BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3520_g1_i1 len=1338 path=[1:0-661 663:662-1337]

Length=1338
                                                                      Score     E

ref|XP_009590412.1|  PREDICTED: laccase-4-like                          743   0.0      
ref|XP_011084946.1|  PREDICTED: laccase-4-like                          715   0.0      
emb|CDP14064.1|  unnamed protein product                                707   0.0      
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg                679   0.0      
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            677   0.0      
ref|XP_002265173.1|  PREDICTED: laccase-4-like                          668   0.0      Vitis vinifera
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          663   0.0      
gb|EPS61127.1|  laccase 3                                               661   0.0      
emb|CBI31539.3|  unnamed protein product                                659   0.0      
gb|KHG28836.1|  Laccase-22                                              659   0.0      
ref|XP_010104683.1|  hypothetical protein L484_022066                   657   0.0      
ref|XP_011035200.1|  PREDICTED: laccase-4                               656   0.0      
gb|KDP46534.1|  hypothetical protein JCGZ_08506                         654   0.0      
ref|XP_002520425.1|  laccase, putative                                  654   0.0      Ricinus communis
ref|XP_006435668.1|  hypothetical protein CICLE_v10031134mg             653   0.0      
gb|KDO69098.1|  hypothetical protein CISIN_1g008799mg                   653   0.0      
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             648   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             647   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          647   0.0      
ref|XP_002311202.1|  laccase family protein                             645   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010104682.1|  hypothetical protein L484_022065                   645   0.0      
ref|XP_010256659.1|  PREDICTED: laccase-4                               644   0.0      
ref|XP_002316233.1|  hypothetical protein POPTR_0010s20050g             644   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               643   0.0      
ref|XP_008233715.1|  PREDICTED: laccase-4-like                          643   0.0      
ref|XP_007220829.1|  hypothetical protein PRUPE_ppa027203mg             643   0.0      
ref|XP_011039810.1|  PREDICTED: laccase-4-like                          642   0.0      
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          641   0.0      
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          641   0.0      
ref|XP_011036009.1|  PREDICTED: laccase-4-like                          640   0.0      
emb|CDP06511.1|  unnamed protein product                                639   0.0      
gb|KHN06247.1|  Laccase-4                                               639   0.0      
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    639   0.0      
ref|XP_002278638.1|  PREDICTED: laccase-4                               638   0.0      Vitis vinifera
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             637   0.0      
gb|KDO53232.1|  hypothetical protein CISIN_1g0093922mg                  635   0.0      
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          637   0.0      
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          635   0.0      
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          635   0.0      
ref|XP_009786393.1|  PREDICTED: laccase-4-like                          635   0.0      
ref|XP_010098906.1|  hypothetical protein L484_006544                   634   0.0      
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            633   0.0      
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          633   0.0      
ref|XP_009350996.1|  PREDICTED: laccase-4-like                          632   0.0      
ref|XP_004490949.1|  PREDICTED: laccase-4-like                          631   0.0      
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          631   0.0      
ref|XP_009358852.1|  PREDICTED: laccase-4-like                          631   0.0      
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          630   0.0      
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          630   0.0      
ref|XP_008388134.1|  PREDICTED: laccase-4-like                          630   0.0      
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          630   0.0      
ref|XP_008785423.1|  PREDICTED: laccase-22                              629   0.0      
ref|XP_008392913.1|  PREDICTED: laccase-4-like                          629   0.0      
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          628   0.0      
ref|XP_002322962.2|  laccase family protein                             628   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             628   0.0      
ref|XP_003544123.1|  PREDICTED: laccase-4-like                          627   0.0      
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             627   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003616564.1|  Laccase                                            631   0.0      
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          627   0.0      
gb|AAC49536.1|  diphenol oxidase                                        626   0.0      Nicotiana tabacum [American tobacco]
ref|XP_002530417.1|  laccase, putative                                  625   0.0      Ricinus communis
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          624   0.0      
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          624   0.0      
ref|XP_010553253.1|  PREDICTED: laccase-4                               624   0.0      
ref|XP_010101806.1|  hypothetical protein L484_023595                   623   0.0      
ref|XP_002533894.1|  laccase, putative                                  623   0.0      Ricinus communis
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          623   0.0      
ref|XP_010923124.1|  PREDICTED: laccase-22                              623   0.0      
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          622   0.0      
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                622   0.0      
emb|CAA74103.1|  laccase                                                622   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010543748.1|  PREDICTED: laccase-22-like                         621   0.0      
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               620   0.0      
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          621   0.0      
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          621   0.0      
ref|XP_004308920.1|  PREDICTED: laccase-22-like                         620   0.0      
gb|KHG18161.1|  Laccase-4 -like protein                                 620   0.0      
emb|CAC14719.1|  laccase                                                620   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             620   0.0      
gb|KHN20872.1|  Laccase-4                                               620   0.0      
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          619   0.0      
ref|XP_007141799.1|  hypothetical protein PHAVU_008G226700g             619   0.0      
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          619   0.0      
ref|XP_003539958.2|  PREDICTED: laccase-4-like                          618   0.0      
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             618   0.0      
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                618   0.0      
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    618   0.0      
ref|XP_008457399.1|  PREDICTED: laccase-4                               618   0.0      
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          617   0.0      
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             617   0.0      
gb|KGN65788.1|  hypothetical protein Csa_1G528530                       617   0.0      
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 617   0.0      
ref|XP_002308209.2|  laccase family protein                             617   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             617   0.0      
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    617   0.0      
ref|XP_002308208.2|  laccase family protein                             616   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007142229.1|  hypothetical protein PHAVU_008G263100g             616   0.0      
ref|XP_008355354.1|  PREDICTED: laccase-4                               616   0.0      
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          615   0.0      
ref|XP_002280416.1|  PREDICTED: laccase-4                               614   0.0      Vitis vinifera
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   613   0.0      
ref|XP_008377498.1|  PREDICTED: laccase-4-like                          614   0.0      
ref|XP_008220423.1|  PREDICTED: laccase-4                               613   0.0      
ref|XP_009370205.1|  PREDICTED: laccase-4                               613   0.0      
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          613   0.0      
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         612   0.0      
ref|XP_010907627.1|  PREDICTED: laccase-22-like                         611   0.0      
gb|AES99522.2|  laccase/diphenol oxidase family protein                 610   0.0      
ref|XP_006602642.1|  PREDICTED: laccase-4-like isoform X2               610   0.0      
ref|XP_010535416.1|  PREDICTED: laccase-16                              611   0.0      
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         610   0.0      
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          610   0.0      
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             610   0.0      
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             609   0.0      
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         610   0.0      
ref|XP_003522150.1|  PREDICTED: laccase-4-like                          609   0.0      
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          609   0.0      
ref|XP_002879726.1|  IRX12/LAC4                                         608   0.0      
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     608   0.0      
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          608   0.0      
ref|XP_010505418.1|  PREDICTED: laccase-4                               608   0.0      
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          608   0.0      
ref|XP_003516941.1|  PREDICTED: laccase-4-like                          608   0.0      
ref|XP_006602641.1|  PREDICTED: laccase-4-like isoform X1               608   0.0      
ref|XP_004246339.1|  PREDICTED: laccase-4                               607   0.0      
ref|XP_009374280.1|  PREDICTED: laccase-4-like                          607   0.0      
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          606   0.0      
ref|XP_009337309.1|  PREDICTED: laccase-4-like                          605   0.0      
ref|XP_010486777.1|  PREDICTED: laccase-22-like isoform X1              605   0.0      
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             605   0.0      
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          605   0.0      
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          604   0.0      
ref|XP_010486778.1|  PREDICTED: laccase-22-like isoform X2              604   0.0      
ref|NP_565881.1|  laccase-4                                             604   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          604   0.0      
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    604   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          603   0.0      
ref|XP_008358974.1|  PREDICTED: laccase-4-like                          603   0.0      
ref|XP_009346884.1|  PREDICTED: laccase-4-like                          603   0.0      
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          602   0.0      
emb|CDX74915.1|  BnaA05g06610D                                          601   0.0      
ref|XP_010464832.1|  PREDICTED: laccase-22-like                         600   0.0      
ref|XP_010494695.1|  PREDICTED: laccase-22-like                         599   0.0      
ref|XP_010033027.1|  PREDICTED: laccase-4-like                          598   0.0      
emb|CDX91428.1|  BnaC04g07220D                                          599   0.0      
ref|XP_008775059.1|  PREDICTED: laccase-22-like                         598   0.0      
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          598   0.0      
gb|AES98533.2|  laccase/diphenol oxidase family protein                 598   0.0      
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    597   0.0      
ref|XP_010685615.1|  PREDICTED: laccase-4                               597   0.0      
ref|XP_009146739.1|  PREDICTED: laccase-22-like                         597   0.0      
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         595   0.0      
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          595   0.0      
emb|CDY18406.1|  BnaA04g21810D                                          595   0.0      
ref|XP_009143427.1|  PREDICTED: laccase-4                               595   0.0      
dbj|BAJ98144.1|  predicted protein                                      594   0.0      
gb|EMS48198.1|  Laccase-22                                              593   0.0      
ref|XP_003558760.1|  PREDICTED: laccase-22                              593   0.0      
emb|CDX93330.1|  BnaC04g45660D                                          593   0.0      
ref|XP_003604619.1|  Laccase 1a                                         593   0.0      
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g            590   0.0      
emb|CDY01010.1|  BnaC05g41900D                                          591   0.0      
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         589   0.0      
ref|XP_008441433.1|  PREDICTED: laccase-4-like                          588   0.0      
gb|EMT26873.1|  Laccase-22                                              588   0.0      
gb|KCW52562.1|  hypothetical protein EUGRSUZ_J01941                     583   0.0      
gb|KHN04832.1|  Laccase-4                                               581   0.0      
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg             582   0.0      
ref|XP_003615575.1|  Laccase 1a                                         583   0.0      
ref|XP_011080855.1|  PREDICTED: laccase-4                               582   0.0      
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          581   0.0      
ref|XP_010543228.1|  PREDICTED: laccase-10                              579   0.0      
gb|KFK27419.1|  hypothetical protein AALP_AA8G380300                    578   0.0      
ref|XP_009120399.1|  PREDICTED: laccase-16                              578   0.0      
gb|KGN45770.1|  hypothetical protein Csa_6G009490                       577   0.0      
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490          577   0.0      
ref|XP_010690098.1|  PREDICTED: laccase-4-like                          575   0.0      
ref|XP_004506788.1|  PREDICTED: laccase-4-like                          573   0.0      
ref|XP_004138572.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     572   0.0      
emb|CDX80325.1|  BnaC09g34170D                                          572   0.0      
ref|XP_004150626.1|  PREDICTED: laccase-4-like                          564   0.0      
gb|EPS60103.1|  laccase 1a                                              563   0.0      
gb|EPS65618.1|  hypothetical protein M569_09159                         563   0.0      
ref|XP_009789473.1|  PREDICTED: laccase-4-like isoform X1               563   0.0      
ref|XP_010483503.1|  PREDICTED: laccase-16-like isoform X3              560   0.0      
ref|XP_009589148.1|  PREDICTED: laccase-4-like                          559   0.0      
ref|XP_006398646.1|  hypothetical protein EUTSA_v10015593mg             558   0.0      
ref|XP_010454388.1|  PREDICTED: laccase-16                              557   0.0      
ref|XP_006401026.1|  hypothetical protein EUTSA_v10013285mg             555   0.0      
ref|XP_004241179.1|  PREDICTED: laccase-4-like                          556   0.0      
ref|XP_009125430.1|  PREDICTED: laccase-10                              555   0.0      
ref|XP_010443638.1|  PREDICTED: laccase-16-like                         555   0.0      
ref|XP_010483501.1|  PREDICTED: laccase-16-like isoform X1              555   0.0      
ref|NP_195739.2|  laccase 10                                            555   0.0      Arabidopsis thaliana [mouse-ear cress]
sp|Q1PDH6.2|LAC16_ARATH  RecName: Full=Laccase-16; AltName: Full=...    555   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873023.1|  predicted protein                                  554   0.0      
emb|CDY55905.1|  BnaAnng13970D                                          554   0.0      
ref|XP_006287399.1|  hypothetical protein CARUB_v10000605mg             554   0.0      
ref|XP_010490598.1|  PREDICTED: laccase-10-like isoform X1              554   0.0      
ref|XP_010452014.1|  PREDICTED: laccase-10 isoform X1                   553   0.0      
ref|XP_006350822.1|  PREDICTED: laccase-4-like                          553   0.0      
emb|CDY48114.1|  BnaC02g03710D                                          551   0.0      
ref|XP_010423919.1|  PREDICTED: laccase-10-like                         551   0.0      
emb|CAB69847.1|  laccase-like protein                                   549   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009789474.1|  PREDICTED: laccase-4-like isoform X2               547   0.0      
ref|XP_006282033.1|  hypothetical protein CARUB_v10028274mg             546   0.0      
gb|KFK44563.1|  hypothetical protein AALP_AA1G273400                    544   0.0      
gb|KHN24301.1|  Laccase-4                                               540   0.0      
gb|ABE66261.1|  laccase/diphenol oxidase                                540   0.0      
gb|ABK28766.1|  unknown                                                 540   0.0      
gb|KHG22893.1|  Laccase-4 -like protein                                 536   0.0      
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    535   0.0      
gb|ACN39933.1|  unknown                                                 533   0.0      Picea sitchensis
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         530   0.0      
gb|AAK37829.1|AF132125_1  laccase                                       533   0.0      Pinus taeda
gb|KHG17519.1|  Laccase-4 -like protein                                 528   0.0      
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         530   0.0      
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         529   0.0      
dbj|BAN10308.1|  laccase                                                528   2e-180   
gb|KHG11130.1|  Laccase-4 -like protein                                 525   5e-180   
ref|XP_002866298.1|  hypothetical protein ARALYDRAFT_496014             525   1e-179   
ref|XP_004233973.1|  PREDICTED: laccase-11                              526   1e-179   
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         525   3e-179   
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         524   9e-179   
gb|KHG01609.1|  Laccase-11 -like protein                                523   1e-178   
gb|AAK37830.1|AF132126_1  laccase                                       523   3e-178   Pinus taeda
ref|XP_010024157.1|  PREDICTED: laccase-11                              522   3e-178   
ref|XP_007046899.1|  Laccase 11                                         520   3e-177   
ref|XP_003632636.1|  PREDICTED: laccase-11                              520   5e-177   
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             519   7e-177   
ref|NP_200699.1|  laccase 16                                            518   7e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         518   2e-176   
ref|XP_011099634.1|  PREDICTED: laccase-11-like                         518   3e-176   
ref|XP_004232420.1|  PREDICTED: laccase-11                              517   4e-176   
ref|XP_006425656.1|  hypothetical protein CICLE_v10025287mg             517   5e-176   
ref|XP_009793780.1|  PREDICTED: laccase-11-like                         517   5e-176   
ref|XP_006466813.1|  PREDICTED: laccase-11-like                         517   5e-176   
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         516   7e-176   
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             516   1e-175   
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         516   1e-175   
ref|XP_009772835.1|  PREDICTED: laccase-11-like                         516   2e-175   
emb|CDP09155.1|  unnamed protein product                                521   2e-175   
emb|CDP02005.1|  unnamed protein product                                515   3e-175   
ref|XP_006340638.1|  PREDICTED: laccase-11-like                         514   5e-175   
ref|XP_003612035.1|  Laccase-11                                         514   6e-175   
ref|XP_008357173.1|  PREDICTED: laccase-11-like                         512   3e-174   
gb|AES94995.2|  laccase/diphenol oxidase family protein                 512   3e-174   
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         512   3e-174   
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         512   4e-174   
gb|KDP41783.1|  hypothetical protein JCGZ_26801                         521   5e-174   
ref|XP_004292029.1|  PREDICTED: laccase-11-like                         511   6e-174   
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         511   7e-174   
ref|XP_009593896.1|  PREDICTED: laccase-11-like                         511   7e-174   
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         511   7e-174   
ref|XP_002519529.1|  laccase, putative                                  511   9e-174   Ricinus communis
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         511   1e-173   
ref|XP_004143251.1|  PREDICTED: laccase-11-like                         511   1e-173   
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         511   1e-173   
ref|XP_008241697.1|  PREDICTED: laccase-11-like                         511   2e-173   
ref|XP_002512915.1|  laccase, putative                                  510   2e-173   Ricinus communis
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         510   3e-173   
gb|KHN36103.1|  Laccase-11                                              509   4e-173   
ref|XP_009392410.1|  PREDICTED: laccase-11                              509   6e-173   
ref|XP_004232419.1|  PREDICTED: laccase-11-like                         509   8e-173   
ref|XP_007205004.1|  hypothetical protein PRUPE_ppa003572mg             509   9e-173   
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         509   9e-173   
ref|XP_008449246.1|  PREDICTED: laccase-11                              509   9e-173   
ref|XP_006340637.1|  PREDICTED: laccase-11-like                         508   9e-173   
emb|CDY10394.1|  BnaCnng02950D                                          509   1e-172   
ref|XP_010423743.1|  PREDICTED: laccase-11-like                         508   1e-172   
ref|XP_010452196.1|  PREDICTED: laccase-11                              508   1e-172   
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         508   2e-172   
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg             508   2e-172   
ref|XP_010679744.1|  PREDICTED: laccase-11                              508   2e-172   
emb|CDY62896.1|  BnaAnng18410D                                          507   3e-172   
emb|CDO97037.1|  unnamed protein product                                508   3e-172   
ref|XP_009342664.1|  PREDICTED: laccase-11-like                         508   4e-172   
emb|CDX70319.1|  BnaA10g26680D                                          507   4e-172   
ref|XP_009122722.1|  PREDICTED: laccase-11-like                         506   6e-172   
ref|XP_011000403.1|  PREDICTED: laccase-11-like                         506   8e-172   
ref|XP_009125488.1|  PREDICTED: laccase-11                              506   9e-172   
ref|XP_002873085.1|  hypothetical protein ARALYDRAFT_487097             505   2e-171   
ref|XP_006287320.1|  hypothetical protein CARUB_v10000520mg             506   2e-171   
emb|CAN71891.1|  hypothetical protein VITISV_040864                     504   3e-171   
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             504   3e-171   
ref|XP_002313847.2|  hypothetical protein POPTR_0009s10550g             504   4e-171   
ref|XP_006398771.1|  hypothetical protein EUTSA_v10013135mg             504   4e-171   
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g             504   4e-171   
emb|CBI17500.3|  unnamed protein product                                503   5e-171   
emb|CAB86093.1|  laccase precursor-like                                 504   6e-171   
ref|NP_195946.2|  laccase 11                                            504   6e-171   
ref|XP_002275392.1|  PREDICTED: laccase-11                              504   7e-171   
ref|XP_002266464.1|  PREDICTED: laccase-11                              504   8e-171   
gb|KFK24777.1|  hypothetical protein AALP_AA8G023500                    503   9e-171   
ref|XP_003612037.1|  Laccase-11                                         504   9e-171   
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...    503   1e-170   
gb|EYU40190.1|  hypothetical protein MIMGU_mgv1a003793mg                503   2e-170   
emb|CDY44351.1|  BnaC02g03260D                                          502   3e-170   
ref|XP_008385897.1|  PREDICTED: laccase-11-like                         503   3e-170   
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480          502   3e-170   
gb|EAZ12812.1|  hypothetical protein OsJ_02731                          502   3e-170   
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   502   5e-170   
gb|EYU42613.1|  hypothetical protein MIMGU_mgv1a003791mg                502   5e-170   
ref|XP_010926015.1|  PREDICTED: laccase-11-like                         511   6e-170   
ref|XP_008338318.1|  PREDICTED: laccase-11-like                         501   1e-169   
gb|KHN41966.1|  Laccase-11                                              501   1e-169   
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         500   2e-169   
ref|XP_009371609.1|  PREDICTED: laccase-11-like                         500   2e-169   
ref|XP_003538856.1|  PREDICTED: laccase-11-like                         499   3e-169   
ref|XP_008352457.1|  PREDICTED: laccase-11-like                         499   5e-169   
ref|XP_011025818.1|  PREDICTED: laccase-11-like                         498   8e-169   
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             498   1e-168   
ref|XP_003516567.1|  PREDICTED: laccase-11-like                         498   2e-168   
gb|KHN36104.1|  Laccase-11                                              498   2e-168   
ref|XP_010254791.1|  PREDICTED: laccase-11-like                         507   4e-168   
ref|XP_007042164.1|  Laccase 11                                         506   5e-168   
ref|XP_008338086.1|  PREDICTED: laccase-11-like                         496   9e-168   
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g             494   2e-167   
ref|XP_004969263.1|  PREDICTED: laccase-2-like                          493   2e-166   
ref|XP_010107530.1|  hypothetical protein L484_024383                   491   4e-166   
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         491   5e-166   
ref|XP_010558158.1|  PREDICTED: laccase-11                              491   9e-166   
ref|XP_008800741.1|  PREDICTED: laccase-11-like                         504   1e-165   
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g             490   2e-165   
ref|XP_010263632.1|  PREDICTED: laccase-11-like                         500   2e-165   
ref|XP_002278215.1|  PREDICTED: laccase-17                              489   6e-165   
gb|AAK37828.1|AF132124_1  laccase                                       487   3e-164   
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         487   6e-164   
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         486   1e-163   
emb|CDY08537.1|  BnaA05g27730D                                          484   1e-163   
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         486   2e-163   
gb|KCW85519.1|  hypothetical protein EUGRSUZ_B02316                     483   5e-163   
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         483   1e-162   
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             483   2e-162   
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   482   3e-162   
ref|XP_010043504.1|  PREDICTED: laccase-17                              482   5e-162   
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         481   7e-162   
gb|KHN14004.1|  Laccase-17                                              481   9e-162   
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             481   1e-161   
emb|CAN66454.1|  hypothetical protein VITISV_020528                     480   1e-161   
emb|CDP06593.1|  unnamed protein product                                480   2e-161   
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         480   2e-161   
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         480   3e-161   
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   480   3e-161   
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         479   3e-161   
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   479   3e-161   
ref|XP_008223967.1|  PREDICTED: laccase-17                              479   4e-161   
gb|EEC71780.1|  hypothetical protein OsI_04394                          479   4e-161   
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      479   6e-161   
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         479   7e-161   
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         479   8e-161   
gb|AAK37827.1|AF132123_1  laccase                                       479   1e-160   
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          478   1e-160   
ref|NP_001044773.1|  Os01g0842500                                       478   1e-160   
ref|XP_002531562.1|  laccase, putative                                  478   2e-160   
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             478   2e-160   
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         478   2e-160   
ref|XP_004972357.1|  PREDICTED: laccase-2-like                          477   3e-160   
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         477   3e-160   
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         477   3e-160   
emb|CAN71338.1|  hypothetical protein VITISV_008643                     476   4e-160   
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         477   4e-160   
gb|KHF97742.1|  Laccase-17 -like protein                                477   4e-160   
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         477   4e-160   
ref|XP_010107320.1|  hypothetical protein L484_009454                   477   5e-160   
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          477   5e-160   
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         477   5e-160   
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          476   6e-160   
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         477   6e-160   
ref|XP_009597234.1|  PREDICTED: laccase-4-like                          476   6e-160   
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         476   8e-160   
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         476   9e-160   
ref|XP_007207312.1|  hypothetical protein PRUPE_ppa003714mg             475   1e-159   
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              475   1e-159   
emb|CBI16199.3|  unnamed protein product                                475   2e-159   
emb|CAA74102.1|  laccase                                                470   2e-159   
gb|KDO52343.1|  hypothetical protein CISIN_1g008085mg                   474   2e-159   
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             475   2e-159   
ref|XP_007016607.1|  Laccase 17                                         475   2e-159   
ref|XP_007026985.1|  Laccase 17 isoform 3                               473   3e-159   
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              475   3e-159   
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             475   3e-159   
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             475   3e-159   
emb|CAN80346.1|  hypothetical protein VITISV_003134                     476   4e-159   
emb|CBI31651.3|  unnamed protein product                                490   4e-159   
ref|XP_002284473.1|  PREDICTED: laccase-17                              474   4e-159   
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             474   7e-159   
ref|XP_006846062.1|  hypothetical protein AMTR_s00012p00061910          473   9e-159   
ref|XP_007026974.1|  Laccase 17                                         474   9e-159   
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             473   1e-158   
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          473   2e-158   
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             473   2e-158   
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   472   2e-158   
ref|XP_007022468.1|  Laccase 17                                         472   3e-158   
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          472   3e-158   
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         472   3e-158   
ref|XP_004302730.1|  PREDICTED: laccase-17-like                         472   4e-158   
emb|CDY67936.1|  BnaCnng57030D                                          467   4e-158   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         470   5e-158   
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         471   6e-158   
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              471   6e-158   
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   471   6e-158   
ref|XP_007016584.1|  Laccase 17                                         471   6e-158   
ref|XP_002308164.1|  hypothetical protein POPTR_0006s08740g             471   6e-158   
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         471   6e-158   
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         471   8e-158   
emb|CAA74105.1|  laccase                                                471   8e-158   
ref|XP_010541373.1|  PREDICTED: laccase-17                              473   1e-157   
ref|NP_001105875.1|  putative laccase precursor                         471   2e-157   
ref|XP_007026973.1|  Laccase 17                                         470   2e-157   
ref|XP_009120521.1|  PREDICTED: laccase-17-like                         470   2e-157   
ref|XP_007026975.1|  Laccase 17                                         470   2e-157   
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    470   2e-157   
ref|XP_007026983.1|  Laccase 17 isoform 1                               469   3e-157   
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          469   3e-157   
ref|XP_008222248.1|  PREDICTED: laccase-2                               470   3e-157   
ref|XP_010535559.1|  PREDICTED: laccase-17                              469   3e-157   
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          470   3e-157   
dbj|BAN10318.1|  laccase                                                460   4e-157   
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             471   5e-157   
ref|XP_002531565.1|  laccase, putative                                  469   5e-157   
ref|XP_011019845.1|  PREDICTED: laccase-2-like                          469   7e-157   
ref|XP_006846061.1|  hypothetical protein AMTR_s00012p00061860          469   8e-157   
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         468   8e-157   
emb|CBI30529.3|  unnamed protein product                                469   9e-157   
emb|CDM84967.1|  unnamed protein product                                468   9e-157   
gb|AFW84624.1|  putative laccase family protein                         469   9e-157   
ref|NP_001146658.1|  uncharacterized protein LOC100280258 precursor     468   9e-157   
emb|CDX88735.1|  BnaA03g09140D                                          468   1e-156   
gb|AAK37823.1|  laccase                                                 468   1e-156   
ref|XP_011094888.1|  PREDICTED: laccase-17-like                         468   1e-156   
emb|CDP06596.1|  unnamed protein product                                468   1e-156   
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      468   2e-156   
emb|CDY31581.1|  BnaA10g12900D                                          467   2e-156   
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          468   2e-156   
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             468   2e-156   
ref|XP_010264408.1|  PREDICTED: laccase-17-like                         468   2e-156   
ref|XP_002299296.1|  laccase family protein                             467   4e-156   
ref|XP_002531824.1|  laccase, putative                                  467   4e-156   
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          467   4e-156   
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         466   5e-156   
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         467   5e-156   
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          466   5e-156   
ref|XP_010092993.1|  hypothetical protein L484_007174                   467   5e-156   
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             466   5e-156   
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         466   9e-156   
ref|XP_010264410.1|  PREDICTED: laccase-17-like                         466   9e-156   
emb|CAN60348.1|  hypothetical protein VITISV_005802                     465   9e-156   
ref|XP_010455850.1|  PREDICTED: laccase-17-like                         466   1e-155   
emb|CDP09087.1|  unnamed protein product                                465   2e-155   
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         465   2e-155   
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          464   2e-155   
ref|XP_004294638.1|  PREDICTED: laccase-17-like                         465   3e-155   
ref|XP_003632204.1|  PREDICTED: laccase-17                              465   3e-155   
ref|XP_010443793.1|  PREDICTED: laccase-17                              466   3e-155   
ref|XP_002317505.2|  hypothetical protein POPTR_0011s12100g             464   3e-155   
dbj|BAJ84890.1|  predicted protein                                      464   3e-155   
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         464   4e-155   
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         464   4e-155   
ref|XP_010483648.1|  PREDICTED: laccase-17-like                         465   4e-155   
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         464   4e-155   
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         464   5e-155   
emb|CDP09154.1|  unnamed protein product                                456   5e-155   
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      464   5e-155   
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 464   6e-155   
gb|ACN34362.1|  unknown                                                 464   7e-155   
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                463   8e-155   
gb|KCW88963.1|  hypothetical protein EUGRSUZ_A01282                     462   8e-155   
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         463   9e-155   
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          463   9e-155   
ref|XP_006400889.1|  hypothetical protein EUTSA_v10013109mg             463   1e-154   
ref|XP_009345405.1|  PREDICTED: laccase-17-like                         463   1e-154   
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         463   1e-154   
ref|XP_009338597.1|  PREDICTED: laccase-17-like                         463   1e-154   
emb|CDY09232.1|  BnaA02g06580D                                          462   1e-154   
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         462   1e-154   
ref|XP_009796024.1|  PREDICTED: laccase-2-like                          463   1e-154   
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             462   2e-154   
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         462   2e-154   
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         462   2e-154   
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          462   2e-154   
ref|NP_200810.1|  laccase 17                                            462   2e-154   
gb|KHN24986.1|  Laccase-17                                              462   2e-154   
emb|CDX71061.1|  BnaC03g11450D                                          461   4e-154   
ref|XP_009131958.1|  PREDICTED: laccase-17                              461   4e-154   
ref|XP_006280235.1|  hypothetical protein CARUB_v10026150mg             461   4e-154   
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         462   4e-154   
dbj|BAJ96691.1|  predicted protein                                      461   4e-154   
ref|XP_009760365.1|  PREDICTED: laccase-17-like                         461   6e-154   
ref|XP_010047833.1|  PREDICTED: laccase-17-like                         461   7e-154   
emb|CAN60069.1|  hypothetical protein VITISV_012401                     461   7e-154   
ref|XP_004492322.1|  PREDICTED: laccase-17-like                         461   8e-154   
ref|XP_006586249.1|  PREDICTED: laccase-17-like isoform X2              460   8e-154   
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             461   9e-154   
gb|KDP35659.1|  hypothetical protein JCGZ_09097                         460   1e-153   
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                460   1e-153   
gb|AGJ83750.1|  Laccase 1a                                              449   1e-153   
ref|XP_011029469.1|  PREDICTED: laccase-17-like                         460   1e-153   
ref|XP_002864664.1|  hypothetical protein ARALYDRAFT_496140             460   2e-153   



>ref|XP_009590412.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/432 (82%), Positives = 392/432 (91%), Gaps = 0/432 (0%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MAS V+ VVLV LA    P  VES+VRHY FTVV KN TR+C++KPI+ VNGKFPGP+LY
Sbjct  1     MASLVQAVVLVTLATSFFPAFVESIVRHYKFTVVRKNATRLCATKPIITVNGKFPGPTLY  60

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+VRVVNHVQ+NV+IHWHGVRQLRTGWSDGPAYITQCPIQTGQ+++YNFTLTGQ
Sbjct  61    AREDDTVLVRVVNHVQDNVTIHWHGVRQLRTGWSDGPAYITQCPIQTGQSYLYNFTLTGQ  120

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHINWQRATVHGAIVILPKR VPYPFPKP+KEE+I+LGEWW SDVEAVINQAM
Sbjct  121   RGTLLWHAHINWQRATVHGAIVILPKRRVPYPFPKPEKEEIIILGEWWSSDVEAVINQAM  180

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHN  761
             + G+APNVSDAHTINGHPGP PNCSSKGYTL VESGKTYLLRI++AA+NEELFFK+AGHN
Sbjct  181   KMGVAPNVSDAHTINGHPGPAPNCSSKGYTLHVESGKTYLLRIINAALNEELFFKIAGHN  240

Query  762   LTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTAT  941
             LTVVEVDASYVKPFKTDTIFI PGQTTNA+LTADQ+ GKYLIAVSPFMDTIVATDN TAT
Sbjct  241   LTVVEVDASYVKPFKTDTIFIAPGQTTNAILTADQSAGKYLIAVSPFMDTIVATDNLTAT  300

Query  942   GTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIG  1121
             GT+HY GT AL+ T L T+P RNATPVT+ F++ LRSLNSKK+PANVPL  DHSLL  +G
Sbjct  301   GTVHYLGTDALSPTALTTIPSRNATPVTNIFVDSLRSLNSKKYPANVPLTIDHSLLLTMG  360

Query  1122  IGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGT  1301
             IG+NPC+TC NGSR V  INN++FVMPTTA+LQAHYYNISGV+T DFPG P+IPFNYTGT
Sbjct  361   IGVNPCATCQNGSRVVAAINNVTFVMPTTAILQAHYYNISGVYTADFPGNPSIPFNYTGT  420

Query  1302  PPANLQTQNGTK  1337
             PP NLQTQNGTK
Sbjct  421   PPTNLQTQNGTK  432



>ref|XP_011084946.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=555

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/416 (80%), Positives = 374/416 (90%), Gaps = 0/416 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VES VR+Y F+VV KNTT +C+SKPI+VVNGKFPGP+LYAREDD VIVRVVNHV+
Sbjct  16    LYPTCVESRVRNYKFSVVRKNTTALCASKPIIVVNGKFPGPTLYAREDDIVIVRVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
             +NV+IHWHGVRQLRTGWSDGPAYITQCPIQTGQ++IYNFTLTGQRGTLLWHAHINWQRAT
Sbjct  76    DNVTIHWHGVRQLRTGWSDGPAYITQCPIQTGQSYIYNFTLTGQRGTLLWHAHINWQRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKPDKEE+I+ GEWWKSDVEAVINQAM+ G  PNVSDAHTING
Sbjct  136   VHGAIVILPKRGVPYPFPKPDKEEIIIFGEWWKSDVEAVINQAMKLGQPPNVSDAHTING  195

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
              PGP PNCSS+GYTL+VE+GKTYLLRIV+AAVNEELFFK+AGH LT+VEVDASY KPFKT
Sbjct  196   LPGPAPNCSSQGYTLQVETGKTYLLRIVNAAVNEELFFKIAGHQLTIVEVDASYTKPFKT  255

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFIGPGQTTNA+LTADQ  G YLIA+SPFMDTIVA DNQTA GTL Y G  A++ST L
Sbjct  256   DTIFIGPGQTTNALLTADQKIGNYLIAISPFMDTIVAIDNQTAMGTLRYNGMLAVSSTTL  315

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
               MPP+NATP+T+ FM+ LRSLNSK++PANVP   DHSL+FAIG+ +NPC+TC+NGSR +
Sbjct  316   TAMPPQNATPITTKFMDSLRSLNSKEYPANVPQTVDHSLMFAIGVAVNPCATCVNGSRVM  375

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              DINN+SFVMPTTA+LQAHYYNISGV+TDDFP  P  P+NYTGTPP ++QT NGTK
Sbjct  376   ADINNVSFVMPTTAILQAHYYNISGVYTDDFPANPPNPYNYTGTPPTSIQTNNGTK  431



>emb|CDP14064.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/432 (77%), Positives = 378/432 (88%), Gaps = 1/432 (0%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MASW++ VV+++    + P  VE V RHY F VV +  TR+C++K IV VNGKFPGP++Y
Sbjct  1     MASWLQAVVVLSALV-LFPVSVEPVTRHYKFNVVQRKKTRLCATKSIVTVNGKFPGPTVY  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDD ++V+VVNHVQENV+IHWHGVRQLRTGWSDGPAYITQCPIQ+GQ++ YNFTLTGQ
Sbjct  60    AREDDRLVVKVVNHVQENVTIHWHGVRQLRTGWSDGPAYITQCPIQSGQSYTYNFTLTGQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWH H+NW RATVHGAIVILPKRGVPYPFPKPDKEE+IVLGEWWKSDVEAVINQ++
Sbjct  120   RGTLLWHGHVNWLRATVHGAIVILPKRGVPYPFPKPDKEEIIVLGEWWKSDVEAVINQSL  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHN  761
             Q G APNVSDAHTING PGP PNCSS GYTL VESGKTYLLRIV+A +NEELFFK+AGH 
Sbjct  180   QVGRAPNVSDAHTINGLPGPAPNCSSNGYTLHVESGKTYLLRIVNAGLNEELFFKIAGHQ  239

Query  762   LTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTAT  941
             LT+VEVDASYVKPFKTDTIFIGPGQTTNA+LTADQ+ GKYLIA+SPFMDT VATDNQTAT
Sbjct  240   LTIVEVDASYVKPFKTDTIFIGPGQTTNAILTADQDAGKYLIAISPFMDTTVATDNQTAT  299

Query  942   GTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIG  1121
             G + YK T A + T L T+PPRNATPVT++FME LRSLNSK++P  VPL+ DHSLLF IG
Sbjct  300   GVIRYKSTTAFSPTALTTIPPRNATPVTNSFMESLRSLNSKEYPTKVPLEIDHSLLFTIG  359

Query  1122  IGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGT  1301
             IGINPC+TC NGSR V  INN++FV+PTTALLQAHYY ISGV+T+DFPG P  P+NYTGT
Sbjct  360   IGINPCATCQNGSRVVAAINNVTFVLPTTALLQAHYYGISGVYTEDFPGNPPTPYNYTGT  419

Query  1302  PPANLQTQNGTK  1337
             PP N+QT NGTK
Sbjct  420   PPTNIQTTNGTK  431



>gb|EYU41257.1| hypothetical protein MIMGU_mgv1a003880mg [Erythranthe guttata]
Length=558

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/417 (77%), Positives = 368/417 (88%), Gaps = 3/417 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  VES +RHY FTVV KNT+++C+SKPI+ VNGKFPGP+LYAREDDTV+VRVVNHV++N
Sbjct  18    PSLVESRIRHYKFTVVKKNTSKLCASKPIITVNGKFPGPTLYAREDDTVVVRVVNHVKDN  77

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             V+ HWHG+RQLRTGW+DGPAYITQCPIQTGQ++IYNFTLTGQRGTLLWHAHINWQRATVH
Sbjct  78    VTFHWHGIRQLRTGWADGPAYITQCPIQTGQSYIYNFTLTGQRGTLLWHAHINWQRATVH  137

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKRGVPYPFPKPDKEE+IV GEWWKSDVE VINQAM+ G  PNVSDAHTING  
Sbjct  138   GAIVILPKRGVPYPFPKPDKEEIIVFGEWWKSDVEMVINQAMKLGQPPNVSDAHTINGQT  197

Query  636   GPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             GP PNCSSKGYT+ VESGKTYLLRIV+AAVNEELFFK+AGH +T+VEVDA+Y KPF+TDT
Sbjct  198   GPAPNCSSKGYTMYVESGKTYLLRIVNAAVNEELFFKIAGHQMTIVEVDATYTKPFRTDT  257

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGT---QALTSTV  986
             IFIGPGQTTNA+L AD+  G Y IA+SPFMDTIVATD+QTAT TL Y GT    A + T 
Sbjct  258   IFIGPGQTTNALLKADRKIGNYQIAISPFMDTIVATDSQTATATLRYNGTLSAAASSPTT  317

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L TMP +NAT VT+ FM+ LRSLNS+K+PANVP   DHSLL AIG+G+NPC TC+NGSR 
Sbjct  318   LTTMPSKNATKVTTNFMDSLRSLNSRKYPANVPKTIDHSLLLAIGVGVNPCGTCVNGSRV  377

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V DINN++FVMPTTA+LQAHYYN+SGV+TDDFPG P +P+NYTG+PP N+QT NGTK
Sbjct  378   VADINNVTFVMPTTAILQAHYYNVSGVYTDDFPGNPPVPYNYTGSPPTNMQTTNGTK  434



>ref|XP_007009094.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY17904.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=554

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/433 (74%), Positives = 368/433 (85%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWV+    +   + + P  VE  +RHYNFTVV KNTTR+C++KPIV VNG+FPGP+LY
Sbjct  1     MVSWVQ---TLLFMSALFPVLVECKIRHYNFTVVLKNTTRLCATKPIVTVNGQFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE D V+ RV NHVQ NV+IHWHGVRQLRTGWSDGPAYITQCPIQ GQ F+YNFT+TGQ
Sbjct  58    AREGDNVLARVTNHVQHNVTIHWHGVRQLRTGWSDGPAYITQCPIQPGQNFLYNFTVTGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI+W R+T+HGAIVILPK+GVPYPFPKP KE+VI+LGEWWK+D EAV+NQAM
Sbjct  118   RGTLLWHAHISWLRSTMHGAIVILPKKGVPYPFPKPYKEKVIILGEWWKADTEAVVNQAM  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             Q+G+APNVSDAHTINGH GP  NCSS+G YTL VE+GKTYLLR+V+AAVNEELFFK+AGH
Sbjct  178   QTGLAPNVSDAHTINGHAGPLANCSSEGAYTLHVETGKTYLLRVVNAAVNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
             NLTVVEVDA Y KP+KTDT+F+GPGQTT ++LTADQ  GKYLIAVSPFMDTIVA DN TA
Sbjct  238   NLTVVEVDAVYTKPYKTDTLFLGPGQTTTSLLTADQGIGKYLIAVSPFMDTIVAVDNLTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
              G L Y  T A T T L ++PP NAT VT  F + LRSLNSK++PANVPL  DHSL F I
Sbjct  298   VGFLRYNHTLAFTPTTLTSIPPVNATSVTEVFSKSLRSLNSKEYPANVPLTIDHSLFFTI  357

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             GIGINPC+TC+NGSRAV  INN++F MPTTALLQAHYY ISGVFTDDFP +P IPFNYTG
Sbjct  358   GIGINPCATCVNGSRAVAAINNVTFDMPTTALLQAHYYGISGVFTDDFPAKPLIPFNYTG  417

Query  1299  TPPANLQTQNGTK  1337
             TPP++LQT NGT+
Sbjct  418   TPPSSLQTMNGTR  430



>ref|XP_002265173.1| PREDICTED: laccase-4-like [Vitis vinifera]
Length=553

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/416 (74%), Positives = 360/416 (87%), Gaps = 0/416 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  V ++VRHY F+VV KNTTR+C++KPIV VNG+FPGP LYAREDDTVIVRV+NHV 
Sbjct  14    IFPTLVGAMVRHYKFSVVMKNTTRLCATKPIVTVNGRFPGPKLYAREDDTVIVRVINHVT  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV++HWHGV+QLRTGWSDGPAY+TQCPIQ GQ++IYNFTL+GQRGTLLWHAHI+W RAT
Sbjct  74    YNVTLHWHGVKQLRTGWSDGPAYVTQCPIQPGQSYIYNFTLSGQRGTLLWHAHISWLRAT  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             ++GAIVILPKRGVPYPFPKPD+E V++LGEWWK+DVEAVINQA+QSG+ PN+SDAHTING
Sbjct  134   MYGAIVILPKRGVPYPFPKPDREVVVILGEWWKADVEAVINQAIQSGLPPNISDAHTING  193

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             HPGPT  CSS+GYTL VESGKTY+LRIV+AAVN+ELFFK++GH LTVVEVDA Y KPFKT
Sbjct  194   HPGPTSTCSSQGYTLNVESGKTYMLRIVNAAVNDELFFKISGHQLTVVEVDAIYAKPFKT  253

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DT+FI PGQTTNA+LTADQ  GKYL+ VSPFMD  +  DN T T  L Y GT A + TVL
Sbjct  254   DTLFIAPGQTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAILSYTGTLAASPTVL  313

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P +NAT +TS+FM+ L+SLNSK++PANVPL  DHSLLF IG+G+NPCSTC+NGSR V
Sbjct  314   TTSPSQNATQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVGVNPCSTCVNGSRLV  373

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
               INN++FVMPTT LL+AHYYNI GVFT DFPG P I FNYTGT P+N+QT NGT+
Sbjct  374   SYINNVTFVMPTTGLLEAHYYNIGGVFTVDFPGNPLIAFNYTGTQPSNMQTMNGTR  429



>ref|XP_010262771.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=555

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/434 (72%), Positives = 369/434 (85%), Gaps = 5/434 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   L+ L A + P  VE  VRHY F VV++N TR+CS+KPIV VNG+FPGP+LY
Sbjct  1     MVSWVR---LLVLVAFLLPSLVECRVRHYKFNVVTRNFTRLCSTKPIVTVNGRFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE DTV+V+VVNHVQ NV+IHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREGDTVLVKVVNHVQYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGAIVILPKRGVPYPFPKP KE V++LGEWWKSDVEAVIN+A+
Sbjct  118   RGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVILGEWWKSDVEAVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
              SG+APNVSDAHTINGHPGP P CSS+ G+ L+V+ GKTY+LR+++AA+NEELFFK+AGH
Sbjct  178   GSGLAPNVSDAHTINGHPGPVPGCSSQDGFQLQVDPGKTYMLRLINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQT  935
              LTVVEVDA Y KPFKTDT+ I PGQTTN +LTA ++ GKYL+A SPFMDT +VA DN T
Sbjct  238   QLTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLTAGRSSGKYLVAASPFMDTPVVAVDNMT  297

Query  936   ATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             AT TLHY G+ A ++T L   PP+NATPV + FM+ LRSLNSK++PA VP   DHSLLF+
Sbjct  298   ATATLHYSGSLATSATTLTNPPPQNATPVATNFMDSLRSLNSKQYPAKVPQTVDHSLLFS  357

Query  1116  IGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             +G+G+NPCSTC NGSR V DINN+SFVMPTTALLQAH++NISGVFTDDFP  P I +NYT
Sbjct  358   VGLGVNPCSTCPNGSRVVADINNVSFVMPTTALLQAHFFNISGVFTDDFPANPPIAYNYT  417

Query  1296  GTPPANLQTQNGTK  1337
             GT PANLQT NGTK
Sbjct  418   GTQPANLQTINGTK  431



>gb|EPS61127.1| laccase 3, partial [Genlisea aurea]
Length=551

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/414 (74%), Positives = 351/414 (85%), Gaps = 0/414 (0%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  VES+VRHY F+VV KNT ++C SKPI+ VNGKFPGP+LYAREDDTV+V+VVN V EN
Sbjct  14    PLHVESIVRHYKFSVVKKNTRKLCESKPIITVNGKFPGPTLYAREDDTVLVKVVNRVTEN  73

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             V+IHWHGVRQLRTGWSDGPAYITQCPIQ G+++ YNFTLTGQRGTLL+H+HINWQRAT+H
Sbjct  74    VTIHWHGVRQLRTGWSDGPAYITQCPIQAGKSYTYNFTLTGQRGTLLYHSHINWQRATLH  133

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILP+    YPFPKPD E++I+L EWWKSDVEAVIN AM  G+ PNVSDAHTING P
Sbjct  134   GAIVILPRLRDSYPFPKPDDEKIIILAEWWKSDVEAVINSAMSQGLPPNVSDAHTINGLP  193

Query  636   GPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             GP PNC+S GYTL VESGKTYLLRI++AA+NEELFFK+A H  TVVEVDA Y KPF TDT
Sbjct  194   GPLPNCTSPGYTLHVESGKTYLLRIINAALNEELFFKIADHKFTVVEVDARYTKPFTTDT  253

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             +FIGPGQTTN +L ADQ  GKYLIA+SPFMDTIVATDNQ AT  L Y  T A + T L  
Sbjct  254   LFIGPGQTTNVLLRADQKIGKYLIAISPFMDTIVATDNQRATAFLRYNNTVAFSPTNLTP  313

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +PPRNAT VT+TF++ LRS+NS  FPANVP + DHSLL AIG+G+NPC +C NG+R V D
Sbjct  314   LPPRNATSVTTTFVDSLRSINSNTFPANVPKKIDHSLLLAIGVGVNPCPSCFNGTRLVAD  373

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             INN+SFVMPTTALLQAHYYN+SG+FT DFPG P IP+NYTGTPP N+QT NGTK
Sbjct  374   INNVSFVMPTTALLQAHYYNMSGIFTTDFPGNPPIPYNYTGTPPRNMQTVNGTK  427



>emb|CBI31539.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/409 (75%), Positives = 356/409 (87%), Gaps = 1/409 (0%)
 Frame = +3

Query  114   VVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWH  293
             +VRHY F+VV KNTTR+C++KPIV VNG+FPGP LYAREDDTVIVRV+NHV  NV++HWH
Sbjct  1     MVRHYKFSVVMKNTTRLCATKPIVTVNGRFPGPKLYAREDDTVIVRVINHVTYNVTLHWH  60

Query  294   GVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVIL  473
             GV+QLRTGWSDGPAY+TQCPIQ GQ++IYNFTL+GQRGTLLWHAHI+W RAT++GAIVIL
Sbjct  61    GVKQLRTGWSDGPAYVTQCPIQPGQSYIYNFTLSGQRGTLLWHAHISWLRATMYGAIVIL  120

Query  474   PKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNC  653
             PKRGVPYPFPKPD+E V++LGEWWK+DVEAVINQA+QSG+ PN+SDAHTINGHPGPT  C
Sbjct  121   PKRGVPYPFPKPDREVVVILGEWWKADVEAVINQAIQSGLPPNISDAHTINGHPGPTSTC  180

Query  654   SSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGP  830
             SS+ GYTL VESGKTY+LRIV+AAVN+ELFFK++GH LTVVEVDA Y KPFKTDT+FI P
Sbjct  181   SSQAGYTLNVESGKTYMLRIVNAAVNDELFFKISGHQLTVVEVDAIYAKPFKTDTLFIAP  240

Query  831   GQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRN  1010
             GQTTNA+LTADQ  GKYL+ VSPFMD  +  DN T T  L Y GT A + TVL T P +N
Sbjct  241   GQTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAILSYTGTLAASPTVLTTSPSQN  300

Query  1011  ATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNIS  1190
             AT +TS+FM+ L+SLNSK++PANVPL  DHSLLF IG+G+NPCSTC+NGSR V  INN++
Sbjct  301   ATQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVGVNPCSTCVNGSRLVSYINNVT  360

Query  1191  FVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             FVMPTT LL+AHYYNI GVFT DFPG P I FNYTGT P+N+QT NGT+
Sbjct  361   FVMPTTGLLEAHYYNIGGVFTVDFPGNPLIAFNYTGTQPSNMQTMNGTR  409



>gb|KHG28836.1| Laccase-22 [Gossypium arboreum]
Length=574

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/433 (72%), Positives = 359/433 (83%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  WVR    +   +++ P  VE  +RHY+F VV KN T++CS+KPIV VNGKFPG +LY
Sbjct  21    MVCWVR---TLLFISVLVPAFVECRIRHYHFNVVVKNETKLCSTKPIVTVNGKFPGQTLY  77

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE D V+VR+ NHVQ NV+IHWHGVRQLRTGWSDGPAYITQCPIQ GQ F+YNFTLTGQ
Sbjct  78    AREGDNVLVRLTNHVQYNVTIHWHGVRQLRTGWSDGPAYITQCPIQPGQNFLYNFTLTGQ  137

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI+W R+TVHGAIVILPK+GVPYPFPKP KE+VIVLGEWWK+D EAV+NQAM
Sbjct  138   RGTLLWHAHISWLRSTVHGAIVILPKKGVPYPFPKPYKEKVIVLGEWWKADTEAVVNQAM  197

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             Q+G+ PN+SDAHTINGHPGP PNCSS   YTL VE+GKTYLLR+++AA+N+ELFFK+A H
Sbjct  198   QTGLPPNISDAHTINGHPGPVPNCSSDDAYTLHVETGKTYLLRVINAALNDELFFKIANH  257

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
             NLTVVEVDA Y KP +TDT+F+GPGQTT A+L ADQ  GKYLIA+SPFMDT+VA DN T 
Sbjct  258   NLTVVEVDACYTKPLETDTLFLGPGQTTTALLKADQGIGKYLIAISPFMDTVVAVDNLTG  317

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
              G L Y  T A T T    +P  NATP+TS F + LRSLNSK++ ANVPL  DHSL F I
Sbjct  318   MGYLRYNHTLAFTPTTFVPIPSVNATPLTSVFSDSLRSLNSKQYLANVPLTIDHSLFFTI  377

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+GINPC+TC NGSRAV  INN+SFVMPTTA+LQAHYY I+GVFTDDFP +PAIPFNYTG
Sbjct  378   GVGINPCATCFNGSRAVAAINNVSFVMPTTAILQAHYYGINGVFTDDFPAKPAIPFNYTG  437

Query  1299  TPPANLQTQNGTK  1337
             TPP+ +QT NGTK
Sbjct  438   TPPSGIQTMNGTK  450



>ref|XP_010104683.1| hypothetical protein L484_022066 [Morus notabilis]
 gb|EXC01489.1| hypothetical protein L484_022066 [Morus notabilis]
Length=556

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/433 (71%), Positives = 363/433 (84%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  WVR   +  L A + P  V+ +VRHY F VV KNTT++CSSKPIV VNGKFPGP++Y
Sbjct  3     MVPWVR---VFILVACLFPASVDCMVRHYKFNVVLKNTTKLCSSKPIVTVNGKFPGPTIY  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDT++++VVNHV+ N+SIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  60    AREDDTLLIKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPKRGVPYPFP P+KEEVIVLGEWWKSDVE+VINQA+
Sbjct  120   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPTPNKEEVIVLGEWWKSDVESVINQAL  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTING PGP  NC S+ G+TL VESG+TY+LRIV+AA+NEELFFK+AGH
Sbjct  180   KSGLAPNVSDAHTINGQPGPVSNCPSQGGFTLPVESGQTYMLRIVNAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              L VVEVDA Y KPFKTDTI I PGQTTNA+LTADQN GKY +  SP+MD  +A DN+TA
Sbjct  240   KLAVVEVDAVYTKPFKTDTIVIAPGQTTNALLTADQNAGKYSVLASPYMDAPIAVDNKTA  299

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT + + T+L   PP+NAT + + F   LRSLNSKK+PA VPL+ DHSLLF I
Sbjct  300   TATLHYSGTLSSSRTILTAPPPQNATSIATKFTNSLRSLNSKKYPARVPLKIDHSLLFTI  359

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC TC+NGSR V DINN++FVMP  ALLQAH++NISGVFTDDFPG+P +PFNYTG
Sbjct  360   GLGVNPCKTCVNGSRVVADINNVTFVMPNIALLQAHFFNISGVFTDDFPGKPPVPFNYTG  419

Query  1299  TPPANLQTQNGTK  1337
             T P+N  T  GT+
Sbjct  420   TQPSNFATTQGTR  432



>ref|XP_011035200.1| PREDICTED: laccase-4 [Populus euphratica]
Length=556

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/433 (72%), Positives = 359/433 (83%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MA W+R   ++ L A + P  VES+VRHY F VV KNTTR+CS KPIV VNG+FPGP+L 
Sbjct  3     MALWLR---VLVLVACLFPASVESMVRHYKFNVVMKNTTRLCSEKPIVTVNGRFPGPTLV  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHV+ NVSIHWHGVRQLRTGW+DGPAYITQCPIQ  Q+F+YNFT+TGQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPRQSFVYNFTITGQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPKRGVPYPFP P +EEVIVLGEWWKSDVEAVIN+AM
Sbjct  120   RGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPTPHREEVIVLGEWWKSDVEAVINEAM  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
              SGMAPNVSDAHTINGHPGP   CSS+ GY L V+ GKTYLLRI++AA+NEELFFK+AGH
Sbjct  180   SSGMAPNVSDAHTINGHPGPVSACSSQGGYNLPVQPGKTYLLRIINAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFK DTI I PGQTTN ++TA++  G+YL+A SPFMD  +A DN TA
Sbjct  240   QLTVVEVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGRYLVAASPFMDAPIAVDNVTA  299

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A ++T L   P +NATPV + F + LRSLNS K+PA VPL+ DHSL F +
Sbjct  300   TATLHYSGTLASSATTLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTV  359

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC+TC+NGSR V D NN++FVMPT ALLQAH++NI GVFTDDFPG P  PFNYTG
Sbjct  360   GLGVNPCATCVNGSRVVADFNNVTFVMPTIALLQAHFFNIKGVFTDDFPGNPPTPFNYTG  419

Query  1299  TPPANLQTQNGTK  1337
             T P N QT NGTK
Sbjct  420   TQPTNFQTVNGTK  432



>gb|KDP46534.1| hypothetical protein JCGZ_08506 [Jatropha curcas]
Length=563

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/415 (73%), Positives = 352/415 (85%), Gaps = 1/415 (0%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V+ +VRHY F VV K  TR+CSSKPIV VNGKFPGP++ AREDDTV+V+VVNHV+ N
Sbjct  25    PASVDCLVRHYKFNVVMKKATRLCSSKPIVTVNGKFPGPTIVAREDDTVLVKVVNHVKYN  84

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTLLWHAHI W RATVH
Sbjct  85    VSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYLYNFTVTGQRGTLLWHAHILWLRATVH  144

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKRGVPYPFP P KEEVIVLGEWWKSDVEAV+N+AM+SG APNVSDAHTINGHP
Sbjct  145   GAIVILPKRGVPYPFPTPHKEEVIVLGEWWKSDVEAVVNEAMKSGGAPNVSDAHTINGHP  204

Query  636   GPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             GP P C S+ G+ L VESGKTY+LRI++AA+NEELFFK+A H LTVVEVDA+YVKPFKTD
Sbjct  205   GPVPACPSQGGFNLPVESGKTYMLRIINAALNEELFFKIACHKLTVVEVDATYVKPFKTD  264

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLA  992
             TI I PGQTTN +LTAD+  GKYL+A SPFMD  +A DN TA+ TLHY G  +  +T+L 
Sbjct  265   TIVIAPGQTTNVLLTADRTSGKYLVAASPFMDAPIAVDNVTASATLHYSGALSSAATILT  324

Query  993   TMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVG  1172
               PP+NATP+ +TF   LRSLNSKK+PANVPL+ DH L F IG+G+NPC+TC  G+R V 
Sbjct  325   VPPPQNATPIAATFANSLRSLNSKKYPANVPLKIDHFLFFTIGLGVNPCATCATGNRVVA  384

Query  1173  DINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             DINN++FVMPT +LLQAH++NISGVFTDDFPG P + FNYTGT P+N+QT NGT+
Sbjct  385   DINNVTFVMPTISLLQAHFFNISGVFTDDFPGNPPVQFNYTGTQPSNVQTNNGTR  439



>ref|XP_002520425.1| laccase, putative [Ricinus communis]
 gb|EEF41838.1| laccase, putative [Ricinus communis]
Length=556

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/433 (71%), Positives = 360/433 (83%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             +A WVR   ++ L A + P  VE +VRHY F VV K  T+MCS+KPIV VNGKFPGP+L 
Sbjct  3     IAPWVR---VLVLVACLFPASVECMVRHYKFNVVMKTATKMCSTKPIVTVNGKFPGPTLV  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHV+ N+SIHWHG+RQ+RTGW+DGPAYITQCPIQ GQ+++YNFTLTGQ
Sbjct  60    AREDDTVLVKVVNHVKYNLSIHWHGIRQVRTGWADGPAYITQCPIQPGQSYVYNFTLTGQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPKRGVPYPFP PDKEEVIVL EWWKSDVEAVIN+A+
Sbjct  120   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPTPDKEEVIVLSEWWKSDVEAVINEAL  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP P C S+ G+TL V SGKTY+LRIV+AA+NEELFFK+AGH
Sbjct  180   KSGLAPNVSDAHTINGHPGPVPACPSQGGFTLPVHSGKTYMLRIVNAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFKTDTI I PGQTTN +LTA ++ GKYL+A SPFMD  +A DN TA
Sbjct  240   QLTVVEVDATYVKPFKTDTIVIAPGQTTNVLLTAGRSSGKYLVAASPFMDAPIAVDNVTA  299

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
               TLHY GT + ++T L   PP+NAT + S F   LRSLNSKK+PANVPL+ DHSL F I
Sbjct  300   VATLHYSGTLSSSATTLTATPPKNATSIASNFTNALRSLNSKKYPANVPLKIDHSLFFTI  359

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC+TC+NGSR V DINN++FVMPT  LLQAH++NISGVFTDDFP  P + +NYTG
Sbjct  360   GLGVNPCATCVNGSRVVADINNVTFVMPTIGLLQAHFFNISGVFTDDFPSNPPVSYNYTG  419

Query  1299  TPPANLQTQNGTK  1337
             T P N QT  GT+
Sbjct  420   TQPTNFQTTTGTR  432



>ref|XP_006435668.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
 ref|XP_006486373.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR48908.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
Length=553

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/414 (75%), Positives = 349/414 (84%), Gaps = 0/414 (0%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  VES VRHYNFTVV  N T++C+SK IV VNGKFPGP+L+AREDD VIVRV NHV+ N
Sbjct  16    PALVESAVRHYNFTVVMTNMTKLCASKSIVTVNGKFPGPTLHAREDDNVIVRVTNHVKYN  75

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             V+IHWHGVRQLRTGW DGPAYITQCPIQ GQ+++YNFTLTGQRGTLLWHAHI+W RATVH
Sbjct  76    VTIHWHGVRQLRTGWYDGPAYITQCPIQPGQSYVYNFTLTGQRGTLLWHAHISWLRATVH  135

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKR VPYPFPK DKE++IV GEWWK+DVEAVINQA Q G+APNVSDAHTINGHP
Sbjct  136   GAIVILPKRSVPYPFPKADKEKIIVFGEWWKADVEAVINQATQMGVAPNVSDAHTINGHP  195

Query  636   GPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             GP  NC+S+G+TL VESGKTYLLRIV+AAVN+ELFFK+AGHNLTVVEVD+SY KPFKTDT
Sbjct  196   GPVTNCTSQGFTLHVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDSSYTKPFKTDT  255

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             IFIGPGQTTNA+LTAD+  GKYLI VSPFMDTIVA +N T    L YKGT A +ST L  
Sbjct  256   IFIGPGQTTNALLTADKKIGKYLITVSPFMDTIVAVNNVTGIAFLRYKGTVAFSSTTLTN  315

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +P  NAT VT+TF + LRSLNSK++PA VPL  DHSLL  + + +NPC+TC NG++    
Sbjct  316   VPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLITMAVAVNPCATCPNGTKVGAA  375

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             +NNISFVMPTTALLQAHYY ISGVFTDDFP +P I FNYTG     LQT NGT+
Sbjct  376   MNNISFVMPTTALLQAHYYKISGVFTDDFPAKPPIAFNYTGNYTGTLQTTNGTR  429



>gb|KDO69098.1| hypothetical protein CISIN_1g008799mg [Citrus sinensis]
Length=553

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/414 (74%), Positives = 349/414 (84%), Gaps = 0/414 (0%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  VES VRHYNFTVV  N T++C+SK IV VNGKFPGP+L+AREDD VIVRV NHV+ N
Sbjct  16    PALVESAVRHYNFTVVMTNMTKLCASKSIVTVNGKFPGPTLHAREDDNVIVRVTNHVKYN  75

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             V+IHWHGVRQLRTGW DGPAYITQCPIQ GQ+++YNFTLTGQRGTLLWHAHI+W RATVH
Sbjct  76    VTIHWHGVRQLRTGWYDGPAYITQCPIQPGQSYVYNFTLTGQRGTLLWHAHISWLRATVH  135

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKR VPYPFPK DKE++IV GEWWK+DVEAVINQA Q G+APNVSDAHTINGHP
Sbjct  136   GAIVILPKRSVPYPFPKADKEKIIVFGEWWKADVEAVINQATQMGVAPNVSDAHTINGHP  195

Query  636   GPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             GP  NC+S+G+TL VESGKTYLLRIV+AAVN+ELFFK+AGHNLTVVEVD+SY KPFKTDT
Sbjct  196   GPVTNCTSQGFTLHVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDSSYTKPFKTDT  255

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             IFIGPGQTTNA+LTAD+  GKYLI +SPFMDTIVA +N T    L YKGT A +ST L  
Sbjct  256   IFIGPGQTTNALLTADKKIGKYLITISPFMDTIVAVNNVTGIAFLRYKGTVAFSSTTLTN  315

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +P  NAT VT+TF + LRSLNSK++PA VPL  DHSLL  + + +NPC+TC NG++    
Sbjct  316   VPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLLTMAVAVNPCATCPNGTKVGAA  375

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             +NNISFVMPTTALLQAHYY ISGVFTDDFP +P I FNYTG     LQT NGT+
Sbjct  376   MNNISFVMPTTALLQAHYYKISGVFTDDFPAKPPIAFNYTGNYTGTLQTTNGTR  429



>ref|XP_002314124.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
 gb|EEE88079.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
Length=556

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/433 (71%), Positives = 357/433 (82%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MA W+R   ++ L A + P  VES+VRHY F VV KN+T++CS+KPIV VNG+FPGP+L 
Sbjct  3     MAPWIR---VLVLVACLFPASVESMVRHYKFNVVMKNSTKLCSTKPIVTVNGQFPGPTLV  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+F+YNFT+TGQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSFVYNFTITGQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGAIVILPKRGVPYPFP P KE+VI+LGEWWKSDVEAVIN+A 
Sbjct  120   RGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPTPRKEKVIILGEWWKSDVEAVINEAT  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP   CSS  GY L V  GKTY+LRI++AA+NEELFFK+AGH
Sbjct  180   KSGIAPNVSDAHTINGHPGPVSACSSHGGYNLSVHPGKTYMLRIINAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFK DT+ I PGQTTN ++TA++  G+YL+A SPFMD  +A DN TA
Sbjct  240   QLTVVEVDATYVKPFKIDTVVIAPGQTTNVLVTANRGSGQYLVAASPFMDAPIAVDNVTA  299

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A T T L   P +NATPV + F   LRSLNS K+PA VPL+ DHSL F +
Sbjct  300   TATLHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDHSLFFTV  359

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC+TC+NGSR V DINN++FVMPT ALLQAH +NISGVFTDDFP  P  PFNYTG
Sbjct  360   GLGVNPCATCINGSRVVADINNVTFVMPTIALLQAHVFNISGVFTDDFPANPPTPFNYTG  419

Query  1299  TPPANLQTQNGTK  1337
             T P N QT  GTK
Sbjct  420   TQPTNFQTVKGTK  432



>ref|XP_002299828.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
 gb|EEE84633.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
Length=557

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/433 (72%), Positives = 359/433 (83%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MA W+R   ++ L A + P  VES+VRHY F VV KNTTR+CS KPIV VNG+FPGP+L 
Sbjct  4     MALWLR---VLVLVACLFPASVESMVRHYKFNVVMKNTTRLCSEKPIVTVNGRFPGPTLV  60

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCP+Q GQ F+YNFT+TGQ
Sbjct  61    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPLQPGQNFVYNFTITGQ  120

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGAIVILPKRGVPYPFP P +EEVIVLGEWWKSDVEAVIN+AM
Sbjct  121   RGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPTPHREEVIVLGEWWKSDVEAVINEAM  180

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
              SG APNVSDAHTINGHPGP   CSS+ GY L V  GKTY+LRI++AA+NEELFFK+AGH
Sbjct  181   NSGRAPNVSDAHTINGHPGPVSGCSSQGGYNLPVRPGKTYMLRIINAALNEELFFKIAGH  240

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFK DTI I PGQTTN ++TA++  GKYL+A SPFMD  +A DN TA
Sbjct  241   QLTVVEVDATYVKPFKIDTIVIAPGQTTNVLVTANRGSGKYLVAASPFMDAPIAVDNVTA  300

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A T+T L   P +NATPV + F + LRSLNS K+PA VPL+ DHSL F I
Sbjct  301   TATLHYSGTLASTTTTLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTI  360

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC+TC+NG+R V DINN++FVMPT ALLQAH++NI GVFTDDFPG P  PFNYTG
Sbjct  361   GLGVNPCATCVNGNRVVADINNVTFVMPTIALLQAHFFNIKGVFTDDFPGNPPTPFNYTG  420

Query  1299  TPPANLQTQNGTK  1337
             T P N QT NGTK
Sbjct  421   TQPKNFQTVNGTK  433



>ref|XP_010067496.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW65638.1| hypothetical protein EUGRSUZ_G03028 [Eucalyptus grandis]
Length=561

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/416 (71%), Positives = 350/416 (84%), Gaps = 0/416 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P   E ++RHY F+VV KN T++C+SKPI  VNGKFPGP+LYAREDDTV+VRVVNHV 
Sbjct  22    MLPAAAEGLIRHYKFSVVMKNVTKLCASKPIATVNGKFPGPTLYAREDDTVLVRVVNHVS  81

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQLRTGWSDGPA+ITQCPIQ GQ++IYNFTLTGQRGTLLWHAHI W R+T
Sbjct  82    YNVTIHWHGVRQLRTGWSDGPAFITQCPIQPGQSYIYNFTLTGQRGTLLWHAHITWLRST  141

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVILPKRGVPYPFPKP KE+ I+ GEWWK+D E V++Q++QSGM PN SD+HTING
Sbjct  142   LHGAIVILPKRGVPYPFPKPYKEKTIIFGEWWKADTELVLSQSVQSGMPPNKSDSHTING  201

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             +PGP PNCSS+GY L+VESGKTYLLRIV+AAVN+ELFFK+AGHNLTVVEVDASY KPF  
Sbjct  202   YPGPLPNCSSQGYELQVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDASYTKPFSI  261

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFI PGQTTNA+L AD++GG Y++A+SPFMDT+VA DN TATG + YKGT A   TV 
Sbjct  262   DTIFIAPGQTTNALLAADKSGGSYIMAISPFMDTVVAVDNLTATGIVQYKGTIASAPTVQ  321

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
             A++P  NAT    +F+  LRSLNSK++PA VPL  DHSL   +  G+NPCSTC+NG + V
Sbjct  322   ASIPAINATSFEFSFINSLRSLNSKQYPAKVPLTVDHSLFITMSAGVNPCSTCVNGKKLV  381

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
               +NN+SFVMP+T +L+AHYY I GV+TDDFPG P  PFNYTGTPP+N+QT NGT+
Sbjct  382   AALNNVSFVMPSTDILEAHYYKIKGVYTDDFPGNPPTPFNYTGTPPSNMQTTNGTR  437



>ref|XP_002311202.1| laccase family protein [Populus trichocarpa]
 gb|EEE88569.1| laccase family protein [Populus trichocarpa]
Length=556

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/417 (73%), Positives = 355/417 (85%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VR Y+F VV  NTT++CS+K IV +NGKFPGP++YARE D V +++ NHVQ
Sbjct  16    IFPALVECEVRLYDFRVVLTNTTKLCSTKSIVTINGKFPGPTIYAREGDNVNIKLTNHVQ  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQLRTGWSDGPAYITQCPI+ GQ+++YNFTLTGQRGTLLWHAHI+W RAT
Sbjct  76    YNVTIHWHGVRQLRTGWSDGPAYITQCPIRPGQSYLYNFTLTGQRGTLLWHAHISWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVILP++GVPYPFPKPDKE++I+LGEWWK+DVEAV+NQA Q+G+ PN+SDAH +NG
Sbjct  136   IHGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQTGLPPNISDAHIVNG  195

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
               G  P C S G+TL VESGKTYLLRI++AA+N+ELFFK+AGHN+TVVEVDA+Y KPF T
Sbjct  196   QTGAVPGCPSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAAYTKPFST  255

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFIGPGQTTNA+LTAD++ GKYL+AVSPFMDT+VA DN TA   L YKGT A +  VL
Sbjct  256   DTIFIGPGQTTNALLTADKSVGKYLMAVSPFMDTVVAVDNVTAIAFLRYKGTIAFSPPVL  315

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P  NATPVTSTFM+ LRSLNSKKFPANVPL  DHSL F IG+GI+PC+TC+NGS+AV
Sbjct  316   TTTPAINATPVTSTFMDNLRSLNSKKFPANVPLTVDHSLYFTIGVGIDPCATCVNGSKAV  375

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPA-NLQTQNGTK  1337
             G INNISF+MPTTALLQAHYY+ISGVFTDDFP  P   FNYTG   A NLQT NGT+
Sbjct  376   GAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYTGNNTALNLQTINGTR  432



>ref|XP_010104682.1| hypothetical protein L484_022065 [Morus notabilis]
 gb|EXC01488.1| hypothetical protein L484_022065 [Morus notabilis]
Length=556

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/433 (69%), Positives = 360/433 (83%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  WVR   ++ L A + P  VE +VRHY F VV KN+T++CSSK IV VNGKFPGP++Y
Sbjct  3     MVPWVR---VLILVACLFPASVECMVRHYKFNVVLKNSTKLCSSKQIVTVNGKFPGPTIY  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDT++V+VVNHV+ N+SIHWHG+RQLRTGW+DGPAYITQCPIQ GQ F+YNFT+TGQ
Sbjct  60    AREDDTLLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQQFVYNFTITGQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPKRGVPYPFP+P KE+V+VLGEWWKSDVEAVIN+A+
Sbjct  120   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPRPHKEKVLVLGEWWKSDVEAVINEAL  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTING PGP   C+S+ G+TL V + KTYLLRIV+AA+NEELFFK+AGH
Sbjct  180   KSGLAPNVSDAHTINGQPGPVSGCTSQGGFTLPVGASKTYLLRIVNAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA Y KPFKT T+ I PGQTTN +L AD+  G+YL+A +PFMD  +A DN+TA
Sbjct  240   QLTVVEVDAVYTKPFKTGTVIIAPGQTTNVLLNADRKAGRYLVAATPFMDAPIAVDNKTA  299

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT + + T+L  +PP+NAT + + F   LRSLNSKK+PA VPL+ DHSLLF I
Sbjct  300   TATLHYSGTLSSSRTILTALPPQNATSIATNFTSSLRSLNSKKYPARVPLKIDHSLLFTI  359

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC TC+NGSR V DINN++FVMP  ALLQAH++NISGVFTDDFPG+P +PFNYTG
Sbjct  360   GLGVNPCKTCVNGSRVVADINNVTFVMPNIALLQAHFFNISGVFTDDFPGKPPVPFNYTG  419

Query  1299  TPPANLQTQNGTK  1337
             T P+N  T  GT+
Sbjct  420   TQPSNFATTQGTR  432



>ref|XP_010256659.1| PREDICTED: laccase-4 [Nelumbo nucifera]
Length=554

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/433 (72%), Positives = 358/433 (83%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR ++LVA         VE  +RHY F VV KNTTR+CS+KPIV VNG+FPGP+LY
Sbjct  1     MVSWVRLLLLVAFLLPAL---VECRIRHYKFNVVMKNTTRLCSTKPIVTVNGRFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHVQ NV+IHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREDDTVLVKVVNHVQYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGAIVILPK GVPYPFP P KE V++LGEWWKSDVEAVIN+A+
Sbjct  118   RGTLLWHAHILWLRATLHGAIVILPKHGVPYPFPTPHKEVVVILGEWWKSDVEAVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
              SG+APNVSDAHTING PGP P C S+ G+ L+VE GKTY+LRI++AA+NEELFFK+AGH
Sbjct  178   NSGLAPNVSDAHTINGQPGPVPTCPSQSGFNLKVEPGKTYMLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA Y KPFKTDTI I PGQTTN +L   +  GKYL+A SPFMD+ +A DN TA
Sbjct  238   KLTVVEVDAVYTKPFKTDTIVIAPGQTTNVLLETGRGSGKYLVAASPFMDSPIAVDNMTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A ++T L   PP+NATPV S F++ LRSLNSK++P  VPL  DHSLLF +
Sbjct  298   TATLHYSGTLATSATTLTNPPPQNATPVASNFIDSLRSLNSKEYPVKVPLTVDHSLLFTV  357

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPCSTC NG R + DINN+SFVMPTTALLQAHY NISGVFTDDFP  P I FNYTG
Sbjct  358   GLGVNPCSTCPNGIRVIADINNVSFVMPTTALLQAHYLNISGVFTDDFPANPPISFNYTG  417

Query  1299  TPPANLQTQNGTK  1337
             T PANLQT NGTK
Sbjct  418   TQPANLQTMNGTK  430



>ref|XP_002316233.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
 gb|EEF02404.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
Length=555

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/417 (72%), Positives = 352/417 (84%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VR YNF VV  NTT++CS+K I  +NGKFPGP++YARE D V +R+ N VQ
Sbjct  15    IFPALVECKVRLYNFRVVLTNTTKLCSTKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQ  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV++HWHGVRQLRTGW+DGPAYITQCPIQ GQ+++YNFTLTGQRGTLLWHAHI+W RAT
Sbjct  75    YNVTVHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVI PK+GVPYPFPKPDKE++I+L EWWK+DVEAV+NQA  +G+ PN+SDAHT+NG
Sbjct  135   IHGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNG  194

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             H G  P C+S G+TL VESGKTYLLRI++AA+N+ELFFK+AGHN+TVVEVDA++ KPF T
Sbjct  195   HTGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATFTKPFST  254

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFIGPGQTTNA+LTAD++ GKYLIAVSPFMDT+VA DN TA   L YKGT A +  VL
Sbjct  255   DTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYKGTLAFSPPVL  314

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P  NATP TSTFM+ LRSLNSKK+PANVPL  DH L F IG+GI+PC+TC NGS+AV
Sbjct  315   TTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCTNGSKAV  374

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPA-NLQTQNGTK  1337
              DINN+SF+MPTTALLQAHYYNISGVFTDDFP +P I FNYTG   A NL+T NGT+
Sbjct  375   ADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGNNTAMNLKTTNGTR  431



>ref|XP_011032154.1| PREDICTED: laccase-4-like isoform X2 [Populus euphratica]
Length=556

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/433 (71%), Positives = 354/433 (82%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             +A W+R   ++ L A + P  VES+VRHY F VV KN+T++CS+KPIV VNG+FPGP+L 
Sbjct  3     IALWIR---VLVLVACLFPASVESMVRHYKFNVVMKNSTKLCSTKPIVTVNGQFPGPTLV  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  60    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPKRGVPYPFP P KE+VIVLGEWWKSDVEAVIN+A 
Sbjct  120   RGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPTPRKEKVIVLGEWWKSDVEAVINEAT  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SGMAPNVSDAHTINGHPGP   CSS  GY L V  GKTY+ RI++AA+NEELFFK+AGH
Sbjct  180   KSGMAPNVSDAHTINGHPGPVSACSSHGGYNLTVHPGKTYMFRIINAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFK DT+ I PGQTTN +LTA++  GKYL+A SPFMD  +A DN TA
Sbjct  240   QLTVVEVDAAYVKPFKIDTVVIAPGQTTNVLLTANRGSGKYLVAASPFMDAPIAVDNVTA  299

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T  LHY GT A T T L   P +NATPV + F   LRSLNS K+PA VPL+ D SL F +
Sbjct  300   TAILHYSGTLASTITTLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDRSLFFTV  359

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC+TC+NGSR V DINN++FVMPT ALLQAH +NISGVFTDDFP  P  PFNYTG
Sbjct  360   GLGVNPCATCINGSRVVADINNVTFVMPTIALLQAHVFNISGVFTDDFPANPPTPFNYTG  419

Query  1299  TPPANLQTQNGTK  1337
             T P N QT NGTK
Sbjct  420   TQPTNFQTVNGTK  432



>ref|XP_008233715.1| PREDICTED: laccase-4-like [Prunus mume]
Length=558

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/415 (72%), Positives = 351/415 (85%), Gaps = 1/415 (0%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V+S+VRHY F+VV KNTT++CSSKP + VNGKFPGP+LYAREDDTVIVRV+NHV  N
Sbjct  20    PAFVQSLVRHYKFSVVFKNTTKLCSSKPTITVNGKFPGPTLYAREDDTVIVRVINHVNHN  79

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             ++IHWHGV+QL T W+DGPAYITQCPIQ GQ FIYNFTLTGQRGTLLWHAH +W RAT+H
Sbjct  80    LTIHWHGVKQLGTAWADGPAYITQCPIQPGQNFIYNFTLTGQRGTLLWHAHTSWLRATLH  139

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKRG PYPFP PD+E+ ++L EWWKSDVEAV+NQ+++SG+ PNVSDAHTINGH 
Sbjct  140   GAIVILPKRGTPYPFPTPDEEKTVILAEWWKSDVEAVVNQSIKSGLPPNVSDAHTINGHA  199

Query  636   GPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             GP P CSS+ GYTL VESGKTYLLRI++AA+N++LFFK+AGHNLTVVEVDASY KPF+TD
Sbjct  200   GPVPGCSSQGGYTLHVESGKTYLLRIINAALNDDLFFKIAGHNLTVVEVDASYTKPFQTD  259

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLA  992
             TIFI PGQTTNA+LTA++  GKYLIA SPFMD  V  DN T+  +L YKGT A     L 
Sbjct  260   TIFISPGQTTNAILTANRRIGKYLIAASPFMDAPVGFDNLTSIASLRYKGTPANPKAFLT  319

Query  993   TMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVG  1172
             ++PP+NATPVT+TFM+ LRSLNSK++PANVPL  DHSL F I +G+NPC+TC+NGS+ V 
Sbjct  320   SIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFTIAVGVNPCATCVNGSKLVA  379

Query  1173  DINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
               NN+SFVMPT ALLQA+YYNI GV+T DFP  P IPFNYTG   AN+QT NGT+
Sbjct  380   AFNNVSFVMPTIALLQAYYYNIKGVYTLDFPANPPIPFNYTGNTTANMQTTNGTR  434



>ref|XP_007220829.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
 gb|EMJ22028.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
Length=558

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/417 (72%), Positives = 351/417 (84%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+S+VRHY F+VV KNTT++CSSKP + VNGKFPGP+LYAREDDTVIVRV+NHV 
Sbjct  18    LYPAFVQSLVRHYKFSVVFKNTTKLCSSKPTITVNGKFPGPTLYAREDDTVIVRVINHVN  77

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N++IHWHGVRQL T W+DGPAYITQCPIQ GQ FIYNFTLTGQRGTLLWHAH +W RAT
Sbjct  78    HNLTIHWHGVRQLGTAWADGPAYITQCPIQPGQNFIYNFTLTGQRGTLLWHAHTSWLRAT  137

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVILPKRG PYPFP PD+E+ ++L EWWKSDVEAV+NQ+++SG+ PNVSDAHTING
Sbjct  138   LHGAIVILPKRGTPYPFPTPDEEKTVILAEWWKSDVEAVVNQSIKSGLPPNVSDAHTING  197

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP P CSS+ GYTL VESGKTYLLRI++AA+N++LFFK+AGHNLTVVEVDASY KPF+
Sbjct  198   HAGPVPGCSSQGGYTLHVESGKTYLLRIINAALNDDLFFKIAGHNLTVVEVDASYTKPFQ  257

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTIFI PGQTTNA+LTA++  GKYLIA SPFMD  V  DN T+  +L YKGT A     
Sbjct  258   TDTIFISPGQTTNAILTANRGIGKYLIAASPFMDAPVGFDNLTSIASLLYKGTPANPKAF  317

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PP+NATPVT+TFM+ LRSLNSK++PANVPL  DHSL F I +G+NPC+TC+NGS+ 
Sbjct  318   LTSIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFTIAVGVNPCATCVNGSKL  377

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V   NN+SFVMPT ALLQA+YYN  GVFT DFP  P IPFNYTG   AN+QT NGT+
Sbjct  378   VAAFNNVSFVMPTIALLQAYYYNTKGVFTLDFPANPPIPFNYTGNSTANMQTTNGTR  434



>ref|XP_011039810.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=556

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/417 (72%), Positives = 353/417 (85%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  V+  VR Y+F VV  NTT++CS+K IV +NGKFPGP++YARE D V +++ NHVQ
Sbjct  16    IFPALVQCKVRRYDFRVVLTNTTKLCSTKSIVTINGKFPGPTIYAREGDNVNIKLTNHVQ  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQLRTGWSDGPAYITQCPI+ GQ+++YNFTLTGQRGTLLWHAHI+W RAT
Sbjct  76    YNVTIHWHGVRQLRTGWSDGPAYITQCPIRPGQSYLYNFTLTGQRGTLLWHAHISWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVILP++GVPYPFPKPDKE++I+LGEWWK+DVEAV+NQA Q+G+ PN+SDAH +NG
Sbjct  136   IHGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQTGLPPNISDAHIVNG  195

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
               G  P C S G+TL VESGKTYLLRI++AA+N+ELFFK+AGHN+TVVEVDA+Y KP  T
Sbjct  196   QTGAVPGCPSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAAYTKPLST  255

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFIGPGQTTNA+LTAD+  GKYL+AVSPFMDT+VA DN TA   L YKGT A +  VL
Sbjct  256   DTIFIGPGQTTNALLTADKRVGKYLMAVSPFMDTVVAVDNVTAIAFLRYKGTIAFSPPVL  315

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P  NATPVTSTFM+ LRSLNSKK+PANVPL  DHSL F IG+GI+PC+TC+NGS+AV
Sbjct  316   TTTPAINATPVTSTFMDNLRSLNSKKYPANVPLTVDHSLYFTIGVGIDPCATCVNGSKAV  375

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPA-NLQTQNGTK  1337
             G INNISF+MPTTALLQAHYY+ISGVFTDDFP  P   FNYTG   A NLQT NGT+
Sbjct  376   GAINNISFIMPTTALLQAHYYSISGVFTDDFPAMPPNSFNYTGNNTALNLQTNNGTR  432



>ref|XP_010044087.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86093.1| hypothetical protein EUGRSUZ_B02794 [Eucalyptus grandis]
Length=556

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/435 (71%), Positives = 368/435 (85%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW++   ++ L A I P  VE+ VR+Y+F VV KN TR+CSSKPIV VNGKFPGP+LY
Sbjct  1     MDSWLK---ILVLVACITPAVVEARVRNYSFNVVMKNKTRLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDD V+VRV NHV+ NV+IHWHGVRQLRTGW+DGPAYITQCPIQTGQ+++YNFT+TGQ
Sbjct  58    AREDDNVLVRVTNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGAIVILPKRGVPYPFPKP KE V+VLGEWWKSD EAVINQA+
Sbjct  118   RGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP+ NC S+ G+TL VESGK Y+LRI++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPFKT+TI I PGQTTNA+++ DQ+ GKY++A SPFMD+ +A DN TA
Sbjct  238   QLTIVEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A TST L   PP+NAT V + F+  LRSLNSK++PA VPL  DHSLLF +
Sbjct  298   TATLHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+G+NPC +C   NGSR V  +NN++FVMP+TALLQAH++NISGVFT DFPG P   FNY
Sbjct  358   GLGVNPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTSDFPGNPRTTFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TG+PP+NL+T +GTK
Sbjct  418   TGSPPSNLRTTSGTK  432



>ref|XP_010041000.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW44721.1| hypothetical protein EUGRSUZ_L01734 [Eucalyptus grandis]
Length=556

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/435 (71%), Positives = 368/435 (85%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW++   ++ L A I P  VE+ VR+Y+F VV KN TR+CSSKPIV VNGKFPGP+LY
Sbjct  1     MDSWLK---ILVLVACITPAVVEARVRNYSFNVVMKNKTRLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDD V+VRV NHV+ NV+IHWHGVRQLRTGW+DGPAYITQCPIQTGQ+++YNFT+TGQ
Sbjct  58    AREDDNVLVRVTNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGAIVILPKRGVPYPFPKP KE V+VLGEWWKSD EAVINQA+
Sbjct  118   RGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP+ NC S+ G+TL VESGK Y+LRI++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPFKT+TI I PGQTTNA+++ DQ+ GKY++A SPFMD+ +A DN TA
Sbjct  238   QLTIVEVDATYVKPFKTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A TST L   PP+NAT V + F+  LRSLNSK++PA VPL  DHSLLF +
Sbjct  298   TATLHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+G+NPC +C   NGSR V  +NN++FVMP+TALLQAH++NISGVFT DFPG P   FNY
Sbjct  358   GLGVNPCPSCKAGNGSRVVASMNNVTFVMPSTALLQAHFFNISGVFTSDFPGNPRTTFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TG+PP+NL+T +GTK
Sbjct  418   TGSPPSNLRTTSGTK  432



>ref|XP_011036009.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=555

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/417 (72%), Positives = 350/417 (84%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VR YNF VV  NTT++CS+K I  +NGKFPGP++YARE D V +R+ N VQ
Sbjct  15    IFPALVECKVRLYNFRVVLTNTTKLCSTKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQ  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV++HWHGVRQLRTGW+DGPAYITQCPI  GQ+++YNFTLTGQRGTLLWHAHI+W RAT
Sbjct  75    HNVTVHWHGVRQLRTGWADGPAYITQCPILPGQSYLYNFTLTGQRGTLLWHAHISWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVI PK+GVPYPFPKPDKE++I L EWWK+DVEAVINQA  +G+ PN+SDAHT+NG
Sbjct  135   IHGAIVIFPKKGVPYPFPKPDKEKIITLSEWWKADVEAVINQATMTGLPPNISDAHTVNG  194

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
               G  P C+S G+TL VESGKTYLLRI++AA+N+ELFFK+AGHN+TVVEVDA+Y KPF T
Sbjct  195   QTGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATYTKPFST  254

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFIGPGQTTNA+LTAD++ GKYLIAVSPFMDT+VA DN TA   L YKGT A +  VL
Sbjct  255   DTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYKGTLAFSPPVL  314

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P  NATP TSTFM+ LRSLNSKK+PANVPL  DH L F IG+GI+PC+TC+NGS+AV
Sbjct  315   TTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCINGSKAV  374

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPA-NLQTQNGTK  1337
              DINN+SF+MPTTALLQAHYYNISGVFTDDFP +P I FNYTG   A NL+T NGT+
Sbjct  375   ADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPITFNYTGNNTAMNLKTTNGTR  431



>emb|CDP06511.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/420 (71%), Positives = 347/420 (83%), Gaps = 4/420 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V   VRHY F VV KN TR+CSSKPIV VNGKFPGP+LYAREDDTV+VRVVNHV+
Sbjct  18    LFPALVHCRVRHYKFDVVLKNFTRLCSSKPIVTVNGKFPGPTLYAREDDTVLVRVVNHVK  77

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  78    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRAT  137

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPKRGV YPFPKP  E V+VLGEWWKSD EAVIN+A++SGMAPNVSDAHTING
Sbjct  138   VHGAVVILPKRGVLYPFPKPHHENVVVLGEWWKSDTEAVINEALKSGMAPNVSDAHTING  197

Query  630   HPGPTPNCSSK--GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPF  803
             HPG   NCSS   G+TL VE GK+YLLR+++AA+NEELFFK+AGH LTVVEVDA+YVKPF
Sbjct  198   HPGAVANCSSDQGGFTLSVEPGKSYLLRVINAALNEELFFKIAGHTLTVVEVDATYVKPF  257

Query  804   KTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTST  983
             KTDTI + PGQTTN ++TADQ+ GKY+++ S FMD+ +A DN +AT TLHY GT + + T
Sbjct  258   KTDTILVAPGQTTNVIVTADQSAGKYMVSASTFMDSTIAVDNTSATATLHYSGTLSSSPT  317

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNG  1157
                T P  NATPV + F   LRSLNS+K+PA VP   DHSL F + +GINPC TC   NG
Sbjct  318   TFTTAPALNATPVANKFTNSLRSLNSEKYPAQVPQTVDHSLFFVVSLGINPCPTCKAANG  377

Query  1158  SRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             SR V  +NN++FVMPT ALLQAH++NI+GVFT DFPG P  PFNYTGTPPANLQT+NGTK
Sbjct  378   SRVVASVNNVTFVMPTVALLQAHFFNINGVFTTDFPGNPPSPFNYTGTPPANLQTKNGTK  437



>gb|KHN06247.1| Laccase-4 [Glycine soja]
Length=556

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/417 (70%), Positives = 349/417 (84%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDDTV+V+VVNHV+
Sbjct  16    LLPLSVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPNIYAREDDTVLVKVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ FIYNFTLTGQRGTL WHAHI W RAT
Sbjct  76    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFIYNFTLTGQRGTLWWHAHILWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFPKP+ E+V++L EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  136   VHGALVILPKLGVPYPFPKPNMEQVMILSEWWKSDTEAVINEALKSGLAPNVSDAHTING  195

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP   C+S+ G+ L+V+ G TYLLRI++AA+NEELFFK+AGH LTVVEVDA Y KPFK
Sbjct  196   HPGPVQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPFK  255

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTN +LT     GKYL+A SPFMD  +A DN+TAT TLHY GT   T T 
Sbjct  256   TDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATATLHYSGTLGSTITT  315

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L +MPP+NATP+ ++F + LRSLNSKK+PA VPL+ DH+LLF + +GINPC+TC+N SR 
Sbjct  316   LTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVSLGINPCATCVNNSRV  375

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V DINN++FVMP  +LLQAH++ I GVFTDDFPG P + +N+TGT P+NL+T  GT+
Sbjct  376   VADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFTGTQPSNLRTMKGTR  432



>ref|XP_007026781.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY07283.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
Length=556

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/435 (71%), Positives = 363/435 (83%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVRG+VLVA    + P  V+  VR+Y F VV KN TR+CSSKPIV VNGKFPGP+LY
Sbjct  1     MGSWVRGLVLVAC---LFPVLVDCTVRNYKFDVVLKNKTRLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE DTV+V+VVNHV+ NVSIHWHGVRQLRTGW+DGPAYITQCPI TGQ+++YNFT+TGQ
Sbjct  58    AREGDTVLVKVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W R+TVHGAIVILPKRGVPYPFPKP KE V++L EWWKSD EAVIN+A+
Sbjct  118   RGTLLWHAHILWLRSTVHGAIVILPKRGVPYPFPKPHKEVVVILAEWWKSDTEAVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGH GP  +C S+ G+TL VE+GKTYLLR+++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHTGPVSSCPSQGGFTLPVENGKTYLLRLINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFKT T+ I PGQTTN +++AD++ GKYL+A SPFMD  +A DN TA
Sbjct  238   KLTVVEVDATYVKPFKTKTVIIAPGQTTNVLVSADKSSGKYLVAASPFMDAPIAVDNLTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A T T L ++PP+NATPV + F+  LR+LNSK++PA VP   DH+L F +
Sbjct  298   TATLHYSGTLANTPTTLTSLPPKNATPVANNFINSLRALNSKQYPALVPQSIDHNLFFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC TC   NGSRAV  INN++FVMPTTALLQAH++NISGVFT DFP  P   FNY
Sbjct  358   GLGINPCPTCKAGNGSRAVASINNVTFVMPTTALLQAHFFNISGVFTTDFPANPPNVFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             +GTPP NLQT NGTK
Sbjct  418   SGTPPTNLQTTNGTK  432



>ref|XP_002278638.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI30423.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/433 (72%), Positives = 363/433 (84%), Gaps = 7/433 (2%)
 Frame = +3

Query  48    SWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAR  227
             SWVR   ++ L A + P  VE  VR Y F VV KNT R+C+SKPIV VNG+FPGP+LY R
Sbjct  4     SWVR---VLVLVACLLPALVECRVRQYTFNVVLKNTNRLCASKPIVTVNGRFPGPTLYVR  60

Query  228   EDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRG  407
             EDDTV+VRVVNHV+ NVSIHWHG+RQLRTGWSDGPAYITQCPIQTGQ+++YNFT+TGQRG
Sbjct  61    EDDTVLVRVVNHVKYNVSIHWHGIRQLRTGWSDGPAYITQCPIQTGQSYLYNFTVTGQRG  120

Query  408   TLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQS  587
             TLLWHAH+ W RATVHGAIVILPKRGVPYPFPKP KE V++LGEWWKSDVEAVINQA+ S
Sbjct  121   TLLWHAHVLWLRATVHGAIVILPKRGVPYPFPKPHKEVVVILGEWWKSDVEAVINQALSS  180

Query  588   GMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNL  764
             G+APNVSDAHTINGHPGP  NC S+ G++L+VE+GKTYLLRI++AA+NEELFFK+AGH L
Sbjct  181   GLAPNVSDAHTINGHPGPVSNCPSQGGFSLQVEAGKTYLLRIINAALNEELFFKIAGHQL  240

Query  765   TVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATG  944
             +VVEVDA Y KPFK DT+ I PGQTTNA++TADQ+ GKYL+A SPFMD+ +A DN TAT 
Sbjct  241   SVVEVDAVYTKPFKIDTLVIAPGQTTNALITADQSSGKYLMAASPFMDSPIAVDNLTATA  300

Query  945   TLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGI  1124
             TLHY GT A + T L + PP NAT V + F+  LRSLNSKK+PA VPL  DHSL   +G+
Sbjct  301   TLHYSGTLASSPTSLTSPPPPNATAVANKFVNSLRSLNSKKYPAKVPLTVDHSLFITVGL  360

Query  1125  GINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             GINPC+TC+  NGSRAV  +NN++FVMPTTA+LQAHY+NISGV+T DFP  P + FNYTG
Sbjct  361   GINPCATCVAGNGSRAVASMNNVTFVMPTTAILQAHYFNISGVYTTDFPANPPVAFNYTG  420

Query  1299  TPPANLQTQNGTK  1337
             + PANLQT NGTK
Sbjct  421   S-PANLQTTNGTK  432



>ref|XP_006429309.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
 ref|XP_006480970.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR42549.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
Length=555

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/435 (70%), Positives = 361/435 (83%), Gaps = 7/435 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   L+ L A + P  VE  VRHY F VV KN+T++CSSKPIV VNGKFPGP+LY
Sbjct  1     MDSWVR---LLLLVACLFPALVECRVRHYKFNVVMKNSTKLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE DTV+V+VVNHV+ NV+IHWHGVRQLRTGW+DGPAYITQCPIQ+G +++YNFT+TGQ
Sbjct  58    AREHDTVLVKVVNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQSGHSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGAIVILPKRGVPYPFPKP KE V+VL EWWKSD EAVINQA+
Sbjct  118   RGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWWKSDTEAVINQAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSD+HTING PGP  +CSS+ G+TL V+SGKTY+LRI++AA+NEELFFK+AGH
Sbjct  178   RSGLAPNVSDSHTINGQPGPISSCSSQGGFTLPVDSGKTYMLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFKTDTI I PGQTTN +L+AD+  GKYL+A SPFMD  +A DN TA
Sbjct  238   KLTVVEVDATYVKPFKTDTIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNATA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A ++T L + PP+N T + + F++ LRSLNSKK+PA VP   DH+LLF +
Sbjct  298   TATLHYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+G+NPC +C   NGSR V  INN++FVMPT ALLQAH++NISGVFT DFPG P   +N+
Sbjct  358   GLGVNPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTTDFPGNPPHTYNF  417

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P NLQT NGTK
Sbjct  418   TGT-PKNLQTSNGTK  431



>gb|KDO53232.1| hypothetical protein CISIN_1g0093922mg, partial [Citrus sinensis]
Length=506

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/435 (70%), Positives = 359/435 (83%), Gaps = 7/435 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   L+ L A + P  VE  VRHY F VV KN+T++CSSKPIV VN KFPGP+LY
Sbjct  1     MDSWVR---LLLLVACLFPALVECRVRHYKFNVVMKNSTKLCSSKPIVTVNRKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE DTV+V+VVNHV+ NV+IHWHGVRQLRTGW+DGPAYITQCPIQ+G +++YNFT+TGQ
Sbjct  58    AREHDTVLVKVVNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQSGHSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGAIVILPKRGVPYPFPKP KE V+VL EWWKSD EAVINQA+
Sbjct  118   RGTLLWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWWKSDTEAVINQAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             QSG+APNVSD+HTING PGP  +CSS+ G+TL V+SGKTY+LRI++AA+NEELFFK+AGH
Sbjct  178   QSGLAPNVSDSHTINGQPGPISSCSSQGGFTLPVDSGKTYMLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFKTD I I PGQTTN +L+AD+  GKYL+A SPFMD  +A DN TA
Sbjct  238   KLTVVEVDATYVKPFKTDNIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNVTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A ++T L + PP+N T + + F++ LRSLNSKK+PA VP   DH+LLF +
Sbjct  298   TATLHYSGTLASSATTLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+G+NPC +C   NGSR V  INN++FVMPT ALLQAH++NISGVFT DFPG P   +N+
Sbjct  358   GLGVNPCPSCKAGNGSRVVASINNVTFVMPTIALLQAHFFNISGVFTTDFPGNPPHTYNF  417

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P NLQT NGTK
Sbjct  418   TGT-PKNLQTSNGTK  431



>ref|XP_003551299.1| PREDICTED: laccase-4-like [Glycine max]
Length=556

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/417 (70%), Positives = 349/417 (84%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDDTV+V+VVNHV+
Sbjct  16    LLPLSVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ FIYNFTLTGQRGTL WHAHI W RAT
Sbjct  76    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFIYNFTLTGQRGTLWWHAHILWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFPKP+ E+V++L EWWKSD EAVIN+A++SG+APNVS+AHTING
Sbjct  136   VHGALVILPKLGVPYPFPKPNMEQVMILSEWWKSDTEAVINEALKSGLAPNVSNAHTING  195

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP   C+S+ G+ L+V+ G TYLLRI++AA+NEELFFK+AGH LTVVEVDA Y KPFK
Sbjct  196   HPGPVQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPFK  255

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTN +LT     GKYL+A SPFMD  +A DN+TAT TLHY GT   T T 
Sbjct  256   TDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATATLHYSGTLGSTITT  315

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L +MPP+NATP+ ++F + LRSLNSKK+PA VPL+ DH+LLF + +GINPC+TC+N SR 
Sbjct  316   LTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVSLGINPCATCVNNSRV  375

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V DINN++FVMP  +LLQAH++ I GVFTDDFPG P + +N+TGT P+NL+T  GT+
Sbjct  376   VADINNVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFTGTQPSNLRTMKGTR  432



>ref|XP_009799024.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=557

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/435 (69%), Positives = 356/435 (82%), Gaps = 5/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR  + + LAA + P  VE  +RHY F VV KNTTR+CSSKPIV VNGKFPGP++Y
Sbjct  1     MNSWVR--LFIVLAACLFPLVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTIY  58

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE+DTV+V+VVNHV+ N+SIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQ
Sbjct  59    AREEDTVLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQ  118

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPK GVPYPFPKP+ E V++L EWWKSD EAVIN+A+
Sbjct  119   RGTLFWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVLLAEWWKSDTEAVINEAI  178

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC S+ GY L V+ GKTYLLR+++AA+NEELFFK+AGH
Sbjct  179   KSGLAPNVSDAHTINGHPGPVSNCPSQGGYKLNVDPGKTYLLRVINAALNEELFFKIAGH  238

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+YVKPFKTDTI I PGQTTN ++TA+Q  GKY++A SPFMD  +A DN TA
Sbjct  239   KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTA  298

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
               TLHY GTQ      L + PP+NATPV +TF++ LRSLNSKK+PANVP + DHSL F +
Sbjct  299   IATLHYSGTQGNNRISLTSTPPKNATPVANTFLDSLRSLNSKKYPANVPKKIDHSLFFTV  358

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC +C   NGSR V  +NN++FVMPTTALLQAH++ I GVFT DFP  P   FNY
Sbjct  359   GLGINPCPSCKQGNGSRVVASVNNVTFVMPTTALLQAHFFGIKGVFTTDFPANPPFAFNY  418

Query  1293  TGTPPANLQTQNGTK  1337
             TGT PANL T NGTK
Sbjct  419   TGTGPANLATTNGTK  433



>ref|XP_011077581.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=557

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/436 (69%), Positives = 357/436 (82%), Gaps = 7/436 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   ++ L   + P  V+  VRHY F VV KNTTR+CS+K IV VNGKFPGP++Y
Sbjct  1     MDSWVR---VLILLGCLFPVLVQCRVRHYKFNVVMKNTTRLCSTKSIVTVNGKFPGPTIY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+++VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGA+VILPK GVPYPFPKP+ E VI+LGEWWKSD EAVIN+A+
Sbjct  118   RGTLLWHAHILWLRATLHGALVILPKLGVPYPFPKPNHERVIILGEWWKSDTEAVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSS-KGYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP PNCSS  G+ L+VE GKTYLLR+++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPVPNCSSTDGFILDVEPGKTYLLRLINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQT  935
              +T+VEVDA+YVKPFKTDTI I PGQTTNA+LT D+  GKY++A SPFMDT +VA DN T
Sbjct  238   RMTIVEVDATYVKPFKTDTIVIAPGQTTNAILTTDRAVGKYMVAASPFMDTPVVAVDNLT  297

Query  936   ATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             AT TLHY GT + + T     P +NATPV + F   LRSLNS K+PA VP + DHSL F 
Sbjct  298   ATATLHYSGTLSSSLTTFTRPPAQNATPVANNFTNSLRSLNSNKYPAKVPQKVDHSLFFT  357

Query  1116  IGIGINPCSTC--LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFN  1289
             +G+GINPC TC   NGSR V  +NN++FVMPT ALLQAH++NI GVFT DFPG P   FN
Sbjct  358   VGLGINPCPTCKATNGSRVVAAVNNVTFVMPTIALLQAHFFNIKGVFTTDFPGNPPFAFN  417

Query  1290  YTGTPPANLQTQNGTK  1337
             YTG+PPANL T NGTK
Sbjct  418   YTGSPPANLGTTNGTK  433



>ref|XP_009786393.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=556

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/435 (69%), Positives = 354/435 (81%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   +  L A + P  VE  +R YNF V+ KNTTR+CS+KPIV VNGKFPGP++Y
Sbjct  1     MESWVR---IFILFACLFPAFVECRIRRYNFNVMVKNTTRLCSTKPIVTVNGKFPGPTVY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV++RVVNHV+ NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREDDTVLIRVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W R+TVHGAIVILPK GVPYPFPKPD E V+VL EWWKSD EAVINQA+
Sbjct  118   RGTLFWHAHILWLRSTVHGAIVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC S+ GYTL V+ GK+Y+LR+++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPLSNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+Y+KPFKTDTI I PGQTTN ++TA+Q  GKY++  SPFMD  +A DN TA
Sbjct  238   KMTVVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVVASPFMDAPIAVDNATA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A + T L   PP+NATPV + F++ LRSLNSKK+PA VP   DHSL F +
Sbjct  298   TATLHYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC +C   NGSR V  INN++FVMPTTALLQAH++ I GV+T DFP  P I FNY
Sbjct  358   GLGINPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTTDFPQNPPIKFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TG PP NL T +GTK
Sbjct  418   TGKPPVNLATTSGTK  432



>ref|XP_010098906.1| hypothetical protein L484_006544 [Morus notabilis]
 gb|EXB76109.1| hypothetical protein L484_006544 [Morus notabilis]
Length=545

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/416 (69%), Positives = 344/416 (83%), Gaps = 0/416 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+ +VRHYNF+VV  NTT++CSSKP V VNG+FPGP+LYAREDD VIVRV+NHV 
Sbjct  15    LFPASVDCLVRHYNFSVVLTNTTKLCSSKPTVTVNGQFPGPTLYAREDDNVIVRVINHVN  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N++IHWHG+RQLRT W+DGPAY+TQCPIQ GQ ++YNFTLTGQRGTLLWHAHI+W RAT
Sbjct  75    RNLTIHWHGIRQLRTAWADGPAYVTQCPIQPGQNYVYNFTLTGQRGTLLWHAHISWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKPDKE++I+L EWWK+DVEAV+NQA QSG  PNVSDAHTING
Sbjct  135   VHGAIVILPKRGVPYPFPKPDKEKIIILAEWWKADVEAVVNQATQSGQPPNVSDAHTING  194

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
              PG  P+CSS+GYTL V++GKTYLLRI++AA+N+ELFFK+AGHNLTVVE DASY KPF+T
Sbjct  195   FPGQVPSCSSQGYTLHVKTGKTYLLRIINAALNDELFFKIAGHNLTVVEADASYTKPFET  254

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIF+ PGQTTNA+L  DQ  GKYLIA++PFMD  +  +N T+  TL YK T     T+L
Sbjct  255   DTIFLSPGQTTNALLKTDQAIGKYLIAINPFMDAPIGYNNVTSFATLRYKKTPPNPKTIL  314

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
               +PP+N TP T  F++ LRSLNSK++PA VPL   HSL   I +G+NPC TC+NG++ V
Sbjct  315   TKIPPQNDTPKTKAFIDSLRSLNSKQYPAKVPLNVHHSLFLTIAVGVNPCDTCVNGTKLV  374

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              DINN+SFV+P+ ALLQAHYYNI  VFTDDFPG P   FNYTG  PAN+QT NGT+
Sbjct  375   ADINNVSFVLPSIALLQAHYYNIGAVFTDDFPGNPPFRFNYTGPSPANIQTTNGTR  430



>ref|XP_007016183.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY33802.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=557

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/433 (70%), Positives = 361/433 (83%), Gaps = 3/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MA W+R  VL+ LA L+ P  VE +VRHY F VV +NTTR+CSSKPIV VNG++PGP+L 
Sbjct  3     MAPWIR--VLMFLACLLFPASVECMVRHYKFNVVLENTTRLCSSKPIVTVNGRYPGPTLV  60

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHV+ N+SIHWHG+RQ+RTGW+DGP YITQCPIQ GQ F+YNFT+TGQ
Sbjct  61    AREDDTVLVKVVNHVKYNLSIHWHGIRQIRTGWADGPGYITQCPIQPGQNFVYNFTITGQ  120

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPKRGVPYPFPKP KEE I+LGEWWKSDVEAVIN+A+
Sbjct  121   RGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPKPHKEETIILGEWWKSDVEAVINEAL  180

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SGMAPNVSDAHTINGHPGP  +C ++ GYTL V+ GKTY+LRI++AA+NEELFFK+AGH
Sbjct  181   KSGMAPNVSDAHTINGHPGPVSSCPTQGGYTLRVKPGKTYMLRIINAALNEELFFKIAGH  240

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+YVKPFKT+TI I PGQTTN +LTA +  GKYL+A SPFMD  +  DN TA
Sbjct  241   LLTVVEVDATYVKPFKTETIVITPGQTTNVLLTAHRGAGKYLVAASPFMDAPIVVDNVTA  300

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY G+   T+T L ++PP+NAT V + F   LRSLNSK++PANVPL+ DHSLLF +
Sbjct  301   TATLHYSGSLTSTATTLTSLPPKNATSVATNFTNALRSLNSKQYPANVPLKIDHSLLFTV  360

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+GINPC +C+NGSR V  INN++FVMP  +LLQAH++NISGVFT DFPG P +PFNYT 
Sbjct  361   GLGINPCPSCVNGSRVVASINNVTFVMPKISLLQAHFFNISGVFTTDFPGNPPVPFNYTS  420

Query  1299  TPPANLQTQNGTK  1337
             T   N QT+ GTK
Sbjct  421   TQLTNFQTKQGTK  433



>ref|XP_009593041.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/435 (69%), Positives = 353/435 (81%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   +  L A + P  VE  +R YNF V+ KNT+R+CS+KPIV VNGKFPGP++Y
Sbjct  1     MESWVR---IFILFACLFPAFVECRIRRYNFNVMVKNTSRLCSTKPIVTVNGKFPGPTVY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV++RVVNHV+ NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREDDTVLIRVVNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W R+TVHGAIVILPK GVPYPFPKPD E V++L EWWKSD EAVINQA+
Sbjct  118   RGTLFWHAHILWLRSTVHGAIVILPKLGVPYPFPKPDHEAVVILAEWWKSDTEAVINQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC S+ GY L V+ GK+Y+LR+++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPLSNCPSQGGYKLSVDPGKSYMLRVINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+YVKPFKTDTI I PGQTTN ++ A+Q  GKY++  SPFMD  +A DN TA
Sbjct  238   KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVAANQGSGKYMVVASPFMDAPIAVDNATA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A + T L   PP+NATPV + F++ LRSLNSKK+PA VP   DHSL F +
Sbjct  298   TATLHYSGTLASSVTTLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC +C   NGSR V  INN++FVMPTTALLQAH++ I GV+T DFP  P   FNY
Sbjct  358   GLGINPCPSCKQGNGSRVVASINNVTFVMPTTALLQAHFFGIKGVYTTDFPQNPPFKFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TGTPPANL T +GTK
Sbjct  418   TGTPPANLSTMSGTK  432



>ref|XP_009350996.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/417 (71%), Positives = 346/417 (83%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VES++RHY F+VV KNTT +C+SKPIV VNGKFPGP+LYAREDDTVIVRV NHV+
Sbjct  18    LYPAFVESLIRHYKFSVVYKNTTNLCASKPIVTVNGKFPGPTLYAREDDTVIVRVTNHVK  77

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGV+Q  TGWSDGPAYITQCPIQ GQ +IYNFTLTGQRGTLLWHAH +W RAT
Sbjct  78    YNVTIHWHGVKQRGTGWSDGPAYITQCPIQPGQNYIYNFTLTGQRGTLLWHAHDSWLRAT  137

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVILPKR  PYPFP PD+E++I++ EWWKSDVE VINQA QSG+ PNVSDAHTING
Sbjct  138   LHGAIVILPKRSTPYPFPTPDEEKIIIMAEWWKSDVEDVINQATQSGLPPNVSDAHTING  197

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
               GP P CSS+ GYTL VE+GKTY+LRIV+AA+N+ELFFKVAGHNLTVVEVDASY KPF+
Sbjct  198   RVGPLPGCSSQGGYTLHVENGKTYMLRIVNAAINDELFFKVAGHNLTVVEVDASYTKPFQ  257

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI+ GPGQTTN +LTA+Q  GKY I  SPFMD  +  DN T   TL YKGT A  + +
Sbjct  258   TDTIYTGPGQTTNVILTANQGIGKYFITASPFMDAPIGFDNATVIATLRYKGTPANPTAI  317

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PPRNATP+T  F++ LRSLNSK++PA+VPL  DHSL F I +G NPC+ C++GS+ 
Sbjct  318   LTSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVGANPCAACVSGSKL  377

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V  INN+SFVMP+ +LLQA+YYN+ GV+T DFP  P IPFNYTGT PANLQT NGT+
Sbjct  378   VSAINNVSFVMPSISLLQAYYYNVKGVYTLDFPANPPIPFNYTGTSPANLQTTNGTR  434



>ref|XP_004490949.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=554

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/417 (69%), Positives = 348/417 (83%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+S+VRHYNF VV KN+T++CS+K  V VNGKFPGP++YAREDD VIVRV NHV+
Sbjct  14    LFPTFVQSLVRHYNFNVVLKNSTKLCSTKSFVTVNGKFPGPTIYAREDDNVIVRVTNHVK  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHG++QLRT WSDGPAYITQCPIQTGQ+F+YNFT+TGQRGTLLWHAHI W RAT
Sbjct  74    HNVTIHWHGIKQLRTCWSDGPAYITQCPIQTGQSFVYNFTITGQRGTLLWHAHITWLRAT  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVILPKR +PYPFPKPDKE++I+LGEWWKSDVEAV+NQA  SG+ PN+SDAHTING
Sbjct  134   MHGAIVILPKRDIPYPFPKPDKEKIIILGEWWKSDVEAVVNQATNSGLPPNISDAHTING  193

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             HPG  P C S+GYTL VE GKTYLLRI++AA+N+ELFFK+AGH LTVVE DASY+KPF+T
Sbjct  194   HPGSVPGCMSQGYTLHVERGKTYLLRIINAALNDELFFKIAGHKLTVVEADASYIKPFET  253

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIF+ PGQTTN +LT +Q+ GKYLIA +PFMD  +  DN T+  TLHYKGTQ  T T+L
Sbjct  254   DTIFLSPGQTTNVLLTTNQSVGKYLIATTPFMDAPIGFDNVTSIATLHYKGTQPDTKTIL  313

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
               +PP NAT +T TF + L+SLNSK++P  VPL+ D SLLFAI +GI+PC TC +G++ V
Sbjct  314   TNIPPLNATTLTKTFTDSLKSLNSKQYPTKVPLKIDQSLLFAITVGIDPCDTCTSGNKLV  373

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
               INN++F+MPT +LLQAHYYNI GVFTDDFP  P + F+YTG   P NL T+NGT+
Sbjct  374   SAINNVTFLMPTISLLQAHYYNIKGVFTDDFPANPPLVFDYTGADQPDNLHTENGTR  430



>ref|XP_010044089.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86095.1| hypothetical protein EUGRSUZ_B02796 [Eucalyptus grandis]
Length=556

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/435 (70%), Positives = 364/435 (84%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW++   ++ L A I P  VE  VR+Y F VV KNTTR+CSSKPIV VNG FPGP+LY
Sbjct  1     MDSWLQ---ILVLVACITPAVVEGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+VRV N V+ NV+IHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREDDTVLVRVSNRVKYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGAIVILPKRGVPYPFPKP KE V+VLGEWWKSD EAVI+QA+
Sbjct  118   RGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVISQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP+ NC S+ G+TL VESGK Y+LRI++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPFKTDTI I PGQTTNA+++ DQ+ GKY++A SPFMD+ +A DN TA
Sbjct  238   QLTIVEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A TST L   PP+NAT V + F+  LRSLNSK++PA +PL  DHSLLF +
Sbjct  298   TATLHYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC +C   NGSR V  +NN++FVMPTTA+LQAH++N SGVFT DFPG P   FNY
Sbjct  358   GLGINPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTSDFPGNPPTIFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TG+PP+NL+T +GTK
Sbjct  418   TGSPPSNLRTTSGTK  432



>ref|XP_009358852.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=559

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/421 (72%), Positives = 356/421 (85%), Gaps = 5/421 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VES VRHY F VV +N T++CSSKPIV VNGKFPGP+LYAREDD V+V+V NHV+
Sbjct  15    VLPALVESRVRHYKFNVVLRNKTKLCSSKPIVTVNGKFPGPTLYAREDDNVLVKVTNHVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGWSDGPAYITQCPI  GQ+++YNFT+TGQRGTLLWHAHINW RAT
Sbjct  75    YNVSIHWHGIRQLRTGWSDGPAYITQCPIPPGQSYVYNFTITGQRGTLLWHAHINWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPKRGVPYPFP P KE  +VLGEWWKSD E VINQA++SG+APNVSDAHTING
Sbjct  135   VHGALVILPKRGVPYPFPAPHKEVNVVLGEWWKSDTETVINQALKSGIAPNVSDAHTING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG  PNCSS+ G+TL VESGKTYLLRI++AA+NEELFFK+AGHNLT+VEVDA+YVKPFK
Sbjct  195   HPGVVPNCSSEGGFTLPVESGKTYLLRIINAALNEELFFKIAGHNLTIVEVDATYVKPFK  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTNA++TA+QN GKY++A SPFMD+ +A DN TAT TLHY GT A T T 
Sbjct  255   TDTIVIAPGQTTNALVTANQNSGKYMMAASPFMDSPIAVDNLTATATLHYTGTLASTPTT  314

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L + PP+NAT V ++F+  L++LNS KFPA VPL+ DH+LLF +G+GINPC +C   NGS
Sbjct  315   LTSPPPQNATQVANSFINSLKALNSNKFPAKVPLKIDHNLLFTVGLGINPCPSCKAGNGS  374

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPAN--LQTQNGT  1334
             R V  +NN++FVMPTTALLQAH++N SGVFT DFPG P + FNY+G PPAN  L T NGT
Sbjct  375   RVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPMAFNYSGGPPANSSLATTNGT  434

Query  1335  K  1337
             +
Sbjct  435   R  435



>ref|XP_009624727.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/435 (68%), Positives = 354/435 (81%), Gaps = 5/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW+R  + + LAA + P  VE  +RHY F VV KNTTR+CSSKPIV VNGKFPGP++Y
Sbjct  1     MNSWIR--LFIVLAACLFPLVVECRIRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTIY  58

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE DTV+V+VVNHV+ N+SIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQ
Sbjct  59    AREGDTVLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQ  118

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPK GVPYPFPKP+ E V++L EWWKSD EAVIN+A+
Sbjct  119   RGTLFWHAHILWLRATVHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAI  178

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC+S+ GY L V+ GKTY+LR+++AA+NEELFFK+AGH
Sbjct  179   KSGLAPNVSDAHTINGHPGPVSNCASQGGYKLNVDPGKTYMLRVINAALNEELFFKIAGH  238

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+Y+KPFKTDTI I PGQTTN ++TA+Q  GKY++A SPFMD  +A DN TA
Sbjct  239   KMTVVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTA  298

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
               TLHY GTQ  +   L + PP+NATPV +TF++ LRSLNSKK+PA VP + DHSL F +
Sbjct  299   IATLHYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTV  358

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC TC   NGSR V  +NN++FVMPT ALLQAH++ I GVFT DFP  P   FNY
Sbjct  359   GLGINPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGIKGVFTTDFPANPPFAFNY  418

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P NL T NGTK
Sbjct  419   TGTGPTNLATMNGTK  433



>ref|XP_010044088.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86094.1| hypothetical protein EUGRSUZ_B02795 [Eucalyptus grandis]
Length=556

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/435 (70%), Positives = 362/435 (83%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW++   ++ L A I P  VE  VR+Y F VV KNTTR+CSSKPIV VNG FPGP+LY
Sbjct  1     MDSWLQ---ILVLVACITPAVVEGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+VRV N V+ NV+IHWHG+RQLR GW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREDDTVLVRVSNRVKYNVTIHWHGIRQLRMGWADGPAYITQCPIQPGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGAIVILPKRGVPYPFPKP KE V+VLGEWWKSD EAVINQA+
Sbjct  118   RGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAH INGHPGP+ NC S+ G+TL VESGK Y+LRI++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHMINGHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPFKTDTI I PGQTTNA+++ DQ+ GKY++A SPFMD+ +A DN TA
Sbjct  238   QLTIVEVDATYVKPFKTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A TST L   PP+NAT V + F+  LRSLNSK++PA +PL  DHSLLF +
Sbjct  298   TATLHYSGTLAATSTTLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC +C   NGSR V  +NN++FVMPTTA+LQAH++N SGVFT DFPG P   FNY
Sbjct  358   GLGINPCPSCKAGNGSRVVASMNNVTFVMPTTAILQAHFFNKSGVFTSDFPGNPPTIFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TG+PP+NL+T +GTK
Sbjct  418   TGSPPSNLRTTSGTK  432



>ref|XP_008388134.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/421 (72%), Positives = 355/421 (84%), Gaps = 5/421 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VES VRHY F VV +N T++CSSKPIV VNGKFPGP+LYAREDDTV+V+V NHV+
Sbjct  15    VLPALVESRVRHYKFNVVLRNKTKLCSSKPIVTVNGKFPGPTLYAREDDTVLVKVTNHVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPI TGQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  75    YNVSIHWHGIRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTLLWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPKRGVPYPFP P KE  +VLGEWWKSD E VINQA++SG+APNVSDAHTING
Sbjct  135   VHGALVILPKRGVPYPFPAPHKEVNVVLGEWWKSDTETVINQALKSGIAPNVSDAHTING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG  PNCSS+ G+TL VESGKTYLLRI++AA+NEELFFK+AGHNLT+VEVDA+YVKPFK
Sbjct  195   HPGVVPNCSSQGGFTLPVESGKTYLLRIINAALNEELFFKIAGHNLTIVEVDATYVKPFK  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTNA++TA+QN GKY++A SPFMD+ +A DN TAT TLHY GT A T T 
Sbjct  255   TDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATATLHYTGTLASTPTT  314

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L + PP+NAT V ++F+  L++LNS  FPA VPL+ DH+LLF +G+GINPC +C   NGS
Sbjct  315   LTSPPPQNATQVANSFINSLKALNSNNFPAKVPLKIDHNLLFTVGLGINPCPSCKAGNGS  374

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPAN--LQTQNGT  1334
             R VG +NN+SFVMPTTALLQAH +N SGVFT DFPG P   FNY+G PPAN  L T NGT
Sbjct  375   RVVGSVNNVSFVMPTTALLQAHVFNKSGVFTTDFPGNPPTAFNYSGGPPANASLATTNGT  434

Query  1335  K  1337
             K
Sbjct  435   K  435



>ref|XP_010044090.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044092.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044093.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86096.1| hypothetical protein EUGRSUZ_B02797 [Eucalyptus grandis]
 gb|KCW86097.1| hypothetical protein EUGRSUZ_B02798 [Eucalyptus grandis]
 gb|KCW86098.1| hypothetical protein EUGRSUZ_B02799 [Eucalyptus grandis]
Length=556

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/435 (71%), Positives = 361/435 (83%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW++   ++ L A I P  V+  VR+Y F VV KNTTR+CSSKPIV VNG FPGP+LY
Sbjct  1     MDSWLQ---ILVLVACITPAVVQGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+VRV N V+ NV+IHWHG+RQLR+GW+DGPAYITQCPIQ GQ+++YNFT+TGQ
Sbjct  58    AREDDTVLVRVSNRVKYNVTIHWHGIRQLRSGWADGPAYITQCPIQPGQSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGAIVILPKRGVPYPFPKP KE V+VLGEWWKSD EAVI QA+
Sbjct  118   RGTLLWHAHILWLRATLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVIKQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC S+ G+TL VESGK Y+LRIV+AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPISNCPSQGGFTLPVESGKRYMLRIVNAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPFKTDTI I PGQTTNA+++ADQ+ GKYL+A SPFMD+ +  DN TA
Sbjct  238   QLTIVEVDATYVKPFKTDTIVIAPGQTTNALISADQSSGKYLVAASPFMDSPITVDNMTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A TST L   PP+NAT V + F+  LRSLNSK +PA VPL  DH+LLF +
Sbjct  298   TATLHYSGTLAATSTTLTKTPPQNATAVANNFINSLRSLNSKIYPAKVPLTVDHNLLFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC +C   NGSR V  +NN++FVMPTTALLQAH++NISGVFT DFPG P   FNY
Sbjct  358   GLGINPCPSCKAGNGSRVVASMNNVTFVMPTTALLQAHFFNISGVFTSDFPGNPPTTFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TG+PP NL+T +GTK
Sbjct  418   TGSPPTNLRTTSGTK  432



>ref|XP_008785423.1| PREDICTED: laccase-22 [Phoenix dactylifera]
Length=554

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/433 (68%), Positives = 353/433 (82%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M S++R +VL A    + P  V+   RHY F VV KN TR+CS+KPIV VNG+FPGP+LY
Sbjct  1     MLSFIRALVLAAC---LLPVLVDGRTRHYKFNVVMKNATRLCSTKPIVTVNGRFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE D V+V+VVNHV+ NV+IHWHGVRQLRTGW+DGPAYITQCPIQ G +++YNFT+TGQ
Sbjct  58    AREGDNVLVKVVNHVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGSSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W R TVHGAIVILPK  VPYPFP P KEEVI+LGEWWKSD EAVINQA+
Sbjct  118   RGTLFWHAHILWLRVTVHGAIVILPKLHVPYPFPTPHKEEVIILGEWWKSDTEAVINQAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP   C +SKG+ L+V+SG+TY+LRIV+AA+NEELFF+VAGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPMSACPASKGFQLKVDSGRTYMLRIVNAALNEELFFRVAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+Y KPFKTDTI I PGQTTN +LTADQ  G+YL+  SPFMD+ +A DNQTA
Sbjct  238   QMTVVEVDATYTKPFKTDTILITPGQTTNVLLTADQGAGRYLVTASPFMDSPIAVDNQTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
                +HY  T A ++      PP+NATPV S F++ LRSLNSK++PA VP   DHSLLF +
Sbjct  298   MAVVHYTNTVAASALTAIKPPPQNATPVASNFIDSLRSLNSKQYPARVPSTVDHSLLFTV  357

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC TC+NGSR V D+NN+SF MPTTA+LQAHY+N+SGVFTDDFPG+P I FNYTG
Sbjct  358   GLGVNPCPTCVNGSRVVADMNNVSFTMPTTAILQAHYFNVSGVFTDDFPGKPPIAFNYTG  417

Query  1299  TPPANLQTQNGTK  1337
             + P NL T  GT+
Sbjct  418   SGPRNLGTMTGTR  430



>ref|XP_008392913.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 347/417 (83%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VES++RHY F+VV K+TT +CSSKPIV VNGKFPGP+LYAREDDTVIV+V NHV+
Sbjct  18    LYPAFVESLIRHYEFSVVYKDTTNLCSSKPIVTVNGKFPGPTLYAREDDTVIVKVTNHVK  77

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGV+Q  TGWSDGPAYITQCPIQ G+ +IYNFTLTGQRGTLLWHAH +W RAT
Sbjct  78    YNVTIHWHGVKQRGTGWSDGPAYITQCPIQPGRNYIYNFTLTGQRGTLLWHAHDSWLRAT  137

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVILPKRG PYPFP PD+E++I++ EWWKSDVE VINQA QSG+ PNVSDAHTING
Sbjct  138   LHGAIVILPKRGTPYPFPTPDEEKIIIMAEWWKSDVEDVINQATQSGLPPNVSDAHTING  197

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
               GP P CSS+ GYTL VES KTY+LRIV+AA+N+ELFFKVAGH+LTVVEVDASY KPF+
Sbjct  198   RVGPLPGCSSQGGYTLHVESDKTYMLRIVNAALNDELFFKVAGHSLTVVEVDASYTKPFQ  257

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI+ GPGQTTNA+LTA+Q  GKY I  SPFMD  +  DN T   TL YKGT A  + +
Sbjct  258   TDTIYTGPGQTTNAILTANQGIGKYFITASPFMDAPIGFDNATVIATLRYKGTPANPTAI  317

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PPRNATP+T  F++ LRSLNSK++PA+VPL  DHSL F I +G NPC+TC++GS+ 
Sbjct  318   LTSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVGANPCATCVSGSKL  377

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V   NN+SFVMP+ +LLQA+YYN+ GV+T DFP  P IPFNYTGT PANLQT NGT+
Sbjct  378   VSAFNNVSFVMPSISLLQAYYYNVKGVYTLDFPANPPIPFNYTGTSPANLQTTNGTR  434



>ref|XP_011094977.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=558

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/437 (69%), Positives = 349/437 (80%), Gaps = 8/437 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  WVR   +  L A + P  V+  VRHY F VV KNTTR+CS+K IV VNGKFPGP++Y
Sbjct  1     MELWVR---VFILVACLLPAVVQCKVRHYQFNVVMKNTTRLCSTKSIVTVNGKFPGPTIY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV++RV+N V+ NVSIHWHGVRQLRTGW+DGPAYITQCPIQ G +++YNFT+TGQ
Sbjct  58    AREDDTVLIRVINRVKYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGHSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RAT+HGA+VILPK GVPYPFPKPD E V+VLGEWWKSD EAVIN+A+
Sbjct  118   RGTLLWHAHILWLRATLHGALVILPKLGVPYPFPKPDHEAVVVLGEWWKSDTEAVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK--GYTLEVESGKTYLLRIVSAAVNEELFFKVAG  755
             +SG+APNVSDAHTINGHPGP  NC S   G+TL V  GKTY+LR+++AA+NEELFFK+AG
Sbjct  178   KSGLAPNVSDAHTINGHPGPVSNCPSTGGGFTLNVSPGKTYMLRLINAALNEELFFKIAG  237

Query  756   HNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQ  932
             H LTVVEVDA+YVKPFKTDT+ I PGQTTN ++ ADQ  GKY++A SPF+DT IVA DN 
Sbjct  238   HKLTVVEVDATYVKPFKTDTVLIAPGQTTNVIVVADQGAGKYMLAASPFLDTPIVAVDNM  297

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
             TAT TLHY GT A + T   + P RNATPV + F+  LRSLNSKK+PA VP + DHSL F
Sbjct  298   TATATLHYSGTLASSPTTFTSTPARNATPVANNFVNSLRSLNSKKYPAKVPQKVDHSLFF  357

Query  1113  AIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPF  1286
              +G+GINPC +C   NGSRAV  INN++FVMPT ALLQAH   I GVFT DFP  P   F
Sbjct  358   TVGLGINPCPSCKAGNGSRAVASINNVTFVMPTIALLQAHVLKIKGVFTTDFPANPPFAF  417

Query  1287  NYTGTPPANLQTQNGTK  1337
             NYTGTPPANL T  GTK
Sbjct  418   NYTGTPPANLATTTGTK  434



>ref|XP_002322962.2| laccase family protein [Populus trichocarpa]
 gb|EEF04723.2| laccase family protein [Populus trichocarpa]
Length=564

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/440 (69%), Positives = 358/440 (81%), Gaps = 6/440 (1%)
 Frame = +3

Query  27    QRTRIMASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFP  206
             +  ++  SW R    + LA  + P  VE  VRHY F VV KNTTR+CSSKP+V VNG+FP
Sbjct  4     KSAKMEYSWFR---FMLLAVSLFPALVECRVRHYKFNVVMKNTTRLCSSKPVVTVNGRFP  60

Query  207   GPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNF  386
             GP+LYAREDDTV+V+VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQTGQ+++YNF
Sbjct  61    GPTLYAREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNF  120

Query  387   TLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAV  566
             T+TGQRGTLLWHAHI W RATVHGAIV+LPKRGVPYPFP P KE V+VL EWWKSD EAV
Sbjct  121   TITGQRGTLLWHAHILWLRATVHGAIVVLPKRGVPYPFPAPHKEFVVVLAEWWKSDTEAV  180

Query  567   INQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFF  743
             IN+A++SG+APNVSDAHTINGHPG    C S+ G+TL VESGKTY+LR+++AA+NEELFF
Sbjct  181   INEALKSGLAPNVSDAHTINGHPGAVSACPSQGGFTLPVESGKTYMLRLINAALNEELFF  240

Query  744   KVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVAT  923
             K+AGH LT+VEVDA+YVKPFKTDT+ I PGQTTN ++T ++N GKYL+A SPFMD  +A 
Sbjct  241   KIAGHKLTLVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAV  300

Query  924   DNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHS  1103
             DN TAT TLHY G  + T T L   PP+NAT V + F   LRSLNSK+FPA VPL  DH+
Sbjct  301   DNMTATATLHYSGALSGTPTTLTIPPPKNATAVANQFTNSLRSLNSKRFPAKVPLTVDHN  360

Query  1104  LLFAIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPA  1277
             L F +G+GINPC TC   NGSR V  INN++FVMPTTALLQAH++NISGVFT DFP +P 
Sbjct  361   LFFTVGLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPSKPP  420

Query  1278  IPFNYTGTPPANLQTQNGTK  1337
               FNYTGTPP NLQT +GTK
Sbjct  421   HVFNYTGTPPTNLQTTSGTK  440



>ref|XP_006425016.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
 ref|XP_006488481.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR38256.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
Length=557

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/418 (70%), Positives = 345/418 (83%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+ +VR Y F VV KN TR+CS+KPIV VNG FPGP++ AREDDTV+V+VVNHV+
Sbjct  16    LFPASVQCMVREYKFNVVMKNATRLCSTKPIVTVNGYFPGPTIVAREDDTVLVKVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRT W+DGPAYITQCPIQ GQ +IYNFTL GQRGTL WHAHI W RAT
Sbjct  76    YNVSIHWHGVRQLRTCWADGPAYITQCPIQPGQNYIYNFTLAGQRGTLWWHAHILWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKP KE  ++L EWWKSDVEAVIN+A++SG+APNVSDAHTING
Sbjct  136   VHGAIVILPKRGVPYPFPKPHKEVTVILSEWWKSDVEAVINEALKSGLAPNVSDAHTING  195

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP  +C S+ G+ L VESGKTY+LR+++AA+NEELFFK+AGH LTVVEVDA+YVKPF 
Sbjct  196   HPGPLSSCPSQGGFKLPVESGKTYMLRLINAALNEELFFKIAGHKLTVVEVDAAYVKPFN  255

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTST  983
             T+T+ I PGQTTN +L+A    GKYL+A SPF+DT  +  DN+TAT T+HY GT   T+T
Sbjct  256   TETVLIAPGQTTNVLLSAAHATGKYLVAASPFLDTPAILVDNKTATATVHYSGTLGSTAT  315

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSR  1163
              L   PPRNATPV + F   LRSLNSKK+PA VPL+ DHSL F IG+GINPC+TC+NGSR
Sbjct  316   TLTVPPPRNATPVAANFTASLRSLNSKKYPARVPLKIDHSLFFTIGLGINPCATCVNGSR  375

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V DINN++FVMPT +LLQAH++ I GVFTDDFPG P + +N+TGT PAN QT NGT+
Sbjct  376   VVADINNVTFVMPTISLLQAHFFKIGGVFTDDFPGNPPVTYNFTGTQPANFQTNNGTR  433



>ref|XP_003544123.1| PREDICTED: laccase-4-like [Glycine max]
Length=554

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/412 (70%), Positives = 347/412 (84%), Gaps = 1/412 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V+S+VRHY F+VV KNTT++CS+K  V VNG+ PGP+LYAREDDTVIV+V NHV+ N++I
Sbjct  19    VQSLVRHYKFSVVLKNTTKLCSTKSFVTVNGQCPGPTLYAREDDTVIVKVTNHVKYNITI  78

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG++QLRTGWSDGPAY+TQCPIQ GQ+++YNFT+ GQRGTLLWHAHI W RATV+G I
Sbjct  79    HWHGIKQLRTGWSDGPAYVTQCPIQPGQSYVYNFTINGQRGTLLWHAHITWLRATVYGGI  138

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPKRG+ YPFPKPDKE++I+LGEWWKSDVEA++NQA  SG+ PN+SDAHTINGH GP 
Sbjct  139   VILPKRGISYPFPKPDKEKIIILGEWWKSDVEAILNQAENSGLPPNISDAHTINGHTGPI  198

Query  645   PNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
             P C+S+GYTL VESGKTYLLRI++AA+N+ELFFK+AGH LTVVE DASYVKPF+TDTIF+
Sbjct  199   PGCTSQGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEADASYVKPFETDTIFM  258

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTTN +LTA+Q  GKYLIAV+PFMD  +  DN T+  TL YKGT     T L T+P 
Sbjct  259   SPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTSIATLRYKGTPPYPKTTLTTIPA  318

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
              NATP+TS F++ LRSLNSK++PA  PL  DHSL F+I +G+NPC TCL G+R V  INN
Sbjct  319   LNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSITVGLNPCHTCLTGARLVSAINN  378

Query  1185  ISFVMP-TTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             I+F+MP TT+LL+AHYYNI GVFTDDFP  P I FNYTGT PAN+QT NGT+
Sbjct  379   ITFLMPTTTSLLEAHYYNIKGVFTDDFPSFPPIAFNYTGTQPANIQTNNGTR  430



>ref|XP_002322961.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
 gb|EEF04722.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
Length=557

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/433 (69%), Positives = 351/433 (81%), Gaps = 6/433 (1%)
 Frame = +3

Query  48    SWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAR  227
             SW R    + LA  + P  VE  +RHY F VV KNTTR+CSSKPIV VNG FPGP+LYAR
Sbjct  4     SWFR---FMLLAVCLFPAVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGLFPGPTLYAR  60

Query  228   EDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRG  407
             EDDTV+V+VVN V+ N+SIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRG
Sbjct  61    EDDTVLVKVVNRVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRG  120

Query  408   TLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQS  587
             TLLWHAHI W RATVHGA+V+LPK GVPYPFP P KE V+VL EWWKSD EAVIN+A++S
Sbjct  121   TLLWHAHILWLRATVHGALVVLPKLGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKS  180

Query  588   GMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNL  764
             G+APNVSDAHTINGHPG    CSS+ G+TL V+SGKTY+LR+++AA+NEELFFK+AGH L
Sbjct  181   GLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVQSGKTYMLRLINAALNEELFFKIAGHKL  240

Query  765   TVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATG  944
             TVVEVDA+YVKPFKTDT+ I PGQTTN ++T ++N GKYL+A SPFMD  +A DN TAT 
Sbjct  241   TVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATA  300

Query  945   TLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGI  1124
             TLHY G  + + T L   PP+NAT + + F   LRSLNSK FPA VPL  DHSL F +G+
Sbjct  301   TLHYSGALSNSPTTLTIPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGL  360

Query  1125  GINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             GINPC TC   NGSR V  INN++FVMPTTALLQAH++NISGVFT DFP +P   FNYTG
Sbjct  361   GINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTG  420

Query  1299  TPPANLQTQNGTK  1337
             TPP NLQT +GTK
Sbjct  421   TPPTNLQTTSGTK  433



>ref|XP_003616564.1| Laccase [Medicago truncatula]
Length=675

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/415 (70%), Positives = 345/415 (83%), Gaps = 1/415 (0%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V+S+VRHYNF+VV KN T++CS+K  V VNGKFPGP+LYAREDDT+IVRV N VQ N
Sbjct  137   PLFVQSLVRHYNFSVVLKNETKLCSTKSFVSVNGKFPGPTLYAREDDTLIVRVTNLVQHN  196

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             V+IHWHG++QLRT WSDGPAY+TQCPIQTGQ+F+YNFT+TGQRGTLLWHAHI W RAT+H
Sbjct  197   VTIHWHGIKQLRTCWSDGPAYVTQCPIQTGQSFVYNFTITGQRGTLLWHAHITWLRATMH  256

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKRG PYPFPKPDKE++I+LGEWWKSDVEAV+NQA  SGM PN+SDAHTINGHP
Sbjct  257   GAIVILPKRGTPYPFPKPDKEKIIILGEWWKSDVEAVVNQATSSGMPPNISDAHTINGHP  316

Query  636   GPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             GP P C S+GYTL VESGKTYLLRI++AA+N+ELFFK+AGH L VVE DASY+KPF+ DT
Sbjct  317   GPVPGCISQGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLIVVEADASYLKPFEIDT  376

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             IF+ PGQTTN +LTA+Q  GKYLIA++PFMD  +  DN ++  TL YKG    T T+L  
Sbjct  377   IFLSPGQTTNVLLTANQPIGKYLIAITPFMDAPIGFDNLSSIATLRYKGIPPYTKTILTN  436

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +PP NATP+T TF + LRSLNSK +P  V L  DHSLLFAI +G+NPC TC+  ++ V  
Sbjct  437   IPPLNATPITKTFTDSLRSLNSKTYPTRVSLTIDHSLLFAITVGLNPCDTCITDNKLVSA  496

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             INNI+F+MPT +LLQA+YYNI GVFTDDFP +P + F+YTGT  PANL T NGTK
Sbjct  497   INNITFLMPTVSLLQANYYNIKGVFTDDFPSKPPMVFDYTGTDQPANLHTDNGTK  551



>ref|XP_004500229.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=556

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/417 (69%), Positives = 345/417 (83%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P   E++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDD V+++VVNHV+
Sbjct  16    LLPLYAEAIVRHYKFNVVMKNATRLCSTKPIVTVNGKFPGPTIYAREDDNVLIKVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGV+QLRTGW+DGPAYITQCPIQ+GQT++YNFTLTGQRGTL WHAH+ W RAT
Sbjct  76    YNVSIHWHGVKQLRTGWADGPAYITQCPIQSGQTYLYNFTLTGQRGTLWWHAHVLWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFPKP  E+VIVLGEWWKSD EA+IN+A++SG+APN+SDAHTING
Sbjct  136   VHGALVILPKLGVPYPFPKPHMEQVIVLGEWWKSDTEAIINEALKSGLAPNISDAHTING  195

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP   CS + G++LEVE   TYLLRIV+AA+NEELFFKVA H LTVVEVDA+YVKPF+
Sbjct  196   HPGPIQGCSPQGGFSLEVEPKNTYLLRIVNAALNEELFFKVASHQLTVVEVDATYVKPFQ  255

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTN +LTA    GKYL+A SPFMD  +  DN+TAT T+HY GT   T T 
Sbjct  256   TDTIVIAPGQTTNVLLTAKHTTGKYLVAASPFMDAPIVVDNKTATATIHYSGTLGSTITT  315

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PP+NATP+ +TF + LRSLNSKK+PA VPL+ DH+LLF + +GINPC TC+N SR 
Sbjct  316   LTSLPPKNATPLATTFTDSLRSLNSKKYPAKVPLKIDHNLLFTVSLGINPCPTCVNNSRV  375

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V  INN++FVMP  ALLQAH++NI GVF++DFPG P I +N+TGT P N  T  GT+
Sbjct  376   VAAINNVTFVMPKIALLQAHFFNIKGVFSEDFPGNPPIVYNFTGTQPTNFGTTKGTR  432



>gb|AAC49536.1| diphenol oxidase [Nicotiana tabacum]
Length=557

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/435 (68%), Positives = 352/435 (81%), Gaps = 5/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW+R  + + LAA + P  VE  +RHY F VV KNTTR+CSSKPIV VNGKFPGP++Y
Sbjct  1     MNSWIR--LFIVLAACLFPLVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTIY  58

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE DTV+V+VVNHV+ N+SIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQ
Sbjct  59    AREGDTVLVKVVNHVKYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQ  118

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILP  GVPYPFPKP+ E V++L EWWKSD EAVIN+A+
Sbjct  119   RGTLFWHAHILWLRATVHGAIVILPNLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAI  178

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC+S+ GY L V+ GKTY+LR+++AA+NEELFFK+AGH
Sbjct  179   KSGLAPNVSDAHTINGHPGPVSNCASQGGYKLNVDPGKTYMLRVINAALNEELFFKIAGH  238

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+Y+KPFKTDTI I PGQTTN ++TA+Q  GKY++A SPFMD  +A DN TA
Sbjct  239   KMTVVEVDATYIKPFKTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTA  298

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
               TLHY GTQ  +   L + PP+NATPV +TF++ LRSLNSKK+PA VP + DHSL F +
Sbjct  299   IATLHYSGTQGNSHISLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTV  358

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC TC   NGSR V  +NN++FVMPT ALLQAH++   GVFT DFP  P   FNY
Sbjct  359   GLGINPCPTCKQGNGSRVVASVNNVTFVMPTVALLQAHFFGTKGVFTTDFPANPPFAFNY  418

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P NL T NGTK
Sbjct  419   TGTGPTNLATMNGTK  433



>ref|XP_002530417.1| laccase, putative [Ricinus communis]
 gb|EEF31987.1| laccase, putative [Ricinus communis]
Length=554

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/416 (72%), Positives = 344/416 (83%), Gaps = 0/416 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VES VRHYNFTV + NTT++CSSK IV VNGKFPGP+L+AREDD V VRV+N+VQ
Sbjct  15    LFPALVESTVRHYNFTVATTNTTKLCSSKSIVTVNGKFPGPTLFAREDDNVNVRVINNVQ  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQL TGW+DGPAYITQCPIQ GQ+++YNFTLTGQRGTLLWHAHI+W R T
Sbjct  75    YNVTIHWHGVRQLLTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRTT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK+GVPYPFPKP+KE++IVLGEWWK+D EAVI QAMQ+G+APN+SD+HTING
Sbjct  135   VHGAIVILPKKGVPYPFPKPNKEKLIVLGEWWKTDTEAVIKQAMQTGLAPNISDSHTING  194

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             H GP P C+S GYTL VE GKTYL+R+V+AAVN+ELFFK+AGHNLTVVEVDA Y KPF T
Sbjct  195   HTGPVPGCTSPGYTLHVERGKTYLIRLVNAAVNDELFFKIAGHNLTVVEVDACYTKPFNT  254

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             D +F+GPGQTT+ +LTADQ  GKYLIAVSPFMDTIVA DN T    L YK T   +  VL
Sbjct  255   DIVFVGPGQTTSFLLTADQPTGKYLIAVSPFMDTIVAVDNATGIAFLRYKDTVKFSPPVL  314

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P  NAT  TS F++ LRSLNSK++P NVPL  DHSL F IG+GIN C TC+NGSRAV
Sbjct  315   TTTPAINATSETSIFLDKLRSLNSKRYPCNVPLTVDHSLYFTIGVGINSCPTCVNGSRAV  374

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             GDINN+SFVMPT  LL+AHYYNISGVFTDDFP  P  PFNYTG       T NGT+
Sbjct  375   GDINNVSFVMPTMDLLEAHYYNISGVFTDDFPANPPTPFNYTGNYTGGFATSNGTR  430



>ref|XP_008239590.1| PREDICTED: laccase-4-like [Prunus mume]
Length=559

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/437 (71%), Positives = 359/437 (82%), Gaps = 7/437 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  WVR   LV   A + P  VES +RHY F VV KNTTR+CS+KPIV +NG+FPGP+LY
Sbjct  1     MELWVR--FLVLFLACLLPGLVESRIRHYKFNVVLKNTTRLCSTKPIVTINGRFPGPTLY  58

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+V NHV+ NVSIHWHGVRQLRTGW+DGPAYITQCPI  GQ+++YNFT+TGQ
Sbjct  59    AREDDTVLVKVTNHVKYNVSIHWHGVRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQ  118

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGA+VILPKRGVPYPFP P KE  ++L EWWKSD EAVINQA+
Sbjct  119   RGTLLWHAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVILAEWWKSDTEAVINQAL  178

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
              SG+APNVSDAH INGHPGP  NCSS+ G+TL VE+GKTYLLRI++AA+NEELFFK+AGH
Sbjct  179   SSGIAPNVSDAHIINGHPGPVANCSSEGGFTLPVENGKTYLLRIINAALNEELFFKIAGH  238

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPFKTDTI I PGQTTNA++TA+QN GKYL+A SPFMD+ +A DN TA
Sbjct  239   KLTIVEVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTA  298

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A T T L   PP+NAT V + F+  L+SLNSKKFPA VPL+ DH+LLF +
Sbjct  299   TATLHYSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKVDHNLLFTV  358

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC TC   NGSR V  +NN++FVMPTTALLQAH +NISGVFT DFPG P   FN+
Sbjct  359   GLGINPCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTTDFPGNPPNTFNF  418

Query  1293  TGTPPAN--LQTQNGTK  1337
             +G PPAN  + T NGTK
Sbjct  419   SGGPPANASMATTNGTK  435



>ref|XP_011003662.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=557

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/419 (70%), Positives = 344/419 (82%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  +RHY F VV KNTTR+CSSKPIV VNG FPGP+LYAREDDTV+V+VVN V+
Sbjct  15    LFPALVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGLFPGPTLYAREDDTVLVKVVNRVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHG+RQLRTGW+DGPA ITQCPIQTGQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  75    YNLSIHWHGIRQLRTGWADGPANITQCPIQTGQSYVYNFTITGQRGTLLWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIV+LPK GVPYPFP P KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  135   VHGAIVVLPKLGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG    CSS+ G+TL V+SGKTY+LR+++AA+NEELFFK+AGH LT+VEVDA+YVKPFK
Sbjct  195   HPGAVSTCSSQGGFTLPVQSGKTYMLRLINAALNEELFFKIAGHKLTLVEVDATYVKPFK  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             T T+ I PGQTTN ++T ++N GKYL+A SPFMD  +A DN TAT TLHY G  + + T 
Sbjct  255   TSTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLHYSGALSNSPTT  314

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L   PP+NAT + + F   LRSLNSK FPA VPL  DHSL F +G+GINPC TC   NGS
Sbjct  315   LTVPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGLGINPCPTCKAGNGS  374

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++FVMPTTALLQAH++NISGVFT DFP +P   FNYTGTPP NLQT +GTK
Sbjct  375   RVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTGTPPTNLQTTSGTK  433



>ref|XP_010553253.1| PREDICTED: laccase-4 [Tarenaya hassleriana]
Length=559

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/419 (69%), Positives = 346/419 (83%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P   E +VRHY F +V KNTTR+CSSKPIV VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VYPSLTEGLVRHYKFNIVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ ++YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVYVYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPKRGVPYPFPKPD E+ IVL EWWKSD E VIN+A++SG+APNVSDAHTING
Sbjct  137   VHGALVILPKRGVPYPFPKPDHEKAIVLSEWWKSDTENVINEALKSGLAPNVSDAHTING  196

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP  +C SS GY L VE G+TYLLR+V+AA+NEELFFKVAGH+LTVVEVDA YVKPFK
Sbjct  197   HSGPVKSCPSSMGYKLSVERGETYLLRLVNAALNEELFFKVAGHSLTVVEVDALYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDT+ I PGQTTN +LTA ++ GKYL+ VSPFMD  +A DN TAT T+HY GT + ++TV
Sbjct  257   TDTVLIAPGQTTNVLLTASKSAGKYLVTVSPFMDAPIAVDNVTATATVHYSGTLSSSATV  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGS  1160
             L   PP+N+T +++ F   LRSLNSKK+PA VP + DH L F +G+G+NPC TC   NGS
Sbjct  317   LTLPPPQNSTAISNNFTNSLRSLNSKKYPALVPKEVDHHLFFTVGLGVNPCPTCKAANGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++F MPTTALLQAHY+NISGVFT DFP  P   +NYTG+PPANL T+ GT+
Sbjct  377   RVVASINNVTFTMPTTALLQAHYFNISGVFTTDFPKNPPHVYNYTGSPPANLATEKGTR  435



>ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis]
 gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis]
Length=558

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/437 (69%), Positives = 349/437 (80%), Gaps = 8/437 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEP--VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPS  215
             M SWVR   L  +   IC  P  VE  VR+Y F VV+ NTTR+CSSKPIV +NGKFPGP+
Sbjct  1     MDSWVR---LFLIVVAICFSPAFVECRVRNYKFNVVTTNTTRLCSSKPIVTINGKFPGPT  57

Query  216   LYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLT  395
             LYAREDDTV+V+VVN V+ NV+IHWHGVRQLRTGW+DGPAYITQCPI  GQ+++YNFT+T
Sbjct  58    LYAREDDTVLVKVVNRVKYNVTIHWHGVRQLRTGWADGPAYITQCPIPPGQSYVYNFTIT  117

Query  396   GQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQ  575
             GQRGTLLWHAHI W RAT+HGA+VILPK GVPYPFP P KE V+VL EWWKSD E VIN+
Sbjct  118   GQRGTLLWHAHILWLRATIHGALVILPKLGVPYPFPAPHKEVVVVLAEWWKSDTENVINE  177

Query  576   AMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVA  752
             AM+SG+APNVSDAHTING PGP  NC+S+ G+TL V++GKTYLLRI++AA+NEELFFK+A
Sbjct  178   AMKSGLAPNVSDAHTINGRPGPVSNCTSEGGFTLPVQTGKTYLLRIINAALNEELFFKIA  237

Query  753   GHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQ  932
             GH LTVVEVDA+YVKPF  DTI I PGQTTNA++TADQN GKYL+A SPFMD  +A DN 
Sbjct  238   GHKLTVVEVDATYVKPFSIDTIVIAPGQTTNALITADQNSGKYLVAASPFMDAPIAVDNA  297

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
             TAT TLHY GT A  +T L   PP+NAT V + F  GL+SLNS  FPA VPL  DH+L F
Sbjct  298   TATATLHYAGTLANAATTLTVPPPQNATQVANKFTNGLKSLNSNTFPAKVPLSVDHNLFF  357

Query  1113  AIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPF  1286
              + +GINPC TC   NGSR V  INN++FVMPTTALLQAHY+   GVFT DFP  P   F
Sbjct  358   TVSLGINPCPTCKAGNGSRVVASINNVTFVMPTTALLQAHYFKTKGVFTTDFPANPPNVF  417

Query  1287  NYTGTPPANLQTQNGTK  1337
             NY+GTPPA+L T NGTK
Sbjct  418   NYSGTPPASLATTNGTK  434



>ref|XP_002533894.1| laccase, putative [Ricinus communis]
 gb|EEF28494.1| laccase, putative [Ricinus communis]
Length=556

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 345/417 (83%), Gaps = 3/417 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V+  VR YNF VV+K +T++CSSKPIV VNGKFPGP+LYAREDDTV+VRVVN V+ N
Sbjct  16    PVFVDCRVRRYNFNVVTKTSTKLCSSKPIVTVNGKFPGPTLYAREDDTVLVRVVNKVKYN  75

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ ++YNFTLTGQRGTLLWHAHI W R+TVH
Sbjct  76    VSIHWHGVRQLRTGWADGPAYITQCPIQPGQNYVYNFTLTGQRGTLLWHAHILWLRSTVH  135

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKRGVPYPFPKP KEEV++L EWWKSD EAVIN+AM+SG+APNVSDAHTINGHP
Sbjct  136   GAIVILPKRGVPYPFPKPHKEEVVILAEWWKSDTEAVINEAMKSGLAPNVSDAHTINGHP  195

Query  636   GPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+ G+ L VESGK YLLR+++AA+NEELFFK+AGH LTVVE+DA YVKP KTD
Sbjct  196   GAVPNCPSQSGFRLPVESGKAYLLRLINAALNEELFFKIAGHQLTVVEIDACYVKPLKTD  255

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLA  992
             T+ + PGQTTN ++TA++N GKYL+  SPFMD  VA DN+TAT TLHY GT A   T +A
Sbjct  256   TVLLAPGQTTNVLVTANKNSGKYLVTASPFMDAPVAVDNRTATATLHYSGTLASAPTTVA  315

Query  993   TMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGSRA  1166
             T PP+NA+ V + F+  LRSLNS+K+PA VPL+ DH+LLF +G+GIN C +C   NGSR 
Sbjct  316   TPPPQNASAVANNFINSLRSLNSQKYPARVPLKVDHNLLFTVGLGINACPSCKAANGSRV  375

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V  INN++FVMPTTALLQAH++ ISGVFT DFP +P   FN+TG+ P NL T   TK
Sbjct  376   VASINNVTFVMPTTALLQAHFFKISGVFTTDFPSKPPHVFNFTGSGPKNLNTVRATK  432



>ref|XP_004147923.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004165325.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN54357.1| hypothetical protein Csa_4G308480 [Cucumis sativus]
Length=556

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/419 (72%), Positives = 350/419 (84%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VRHY F VV KNTT++CSSK IV VNGKFPGP++YAREDDTV++ VVNHVQ
Sbjct  14    IFPALVECRVRHYKFDVVLKNTTKLCSSKQIVTVNGKFPGPTIYAREDDTVLINVVNHVQ  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHGVRQLRTGW+DGPAYITQCPI +GQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  74    YNLSIHWHGVRQLRTGWADGPAYITQCPIPSGQSYLYNFTVTGQRGTLLWHAHILWLRAT  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFP P+KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  134   VHGALVILPKLGVPYPFPAPNKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  193

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP  NCS++ G+TL V+SG TYLLRI++AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  194   HSGPISNCSTQGGFTLPVKSGHTYLLRIINAALNEELFFKIAGHKLTVVEVDATYVKPFK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTNA++TADQ  GKYL+A SPFMD+ +A DN TAT TLHY GT A T+  
Sbjct  254   TDTILIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATATLHYAGTLATTAAT  313

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L   PP+NATPV + F++ LRSLNS  +PA VPL  DH+L F +G+GINPC TC   NGS
Sbjct  314   LTAPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLGINPCPTCKAGNGS  373

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             RAV  INN++FVMPTTALLQAHY+NI+GVFT DFP  P   FNYTG+ P+NLQT  GTK
Sbjct  374   RAVASINNVTFVMPTTALLQAHYFNINGVFTTDFPANPPHVFNYTGSGPSNLQTTRGTK  432



>ref|XP_010923124.1| PREDICTED: laccase-22 [Elaeis guineensis]
Length=554

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/417 (69%), Positives = 343/417 (82%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+   RHY F VV KN TR+CS+KPIV VNG+FPGP+LYARE D V+V+VVNHV+
Sbjct  14    LLPVVVDGRTRHYKFNVVMKNATRLCSTKPIVTVNGRFPGPTLYAREGDNVLVKVVNHVK  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQLRTGW+DGPAYITQCPIQ G  ++YNFT+TGQRGTL WHAHI W R T
Sbjct  74    YNVTIHWHGVRQLRTGWADGPAYITQCPIQPGNNYVYNFTITGQRGTLFWHAHILWLRVT  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK  VPYPFP P KEEVI+LGEWWKSD EAVIN+A++SG+APNVSDAH ING
Sbjct  134   VHGAIVILPKLHVPYPFPTPHKEEVIILGEWWKSDTEAVINEALKSGLAPNVSDAHVING  193

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP   C +SKG+ L+V+SGKTY+LRI++AA+NEELFFKVAGH LTVVEVDA+Y KPFK
Sbjct  194   HPGPMSTCPASKGFQLKVDSGKTYMLRIINAALNEELFFKVAGHQLTVVEVDATYTKPFK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTN +LTAD+  G+YL+  SPFMD+ +A DNQTA  T+HY  T + T   
Sbjct  254   TDTILITPGQTTNVLLTADRGAGRYLVTASPFMDSPIAVDNQTAMATVHYTNTVSTTVLT  313

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
                 PP+NATPV S F++ LRSLNSKK+PA VPL  DHSLLF +G+G+NPC TC+NGSR 
Sbjct  314   TTKPPPQNATPVASNFIDSLRSLNSKKYPARVPLTVDHSLLFTVGLGVNPCPTCVNGSRV  373

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V D+NN++F MPTTA+LQAHY+NISGVFT DFPG+P I FNY+G+ P+NL T  GT+
Sbjct  374   VADVNNVTFSMPTTAILQAHYFNISGVFTADFPGKPPIAFNYSGSGPSNLGTMTGTR  430



>ref|XP_003518300.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN46170.1| Laccase-4 [Glycine soja]
Length=557

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/418 (69%), Positives = 347/418 (83%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDDTV+V+VVNHV+
Sbjct  16    MLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ F+YNFTLTGQRGTL WHAHI W R+T
Sbjct  76    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFVYNFTLTGQRGTLWWHAHILWLRST  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFPKP  E+VI+L EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  136   VHGALVILPKLGVPYPFPKPHTEKVIILSEWWKSDTEAVINEALKSGLAPNVSDAHTING  195

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG   NC+S+ GY L+V+ G TYLLRI++AA+NEELFFK+AGH LTVVEVDA Y KPFK
Sbjct  196   HPGSVQNCASQGGYELQVQPGNTYLLRIINAALNEELFFKIAGHQLTVVEVDAVYTKPFK  255

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTT+ +L A++  GKYL+A +PFMD+ +A DN TAT TLHY G+   T T 
Sbjct  256   TDTIVIAPGQTTSVLLKANRAAGKYLVAATPFMDSPIAVDNVTATATLHYTGSLGSTITT  315

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PP+NATPV + F + LRSLNSKK+PA VP + DHSL F I +G+NPC TC+NGS+ 
Sbjct  316   LTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTISLGVNPCPTCVNGSKV  375

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGT-PPANLQTQNGTK  1337
             V  INN++FVMP  +LLQAH++NISGVF DDFPG+P + +++TGT  P NL+T  GT+
Sbjct  376   VAAINNVTFVMPKVSLLQAHFFNISGVFIDDFPGKPPVVYDFTGTQQPTNLRTNRGTR  433



>gb|EYU41858.1| hypothetical protein MIMGU_mgv1a003895mg [Erythranthe guttata]
Length=557

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/420 (70%), Positives = 343/420 (82%), Gaps = 4/420 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  VR Y F VV KNTTR+CS+K IV VNGKFPGP++YAREDDTV++RV+N V+
Sbjct  14    LLPCFVECEVRRYQFNVVMKNTTRVCSTKSIVTVNGKFPGPTIYAREDDTVLIRVINRVK  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGWSDGPAYITQCPIQ G +++YNFT+TGQRGTL WHAHI W R+T
Sbjct  74    YNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGHSYVYNFTITGQRGTLFWHAHILWLRST  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFPKPD E V+VLGEWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  134   VHGALVILPKLGVPYPFPKPDHESVVVLGEWWKSDTEAVINEALKSGLAPNVSDAHTING  193

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP  NC S+ G++L V  GK Y+LR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  194   HPGPISNCPSTGGFSLNVSPGKNYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTST  983
             TDTI I PGQTTN ++TADQ  GKY++A SPFMDT +VA DN+TAT T+HY GT A + T
Sbjct  254   TDTILIAPGQTTNVIVTADQGAGKYMVAASPFMDTPVVAVDNKTATATIHYSGTLANSPT  313

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NG  1157
                  PP+NATPV + F+  LRSLNSKK+PA VP++ DHSLLF +G+GIN C +C   NG
Sbjct  314   SFTATPPQNATPVANNFVNSLRSLNSKKYPAKVPMKIDHSLLFTVGLGINRCPSCKAGNG  373

Query  1158  SRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             SR V  +NN++FVMPT ALLQAH  NI GVFT DFPG P   FNYTG PPANL T  GTK
Sbjct  374   SRVVASVNNVTFVMPTVALLQAHVQNIKGVFTSDFPGNPPHAFNYTGAPPANLSTTTGTK  433



>emb|CAA74103.1| laccase [Populus trichocarpa]
Length=555

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/417 (70%), Positives = 342/417 (82%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VR YNF VV  NTT++CSSK I  +NGKFPGP++YARE D V +R+ N VQ
Sbjct  15    IFPALVECKVRLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQ  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV++HWHGV    TGW+DGPAYITQCPIQ GQ+++YNFTLTGQRGTLLWHAHI+W RAT
Sbjct  75    YNVTVHWHGVSSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVI PK+GVPYPFPKPDKE++I+L EWWK+DVEAV+NQA  +G+ PN+SDAHT+NG
Sbjct  135   IHGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNG  194

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             H G  P C+S G+TL VESGKTYLLRI++AA+N+ELFFK+AGHN+TVVEVDA++ KPF T
Sbjct  195   HTGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATFTKPFST  254

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFIGPGQTTNA+LTAD++ GKYLIAVSPFMDT+VA DN TA   L Y          L
Sbjct  255   DTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYNEPLHSPHLSL  314

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P  NATP TSTFM+ LRSLNSKK+PANVPL  DH L F IG+GI+PC+TC NGS+AV
Sbjct  315   TTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCTNGSKAV  374

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPA-NLQTQNGTK  1337
              DINN+SF+MPTTALLQAHYYNISGVFTDDFP +P I FNYTG   A NL+T NGT+
Sbjct  375   ADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGNNTAMNLKTTNGTR  431



>ref|XP_010543748.1| PREDICTED: laccase-22-like [Tarenaya hassleriana]
Length=555

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/408 (71%), Positives = 336/408 (82%), Gaps = 1/408 (0%)
 Frame = +3

Query  117   VRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHG  296
             +R Y F VV KNTT++CS+K IV VNGKFPGP+LYAREDD VIV + NHV  NV+IHWHG
Sbjct  24    IRRYKFDVVMKNTTKLCSTKSIVTVNGKFPGPTLYAREDDQVIVNLTNHVNYNVTIHWHG  83

Query  297   VRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILP  476
             V+QLRTGWSDGPAYITQCPIQ G TFIYNFTLTGQRGTLLWHAHI+W RATVHGAIVILP
Sbjct  84    VKQLRTGWSDGPAYITQCPIQPGGTFIYNFTLTGQRGTLLWHAHISWLRATVHGAIVILP  143

Query  477   KRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCS  656
             +  V YPFP+P KE++I+ GEWWKSDVEAVINQ+  +G+ PNVSDAHTING  GP   C+
Sbjct  144   RHRVAYPFPRPHKEKIIIFGEWWKSDVEAVINQSTFTGLPPNVSDAHTINGQSGPLLGCN  203

Query  657   SKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQ  836
             S GYTL VESGKTY+LRI++AA+N+ELFFK+AGH LTV+EVDASY KPF  DT+F+GPGQ
Sbjct  204   SPGYTLHVESGKTYMLRIINAALNDELFFKIAGHTLTVIEVDASYTKPFSADTLFLGPGQ  263

Query  837   TTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNAT  1016
             TTNA+LTADQ+ GKYLI +SPFMDTIV  DN T T  LHY  T +  S V   +PP NAT
Sbjct  264   TTNALLTADQSSGKYLITISPFMDTIVTVDNVTGTAFLHYNDTTSSPSLVSDKIPPVNAT  323

Query  1017  PVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFV  1196
              V   F + LRSLNS+ +PANVPL+ DHSL F IG+GINPC TC+N ++AVGDINN+SFV
Sbjct  324   SVALGFSDNLRSLNSRDYPANVPLRVDHSLFFTIGVGINPCETCINNTKAVGDINNVSFV  383

Query  1197  MPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG-TPPANLQTQNGTK  1337
             MPT  +LQAHYYNISGVFTDDFPG+P IPFNYT     AN++T NGTK
Sbjct  384   MPTIGILQAHYYNISGVFTDDFPGKPLIPFNYTANNSTANMRTMNGTK  431



>ref|XP_011032153.1| PREDICTED: laccase-4-like isoform X1 [Populus euphratica]
Length=523

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/398 (73%), Positives = 332/398 (83%), Gaps = 1/398 (0%)
 Frame = +3

Query  147   KNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSD  326
             KN+T++CS+KPIV VNG+FPGP+L AREDDTV+V+VVNHV+ NVSIHWHG+RQLRTGW+D
Sbjct  2     KNSTKLCSTKPIVTVNGQFPGPTLVAREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWAD  61

Query  327   GPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPK  506
             GPAYITQCPIQ GQ+++YNFT+TGQRGTL WHAHI W RATVHGAIVILPKRGVPYPFP 
Sbjct  62    GPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFPT  121

Query  507   PDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSKG-YTLEVE  683
             P KE+VIVLGEWWKSDVEAVIN+A +SGMAPNVSDAHTINGHPGP   CSS G Y L V 
Sbjct  122   PRKEKVIVLGEWWKSDVEAVINEATKSGMAPNVSDAHTINGHPGPVSACSSHGGYNLTVH  181

Query  684   SGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTAD  863
              GKTY+ RI++AA+NEELFFK+AGH LTVVEVDA+YVKPFK DT+ I PGQTTN +LTA+
Sbjct  182   PGKTYMFRIINAALNEELFFKIAGHQLTVVEVDAAYVKPFKIDTVVIAPGQTTNVLLTAN  241

Query  864   QNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEG  1043
             +  GKYL+A SPFMD  +A DN TAT  LHY GT A T T L   P +NATPV + F   
Sbjct  242   RGSGKYLVAASPFMDAPIAVDNVTATAILHYSGTLASTITTLTVPPAKNATPVATNFTNA  301

Query  1044  LRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQA  1223
             LRSLNS K+PA VPL+ D SL F +G+G+NPC+TC+NGSR V DINN++FVMPT ALLQA
Sbjct  302   LRSLNSIKYPARVPLKIDRSLFFTVGLGVNPCATCINGSRVVADINNVTFVMPTIALLQA  361

Query  1224  HYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             H +NISGVFTDDFP  P  PFNYTGT P N QT NGTK
Sbjct  362   HVFNISGVFTDDFPANPPTPFNYTGTQPTNFQTVNGTK  399



>ref|XP_008449180.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=556

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/419 (72%), Positives = 349/419 (83%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VRHY F VV KNTT++CSSK IV VNGKFPGP++YAREDDTV++ VVNHVQ
Sbjct  14    IFPALVECRVRHYKFDVVLKNTTKLCSSKQIVTVNGKFPGPTIYAREDDTVLINVVNHVQ  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHGVRQLRTGW+DGPAYITQCPI +GQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  74    YNLSIHWHGVRQLRTGWADGPAYITQCPIPSGQSYLYNFTVTGQRGTLLWHAHILWLRAT  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFP P+KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  134   VHGALVILPKLGVPYPFPAPNKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  193

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP   CS++ G+TL V+SG TYLLRI++AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  194   HSGPISKCSTQGGFTLPVKSGHTYLLRIINAALNEELFFKIAGHKLTVVEVDATYVKPFK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTNA++TADQ  GKYL+A SPFMD+ +A DN TAT TLHY  T A T+T 
Sbjct  254   TDTIVIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATATLHYSDTLATTATT  313

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L   PP+NATPV + F++ LRSLNS  +PA VPL  DH+L F +G+GINPC TC   NGS
Sbjct  314   LTVPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLGINPCPTCKAGNGS  373

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             RAV  INN++FVMPTTALLQAHY+NI+GVFT DFP  P   FNYTG+ P+NLQT  GTK
Sbjct  374   RAVASINNVTFVMPTTALLQAHYFNINGVFTTDFPANPPHVFNYTGSGPSNLQTTRGTK  432



>ref|XP_009787551.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=554

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/435 (66%), Positives = 347/435 (80%), Gaps = 8/435 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW+R         L C  P   + RHY F VV +N +R+CS+KPIV VNG+FPGP++Y
Sbjct  1     MESWLR-----FFVLLACLSPAFGITRHYKFNVVMRNMSRLCSTKPIVTVNGRFPGPTIY  55

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDD V+++VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ++IYNFT+TGQ
Sbjct  56    AREDDRVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQ  115

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAH+ W R+TVHGAIV+LPKRGVPYPFPKP+ E V+VL EWWKSD EAVIN+A+
Sbjct  116   RGTLFWHAHVLWLRSTVHGAIVVLPKRGVPYPFPKPNHEAVVVLAEWWKSDTEAVINEAL  175

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC ++ GYTL V+ GKTY+LR+++AA+NEELFFK+AGH
Sbjct  176   KSGLAPNVSDAHTINGHPGPVSNCPTQGGYTLSVKPGKTYMLRVINAALNEELFFKIAGH  235

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+YVKPFKTDTI I PGQTTN ++TADQ+ GKY++A SPFMD  +A DN TA
Sbjct  236   KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITA  295

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY G    + T L + PP+NAT V + F++ L+SLNSKK+PA VP   DHSL F +
Sbjct  296   TATLHYSGALGSSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTV  355

Query  1119  GIGINPCSTC--LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC TC   NGSR V  +NN++F+MPT ALLQAH++ I+GVFT DFP  P   FNY
Sbjct  356   GLGINPCPTCKQANGSRVVASVNNVTFIMPTVALLQAHFFGINGVFTTDFPANPPFVFNY  415

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P NL T  GTK
Sbjct  416   TGTSPTNLATTKGTK  430



>ref|XP_004308920.1| PREDICTED: laccase-22-like [Fragaria vesca subsp. vesca]
Length=556

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/411 (69%), Positives = 344/411 (84%), Gaps = 0/411 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VES+VRHYNF VV K+TT++CSSK I+ VNGKFPGP+LYAREDDTVI+RV NH   NV+I
Sbjct  22    VESLVRHYNFRVVLKSTTKLCSSKAILTVNGKFPGPTLYAREDDTVIIRVTNHGNRNVTI  81

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGV+QL T W+DGPAYITQCPIQ GQ FIY FT+TGQRGTLLWHAH +W RAT+HGAI
Sbjct  82    HWHGVKQLGTCWADGPAYITQCPIQPGQNFIYKFTITGQRGTLLWHAHDSWLRATLHGAI  141

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK G PYPFP P KE +I+L EWWKSDVEAV++++ QSG+ PN+SDAHTINGHPGP 
Sbjct  142   VILPKLGTPYPFPTPQKERIIILSEWWKSDVEAVVDESTQSGLPPNISDAHTINGHPGPA  201

Query  645   PNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
             P CSS+G+TL VESGKTYLLRI++AA+N++LFFK+A HNLTVVEVDASY KPF+TDTIFI
Sbjct  202   PGCSSQGFTLHVESGKTYLLRIINAALNDDLFFKIARHNLTVVEVDASYTKPFQTDTIFI  261

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTT A+L A+++ G YLI+VSPFMD  +  DN T+  TL YK T   ++T L ++PP
Sbjct  262   SPGQTTTALLEANKDIGNYLISVSPFMDAPIGIDNFTSIATLRYKHTPRNSTTFLTSIPP  321

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
             +NATP+T+TF++ LRSL+SK +PANVPL  DHSL   +G+GINPC TC+NGS+ V  +NN
Sbjct  322   QNATPLTATFIDSLRSLDSKLYPANVPLTIDHSLFLTVGVGINPCDTCVNGSKLVASVNN  381

Query  1185  ISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             +SFVMPT ALLQA+YYNI GV+T DFP +P  PF+YTGTPP N+Q  NGTK
Sbjct  382   VSFVMPTIALLQAYYYNIKGVYTLDFPPKPPNPFDYTGTPPVNVQAANGTK  432



>gb|KHG18161.1| Laccase-4 -like protein [Gossypium arboreum]
Length=556

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/419 (72%), Positives = 349/419 (83%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+  VRHY F VV KNTTR+CSSKPIV VNGKFPGP+LYARE DTV+V+VVNHV+
Sbjct  14    LFPVFVDCTVRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTLYAREGDTVLVKVVNHVK  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ+GQ+++YNFT+TGQRGTLLWHAHI W R+T
Sbjct  74    YNVSIHWHGIRQLRTGWADGPAYITQCPIQSGQSYVYNFTITGQRGTLLWHAHILWLRST  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKR VPYPFPKP KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  134   VHGAIVILPKRSVPYPFPKPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  193

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG    C S+ G++L VESGKTYLLR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  194   HPGKVSGCPSQGGFSLPVESGKTYLLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
              DT+ I PGQTTN +++ADQN GKY++A SPFMD  VA DN TAT TLHY GT   T T 
Sbjct  254   IDTVVIAPGQTTNVLVSADQNSGKYMVAASPFMDAPVAVDNLTATATLHYSGTLDNTPTS  313

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L T PP+NAT V + F++ LRSLNSK+FPA VP   DH+L F +G+G+NPC TC   NGS
Sbjct  314   LTTPPPQNATSVANNFIDSLRSLNSKQFPALVPPTIDHNLYFTVGLGVNPCPTCKAGNGS  373

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++F MPTTALLQAH++NISGVFT DFP  P   FNYTGTPP NLQT+NGTK
Sbjct  374   RVVASINNVTFTMPTTALLQAHFFNISGVFTTDFPSTPPHVFNYTGTPPKNLQTRNGTK  432



>emb|CAC14719.1| laccase [Populus trichocarpa]
Length=555

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/417 (70%), Positives = 341/417 (82%), Gaps = 1/417 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VR YNF VV  NTT++CSSK I  +NGKFPGP++YARE D V +R+ N VQ
Sbjct  15    IFPALVECKVRLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQ  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV++HWHGV    TGW+DGPAYITQCPIQ GQ+++YNFTLTGQRGTLLWHAHI+W RAT
Sbjct  75    YNVTVHWHGVSSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGAIVI PK+GVPYPFPKPDKE++I+L EWWK+DVEAV+NQA  +G+ PN+SDAHT+NG
Sbjct  135   IHGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNG  194

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             H G  P C+S G+TL VESGKTYLLRI++AA+N+ELFFK+AGHN+TVVEVDA++ KPF  
Sbjct  195   HTGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATFTKPFSA  254

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTIFIGPGQTTNA+LTAD++ GKYLIAVSPFMDT+VA DN TA   L Y          L
Sbjct  255   DTIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYNEPLHSPHLSL  314

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
              T P  NATP TSTFM+ LRSLNSKK+PANVPL  DH L F IG+GI+PC+TC NGS+AV
Sbjct  315   TTTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCTNGSKAV  374

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPA-NLQTQNGTK  1337
              DINN+SF+MPTTALLQAHYYNISGVFTDDFP +P I FNYTG   A NL+T NGT+
Sbjct  375   ADINNVSFIMPTTALLQAHYYNISGVFTDDFPAKPPISFNYTGNNTAMNLKTTNGTR  431



>ref|XP_007205010.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
 gb|EMJ06209.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
Length=559

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/437 (70%), Positives = 358/437 (82%), Gaps = 7/437 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   LV   A + P  VES +RHY F VV KNTTR+CS+KPIV +NG+FPGP+LY
Sbjct  1     MESWVR--FLVLFLACLLPGLVESRIRHYKFNVVLKNTTRLCSTKPIVTINGRFPGPTLY  58

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+V NHV+ NVSIHWHGVRQL+TGW+DGPAYITQCPI  GQ+++YNFT+TGQ
Sbjct  59    AREDDTVLVKVTNHVKYNVSIHWHGVRQLQTGWADGPAYITQCPIPPGQSYVYNFTITGQ  118

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGA+VILPKRGVPYPFP P KE  ++L EWWKSD EAVINQA+
Sbjct  119   RGTLLWHAHILWLRATVHGALVILPKRGVPYPFPAPHKEVNVILAEWWKSDTEAVINQAL  178

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
              SG+APNVSDAHTINGHPG   NCSS+ G+TL VE GKTYLLRI++AA+NEELFFK+AGH
Sbjct  179   SSGVAPNVSDAHTINGHPGSVANCSSQGGFTLPVEKGKTYLLRIINAALNEELFFKIAGH  238

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPFKTDTI I PGQTTNA++TA+QN GKYL+A SPFMD+ +A DN TA
Sbjct  239   KLTIVEVDATYVKPFKTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTA  298

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A T T L   PP+NAT V + F+  L+SLNSKKFPA VPL+ DH+LLF +
Sbjct  299   TATLHYSGTLATTPTTLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKIDHNLLFTV  358

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC TC   NGSR V  +NN++FVMPTTALLQAH +NISGVFT DFPG P   FN+
Sbjct  359   GLGINPCPTCKAGNGSRVVASVNNVTFVMPTTALLQAHVFNISGVFTTDFPGNPPNTFNF  418

Query  1293  TGTPPAN--LQTQNGTK  1337
             +G P AN  + T NGTK
Sbjct  419   SGGPSANASMATTNGTK  435



>gb|KHN20872.1| Laccase-4 [Glycine soja]
Length=562

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/420 (69%), Positives = 347/420 (83%), Gaps = 9/420 (2%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V+S+VRHY F+VV KNTT++CS+K  V VNG+ PGP+LYAREDDTVIV+V NHV+ N++I
Sbjct  19    VQSLVRHYKFSVVLKNTTKLCSTKSFVTVNGQCPGPTLYAREDDTVIVKVTNHVKYNITI  78

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG++QLRTGWSDGPAY+TQCPIQ GQ+++YNFT+ GQRGTLLWHAHI W RATV+G I
Sbjct  79    HWHGIKQLRTGWSDGPAYVTQCPIQPGQSYVYNFTINGQRGTLLWHAHITWLRATVYGGI  138

Query  465   VILPKRGVPYPFPKPDKEEVIVLG--------EWWKSDVEAVINQAMQSGMAPNVSDAHT  620
             VILPKRG+ YPFPKPDKE++I+LG        EWWKSDVEA++NQA  SG+ PN+SDAHT
Sbjct  139   VILPKRGISYPFPKPDKEKIIILGKIYVRIKCEWWKSDVEAILNQAENSGLPPNISDAHT  198

Query  621   INGHPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKP  800
             INGH GP P C+S+GYTL VESGKTYLLRI++AA+N+ELFFK+AGH LTVVE DASYVKP
Sbjct  199   INGHTGPIPGCTSQGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEADASYVKP  258

Query  801   FKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS  980
             F+TDTIF+ PGQTTN +LTA+Q  GKYLIAV+PFMD  +  DN T+  TL YKGT     
Sbjct  259   FETDTIFMSPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTSIATLRYKGTPPYPK  318

Query  981   TVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGS  1160
             T L T+P  NATP+TS F++ LRSLNSK++PA  PL  DHSL F+I +G+NPC TCL G+
Sbjct  319   TTLTTIPALNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSITVGLNPCHTCLTGA  378

Query  1161  RAVGDINNISFVMP-TTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INNI+F+MP TT+LL+AHYYNI GVFTDDFP  P I FNYTGT PAN+QT NGT+
Sbjct  379   RLVSAINNITFLMPTTTSLLEAHYYNIKGVFTDDFPSFPPIAFNYTGTQPANIQTNNGTR  438



>ref|XP_003544873.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN40048.1| Laccase-4 [Glycine soja]
Length=557

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/418 (68%), Positives = 345/418 (83%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDDTV+V+VVNHV+
Sbjct  16    MLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQL+TGW+DGPAYITQCPIQ GQ F+YNFTLTGQRGTL WHAHI W R+T
Sbjct  76    YNVSIHWHGVRQLQTGWADGPAYITQCPIQPGQAFVYNFTLTGQRGTLWWHAHILWLRST  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFPKP  E+VI+L EWWKSD EAVIN+A++SG APNVSDAHTING
Sbjct  136   VHGALVILPKLGVPYPFPKPHTEKVIILSEWWKSDTEAVINEALKSGSAPNVSDAHTING  195

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG   NC+S+ GY L+V+ G TYLLRI++AA+NEELFFK+AGH LTVVEVDA Y KPFK
Sbjct  196   HPGSVQNCASQGGYKLQVQPGNTYLLRIINAALNEELFFKIAGHQLTVVEVDAVYTKPFK  255

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTN +L A++  GKYL+A +PFMD+ +  DN TAT TLHY G+   T T 
Sbjct  256   TDTIVIAPGQTTNVLLKANRAAGKYLVAATPFMDSPITVDNVTATATLHYTGSLGSTITT  315

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PP+NATPV + F + LRSLNSKK+PA VP + DHSL F + +G+NPC TC NGS+ 
Sbjct  316   LTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTVSLGVNPCPTCANGSKV  375

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGT-PPANLQTQNGTK  1337
             V  INN++FVMP  +LLQAH++NISGVFTDDFPG+P + +++TGT  P NL+T  GT+
Sbjct  376   VAAINNVTFVMPKVSLLQAHFFNISGVFTDDFPGKPPVVYDFTGTQQPTNLRTNRGTR  433



>ref|XP_007141799.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
 gb|ESW13793.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
Length=553

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/411 (70%), Positives = 345/411 (84%), Gaps = 0/411 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V S+VRHY F+V+SKN+TR+CS+K  V VNG+ PGP+LYAREDDTV+VRV NHV+ N++I
Sbjct  19    VHSLVRHYKFSVISKNSTRLCSTKSFVTVNGQCPGPTLYAREDDTVLVRVTNHVKYNITI  78

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG++QLR+GWSDGPAY+TQCPIQ GQ+F+YNFT TGQRGTLLWHAHI W RATV+GAI
Sbjct  79    HWHGIKQLRSGWSDGPAYVTQCPIQPGQSFVYNFTTTGQRGTLLWHAHITWLRATVYGAI  138

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPKRG+ YPFP PDKE+ I+LGEWWKSDVEAV+N+A  SG+ PN+SDAHTINGH GP 
Sbjct  139   VILPKRGISYPFPTPDKEKTIILGEWWKSDVEAVLNEAESSGLPPNISDAHTINGHTGPV  198

Query  645   PNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
             P C+S+GYTL VESGKTYLLRI++AA+N+ELFFK+AGH LTVVE DASYVKPF+TDTIF+
Sbjct  199   PGCTSRGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEADASYVKPFETDTIFM  258

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTTN +L+ADQ  GKYLIAV+PFMD  +  DN T+  TL YK T    +T L T+P 
Sbjct  259   SPGQTTNVLLSADQGVGKYLIAVTPFMDAPIGFDNVTSIATLRYKTTPPYPTTTLTTIPA  318

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
              NATP+TS F++ LRSLNSK++PA VPL  DHSL FAI +G+NPC  C  GS+ V  +NN
Sbjct  319   LNATPLTSHFIDSLRSLNSKEYPARVPLTVDHSLFFAITVGLNPCDACPTGSKLVSALNN  378

Query  1185  ISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             I+FVMPTT+LL+AHYYN+ GVFTDDFP  P I FNYTGT PAN+QT NGT+
Sbjct  379   ITFVMPTTSLLEAHYYNVKGVFTDDFPAHPPIVFNYTGTQPANIQTNNGTR  429



>ref|XP_004249583.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=557

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/420 (68%), Positives = 341/420 (81%), Gaps = 4/420 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
              C  PV  + RHY F VV KN +R+CSSKPIV +NG+FPGP++YARE+D V+++VVNHV+
Sbjct  14    FCFFPVFGITRHYKFNVVMKNMSRLCSSKPIVTINGRFPGPTIYARENDRVLIKVVNHVK  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTL WHAHI W RAT
Sbjct  74    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRAT  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKP+ E V+VLGEWWKSD EAV+N+A+ SG+APNVSDAHTING
Sbjct  134   VHGAIVILPKRGVPYPFPKPNHEAVVVLGEWWKSDTEAVVNEALNSGLAPNVSDAHTING  193

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP PNC S+ GYTL V  GKTY+LR+++AA+NEELFFK+AGH +TVVEVDA+YVKPFK
Sbjct  194   HPGPVPNCPSEGGYTLSVAPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             +DTI I PGQTTN +LTADQ  GKY++  SPFMD+ +  DN TAT TLHY G  +     
Sbjct  254   SDTILIAPGQTTNVILTADQKFGKYMMIASPFMDSPITVDNVTATATLHYTGALSSAPMT  313

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L + PP+NAT V + F++ L+SLNSKK+PA VP   DHSLLF +G+GINPC TC+  NGS
Sbjct  314   LTSAPPQNATLVANNFIDSLKSLNSKKYPAKVPNNVDHSLLFTVGLGINPCPTCIPANGS  373

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGT-PPANLQTQNGTK  1337
             R V  INN++FVMPTTALLQAH++ I  VFT DFPG P   FNYT T PP +L T NGTK
Sbjct  374   RVVASINNVTFVMPTTALLQAHFFGIKNVFTTDFPGNPPFIFNYTSTLPPPSLATTNGTK  433



>ref|XP_003539958.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN07789.1| Laccase-4 [Glycine soja]
Length=556

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/412 (69%), Positives = 342/412 (83%), Gaps = 1/412 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE++VRHY F VV KNTTR+ S+KPIV +NGKFPGP++YAREDDTV+V+VVN V+ NVSI
Sbjct  21    VEAMVRHYKFNVVQKNTTRLGSTKPIVTINGKFPGPTIYAREDDTVLVKVVNQVKYNVSI  80

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGVRQLRTGW+DGPAYITQCPI   Q ++YNFTLTGQRGTL WHAHI W RATVHGA+
Sbjct  81    HWHGVRQLRTGWADGPAYITQCPILPSQAYVYNFTLTGQRGTLWWHAHILWLRATVHGAL  140

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP+ E+VI+L EWWKSD EAVIN+A++SG+APN SDAHTINGHPGP 
Sbjct  141   VILPKLGVPYPFPKPNMEQVIILSEWWKSDTEAVINEALKSGLAPNASDAHTINGHPGPI  200

Query  645   PNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
                +S+ GY L+V+ GKTYLLRI++AA+NEELFFK+AGH LTVVEVDA Y KP KTDTI 
Sbjct  201   QGYASQGGYKLDVQPGKTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPLKTDTIV  260

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
             I PGQTTN +LT     GKYL+A SPFMD  +A DN+TAT TLHY GT   T T L +MP
Sbjct  261   IAPGQTTNVLLTTKHATGKYLVAASPFMDAPIAVDNKTATATLHYLGTLGSTITTLTSMP  320

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P+NATPV +TF++ LRSLNSK+ PA VPL+ DH+LLF + +G+NPC+TC+N SR V DIN
Sbjct  321   PKNATPVATTFIDSLRSLNSKEHPARVPLKIDHNLLFTVSLGVNPCATCVNNSRVVADIN  380

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N++FVMP  +LLQAH++ I GVFTDDFPG P + +N+TGT P+NL+T  GT+
Sbjct  381   NVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVVYNFTGTQPSNLKTMKGTR  432



>ref|XP_006387495.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
 gb|ERP46409.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
Length=559

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/419 (69%), Positives = 348/419 (83%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  +RHY F VV KNTTR+CS KPIV VNG+FPGP+LYARE DTV+V+VVNHV+
Sbjct  17    LLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREHDTVLVKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  77    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+V+LPKRG+PYPFP P KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  137   VHGAMVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  196

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG    CSS+ G+TL V+SG+TY+LR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  197   HPGAVSACSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDT+ I PGQTTN ++T ++N GKYL+A SPFMD  +A DN TAT TL Y G  A + T 
Sbjct  257   TDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLQYSGALANSPTT  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L T PP+NAT V + F   LRSLNS++FPA VPL  DH+L F +G+G+NPC +C   NGS
Sbjct  317   LTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVGLGVNPCPSCKAGNGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++FVMPTTALLQAH++NISGVFT DFP +P   FNYTGTPP NLQT++GTK
Sbjct  377   RVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYTGTPPTNLQTKSGTK  435



>gb|EYU26646.1| hypothetical protein MIMGU_mgv1a003805mg [Erythranthe guttata]
Length=563

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/418 (71%), Positives = 344/418 (82%), Gaps = 7/418 (2%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE  VRHY F VV KNTT++CSSK IV VNGKFPGP++YAREDDTV+V+VVNHV  N+SI
Sbjct  22    VECKVRHYKFNVVMKNTTKLCSSKSIVTVNGKFPGPTIYAREDDTVLVKVVNHVNYNLSI  81

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTLLWHAHI W R+TVHGAI
Sbjct  82    HWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLLWHAHILWLRSTVHGAI  141

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP+ E VI+L EWWKSD EAVIN+A+ SG+APNVSDAHTINGHPGP 
Sbjct  142   VILPKLGVPYPFPKPNHERVIILAEWWKSDTEAVINEALTSGLAPNVSDAHTINGHPGPV  201

Query  645   PNCSSK---GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
              NC S    G+TL+V++GKTYLLR+++AA+NEELFFK+AGHNLTVV+VDA+YVKPFKT T
Sbjct  202   TNCPSSTADGFTLKVKAGKTYLLRLINAALNEELFFKIAGHNLTVVDVDATYVKPFKTGT  261

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTI-VATDNQTATGTLHYKGTQALTSTVLA  992
             I I PGQTT A+LTAD+N GKY++A S FMDT  VA DN TAT TLHY GT + + T   
Sbjct  262   IVIAPGQTTTAILTADRNTGKYIVAASTFMDTPGVAVDNTTATATLHYSGTLSTSPTTFT  321

Query  993   TMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRA  1166
               PP+NATPV + F+  LRSLNSK +PA VP + D SLLF IG+GINPC+TC   NGSR 
Sbjct  322   APPPQNATPVANNFVNSLRSLNSKNYPAKVPQKVDRSLLFTIGLGINPCATCKAGNGSRV  381

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT-GTPPANLQTQNGTK  1337
             V DINN++FVMP  ALLQAH +NI GVFT DFPG P + FNYT G PP+N  T+NGTK
Sbjct  382   VADINNVTFVMPKIALLQAHVFNIKGVFTTDFPGNPPVSFNYTGGPPPSNFGTRNGTK  439



>ref|XP_011019150.1| PREDICTED: laccase-4 isoform X1 [Populus euphratica]
Length=559

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/419 (69%), Positives = 348/419 (83%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  +RHY F VV KNTTR+CS KPIV VNG+FPGP+LYAREDDTV+V+VVNHV+
Sbjct  17    LLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREDDTVLVKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTLLWHAHI W R+T
Sbjct  77    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLLWHAHILWLRST  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIV+LPKRG+PYPFP P KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  137   VHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  196

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG    CSS+ G+TL V SG+TY+LR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  197   HPGAVSACSSQGGFTLPVRSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDT+ I PGQTTN ++T ++N G YL+A SPFMD+ +A DN TAT TL Y G  A + T 
Sbjct  257   TDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTATATLQYSGALANSPTT  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L T PP+NAT V + F+  LRSLNS+KFPA VP+  DH+L F +G+G+NPC +C   NGS
Sbjct  317   LTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTVGLGVNPCPSCKAGNGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++FVMPTTALLQAH++NISGVFT DFP +P   FNY+GTPP NLQT++GTK
Sbjct  377   RVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYSGTPPTNLQTKSGTK  435



>ref|XP_008457399.1| PREDICTED: laccase-4 [Cucumis melo]
Length=562

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/438 (66%), Positives = 354/438 (81%), Gaps = 5/438 (1%)
 Frame = +3

Query  39    IMASW-VRGvvlvalaalIC---PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFP  206
             + A W +RG +   LA + C   P PVE +VRHY F VV +  TR+CSSKPIV +NGKFP
Sbjct  1     MAALWFIRGGLAAVLAVVFCFMSPPPVECLVRHYKFNVVMRKVTRLCSSKPIVTINGKFP  60

Query  207   GPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNF  386
             GP++YAREDDTV+V+VVNHV  NVSIHWHG+RQLRTGW+DGPAYITQCP+QTGQ+++YNF
Sbjct  61    GPTIYAREDDTVLVKVVNHVPYNVSIHWHGIRQLRTGWADGPAYITQCPLQTGQSYVYNF  120

Query  387   TLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAV  566
             T+TGQRGTL WHAHI W RAT++GA+VILPK GVPYPFP P KE V++LGEWWKSDVE V
Sbjct  121   TITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPTPHKELVLILGEWWKSDVEGV  180

Query  567   INQAMQSGMAPNVSDAHTINGHPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFK  746
             +N+A +SG+APNVSDAHTINGHPGP   C ++G+++ V+ GKTYLLRI++AA+NE+LFFK
Sbjct  181   VNEAAKSGLAPNVSDAHTINGHPGPVHGCLTRGFSMPVQPGKTYLLRIINAALNEDLFFK  240

Query  747   VAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVAT  923
             VAGH LTVVEVDA+Y KPF TDTI I PGQTTNA+LTAD   GKY I+ SPFMDT IVA 
Sbjct  241   VAGHKLTVVEVDAAYTKPFITDTIVIAPGQTTNALLTADLKSGKYAISASPFMDTPIVAV  300

Query  924   DNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHS  1103
             DN TAT TLHY GT + T T    +PP+NAT + + F   LRSLNSK++PA V L+ DHS
Sbjct  301   DNVTATATLHYTGTISTTPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDHS  360

Query  1104  LLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIP  1283
             LLF +G+G+N C TC +G++ V DINN++FVMPT +LLQAHY+NI GVFTDDFP  P I 
Sbjct  361   LLFTVGLGVNRCKTCSSGNQLVADINNVTFVMPTISLLQAHYFNIDGVFTDDFPANPPIR  420

Query  1284  FNYTGTPPANLQTQNGTK  1337
             ++YTG  P+N+QT  GT+
Sbjct  421   YDYTGKQPSNMQTTKGTR  438



>ref|XP_010037723.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW49475.1| hypothetical protein EUGRSUZ_K02996 [Eucalyptus grandis]
Length=562

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/420 (72%), Positives = 337/420 (80%), Gaps = 6/420 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  VE  VRHY F VV KN TR+CS+KPIV VNGK PGP+LYARE D V+V+V NHV+ N
Sbjct  19    PAMVECRVRHYKFNVVMKNMTRLCSTKPIVTVNGKLPGPTLYAREGDNVLVKVANHVKYN  78

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             V+IHWHGVRQLRTGW+DGPAYITQCPIQTGQ FIYNFT+TGQRGTLLWHAHI W R T+H
Sbjct  79    VTIHWHGVRQLRTGWADGPAYITQCPIQTGQNFIYNFTITGQRGTLLWHAHILWLRVTLH  138

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKRGVPYPFPKP KE VI+L EWWKSD E VINQAM  G+APNVSDAHTINGHP
Sbjct  139   GAIVILPKRGVPYPFPKPSKEYVIILAEWWKSDTETVINQAMSQGLAPNVSDAHTINGHP  198

Query  636   GPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             GP P C S + YTL VESGKTYLLRIV+AA+NEELFFK+A HNLTVVEVDA+YVKPF+TD
Sbjct  199   GPVPGCPSERSYTLPVESGKTYLLRIVNAALNEELFFKIAQHNLTVVEVDATYVKPFQTD  258

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTTN +LT +QN GKYLI  S FM+T IVA DN TA+  +HY GT A  STVL
Sbjct  259   TILITPGQTTNVLLTTNQNAGKYLITASTFMETAIVAIDNVTASAAVHYSGTLASASTVL  318

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NA+ V ++F   LRSLNSKK+PA VP   DH+L F +G+G+NPC TC   NGSR
Sbjct  319   TKPPPQNASAVANSFNNALRSLNSKKYPAKVPKTVDHNLFFTMGLGVNPCPTCTAGNGSR  378

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPAN--LQTQNGTK  1337
              V  +NNISFVMPT ALLQAH +NISGVFT DFPG P   +NYT TPP N  + T NGTK
Sbjct  379   VVAAVNNISFVMPTIALLQAHVFNISGVFTTDFPGNPPTTYNYTATPPQNASVPTMNGTK  438



>ref|XP_007140382.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
 gb|ESW12376.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
Length=560

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/439 (70%), Positives = 352/439 (80%), Gaps = 10/439 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   ++   A I P  VE  VRHY F VV KNTTR+CSSKPIV VNGKFPGP+LY
Sbjct  1     MDSWVR---VLLFIACIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+V N V  NV+IHWHGVRQ+RTGW+DGPAYITQCPI  GQ+++YNFTLTGQ
Sbjct  58    AREDDTVLVKVRNLVNHNVTIHWHGVRQIRTGWADGPAYITQCPILPGQSYLYNFTLTGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAH+NW R+T+HGAIVILPK GVPYPFPKP KE V++LGEWWKSD E VIN+A+
Sbjct  118   RGTLLWHAHVNWLRSTLHGAIVILPKHGVPYPFPKPVKELVVILGEWWKSDTEDVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGP--TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVA  752
             +SG+APNVSDAHTING PG     NCS++  Y L VESGKTYLLRI++AA+NEE FFK+A
Sbjct  178   KSGLAPNVSDAHTINGLPGIVFVANCSTQDVYKLPVESGKTYLLRIINAALNEETFFKIA  237

Query  753   GHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDN  929
             GH  TVVEVDASYVKPFKTDT+ I PGQTTNA+LT DQN GKY I  S FMD+ +VA DN
Sbjct  238   GHLFTVVEVDASYVKPFKTDTLLIAPGQTTNALLTTDQNSGKYTIVASTFMDSPVVAVDN  297

Query  930   QTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLL  1109
              TAT TLHY GT A T TVL T PPRNAT V + F + L+SLNSKK+PANVPL  DHSLL
Sbjct  298   LTATATLHYTGTLATTPTVLITPPPRNATQVANNFTKSLKSLNSKKYPANVPLTVDHSLL  357

Query  1110  FAIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIP  1283
             F +G+GINPC +C   NGSR V  +NN++FVMPTTALLQAHY+N  GVFT DFPG P   
Sbjct  358   FTVGLGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNTQGVFTTDFPGNPPQV  417

Query  1284  FNYTGTP-PANLQTQNGTK  1337
             +NYT TP  A+ QT NGTK
Sbjct  418   YNYTATPRAASSQTTNGTK  436



>gb|KGN65788.1| hypothetical protein Csa_1G528530 [Cucumis sativus]
Length=562

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/433 (66%), Positives = 351/433 (81%), Gaps = 4/433 (1%)
 Frame = +3

Query  51    WVRGvvlvalaalIC---PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             ++RG +   L  + C   P PVE +VRHY F VV +  TR+CSSKPIV +NGKFPGP++Y
Sbjct  6     FIRGGLAAVLTVVFCFMSPPPVECLVRHYKFNVVMRKVTRLCSSKPIVTINGKFPGPTIY  65

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+++VVNHV  NVSIHWHG+RQLRTGW+DGPAYITQCP+QTGQ+++YNFT+TGQ
Sbjct  66    AREDDTVLIKVVNHVPYNVSIHWHGIRQLRTGWADGPAYITQCPLQTGQSYVYNFTITGQ  125

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RAT++GA+VILPK GVPYPFP P KE V++LGEWWKSDVEAV+++A 
Sbjct  126   RGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPTPHKELVLILGEWWKSDVEAVVHEAA  185

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHN  761
             +SG+APNVSDAHTINGHPGP   C ++G+++ V+ GKTYLLRI++AA+NEELFFKVAGH 
Sbjct  186   KSGLAPNVSDAHTINGHPGPVNGCLTRGFSMPVQPGKTYLLRIINAALNEELFFKVAGHK  245

Query  762   LTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTA  938
             LTVVEVDA+Y KPF TDTIFI PGQTTNA+LTAD   GKY I+ SPF DT IVA DN TA
Sbjct  246   LTVVEVDAAYTKPFITDTIFIAPGQTTNALLTADLKSGKYAISASPFRDTPIVAVDNVTA  305

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT + + T    +PP+NAT + + F   LRSLNSK++PA V L+ DHSL F +
Sbjct  306   TATLHYTGTISTSPTSFTGLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDHSLFFTV  365

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+N C TC +G++ V DINN++FVMPT +LLQAHY+NI GVFTDDFP  P I ++YTG
Sbjct  366   GLGVNRCKTCSSGTQVVADINNVTFVMPTISLLQAHYFNIDGVFTDDFPANPPIRYDYTG  425

Query  1299  TPPANLQTQNGTK  1337
               P+NLQT  GT+
Sbjct  426   KQPSNLQTTKGTR  438



>gb|KEH34185.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=556

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/412 (68%), Positives = 341/412 (83%), Gaps = 1/412 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V+++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDD V+++VVNHV+ NVSI
Sbjct  21    VDAMVRHYKFNVVMKNATRLCSTKPIVTVNGKFPGPTIYAREDDNVLIKVVNHVKYNVSI  80

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGV+QLRTGW+DGPAYITQCPIQ GQT++YNFTLTGQRGTL WHAH+ W RATVHGAI
Sbjct  81    HWHGVKQLRTGWADGPAYITQCPIQPGQTYLYNFTLTGQRGTLWWHAHVLWLRATVHGAI  140

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP  E+VI+LGEWWKSD EA+IN+A++SG+APN SDAHTINGHPGP 
Sbjct  141   VILPKLGVPYPFPKPHMEQVILLGEWWKSDTEAIINEALKSGLAPNTSDAHTINGHPGPV  200

Query  645   PNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
               C+S+ G++LEV+   TYLLRI++AA+NEELFFK+A H LTVVEVDA+YVKPFKTDTI 
Sbjct  201   QGCASQGGFSLEVQPKNTYLLRIINAALNEELFFKIANHQLTVVEVDATYVKPFKTDTIV  260

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
             I PGQTTN ++TA    G +L+A SPFMD  +  DN+TAT TLHY GT   + T L ++P
Sbjct  261   IAPGQTTNVLVTAKHKIGNFLVAASPFMDAPIVVDNKTATATLHYSGTLGSSLTTLTSLP  320

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P NAT V +TF + LRSLNSKKFPA VPL+ DH+LLF + +G+NPC+TC+N SR V DIN
Sbjct  321   PTNATSVANTFTDSLRSLNSKKFPAKVPLKIDHNLLFTVSLGVNPCATCVNNSRVVADIN  380

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N++FVMP  ALLQAH++ I GVFTDDFPG P + +N+TG+   NL T  GT+
Sbjct  381   NVTFVMPKIALLQAHFFKIKGVFTDDFPGNPPVVYNFTGSQVTNLATTKGTR  432



>ref|XP_002308209.2| laccase family protein [Populus trichocarpa]
 gb|EEE91732.2| laccase family protein [Populus trichocarpa]
Length=559

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/419 (69%), Positives = 347/419 (83%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  +RHY F VV KNTTR+CS KPIV VNG+FPGP+LYARE DTV+V+VVNHV+
Sbjct  17    LLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREHDTVLVKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  77    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+V+LPKRG+PYPFP P KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  137   VHGALVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  196

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG    CSS+ G+TL V+SG+TY+LR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  197   HPGAVSACSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDT+ I PGQTTN ++T ++N GKYL+A SPFMD  +A DN TAT TL Y G  A + T 
Sbjct  257   TDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLQYSGALANSPTT  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L T PP+NAT V + F   LRSLNS++FPA VPL  DH+L F +G+G+NPC +C   NGS
Sbjct  317   LTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVGLGVNPCPSCKAGNGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++FVMPTTALLQAH+ NISGVFT DFP +P   FNYTGTPP NLQT++GTK
Sbjct  377   RVVASINNVTFVMPTTALLQAHFLNISGVFTTDFPAKPPHVFNYTGTPPTNLQTKSGTK  435



>ref|XP_007146741.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
 gb|ESW18735.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
Length=556

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/412 (69%), Positives = 347/412 (84%), Gaps = 1/412 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDDTV+++VVNHV+ NVSI
Sbjct  21    VEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPTIYAREDDTVLIKVVNHVKYNVSI  80

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGVRQ+RTGW+DGPAYITQCPIQ GQ ++YNFTLTGQRGTL WHAHI W RAT+HGA+
Sbjct  81    HWHGVRQVRTGWADGPAYITQCPIQPGQAYVYNFTLTGQRGTLWWHAHILWLRATLHGAL  140

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP+ E+VI+L EWWKSD EAVIN+A++SG+APNVSDAHTINGHPGP 
Sbjct  141   VILPKLGVPYPFPKPNMEQVIILSEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPV  200

Query  645   PNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
               C+S+ G+ L+V+ G TYLLRI++AA+NEELFFK+AGH LTVVEVDA Y KPFKTDTI 
Sbjct  201   QGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPFKTDTIV  260

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
             I PGQTTN +LTA    GKYL+A SPFMD  +A DN+TAT TLHY GT + + T L ++P
Sbjct  261   ITPGQTTNVLLTAKHAAGKYLVAASPFMDAPIAVDNKTATATLHYSGTLSSSLTTLTSLP  320

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P+N+T + ++F + LRSLNSKK+PA VPL+ D +LLF + +GINPC+TC+N SR V DIN
Sbjct  321   PKNSTILATSFTDSLRSLNSKKYPARVPLKIDRNLLFTVSLGINPCATCVNNSRVVADIN  380

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N++FVMP  +LLQAH++ I GVFTDDFPG P + +N+TGT P+NL T NGT+
Sbjct  381   NVTFVMPKISLLQAHFFKIKGVFTDDFPGNPPVFYNFTGTQPSNLNTVNGTR  432



>ref|XP_011019151.1| PREDICTED: laccase-4 isoform X2 [Populus euphratica]
Length=558

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/434 (68%), Positives = 355/434 (82%), Gaps = 6/434 (1%)
 Frame = +3

Query  45    ASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYA  224
             A W+R    + LA  + P  V+  VRHY F VV KNTTR+CS KPIV VNG+FPGP+LYA
Sbjct  4     ACWLR---FILLAVCLFPALVQCRVRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYA  60

Query  225   REDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQR  404
             REDDTV+V+VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQR
Sbjct  61    REDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQR  120

Query  405   GTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQ  584
             GTLLWHAHI W R+TVHGAIV+LPKRG+PYPFP P KE V+VL EWWKSD EAVIN+A++
Sbjct  121   GTLLWHAHILWLRSTVHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALK  180

Query  585   SGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHN  761
             SG+APNVSDAHTINGHPG    CSS+ G+TL V SG+TY+LR+++AA+NEELFFK+AGH 
Sbjct  181   SGLAPNVSDAHTINGHPGAVSACSSQGGFTLPVRSGETYMLRLINAALNEELFFKIAGHK  240

Query  762   LTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTAT  941
             LTVVEVDA+YVKPFKTDT+ I PGQTTN ++T ++N G YL+A SPFMD+ +A DN TAT
Sbjct  241   LTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTAT  300

Query  942   GTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIG  1121
              TL Y G  A + T L T PP+NAT V + F+  LRSLNS+KFPA VP+  DH+L F +G
Sbjct  301   ATLQYSGALANSPTTLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTVG  360

Query  1122  IGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             +G+NPC +C   NGSR V  INN++FVMPTTALLQAH++NISGVFT DFP +P   FNY+
Sbjct  361   LGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFNISGVFTTDFPAKPPHVFNYS  420

Query  1296  GTPPANLQTQNGTK  1337
             GTPP NLQT++GTK
Sbjct  421   GTPPTNLQTKSGTK  434



>ref|XP_002308208.2| laccase family protein [Populus trichocarpa]
 gb|EEE91731.2| laccase family protein [Populus trichocarpa]
Length=558

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/434 (68%), Positives = 355/434 (82%), Gaps = 6/434 (1%)
 Frame = +3

Query  45    ASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYA  224
             A W+R    + LA  + P  V+  VRHY F VV KNTTR+CS KPIV VNG+FPGP+LYA
Sbjct  4     ACWLR---FMLLAVCLFPALVQCRVRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYA  60

Query  225   REDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQR  404
             REDDTV+V+VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQR
Sbjct  61    REDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQR  120

Query  405   GTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQ  584
             GTLLWHAHI W RATVHGA+V+LPKRG+PYPFP P KE ++VL EWWKSD EAVIN+A++
Sbjct  121   GTLLWHAHILWLRATVHGALVVLPKRGIPYPFPAPHKEVLVVLAEWWKSDTEAVINEALK  180

Query  585   SGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHN  761
             SG+APNVSDAHTINGHPG    CSS+ G+TL V+SG+TY+LR+++AA+NEELFFK+AGH 
Sbjct  181   SGLAPNVSDAHTINGHPGAVSTCSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGHK  240

Query  762   LTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTAT  941
             LTVVEVDA+YVKPFKTDT+ I PGQTTN ++T ++N GKYL+A SPFMD+ +A DN TAT
Sbjct  241   LTVVEVDATYVKPFKTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDSPIAVDNMTAT  300

Query  942   GTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIG  1121
              TL Y G  A + T L T PP+NAT V + F   LRSLNS++FPA VPL  DH+L F + 
Sbjct  301   ATLQYSGALANSPTTLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVS  360

Query  1122  IGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             +G+NPC +C   NGSR V  INN++FVMPTTALLQAH+ NISGVFT DFP +P   FNYT
Sbjct  361   LGVNPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFLNISGVFTTDFPAKPPHVFNYT  420

Query  1296  GTPPANLQTQNGTK  1337
             GTPP NLQT++GTK
Sbjct  421   GTPPTNLQTKSGTK  434



>ref|XP_007142229.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
 gb|ESW14223.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
Length=555

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/418 (67%), Positives = 348/418 (83%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE++VRHY F VV KN TR+CS+KPIV VNGKFPGP++YAREDDTV+V+VVNHV+
Sbjct  14    MLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHVK  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ F+YNFTLTGQRGTL WHAHI W R+T
Sbjct  74    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVFVYNFTLTGQRGTLWWHAHILWLRST  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGA+VILPK GVPYPFPKP+ E+VI+L EWWKSD EA+I +A++SG+APNVSDAHTING
Sbjct  134   LHGALVILPKLGVPYPFPKPNAEKVILLSEWWKSDTEAIIKEALKSGLAPNVSDAHTING  193

Query  630   HPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H G    C+S+G Y LEV++G TYLLRI++AA+NEELFFK+AGH LTVVEVDA Y KP K
Sbjct  194   HTGSVQQCASQGVYKLEVDAGNTYLLRIINAALNEELFFKIAGHQLTVVEVDAVYTKPLK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             T+TI I PGQTTN +L A++  GKYL+A +PFMD+ +A DN TAT TLHY G+ + T T 
Sbjct  254   TNTIVIAPGQTTNVLLKANRATGKYLVAATPFMDSPIAVDNVTATATLHYSGSLSSTITT  313

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PP+NATPV +TF + LRSLNSK +PA VP + DH+L F + +G+NPC TC+NGSR 
Sbjct  314   LTSLPPKNATPVATTFTDSLRSLNSKNYPARVPTKVDHNLFFTVSLGVNPCPTCVNGSRV  373

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGT-PPANLQTQNGTK  1337
             V  INN++FVMP  +LLQAH++NISGVFTDDFP +P++ +++TGT  PANL+T  GT+
Sbjct  374   VAAINNVTFVMPKISLLQAHFFNISGVFTDDFPRKPSVVYDFTGTQQPANLRTNRGTR  431



>ref|XP_008355354.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008355361.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008363414.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/435 (67%), Positives = 348/435 (80%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalIC-PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSL  218
             M  W+R   +  L A +C P  VE +VRHY F VV KN +R+CSSKPIV VNG++PGP++
Sbjct  3     MVLWIR---VXLLVACLCFPVSVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTI  59

Query  219   YAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTG  398
             YAREDDTV+++VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TG
Sbjct  60    YAREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITG  119

Query  399   QRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQA  578
             QRGTL WHAHI W RATVHGA+VILPK GVPYPFP P KE V++LGEWWKSD EAVIN+A
Sbjct  120   QRGTLWWHAHILWLRATVHGALVILPKHGVPYPFPAPRKELVVILGEWWKSDTEAVINEA  179

Query  579   MQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAG  755
             ++SG+APN+SDAHTINGHPGP   C S+ G  L V  GKTY+LRI++AA+NEELFFK+A 
Sbjct  180   LKSGLAPNISDAHTINGHPGPLSTCQSQGGLKLPVRPGKTYMLRIINAALNEELFFKIAN  239

Query  756   HNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQ  932
             H LTVVEVDA Y KPFKTDTI I PGQTTN ++T +   GKYL+A SPFMD   +  DN+
Sbjct  240   HKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKYLVAASPFMDNPTIVVDNK  299

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
             TAT TLHY GT   T T+L   PP+NAT V + F   LRSLNS +FPA VPL+ DHSLLF
Sbjct  300   TATATLHYIGTLQSTKTILTAPPPQNATTVATNFTNSLRSLNSIRFPARVPLKIDHSLLF  359

Query  1113  AIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
              +G+G++ C++C NG+R V DINN++FVMP  ALLQAH++NISGVFTDDFPG P  P+NY
Sbjct  360   TVGLGLHTCASCTNGNRVVADINNVTFVMPEIALLQAHFFNISGVFTDDFPGNPLNPYNY  419

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P NLQT+ GT+
Sbjct  420   TGTQPTNLQTRKGTR  434



>ref|XP_010529771.1| PREDICTED: laccase-4-like [Tarenaya hassleriana]
Length=559

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/419 (69%), Positives = 342/419 (82%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KNTTR+CSSK IV VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPFPTESLVRHYKFNVVMKNTTRLCSSKQIVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ GQ ++YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVYVYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPKRG+PYPFPKPD E+VIVL EWWKSD E VIN+A++SG+APNVSDAHTING
Sbjct  137   VHGALVILPKRGIPYPFPKPDNEKVIVLSEWWKSDTENVINEALKSGLAPNVSDAHTING  196

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG   +C SS+GY L VESGK YLLR+++AA+NEELFFKVAGH LTVVEVDA YVKPFK
Sbjct  197   HPGLIKSCSSSQGYKLSVESGKIYLLRLINAALNEELFFKVAGHVLTVVEVDAVYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDT+ I PGQTTN +LTA +  GK+L+ VSPFMD+ +A DN TAT T+HY GT + + TV
Sbjct  257   TDTVLIAPGQTTNVLLTAVKPAGKFLVTVSPFMDSPIAVDNVTATATVHYSGTLSSSPTV  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGS  1160
             L   PP+N+T +   F   LRSLNS K+PA VP + DH L F +G+GINPC TC   NGS
Sbjct  317   LTLPPPQNSTAMADAFTSSLRSLNSVKYPALVPKKIDHHLFFTVGLGINPCPTCKPANGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++F MPTTALLQAHY+N++GVFT DFP  P   FNYTG PPANL T  GT+
Sbjct  377   RVVASINNVTFSMPTTALLQAHYFNVNGVFTTDFPKNPPHVFNYTGAPPANLATDKGTR  435



>ref|XP_002280416.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI16002.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/433 (67%), Positives = 352/433 (81%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  W+R   ++ L A + P  V+   RHY F VV +  TR+CSSKPIV VNG FPGP+++
Sbjct  1     MTQWIR---VLLLVASLFPILVDCRTRHYKFNVVLRKATRLCSSKPIVTVNGNFPGPTIH  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+++VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ++IYNFT+TGQ
Sbjct  58    AREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGA+VILPK GVPYPFP P KE V++LGEWWKSDVEAVIN+AM
Sbjct  118   RGTLLWHAHILWLRATVHGALVILPKLGVPYPFPTPYKEAVVILGEWWKSDVEAVINEAM  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  +CS + G+TL V+ GKTY+LRI++AA+NEELF K+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGPFSSCSLQGGFTLPVDPGKTYMLRIINAALNEELFLKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
             +LTVVEVDA+Y KPF TDT+ I PGQTTN +LTA    GKYL+  S FMD+ +A DN TA
Sbjct  238   HLTVVEVDATYTKPFSTDTVLIAPGQTTNVLLTAGLGAGKYLVTASSFMDSPIAVDNMTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T T+ Y GT + T T +   PP+NAT V + F + LRSLNSKK+PA VPL TDHSLLF +
Sbjct  298   TATVQYSGTLSSTPTTITNPPPQNATSVATKFTDSLRSLNSKKYPARVPLATDHSLLFTV  357

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+GINPC+TC+NG + V +INN++FVMPTTALLQAHY+ + GV+TDDFPG P I FNYTG
Sbjct  358   GLGINPCATCVNGGKVVANINNVTFVMPTTALLQAHYFKMKGVYTDDFPGNPPIAFNYTG  417

Query  1299  TPPANLQTQNGTK  1337
             T P N QT NGT+
Sbjct  418   TQPTNFQTMNGTR  430



>gb|KDO37344.1| hypothetical protein CISIN_1g009854mg [Citrus sinensis]
Length=524

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/399 (71%), Positives = 335/399 (84%), Gaps = 2/399 (1%)
 Frame = +3

Query  147   KNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSD  326
             KN TR+CS+KPIV VNG FPGP++ AREDDTV+V+VVNHV+ NVSIHWHGVRQLRT W+D
Sbjct  2     KNATRLCSTKPIVTVNGYFPGPTIVAREDDTVLVKVVNHVKYNVSIHWHGVRQLRTCWAD  61

Query  327   GPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPK  506
             GPAYITQCPIQ GQ +IYNFTL GQRGTL WHAHI W RATVHGAIVILPKRGVPYPFPK
Sbjct  62    GPAYITQCPIQPGQNYIYNFTLAGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFPK  121

Query  507   PDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVE  683
             P KE  ++L EWWKSDVEAVIN+A++SG+APNVSDAHTINGHPGP  +C S+ G+ L VE
Sbjct  122   PHKEVTVILSEWWKSDVEAVINEALKSGLAPNVSDAHTINGHPGPLSSCPSQGGFKLPVE  181

Query  684   SGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTAD  863
             SGKTY+LR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFKT+T+ I PGQTTN +L+A 
Sbjct  182   SGKTYMLRLINAALNEELFFKIAGHKLTVVEVDAAYVKPFKTETVLIAPGQTTNVLLSAA  241

Query  864   QNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFME  1040
                GKYL+A SPF+DT  +  DN+TAT T+HY GT   T+T L   PPRNATPV + F  
Sbjct  242   HATGKYLVAASPFLDTPAILVDNKTATATVHYSGTLGSTATTLTVPPPRNATPVAANFTA  301

Query  1041  GLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQ  1220
              LRSLNSKK+PA VPL+ DHSL F IG+GINPC+TC+NGSR V DINN++FVMPT +LLQ
Sbjct  302   SLRSLNSKKYPARVPLKIDHSLFFTIGLGINPCATCVNGSRVVADINNVTFVMPTISLLQ  361

Query  1221  AHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             AH++ I GVFTDDFPG P + +N+TGT PAN QT NGT+
Sbjct  362   AHFFKIGGVFTDDFPGNPPVTYNFTGTQPANFQTNNGTR  400



>ref|XP_008377498.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 355/421 (84%), Gaps = 5/421 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VES VRHY F VV +N+T++CSSKPIV VNG+FPGP+LYAREDDTV+V+V NHV+
Sbjct  15    ILPALVESRVRHYKFNVVLRNSTKLCSSKPIVTVNGQFPGPTLYAREDDTVLVKVTNHVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPI+ GQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  75    YNVSIHWHGIRQLRTGWADGPAYITQCPIRPGQSYVYNFTITGQRGTLLWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+++LPKRGVPYPFP P KE  +VL EWWKSD EAVINQA++SG+APNVSDAHTING
Sbjct  135   VHGALIVLPKRGVPYPFPAPHKEVPVVLAEWWKSDTEAVINQALKSGLAPNVSDAHTING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP PNCSS+ G+TL VE+GKTYLLRI++AA+NEELFFK+AGH LT+VEVDA+YVKPFK
Sbjct  195   HPGPVPNCSSQGGFTLPVENGKTYLLRIINAALNEELFFKIAGHILTIVEVDATYVKPFK  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTNA++TA+QN GKY+++ SPFMD+ +A DN TAT TLHY GT A T T 
Sbjct  255   TDTIVIAPGQTTNALVTANQNSGKYMLSASPFMDSPIAVDNLTATATLHYTGTLATTPTT  314

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGS  1160
             L + PP+NAT V ++F+  L++LNSKKFPA VPL+ DH+LLF +G+GIN C +C   NGS
Sbjct  315   LTSPPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLGINSCPSCKAANGS  374

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPAN--LQTQNGT  1334
             R V  +NN++FVMPTTALLQAH++N SGVFT DFPG P   FN++G  PAN  L T  GT
Sbjct  375   RVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPTAFNFSGGLPANASLATTRGT  434

Query  1335  K  1337
             K
Sbjct  435   K  435



>ref|XP_008220423.1| PREDICTED: laccase-4 [Prunus mume]
Length=558

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/418 (68%), Positives = 339/418 (81%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE +VRHY F VV K T+R+CSSKPIV VNG++PGP++YAREDDTV+++VVNHV+
Sbjct  17    LFPASVECMVRHYKFNVVQKKTSRLCSSKPIVTVNGRYPGPTIYAREDDTVLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTVTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+VILPK GVPYPFP P KE V++LGEWWKSDVE+VINQA++SG APNVSDAHTING
Sbjct  137   VHGALVILPKLGVPYPFPAPQKEVVVILGEWWKSDVESVINQALKSGSAPNVSDAHTING  196

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP   CSS+ G+ L V  GKTY+LRI++AA+NEELFFK+A H LTVVEVDA Y KPFK
Sbjct  197   HPGPLSTCSSQGGFKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTST  983
             TDT+ I PGQTTN +L+ +   GKYL+A SPFMD   +  DN+TAT TLHY GT   T T
Sbjct  257   TDTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKTATATLHYMGTLESTRT  316

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSR  1163
              L   PP+NAT V + F   LRSLNS KFPA VPL+ DHSLLF +G+G++ C++C NG+R
Sbjct  317   TLTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFTVGLGLHTCASCANGNR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V DINN++FVMP  +LLQAH++NISGVFTDDFPG P  P+NYTG  P N+QT  GT+
Sbjct  377   LVADINNVTFVMPKISLLQAHFFNISGVFTDDFPGNPLNPYNYTGPQPTNMQTMKGTR  434



>ref|XP_009370205.1| PREDICTED: laccase-4 [Pyrus x bretschneideri]
Length=559

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 355/421 (84%), Gaps = 5/421 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VES VRHY F VV +N+T++CSSKPIV VNG+FPGP+LYAREDDTV+V+V NHV+
Sbjct  15    ILPALVESRVRHYKFNVVLRNSTKLCSSKPIVTVNGQFPGPTLYAREDDTVLVKVTNHVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPI  GQ+++YNFT+TGQRGTLLWHAHI W RAT
Sbjct  75    YNVSIHWHGIRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTLLWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+++LPKRGVPYPFP P KE  +VL EWWKSD EAVINQA++SG+APNVSDAHTING
Sbjct  135   VHGALIVLPKRGVPYPFPAPHKEVPVVLAEWWKSDTEAVINQALKSGLAPNVSDAHTING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPG  PNCSS+ G+TL V++GKTYLLRI++AA+NEELFFK+AGHNLT+VEVDA+YVKPFK
Sbjct  195   HPGLVPNCSSQGGFTLPVKNGKTYLLRIINAALNEELFFKIAGHNLTIVEVDATYVKPFK  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTNA++TA+QN GKY++A SPFMD+ +A DN TAT TLHY GT A T T 
Sbjct  255   TDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATATLHYTGTLATTPTT  314

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGS  1160
             L + PP+NAT V ++F+  L++LNSKKFPA VPL+ DH+LLF +G+GIN C +C   NGS
Sbjct  315   LTSAPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLGINSCPSCKAANGS  374

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPAN--LQTQNGT  1334
             R V  +NN++FVMPTTALLQAH++N SGVFT DFPG P   FN++G  PAN  L T +GT
Sbjct  375   RVVASVNNVTFVMPTTALLQAHFFNKSGVFTTDFPGNPPTAFNFSGGLPANASLATTSGT  434

Query  1335  K  1337
             K
Sbjct  435   K  435



>ref|XP_004490574.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=570

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/444 (64%), Positives = 357/444 (80%), Gaps = 4/444 (1%)
 Frame = +3

Query  15    WRRVQRTRIMAS--WVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVV  188
             WR+ +   ++    W+R ++L+  A  + P  VE++VRHY F VV KN TR+CS+KPIV 
Sbjct  4     WRQRELKEVIMGMMWIR-IILLLAAYCLLPLSVEAIVRHYKFNVVMKNATRLCSTKPIVT  62

Query  189   VNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQ  368
             +NG FPGP++YAREDDT++V+VVNHV+ NVSIHWHG++QLR+GW+DGPAYITQCPIQ GQ
Sbjct  63    INGNFPGPTIYAREDDTILVKVVNHVKYNVSIHWHGIKQLRSGWADGPAYITQCPIQPGQ  122

Query  369   TFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWK  548
              ++YNFTLTGQRGTL WHAHI W RATVHGAIVILPK GVPYPFP+P  E+V++L EWWK
Sbjct  123   VYVYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPRPHMEQVVILSEWWK  182

Query  549   SDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAV  725
             SD E VIN+A++SG+APNVSDAHTINGHPGPT +C+S+ G+ L+VE+GKTYLLRI++AA+
Sbjct  183   SDTEVVINEALKSGLAPNVSDAHTINGHPGPTQHCASQEGFKLQVEAGKTYLLRIINAAL  242

Query  726   NEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFM  905
             NE+LFFK+AGH L VVEVDASY KPFKTDTI I PGQTTN ++ A+   GKY++A S FM
Sbjct  243   NEDLFFKIAGHKLIVVEVDASYTKPFKTDTILIAPGQTTNVLVKANHLAGKYMVAASTFM  302

Query  906   DTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVP  1085
             D  +A DN TAT TLHY G+   T T L ++PPRNAT + + F   L+SLNS K+PA VP
Sbjct  303   DAPIAIDNVTATATLHYTGSLGSTITTLTSLPPRNATFLANNFTNSLKSLNSPKYPARVP  362

Query  1086  LQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFP  1265
              + DHSLLF I +G+NPC+TC+NG R V  INN++FVMP  +LLQAH++NISGVFTDDFP
Sbjct  363   KKVDHSLLFTISLGVNPCATCVNGGRVVAAINNVTFVMPKISLLQAHFFNISGVFTDDFP  422

Query  1266  GQPAIPFNYTGTPPANLQTQNGTK  1337
              +P   +++TG  P+NL+T  GT+
Sbjct  423   EKPPRVYDFTGKQPSNLRTNKGTR  446



>ref|XP_009384856.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/422 (68%), Positives = 344/422 (82%), Gaps = 8/422 (2%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P   +   RHY F VV+KN TR+CS K I+ VNG+FPGP+LYARE DTVIV+V NHVQ
Sbjct  15    LLPLLTQGRTRHYKFNVVAKNFTRLCSPKSIITVNGRFPGPTLYAREGDTVIVKVANHVQ  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
             ENV+IHWHGVRQL TGW+DGPAY+TQCPIQ GQ + YNFTLTGQRGTLLWHAHI WQRAT
Sbjct  75    ENVTIHWHGVRQLTTGWADGPAYVTQCPIQPGQNYAYNFTLTGQRGTLLWHAHIMWQRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFP P KE V+VL EWWKSDVEAVIN+A+QSG+ PNVSDAHTING
Sbjct  135   VHGAIVILPKRGVPYPFPAPHKEVVLVLAEWWKSDVEAVINEALQSGLGPNVSDAHTING  194

Query  630   HPGPTPNCSSK---GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKP  800
             H GPT  C+S    G+TL V+  KTYLLRI++AA+N++LFFKVAGH +TVVEVDA+Y KP
Sbjct  195   HAGPTSGCASSARDGFTLRVDQRKTYLLRIINAALNDDLFFKVAGHLMTVVEVDATYTKP  254

Query  801   FKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALT  977
             F  DT+ I PGQTTN +LTADQ  G+YL+  SPFMD+ +VA DN T T T+ Y  T A++
Sbjct  255   FTIDTLLIAPGQTTNVLLTADQGAGRYLVTASPFMDSPLVAVDNSTGTATVQY--TDAVS  312

Query  978   STVLAT--MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL  1151
             ++ +AT  +PPRN+T + S F++ LRSLNSK++PANVP   DHSLLF +G+G+NPC  C 
Sbjct  313   TSAIATTKLPPRNSTSLASQFIDSLRSLNSKQYPANVPSTVDHSLLFTVGLGVNPCPACT  372

Query  1152  NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNG  1331
             NGSR V  +NN++F+MPTTALLQAHY+N+SGVFT+DFPGQP I FNYTG+ P N QT NG
Sbjct  373   NGSRVVAAMNNVTFMMPTTALLQAHYFNMSGVFTNDFPGQPLIAFNYTGSGPNNTQTMNG  432

Query  1332  TK  1337
             T+
Sbjct  433   TR  434



>ref|XP_010907627.1| PREDICTED: laccase-22-like [Elaeis guineensis]
Length=554

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/433 (67%), Positives = 350/433 (81%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M S++R +VLVA+   + P  V+   RHY F VV K  TR+CS+KPIV VNG+FPGP+LY
Sbjct  1     MLSYIRALVLVAI---LLPVLVDGRTRHYTFNVVMKTATRLCSTKPIVTVNGRFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE D V+V V+N V+ NV+IHWHGVRQLRTGW+DGPAYITQCPIQ G ++ YNF +TGQ
Sbjct  58    AREGDNVLVNVINQVKYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGNSYAYNFIITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W R TVHGAIVILPK  VPYPFP P KEEVI+LGEWWK+D EAVINQA+
Sbjct  118   RGTLFWHAHILWLRVTVHGAIVILPKLNVPYPFPAPYKEEVIILGEWWKADTEAVINQAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             ++G+APNVSDAH INGHPGP  +C +SKG+ LEV+SG+TY+LRI++AA+NEELFFKVAGH
Sbjct  178   KTGLAPNVSDAHIINGHPGPMSDCPTSKGFQLEVKSGETYMLRIINAALNEELFFKVAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDASY KP+KTDTI I PGQTTN +LTAD+  G+YL+  S FMD+ +A DNQTA
Sbjct  238   QMTVVEVDASYTKPYKTDTILITPGQTTNVLLTADREAGRYLVTASTFMDSPIAVDNQTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
               T+HY  T + +       PP+NATPV S F++ LRSLNS+++PA VPL  DHSLLF +
Sbjct  298   MATVHYTNTLSTSILTTTDPPPQNATPVASNFIDSLRSLNSEQYPARVPLTVDHSLLFTV  357

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC TC+NGSR V D+NN+SF MPTTA+LQAHY+NISGVFTDDFPG+P I FNYTG
Sbjct  358   GLGVNPCPTCVNGSRVVADMNNVSFTMPTTAILQAHYFNISGVFTDDFPGKPPIDFNYTG  417

Query  1299  TPPANLQTQNGTK  1337
             + P NL T  GT+
Sbjct  418   SGPKNLGTMTGTR  430



>gb|AES99522.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=529

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/401 (70%), Positives = 333/401 (83%), Gaps = 1/401 (0%)
 Frame = +3

Query  138   VVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTG  317
             VV KN T++CS+K  V VNGKFPGP+LYAREDDT+IVRV N VQ NV+IHWHG++QLRT 
Sbjct  5     VVLKNETKLCSTKSFVSVNGKFPGPTLYAREDDTLIVRVTNLVQHNVTIHWHGIKQLRTC  64

Query  318   WSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYP  497
             WSDGPAY+TQCPIQTGQ+F+YNFT+TGQRGTLLWHAHI W RAT+HGAIVILPKRG PYP
Sbjct  65    WSDGPAYVTQCPIQTGQSFVYNFTITGQRGTLLWHAHITWLRATMHGAIVILPKRGTPYP  124

Query  498   FPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSKGYTLE  677
             FPKPDKE++I+LGEWWKSDVEAV+NQA  SGM PN+SDAHTINGHPGP P C S+GYTL 
Sbjct  125   FPKPDKEKIIILGEWWKSDVEAVVNQATSSGMPPNISDAHTINGHPGPVPGCISQGYTLH  184

Query  678   VESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLT  857
             VESGKTYLLRI++AA+N+ELFFK+AGH L VVE DASY+KPF+ DTIF+ PGQTTN +LT
Sbjct  185   VESGKTYLLRIINAALNDELFFKIAGHKLIVVEADASYLKPFEIDTIFLSPGQTTNVLLT  244

Query  858   ADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFM  1037
             A+Q  GKYLIA++PFMD  +  DN ++  TL YKG    T T+L  +PP NATP+T TF 
Sbjct  245   ANQPIGKYLIAITPFMDAPIGFDNLSSIATLRYKGIPPYTKTILTNIPPLNATPITKTFT  304

Query  1038  EGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALL  1217
             + LRSLNSK +P  V L  DHSLLFAI +G+NPC TC+  ++ V  INNI+F+MPT +LL
Sbjct  305   DSLRSLNSKTYPTRVSLTIDHSLLFAITVGLNPCDTCITDNKLVSAINNITFLMPTVSLL  364

Query  1218  QAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             QA+YYNI GVFTDDFP +P + F+YTGT  PANL T NGTK
Sbjct  365   QANYYNIKGVFTDDFPSKPPMVFDYTGTDQPANLHTDNGTK  405



>ref|XP_006602642.1| PREDICTED: laccase-4-like isoform X2 [Glycine max]
Length=533

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/439 (71%), Positives = 357/439 (81%), Gaps = 10/439 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   ++ L A I P  VE  VRHY F VV KNTTR+CSSKPIV VNGKFPGP+LY
Sbjct  1     MDSWVR---MLFLIACIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+V N V  NV+IHWHGVRQLRTGW+DGPAYITQCPI +GQ+++YNFTLTGQ
Sbjct  58    AREDDTVLVKVNNLVNHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAH+NW R+T+HGAIVILPKRGVPYPFPKPDKE V++LGEWWKSD E VIN+A+
Sbjct  118   RGTLLWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPG--PTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVA  752
             +SG+APNVSDAHTING PG     NCS++  Y L VESGKTYLLRI++AA+NEELFFK+A
Sbjct  178   KSGLAPNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIA  237

Query  753   GHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDN  929
             GH  TVVEVDASYVKPFKTDT+ I PGQTTNA+LTADQN GKY I  S FMD+ +VA DN
Sbjct  238   GHPFTVVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDN  297

Query  930   QTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLL  1109
              TAT TLHY GT A T T+L T PPRNAT V + F   L+SLNSKK+PA VP + DHSLL
Sbjct  298   LTATATLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLL  357

Query  1110  FAIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIP  1283
               +G+GINPC +C   NGSR V  +NN++FVMPTTALLQAHY+NI GVFT DFPG P+  
Sbjct  358   LTVGLGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHV  417

Query  1284  FNYTGTPPANL-QTQNGTK  1337
             +NYT TPPA   QT NGTK
Sbjct  418   YNYTATPPAAAWQTTNGTK  436



>ref|XP_010535416.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535417.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535418.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535419.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
Length=568

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/423 (68%), Positives = 346/423 (82%), Gaps = 7/423 (2%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V S+VRHY F VV KNTT++CSSKPIV VNG FPGP++ AREDDTV+V+VVNHV+
Sbjct  22    LLPTTVHSMVRHYKFNVVMKNTTKLCSSKPIVTVNGMFPGPTIVAREDDTVLVKVVNHVK  81

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHG+RQLRTGW+DGPAYITQCPIQTGQ++ YNFTL GQRGTL WHAHI W RAT
Sbjct  82    YNLSIHWHGIRQLRTGWADGPAYITQCPIQTGQSYTYNFTLAGQRGTLWWHAHILWLRAT  141

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFP+P KE++IVLGEWWKSDVEAVIN+A +SG+APNVSDAHTING
Sbjct  142   VHGAIVILPKLGVPYPFPQPHKEKIIVLGEWWKSDVEAVINEATRSGLAPNVSDAHTING  201

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP PNC S +GY L V+ GKTY+LRIV+AA+NEELFFK+AGH LTVVEVDA Y KPFK
Sbjct  202   HTGPLPNCPSQQGYGLPVKPGKTYMLRIVNAALNEELFFKIAGHELTVVEVDAVYTKPFK  261

Query  807   TDTIFIGPGQTTNAVLTADQNGG-KYLIAVSPFMDTIVATDNQTATGTLHYKG-----TQ  968
             TDT+ I PGQTTN +LTA+   G  Y++A + +MD  +A DN TAT TLHY G       
Sbjct  262   TDTVVIAPGQTTNVLLTANAYAGSNYMVAATTYMDAPIAFDNVTATATLHYVGPTTANAN  321

Query  969   ALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC  1148
             A   TVLAT+PP+NAT V + F++ LRSLNS+++PA VP+  DHSL F +G+G+NPC +C
Sbjct  322   AAAKTVLATLPPQNATWVATKFIKSLRSLNSEEYPARVPMNVDHSLFFTVGLGVNPCRSC  381

Query  1149  LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQN  1328
             +NGSR V DINN++FVMP  ALLQAH++N+ GVFTDDFP +P+ P+NYTGT PAN  T  
Sbjct  382   VNGSRVVADINNVTFVMPKIALLQAHFFNLPGVFTDDFPARPSHPYNYTGTQPANPATMK  441

Query  1329  GTK  1337
             GT+
Sbjct  442   GTR  444



>ref|XP_009407561.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=559

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/420 (67%), Positives = 338/420 (80%), Gaps = 4/420 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P   E + RHY F V  K  TR+CS+K I  VNG+FPGP+LYARE DTV+V+VVNHV 
Sbjct  16    LLPLLAEGITRHYKFNVAEKKFTRLCSTKSIATVNGQFPGPTLYAREGDTVLVKVVNHVH  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQLRTGW+DGPAYITQCPIQ GQ ++YNFTLTGQRGTL WHAHI+W RAT
Sbjct  76    YNVTIHWHGVRQLRTGWADGPAYITQCPIQPGQNYVYNFTLTGQRGTLWWHAHISWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIV+LPK  VPYPFP P KE V+VL EWWKSD EAVIN+A+ SG+APNVSDAHTING
Sbjct  136   VHGAIVVLPKSNVPYPFPAPHKEVVLVLAEWWKSDTEAVINEALNSGLAPNVSDAHTING  195

Query  630   HPGPTPNCSSK---GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKP  800
             H GP   CSS    G+TL+V+ GK YLLRI++AA+NE+LFFKVAGH LTVVEVDA+Y KP
Sbjct  196   HAGPLSGCSSSARDGFTLQVDKGKRYLLRIINAALNEDLFFKVAGHQLTVVEVDAAYTKP  255

Query  801   FKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALT  977
             F TDT+ + PGQTTN +LTA Q  G+Y++  SPFMD+ +VA DN+TAT T+ Y  + + +
Sbjct  256   FTTDTLLLTPGQTTNVLLTARQGAGRYIVTASPFMDSPLVAVDNRTATATVQYANSVSTS  315

Query  978   STVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG  1157
             +      PP+NATPV S+F + LRSLNS+++PA VP   DHSLLF +G+G+NPC+TC NG
Sbjct  316   AITTTKPPPQNATPVASSFTDSLRSLNSQQYPAKVPATVDHSLLFTVGLGVNPCATCANG  375

Query  1158  SRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             SR V DINN+SFVMPTTALLQAHY+N SGVFTDDFPGQP I FNYTG+ P NLQT +GT+
Sbjct  376   SRVVADINNVSFVMPTTALLQAHYFNASGVFTDDFPGQPPIAFNYTGSGPRNLQTMSGTR  435



>ref|XP_006338994.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=557

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/420 (68%), Positives = 335/420 (80%), Gaps = 4/420 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
              C  PV  V RHY F VV +N + +CSSKPIV VNG+FPGP++YAREDD V+++VVNHV+
Sbjct  14    FCFFPVFGVTRHYKFNVVMRNMSCLCSSKPIVTVNGRFPGPTIYAREDDRVLIKVVNHVK  73

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTL WHAHI W RAT
Sbjct  74    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRAT  133

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKP+ E V+VLGEWWKSD EAV N+A+ SG+APNVSDAHTING
Sbjct  134   VHGAIVILPKRGVPYPFPKPNHEAVVVLGEWWKSDTEAVANEALNSGLAPNVSDAHTING  193

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP  NC S+ GY L V  GKTY+LR+++AA+NEELFFK+AGH +TVVEVDA+YVKPFK
Sbjct  194   HPGPVSNCPSQGGYRLSVAPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFK  253

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTN +LTADQN GKY++  SPFMD+ V  DN TAT TLHY G  +     
Sbjct  254   TDTILIAPGQTTNVLLTADQNFGKYMVVASPFMDSPVTVDNVTATATLHYTGALSNAPMT  313

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L + PP+NAT V + F+  L+SLNSKK+PA VP   DHSLLF +G+GINPC TC+  NG 
Sbjct  314   LTSAPPQNATSVANNFIHSLKSLNSKKYPAKVPKNIDHSLLFTVGLGINPCPTCIPSNGI  373

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGT-PPANLQTQNGTK  1337
             R V  INN++FVMP TALLQAH++ I  VFT DFPG P   FNYT T PP +L T NGTK
Sbjct  374   RVVASINNVTFVMPKTALLQAHFFGIKNVFTMDFPGNPPFVFNYTSTVPPPSLATMNGTK  433



>ref|XP_007207096.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
 gb|EMJ08295.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
Length=558

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/418 (67%), Positives = 338/418 (81%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE +VRHY F VV K T+R+CSSKPIV VNG++PGP++YAREDDTV+++VVNHV+
Sbjct  17    LFPASVECMVRHYKFNVVQKKTSRLCSSKPIVTVNGRYPGPTIYAREDDTVLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             +HGA+VILPK GVPYPFP P KE V++LGEWWKSDVE+VINQA++SG APNVSDAHTING
Sbjct  137   LHGALVILPKLGVPYPFPAPQKEVVVILGEWWKSDVESVINQALKSGSAPNVSDAHTING  196

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP   CSS+ G+ L V  GKTY+LRI++AA+NEELFFK+A H LTVVEVDA Y KPFK
Sbjct  197   HSGPLSTCSSQGGFKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTST  983
             TDT+ I PGQTTN +L+ +   GKYL+A SPFMD   +  DN+TAT TLHY GT   T T
Sbjct  257   TDTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKTATATLHYTGTPESTRT  316

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSR  1163
              L   PP+NAT V + F   LRSLNS KFPA VPL+ DHSLLF +G+G++ C++C NG+R
Sbjct  317   TLTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFTVGLGLHTCASCANGNR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V DINN++FVMP  +LLQAH++NISGVFTDDFPG P  P+NYTG  P N+QT  GT+
Sbjct  377   VVADINNVTFVMPKISLLQAHFFNISGVFTDDFPGNPLNPYNYTGPQPTNMQTMKGTR  434



>ref|XP_006293932.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
 gb|EOA26830.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
Length=558

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/418 (68%), Positives = 337/418 (81%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KNTTR+CSSKPIV VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GAIVILPKRGVPYPFPKPD E+VIVLGEWWKSD E VIN+A++SG+APNVSDAH ING
Sbjct  137   VNGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDVINEALKSGLAPNVSDAHMING  196

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             HPGP  NC S+GY L VE+GKTYLLR+++AA+NEELFFKVAGH  TVVEVDA YVKPFK 
Sbjct  197   HPGPVKNCPSQGYKLSVENGKTYLLRLINAALNEELFFKVAGHIFTVVEVDAVYVKPFKI  256

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DT+ I PGQTTN +LTA ++ GK+L+  SPFMD  +A DN TAT T+HY GT + + TVL
Sbjct  257   DTVLIAPGQTTNVLLTASKSAGKFLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVL  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NAT V + F   LRSLNSKK+PA VP   DH LLF +G+G+N C TC   NGSR
Sbjct  317   TLPPPQNATSVANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNACPTCKAGNGSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++F+MP TALL AHY+N SGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   VVASINNVTFIMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  434



>ref|XP_004980096.1| PREDICTED: laccase-22-like [Setaria italica]
Length=589

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/445 (64%), Positives = 350/445 (79%), Gaps = 13/445 (3%)
 Frame = +3

Query  12    SWRRVQRTRIMASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVV  191
             S R + R  +MAS+V          L+      ++ RHY F V+ +N TR+CS+KPI+ V
Sbjct  31    SLRCLVRLLLMASFV----------LLQALSAHAITRHYKFNVIMRNVTRLCSTKPILTV  80

Query  192   NGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQT  371
             NGKFPGP+LYAREDD V+V+VVNHV  NV+IHWHGVRQ+RTGWSDGPAYITQCPIQ G +
Sbjct  81    NGKFPGPTLYAREDDNVLVKVVNHVTHNVTIHWHGVRQIRTGWSDGPAYITQCPIQPGTS  140

Query  372   FIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKS  551
             F+YNFT+TGQRGTLLWHAHINW RATVHGAIVILPK GVPYPFP P KE V+VLGEWWK+
Sbjct  141   FLYNFTVTGQRGTLLWHAHINWLRATVHGAIVILPKLGVPYPFPTPHKEVVVVLGEWWKA  200

Query  552   DVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK--GYTLEVESGKTYLLRIVSAAV  725
             D E VINQAMQ G+ PNVSD+HTINGHPGP  +C+S   G+ L VE+GKTY+LRI++AA+
Sbjct  201   DTEVVINQAMQQGVGPNVSDSHTINGHPGPLSDCASSQDGFKLNVENGKTYMLRIINAAL  260

Query  726   NEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFM  905
             N++LFFK+AGH  TVVEVDA Y KPFKT T+ I PGQTTN +LTAD+  G+YL++VSPFM
Sbjct  261   NDDLFFKIAGHKFTVVEVDAVYTKPFKTATLLITPGQTTNVLLTADRTAGRYLLSVSPFM  320

Query  906   DTIVATDNQTATGTLHYKGTQALTSTV-LATMPPRNATPVTSTFMEGLRSLNSKKFPANV  1082
             D  V  DN+T T TLHY  T + T+ + L   PP+NAT + S F+E LRSLNS+++PANV
Sbjct  321   DAPVQVDNKTGTATLHYANTISATAPLTLIKPPPQNATTIVSKFVESLRSLNSEEYPANV  380

Query  1083  PLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDF  1262
             PL  DHSL+F +G+G+NPC+ C+N +R VG INN++F+MP+T +LQAHYYNI GVFTDDF
Sbjct  381   PLTVDHSLVFTVGVGVNPCAKCINATRLVGTINNVTFIMPSTPILQAHYYNIPGVFTDDF  440

Query  1263  PGQPAIPFNYTGTPPANLQTQNGTK  1337
             P  P   FNYTG+ P NLQT  GT+
Sbjct  441   PATPPHKFNYTGSGPKNLQTMKGTR  465



>ref|XP_003522150.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN02155.1| Laccase-4 [Glycine soja]
Length=557

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/434 (69%), Positives = 350/434 (81%), Gaps = 6/434 (1%)
 Frame = +3

Query  45    ASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYA  224
             + WVR   +V L A I P  VE  VRHY F VVSK T R+CSSK IV +NGKFPGP+LYA
Sbjct  3     SHWVR---MVLLIACILPALVECRVRHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYA  59

Query  225   REDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQR  404
             REDDTV+V+V+N V  NV+IHWHGVRQLRTGW+DGPAY+TQCPIQ GQT++YNFTLTGQR
Sbjct  60    REDDTVLVKVINQVNHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYLYNFTLTGQR  119

Query  405   GTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQ  584
             GTLL+HAH+NW R+T+HGA+VILPKRGVPYPFPKPD E V+VLGEWWKSD EA+IN+A++
Sbjct  120   GTLLYHAHVNWLRSTLHGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAIINEALK  179

Query  585   SGMAPNVSDAHTINGHPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHN  761
             SG+APNVSDAHTING PG   NCS++  Y L VESGKTYLLRI++AA+NEELFFK+AGH 
Sbjct  180   SGLAPNVSDAHTINGLPGAVTNCSTQDVYNLPVESGKTYLLRIINAALNEELFFKIAGHK  239

Query  762   LTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTAT  941
             LTVVEVDA+YVKPFK +TI I PGQTTN +L ADQ  GKYL+A SPFMD  +A DN TAT
Sbjct  240   LTVVEVDATYVKPFKIETILIAPGQTTNVLLNADQKFGKYLVAASPFMDAPIAVDNLTAT  299

Query  942   GTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIG  1121
              TLHY GT A T T+L T PP+N+T + + F+  LR LNSKK+P NVPL  DHSL F +G
Sbjct  300   ATLHYTGTLAATPTILTTPPPKNSTQIANNFISSLRGLNSKKYPVNVPLTVDHSLFFTVG  359

Query  1122  IGINPCSTC--LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             +GI+PC +C   NGSR V  INN++F+MPT ALLQAHY+NI GVFT DFP  P   FNY+
Sbjct  360   LGISPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHLFNYS  419

Query  1296  GTPPANLQTQNGTK  1337
             G  PANL T+ GTK
Sbjct  420   GPGPANLNTETGTK  433



>ref|XP_004294236.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/435 (66%), Positives = 351/435 (81%), Gaps = 3/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  W R ++LVA  + + P P E + RHY F VV K T+R+CSSKPIV +NGK+PGP++Y
Sbjct  3     MVLWFRALLLVACISCLFPAPAECLERHYKFNVVLKKTSRLCSSKPIVTINGKYPGPTIY  62

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+VVNHV+ NVSIHWHG+RQLR GW+DGPAYITQCPIQ GQ ++YNFT+TGQ
Sbjct  63    AREDDTVLVKVVNHVKYNVSIHWHGIRQLRNGWADGPAYITQCPIQPGQQYVYNFTVTGQ  122

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATV+GA+V+LPK GVPYPFP P KE V++LGEWWKSDVEAVIN+A+
Sbjct  123   RGTLWWHAHILWLRATVYGALVVLPKLGVPYPFPAPKKEVVVILGEWWKSDVEAVINEAL  182

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG APNVSDAHTINGHPGP   CSS+ GY L V+ G TYLLRI++AA+N+ELFFKVA H
Sbjct  183   KSGAAPNVSDAHTINGHPGPLSLCSSQGGYKLPVQPGHTYLLRIINAALNDELFFKVANH  242

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQT  935
              LTVVEVDA Y KPF+T TI I PGQTTN +LTAD++ GKYL+A SPFMD   VA DN+T
Sbjct  243   KLTVVEVDAVYTKPFETTTILIAPGQTTNVLLTADRSTGKYLVAASPFMDNPTVAVDNKT  302

Query  936   ATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             AT TLHY+G+ A T+T+L   PP+NAT + ++F + LRSLNS  +PA VPL+ DHSL+F 
Sbjct  303   ATATLHYRGSLASTNTILTVPPPQNATRLATSFTKSLRSLNSDTYPAKVPLKIDHSLMFT  362

Query  1116  IGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             + +G+  C +C NG+R V D+NN++FVMP  +LLQAH +NISGVFTDDFPG P +P+NYT
Sbjct  363   VSLGLQTCPSCANGNRVVADLNNVTFVMPKISLLQAHVFNISGVFTDDFPGNPLMPYNYT  422

Query  1296  GT-PPANLQTQNGTK  1337
             G   P N+QT  GT+
Sbjct  423   GAQQPTNMQTMKGTR  437



>ref|XP_002879726.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55985.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 338/418 (81%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES++RHY F VV KNTTR+CSSKPIV VNG++PGP++YAREDDT++++VVNHV+
Sbjct  16    VFPAPSESIIRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVK  75

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  76    YNLSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  135

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GA+VILPKRGVPYPFPKPD E+VIVLGEWWKSD E +IN+A++SG+APNVSDAH ING
Sbjct  136   VYGALVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENIINEALKSGLAPNVSDAHMING  195

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             HPGP  NC S+GY L VE+GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFKT
Sbjct  196   HPGPVKNCPSQGYKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVVEVDAVYVKPFKT  255

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DT+ I PGQTTN +LTA ++ GKYL+  SPFMD  +A DN TAT T+HY GT + + T+L
Sbjct  256   DTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTIL  315

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NAT + + F + LRSLNSKK+PA VP   DH L F +G+G+N C TC   NGSR
Sbjct  316   TLPPPQNATSIANNFTKSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNACPTCKAGNGSR  375

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++F+MP TALL AHY+N SGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  376   VVASINNVTFIMPKTALLPAHYFNTSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  433



>ref|XP_008442464.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis melo]
Length=559

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/419 (69%), Positives = 339/419 (81%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P   ES VRHY F VV +  TR+CSSKPIV VNG+FPGP+LYARE D V+++VVNHV+
Sbjct  17    LLPGLAESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTLYAREGDNVLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTL WHAHI W RAT
Sbjct  77    YNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHG +VILPK GVPYPFP P+KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  137   VHGGLVILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEALKSGLAPNVSDAHTING  196

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PG  PNC S +G+TL V+ GKTYLLRI++AA+NEELFFKVAGH LTVVEVDA+YVKPFK
Sbjct  197   LPGSIPNCPSQRGFTLPVQRGKTYLLRIINAALNEELFFKVAGHKLTVVEVDATYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDT+ I PGQTTN +LTA+QN GKY++AVSPFMD  VA DN+TAT T+HY GT A + T 
Sbjct  257   TDTVIIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATATVHYTGTLATSLTT  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGS  1160
                 PP+NAT + + F+  LRSLNSKK+PANVPL  DH L F +G+GINPC TC   NGS
Sbjct  317   STNPPPQNATQIANAFINSLRSLNSKKYPANVPLTIDHHLFFTVGLGINPCPTCKAANGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++FVMPTTALLQAH++   GVFT DFP +P   FNY+G  P NLQT   TK
Sbjct  377   RVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPXKPPHKFNYSGPGPKNLQTTTATK  435



>ref|XP_009593274.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=554

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/435 (66%), Positives = 349/435 (80%), Gaps = 8/435 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW+R  VL+A        P   + RHY F VV +N +R+CS+KPIV VNG+FPGP++Y
Sbjct  1     MESWLRFFVLLAFL-----SPAFGITRHYKFNVVMRNMSRLCSTKPIVTVNGRFPGPTIY  55

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDD V+++VVNHV+ NV+IHWHG+RQLRTGW+DGPAYITQCPIQ GQ++IYNFT+TGQ
Sbjct  56    AREDDRVLIKVVNHVKYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQ  115

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAH+ W R+TVHGAIV+LPKRGVPYPFPKP+ E V+VL EWWKSD EAVIN+A+
Sbjct  116   RGTLFWHAHVLWLRSTVHGAIVVLPKRGVPYPFPKPNHEAVVVLAEWWKSDTEAVINEAL  175

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPGP  NC ++ GY+L VE GKTY+LR+++AA+NEELFFK+AGH
Sbjct  176   KSGLAPNVSDAHTINGHPGPVSNCPTQGGYSLSVEPGKTYMLRVINAALNEELFFKIAGH  235

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+YVKPFKTDTI I PGQTTN ++TADQ+ GKY++A SPFMD  +A DN TA
Sbjct  236   KMTVVEVDATYVKPFKTDTIVIAPGQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITA  295

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY G    + T L + PP+NAT V + F++ L+SLNSKK+PA VP   DHSL F  
Sbjct  296   TATLHYSGALGTSPTTLTSTPPQNATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTA  355

Query  1119  GIGINPCSTC--LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+GINPC TC   NGSR V  +NN++FVMPT ALLQAH++ I+GVFT DFP  P   FNY
Sbjct  356   GLGINPCPTCKQANGSRVVASVNNVTFVMPTVALLQAHFFGINGVFTTDFPANPPFVFNY  415

Query  1293  TGTPPANLQTQNGTK  1337
             TGTPP NL T  GTK
Sbjct  416   TGTPPTNLATTKGTK  430



>ref|XP_010505418.1| PREDICTED: laccase-4 [Camelina sativa]
Length=558

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/418 (68%), Positives = 336/418 (80%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KNTTR+CSSKPIV VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GAIVILPKRGVPYPFPKPD E+VIVLGEWWKSD E +IN+A++SG+APNVSDAH ING
Sbjct  137   VNGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDIINEALKSGLAPNVSDAHMING  196

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             HPGP  NC S+GY L VE+GKTYLLR+++AA+NEELFFKVAGH  TVVEVDA YVKPFK 
Sbjct  197   HPGPVKNCPSQGYKLSVENGKTYLLRLINAALNEELFFKVAGHLFTVVEVDAVYVKPFKI  256

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DT+ I PGQTTN +LTA ++ GKYL+  SPFMD  +A DN TAT T+HY GT + + TV 
Sbjct  257   DTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVR  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NAT + + F   LRSLNSKK+PA VP   DH LLF +G+G+N C TC   NGSR
Sbjct  317   TLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNACPTCKAGNGSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++FVMP TALL AHY+N SGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   VVASINNVTFVMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  434



>ref|XP_010517091.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/418 (68%), Positives = 336/418 (80%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KNTTR+CSSKPIV VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GAIVILPKRGVPYPFPKPD E+VIVLGEWWKSD E +IN+A++SG+APNVSDAH ING
Sbjct  137   VNGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDIINEALKSGLAPNVSDAHMING  196

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             HPGP  NC S+GY L VE+GKTYLLR+++AA+NEELFFKVAGH  TVVEVDA YVKPFK 
Sbjct  197   HPGPVKNCPSQGYKLPVENGKTYLLRLINAALNEELFFKVAGHLFTVVEVDAVYVKPFKI  256

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DT+ I PGQTTN +LTA ++ GKYL+  SPFMD  +A DN TAT T+HY GT + + TV 
Sbjct  257   DTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVR  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NAT + + F   LRSLNSKK+PA VP   DH LLF +G+G+NPC TC   NGSR
Sbjct  317   TLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNPCPTCKAGNGSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++FVMP TALL AHY+  SGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   VVASINNVTFVMPKTALLSAHYFKKSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  434



>ref|XP_003516941.1| PREDICTED: laccase-4-like [Glycine max]
Length=557

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/436 (69%), Positives = 351/436 (81%), Gaps = 6/436 (1%)
 Frame = +3

Query  39    IMASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSL  218
             + + WVR   L+ L A I P  VE   RHY F VVSK T R+CSSK IV +NGKFPGP+L
Sbjct  1     MYSHWVR---LMLLIACILPALVECRERHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTL  57

Query  219   YAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTG  398
             YAREDDTV+V+V+N V  NV+IHWHGVRQLRTGW+DGPAY+TQCPIQ GQT++YNFTLTG
Sbjct  58    YAREDDTVLVKVINQVNHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYVYNFTLTG  117

Query  399   QRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQA  578
             QRGTLL+HAH+NW R+T++GA+VILPKRGVPYPFPKPD E V+VLGEWWKSD EAVIN+A
Sbjct  118   QRGTLLYHAHVNWLRSTLYGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAVINEA  177

Query  579   MQSGMAPNVSDAHTINGHPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAG  755
             ++SG+APNVSDAHTING PG   NCS++  Y L VESGKTYLLRIV+AA+NEELFFK+AG
Sbjct  178   LKSGLAPNVSDAHTINGLPGTVTNCSTQDVYNLPVESGKTYLLRIVNAALNEELFFKIAG  237

Query  756   HNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQT  935
             H LTVVEVDA+YVKPFK +TI I PGQTTN +L A+Q  GKYL+A SPFMD  VA DN T
Sbjct  238   HKLTVVEVDATYVKPFKIETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVAVDNLT  297

Query  936   ATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             AT TLHY GT A T T+L T PP+NAT + + F+  LR LNSKK+P NVPL  DHSL+F 
Sbjct  298   ATATLHYTGTLAATPTILTTPPPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFT  357

Query  1116  IGIGINPCSTC--LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFN  1289
             +G+GINPC +C   NGSR V  INN++F+MPT ALLQAHY+NI GVFT DFP  P   FN
Sbjct  358   VGLGINPCPSCKAANGSRVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHVFN  417

Query  1290  YTGTPPANLQTQNGTK  1337
             Y+G  PANL T+ GTK
Sbjct  418   YSGPGPANLNTETGTK  433



>ref|XP_006602641.1| PREDICTED: laccase-4-like isoform X1 [Glycine max]
Length=560

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/439 (71%), Positives = 357/439 (81%), Gaps = 10/439 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   ++ L A I P  VE  VRHY F VV KNTTR+CSSKPIV VNGKFPGP+LY
Sbjct  1     MDSWVR---MLFLIACIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+V N V  NV+IHWHGVRQLRTGW+DGPAYITQCPI +GQ+++YNFTLTGQ
Sbjct  58    AREDDTVLVKVNNLVNHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAH+NW R+T+HGAIVILPKRGVPYPFPKPDKE V++LGEWWKSD E VIN+A+
Sbjct  118   RGTLLWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPG--PTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVA  752
             +SG+APNVSDAHTING PG     NCS++  Y L VESGKTYLLRI++AA+NEELFFK+A
Sbjct  178   KSGLAPNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIA  237

Query  753   GHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDN  929
             GH  TVVEVDASYVKPFKTDT+ I PGQTTNA+LTADQN GKY I  S FMD+ +VA DN
Sbjct  238   GHPFTVVEVDASYVKPFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDN  297

Query  930   QTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLL  1109
              TAT TLHY GT A T T+L T PPRNAT V + F   L+SLNSKK+PA VP + DHSLL
Sbjct  298   LTATATLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLL  357

Query  1110  FAIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIP  1283
               +G+GINPC +C   NGSR V  +NN++FVMPTTALLQAHY+NI GVFT DFPG P+  
Sbjct  358   LTVGLGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHV  417

Query  1284  FNYTGTPPANL-QTQNGTK  1337
             +NYT TPPA   QT NGTK
Sbjct  418   YNYTATPPAAAWQTTNGTK  436



>ref|XP_004246339.1| PREDICTED: laccase-4 [Solanum lycopersicum]
Length=561

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/426 (67%), Positives = 344/426 (81%), Gaps = 13/426 (3%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  VRHY F VV KNTTR+CSSK IV VNGKFPGP++YARE D V+++VVNHV+
Sbjct  15    LFPLVVECRVRHYKFNVVMKNTTRLCSSKSIVTVNGKFPGPTIYAREGDNVLIKVVNHVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTL WHAHI W RAT
Sbjct  75    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFPKP+ E V++L EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  135   VHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGLAPNVSDAHTING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP  NC ++ GY L VE GKTY+LR+++AA+NEELFFK+AGH +TVVEVDA+Y+KPF+
Sbjct  195   HPGPVSNCPAQGGYKLNVEQGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYIKPFQ  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQA-----  971
             TDTI I PGQTTN ++ A++N GKY++  SPFMD  +A DN TA  TLHY GT +     
Sbjct  255   TDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDAPIAVDNVTAIATLHYSGTLSNNPST  314

Query  972   -LTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC  1148
              LTST     PP+NATP+ + F++ LRSLNSKK+PA VP++ DHSLLF +G+GINPC +C
Sbjct  315   TLTST---NTPPKNATPIANNFLDALRSLNSKKYPAKVPIKIDHSLLFTVGLGINPCPSC  371

Query  1149  L--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG-TPPANLQ  1319
                NGSR V  INN++FVMPT ALLQAH+  I GVFT DFPG P + +NYT  TPPAN+ 
Sbjct  372   KQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGVFTADFPGNPPVVYNYTSTTPPANMG  431

Query  1320  TQNGTK  1337
             T +GTK
Sbjct  432   TTSGTK  437



>ref|XP_009374280.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/435 (66%), Positives = 346/435 (80%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalIC-PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSL  218
             M  W+R   +V L A +C P  VE +VRHY F VV KN +R+CSSKPIV VNG++PGP++
Sbjct  3     MVPWIR---VVLLVACLCFPVSVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTI  59

Query  219   YAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTG  398
             YAREDDTV+++VVNHV+ NVSIHWHG+RQLRTGW+DGPAYITQCPIQ  Q ++YNFT+TG
Sbjct  60    YAREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPDQQYVYNFTITG  119

Query  399   QRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQA  578
             QRGTL WHAHI W RATVHGA+VILPK GVPYPFP P KE V++LGEWWKSD EAVIN+A
Sbjct  120   QRGTLWWHAHILWLRATVHGALVILPKLGVPYPFPAPQKELVVILGEWWKSDTEAVINEA  179

Query  579   MQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAG  755
             ++SG+APNVSDAHTINGHPGP   C  + G  L V  GKTY+LRI++AA+NEELFFK+A 
Sbjct  180   LRSGLAPNVSDAHTINGHPGPLSTCQPQGGLKLPVRPGKTYMLRIINAALNEELFFKIAN  239

Query  756   HNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQ  932
             H LTVVEVDA Y KPFKTDTI I PGQTTN ++T +   GK+L+A SPFMD   +  DN+
Sbjct  240   HKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVTTNLGSGKFLVAASPFMDNPTIVVDNK  299

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
             TAT TLHY GT   T T+L   PP+NAT V + F   L+SLNS +FPA VPL+ DHSLLF
Sbjct  300   TATATLHYIGTLQSTKTILTAPPPQNATIVATNFTNSLKSLNSIRFPARVPLKVDHSLLF  359

Query  1113  AIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
              + +G++ C++C NG+R V DINN++FVMP  ALLQAH++NISGVFTDDFPG P  P+NY
Sbjct  360   TVSLGLHTCASCTNGNRVVADINNVTFVMPKIALLQAHFFNISGVFTDDFPGNPLNPYNY  419

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P NLQT+ GT+
Sbjct  420   TGTQPTNLQTRKGTR  434



>ref|XP_006349470.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=556

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/435 (68%), Positives = 350/435 (80%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW+R   ++ L A + P  VE  +R YNF V+ K TTR+CSSKPI  VNGKFPGP++Y
Sbjct  1     MESWLR---ILFLFACLFPAFVECRIRRYNFNVMMKTTTRLCSSKPIATVNGKFPGPTIY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE D V+V VVNHV+ NVSIHWHGVRQLRTGWSDGPAYITQCPIQ GQ ++YNFT+TGQ
Sbjct  58    AREGDNVLVNVVNHVKYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGQNYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RAT+HGAIVILPK GVPYPFPKPD E V+VL EWWKSD EAVINQA+
Sbjct  118   RGTLFWHAHILWLRATMHGAIVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPG   NC S+ GYTL V+ GK+Y+LR+++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGAISNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+YVKPFKTDTI I PGQTTN ++TA++  GKY++A SPFMD  +A DN TA
Sbjct  238   KMTVVEVDATYVKPFKTDTIIIAPGQTTNVIVTANKGSGKYMVAASPFMDAPIAVDNVTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A + T L   PP+NATPV + F++ LRSLNSKK+PA VP + DHSL F +
Sbjct  298   TATLHYSGTLASSITTLTNTPPKNATPVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+G+NPCS+C   NGSR V  INN++FVMPT A+LQAH++ I GV+T DFP  P   FNY
Sbjct  358   GLGVNPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTTDFPQNPPFKFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TGTPP NL T +GTK
Sbjct  418   TGTPPTNLATMSGTK  432



>ref|XP_009337309.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/435 (66%), Positives = 345/435 (79%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalIC-PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSL  218
             M  W+R   +V L A +C P  VE +VRHY F VV KN +R+CSSKPIV VNG++PGP++
Sbjct  3     MVQWIR---VVLLVACLCFPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTI  59

Query  219   YAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTG  398
             YAREDDTV+V+VVNH + NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TG
Sbjct  60    YAREDDTVLVKVVNHAKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITG  119

Query  399   QRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQA  578
             QRGTL WHAHI W RAT+HGA+V+LPK GVPYPFP P KE V++LGEWWKSD E VI QA
Sbjct  120   QRGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQA  179

Query  579   MQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAG  755
             ++SG+APNVSDAHTINGH GP   C S+ G  L V  GKTY+LRI++AA+NEELFFK+A 
Sbjct  180   LKSGLAPNVSDAHTINGHTGPISTCQSQGGIKLPVRPGKTYMLRIINAALNEELFFKIAN  239

Query  756   HNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQ  932
             H LTVVEVDA Y KPFKTDTI I PGQTTN +++ +   GKYL+A SPFMD   +  DN+
Sbjct  240   HKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNK  299

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
             TAT TLHY GT   T+T+L   PP+NAT V + F   LRSLNS +FPA VPL+ DHSLLF
Sbjct  300   TATATLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLF  359

Query  1113  AIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
              +G+G++ C++C NG+R V DINN++FVMP   LLQAH++NISGVFTDDFPG P  P+NY
Sbjct  360   TVGLGLHTCASCANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFTDDFPGNPLNPYNY  419

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P N+QT+ GT+
Sbjct  420   TGTQPTNMQTKKGTR  434



>ref|XP_010486777.1| PREDICTED: laccase-22-like isoform X1 [Camelina sativa]
Length=554

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/413 (69%), Positives = 342/413 (83%), Gaps = 7/413 (2%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E+ +R Y F VV KN T++CS+KPIV +NGKFPGP+LYAREDD VIV + N+V  NV+IH
Sbjct  22    EANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNVTIH  81

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGV+QLRTGWSDGPAYITQCP+Q G TF+YNFTLTGQRGTLLWHAHI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFP+P  E +IV GEWW SDVEAVI+Q+ QSG+ PN+SDAHTING  G  P
Sbjct  142   ILPKRGVPYPFPRPHTERIIVFGEWWNSDVEAVISQSTQSGLPPNISDAHTINGLTGQVP  201

Query  648   NCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
              C S+GYTL VE+GK YLLRI++AAVN+ELFFK+AGHNLTVVEVDA+Y+KPF T+T+F+G
Sbjct  202   GCKSRGYTLHVETGKKYLLRIINAAVNDELFFKIAGHNLTVVEVDATYIKPFDTETLFLG  261

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKG--TQALTSTVLATMP  1001
             PGQTTNA+LTA+   G +L+ +SPFMDT+V  +N TAT  L YK   TQAL S   + +P
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAFLRYKDTRTQALKS---SKIP  318

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P NAT +   F + LRSLNS  +P NVPL+ DHSL FAIG+G+NPC+TC+NG++ + DIN
Sbjct  319   PVNATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADIN  378

Query  1182  NISFVMPTTALLQAHYYNIS-GVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N+SFVMPT A+LQAHY+N S GVFTDDFPG+P+ PFNYTG   +NL+T+NGTK
Sbjct  379   NVSFVMPTVAMLQAHYFNKSEGVFTDDFPGKPSTPFNYTGG-LSNLRTENGTK  430



>ref|XP_006411009.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
 gb|ESQ52462.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
Length=557

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/412 (69%), Positives = 333/412 (81%), Gaps = 2/412 (0%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             ES+VRHY F VV KNTTR+CSSKPIV VNG++PGP++YAREDDT++++VVNHV+ N+SIH
Sbjct  22    ESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKYNISIH  81

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RATV+GAIV
Sbjct  82    WHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIV  141

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFPKPD E+VIVLGEWWKSD E VIN+A++SG+APNVSDAH INGHPGP  
Sbjct  142   ILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEAIKSGLAPNVSDAHMINGHPGPVK  201

Query  648   NCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
             NC S+GY L VE+GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFK DT+ I 
Sbjct  202   NCPSQGYKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVVEVDAVYVKPFKIDTVLIA  261

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPR  1007
             PGQTTN +LTA ++ GKYL+  SPFMD  VA DN TAT T+HY GT + + T L   PP+
Sbjct  262   PGQTTNVLLTASKSAGKYLVTASPFMDAPVAVDNVTATATVHYSGTLSSSPTTLTLPPPQ  321

Query  1008  NATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRAVGDIN  1181
             NAT V + F   LRSLNSKK+PA VP   DH L F +G+G+N C TC   NGSR V  IN
Sbjct  322   NATSVANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNSCPTCKAGNGSRVVASIN  381

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N++F+MP TALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  382   NVTFIMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  433



>ref|XP_004137913.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN58791.1| hypothetical protein Csa_3G732490 [Cucumis sativus]
Length=559

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/413 (69%), Positives = 336/413 (81%), Gaps = 3/413 (1%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             ES VRHY F VV +  TR+CSSKPIV VNG+FPGP++YARE D V+++VVNHV+ N+SIH
Sbjct  23    ESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTVYAREGDNVLIKVVNHVKYNLSIH  82

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTL WHAHI W RATVHG +V
Sbjct  83    WHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRATVHGGLV  142

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPK GVPYPFP P+KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING PG   
Sbjct  143   ILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGLPGSIS  202

Query  648   NC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
             NC S +G+TL V+ GKTYLLRI++AA+NEELFFKVAGH LTVVEVDA+YVKPFKTDT+ I
Sbjct  203   NCPSQRGFTLPVQKGKTYLLRIINAALNEELFFKVAGHKLTVVEVDATYVKPFKTDTVLI  262

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTTN +LTA+QN GKY++AVSPFMD  VA DN+TAT T+HY GT A + T     PP
Sbjct  263   APGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATATVHYTGTLATSLTTSTNPPP  322

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGSRAVGDI  1178
             +NAT + + F   LRSLNSKK+PANVPL  DH L F +G+GINPC TC   NGSR V  I
Sbjct  323   QNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTVGLGINPCPTCKAANGSRVVASI  382

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             NN++FVMPTTALLQAH++   GVFT DFPG P   FNY+G  P NLQT + TK
Sbjct  383   NNVTFVMPTTALLQAHFFKTKGVFTTDFPGNPPHKFNYSGPGPKNLQTISATK  435



>ref|XP_004249084.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=556

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/435 (68%), Positives = 349/435 (80%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW+R   ++ L A + P  VE  +R YNF V+ K TTR+CSSKPI  VNGKFPGP++Y
Sbjct  1     MESWLR---ILFLFACLFPAFVECRIRRYNFNVMMKTTTRLCSSKPIATVNGKFPGPTIY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             ARE D V+V VVNHV+ NVSIHWHGVRQLRTGWSDGPAYITQCPIQ GQ ++YNFT+TGQ
Sbjct  58    AREGDNVLVNVVNHVKYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGQNYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RAT+HGAIVILPK GVPYPFPKPD E V++L EWWKSD EAVINQA+
Sbjct  118   RGTLFWHAHILWLRATMHGAIVILPKLGVPYPFPKPDHEAVVILAEWWKSDTEAVINQAI  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTINGHPG   NC S+ GYTL V+ GK+Y+LR+++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGHPGAISNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              +TVVEVDA+YVKPFKTDTI I PGQTTN ++TAD+  GKY++A SPFMD  +A DN TA
Sbjct  238   KMTVVEVDATYVKPFKTDTIIIAPGQTTNVIVTADKGSGKYMVAASPFMDAPIAVDNVTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT A + T L   PP+NAT V + F++ LRSLNSKK+PA VP + DHSL F +
Sbjct  298   TATLHYSGTLASSITTLTKTPPKNATTVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTV  357

Query  1119  GIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
             G+G+NPCS+C   NGSR V  INN++FVMPT A+LQAH++ I GV+T DFP  P   FNY
Sbjct  358   GLGVNPCSSCKQGNGSRVVASINNVTFVMPTVAILQAHFFGIKGVYTTDFPQNPPFKFNY  417

Query  1293  TGTPPANLQTQNGTK  1337
             TGTPP NL T +GTK
Sbjct  418   TGTPPTNLATMSGTK  432



>ref|XP_010486778.1| PREDICTED: laccase-22-like isoform X2 [Camelina sativa]
Length=565

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/423 (67%), Positives = 343/423 (81%), Gaps = 16/423 (4%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E+ +R Y F VV KN T++CS+KPIV +NGKFPGP+LYAREDD VIV + N+V  NV+IH
Sbjct  22    EANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNVTIH  81

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGV+QLRTGWSDGPAYITQCP+Q G TF+YNFTLTGQRGTLLWHAHI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFP+P  E +IV GEWW SDVEAVI+Q+ QSG+ PN+SDAHTING  G  P
Sbjct  142   ILPKRGVPYPFPRPHTERIIVFGEWWNSDVEAVISQSTQSGLPPNISDAHTINGLTGQVP  201

Query  648   NCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
              C S+GYTL VE+GK YLLRI++AAVN+ELFFK+AGHNLTVVEVDA+Y+KPF T+T+F+G
Sbjct  202   GCKSRGYTLHVETGKKYLLRIINAAVNDELFFKIAGHNLTVVEVDATYIKPFDTETLFLG  261

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKG--TQALTSTVLATMP  1001
             PGQTTNA+LTA+   G +L+ +SPFMDT+V  +N TAT  L YK   TQAL S   + +P
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAFLRYKDTRTQALKS---SKIP  318

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P NAT +   F + LRSLNS  +P NVPL+ DHSL FAIG+G+NPC+TC+NG++ + DIN
Sbjct  319   PVNATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADIN  378

Query  1182  NISFVMPTTALLQAHYYNIS-GVFTDDFPGQPAIPFNYTGTPP----------ANLQTQN  1328
             N+SFVMPT A+LQAHY+N S GVFTDDFPG+P+ PFNYTG  P          +NL+T+N
Sbjct  379   NVSFVMPTVAMLQAHYFNKSEGVFTDDFPGKPSTPFNYTGGKPSTPFNYTGGLSNLRTEN  438

Query  1329  GTK  1337
             GTK
Sbjct  439   GTK  441



>ref|NP_565881.1| laccase-4 [Arabidopsis thaliana]
 sp|O80434.2|LAC4_ARATH RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Protein 
IRREGULAR XYLEM 12; AltName: Full=Urishiol oxidase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96573.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL36080.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL38363.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAC27158.2| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAM47955.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AEC09487.1| laccase-4 [Arabidopsis thaliana]
Length=558

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/418 (67%), Positives = 335/418 (80%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNVTRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GA+VILPKRGVPYPFPKPD E+VIVLGEWWKSD E +IN+A++SG+APNVSD+H ING
Sbjct  137   VYGALVILPKRGVPYPFPKPDNEKVIVLGEWWKSDTENIINEALKSGLAPNVSDSHMING  196

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             HPGP  NC S+GY L VE+GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFKT
Sbjct  197   HPGPVRNCPSQGYKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVVEVDAVYVKPFKT  256

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DT+ I PGQTTN +LTA ++ GKYL+  SPFMD  +A DN TAT T+HY GT + + T+L
Sbjct  257   DTVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTIL  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NAT + + F   LRSLNSKK+PA VP   DH L F +G+G+N C TC   NGSR
Sbjct  317   TLPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNACPTCKAGNGSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++F+MP TALL AHY+N SGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   VVASINNVTFIMPKTALLPAHYFNTSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  434



>ref|XP_010509229.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/416 (68%), Positives = 334/416 (80%), Gaps = 2/416 (0%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P P ES+VRHY F VV KNTTR+CSSKPIV VNG++PGP++YAREDDT++++VVNHV+ N
Sbjct  19    PAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKYN  78

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RATV+
Sbjct  79    VSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVN  138

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPKRGVPYPFPK D E+VIVLGEWWKSD E +IN+A++SG+APNVSDAH INGHP
Sbjct  139   GAIVILPKRGVPYPFPKADHEKVIVLGEWWKSDTEDIINEALKSGLAPNVSDAHMINGHP  198

Query  636   GPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             GP  NC S+GY L VE+GKTYLLR+++AA+NEELFFKVAGH  TVVEVDA YVKPFK DT
Sbjct  199   GPVKNCPSQGYKLSVENGKTYLLRLINAALNEELFFKVAGHLFTVVEVDAVYVKPFKIDT  258

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             + I PGQTTN +LTA ++ GKYL+  SPFMD  +A DN TAT T+HY GT + + TV   
Sbjct  259   VLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVRTL  318

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRAV  1169
              PP+NAT + + F   LRSLNSKK+PA VP   DH LLF +G+G+N C TC   NGSR V
Sbjct  319   PPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNACPTCKAGNGSRVV  378

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
               INN++FVMP TALL AHY+N SGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  379   ASINNVTFVMPKTALLSAHYFNKSGVFTTDFPKNPPHVFNYSGGSVKNMATETGTR  434



>sp|Q0IQU1.2|LAC22_ORYSJ RecName: Full=Laccase-22; AltName: Full=Benzenediol:oxygen oxidoreductase 
22; AltName: Full=Diphenol oxidase 22; AltName: 
Full=Urishiol oxidase 22; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX95423.1| laccase (EC 1.10.3.2) precursor - common tobacco [Oryza sativa 
Japonica Group]
 gb|ABA95532.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ19339.1| hypothetical protein OsJ_34890 [Oryza sativa Japonica Group]
Length=564

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/414 (67%), Positives = 332/414 (80%), Gaps = 4/414 (1%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
              ++ RHY F VV +N TR+CS+KPI+ VNGKFPGP+LYARE D V+V+VVNHV  NV+IH
Sbjct  27    HAITRHYKFNVVMRNMTRLCSTKPILTVNGKFPGPTLYAREGDNVLVKVVNHVAHNVTIH  86

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGVRQ+RTGW DGPAYITQCPIQ G +F+YNFT+TGQRGTLLWHAHINW RATVHGAIV
Sbjct  87    WHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGTLLWHAHINWLRATVHGAIV  146

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPK GVPYPFP P KE VIVLGEWWK D E VINQAMQ G+ PN+SD+HTINGHPGP  
Sbjct  147   ILPKLGVPYPFPAPHKEAVIVLGEWWKEDTETVINQAMQLGVGPNISDSHTINGHPGPLS  206

Query  648   NCSSK--GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              C+S   G+ L VE+GKTY+LRI++AA+N++LFFKVAGH LTVVEVDA Y KPFKTDT+ 
Sbjct  207   ECASSQDGFKLSVENGKTYMLRIINAALNDDLFFKVAGHELTVVEVDAVYTKPFKTDTLL  266

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGT--QALTSTVLAT  995
             I PGQTTN ++ A+Q  G+YL++VSPFMD  V  DN+T T TLHY  T   ++ S  L  
Sbjct  267   ITPGQTTNVLVRANQGAGRYLLSVSPFMDAPVQVDNKTGTATLHYANTVSSSMASLTLVK  326

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
              PP+NAT + S F + L SLNSK++PANVP   DHSLL  +G+G+NPC +C+NG+R VG 
Sbjct  327   PPPQNATHIVSKFTDSLHSLNSKEYPANVPQTVDHSLLLTVGVGVNPCPSCINGTRVVGT  386

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             INN++F+MP+T +LQAHYYNI GVFT+DFP  P   FNYTG+ P NLQT NGT+
Sbjct  387   INNVTFIMPSTPILQAHYYNIPGVFTEDFPATPLHKFNYTGSGPKNLQTMNGTR  440



>ref|XP_004163861.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=559

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/413 (69%), Positives = 335/413 (81%), Gaps = 3/413 (1%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             ES VRHY F VV +  TR+CSSKPIV VNG+FPGP++YARE D V+++VVNHV+ N+SIH
Sbjct  23    ESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTVYAREGDNVLIKVVNHVKYNLSIH  82

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTL WHAHI W RATVHG +V
Sbjct  83    WHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRATVHGGLV  142

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPK GVPYPFP P+KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTING PG   
Sbjct  143   ILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGLPGSIS  202

Query  648   NC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
             NC S +G+TL V+ GKTYLLRI++AA+NEELFFKVAGH LTVVEVDA+YVKPFKTDT+ I
Sbjct  203   NCPSQRGFTLPVQKGKTYLLRIINAALNEELFFKVAGHKLTVVEVDATYVKPFKTDTVLI  262

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTTN +LTA+QN GKY++AVSPFMD  VA DN+TAT T+HY GT A + T     PP
Sbjct  263   APGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATATVHYTGTLATSLTTSTNPPP  322

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGSRAVGDI  1178
             +NAT + + F   LRSLNSKK+PANVPL  DH L F +G+GINPC TC   NGSR V  I
Sbjct  323   QNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTVGLGINPCPTCKAANGSRVVASI  382

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             NN++FVMPTTALLQ H++   GVFT DFPG P   FNY+G  P NLQT + TK
Sbjct  383   NNVTFVMPTTALLQGHFFKTKGVFTTDFPGNPPHKFNYSGPGPKNLQTTSATK  435



>ref|XP_008358974.1| PREDICTED: laccase-4-like [Malus domestica]
Length=557

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/434 (65%), Positives = 342/434 (79%), Gaps = 5/434 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalIC-PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSL  218
             M  W+R   +V L A +C P  VE +VRHY F VV KN +R+CSSKPIV VNG++PGP++
Sbjct  3     MVQWIR---VVLLVACLCFPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTI  59

Query  219   YAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTG  398
             YAREDDTV+V+VVNH + NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TG
Sbjct  60    YAREDDTVLVKVVNHAKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITG  119

Query  399   QRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQA  578
             QRGTL WHAHI W RAT+HGA+V+LPK GVPYPFP P KE V++LGEWWKSD E VI QA
Sbjct  120   QRGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQA  179

Query  579   MQSGMAPNVSDAHTINGHPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             ++SG+APNVSDAHTING+PGP   C S+G  L V  GKTY+LRI++AA+NEELFFK+A H
Sbjct  180   LKSGLAPNVSDAHTINGYPGPISTCQSQGGLLPVRPGKTYMLRIINAALNEELFFKIANH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQT  935
              LTVVEVDA Y KPFKTDT  I PGQTTN +++ +   GKYL+A SPFMD   +  DN+T
Sbjct  240   KLTVVEVDAVYTKPFKTDTXLIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKT  299

Query  936   ATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             AT TLHY GT   T T+L + PP+NAT V + F   LRSLNS +FPA VPL+ DHSLLF 
Sbjct  300   ATATLHYIGTLESTRTILTSPPPQNATLVATNFTNSLRSLNSIRFPARVPLKIDHSLLFT  359

Query  1116  IGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             +G+G++ C +C NG R V DINN++FVMP  ALLQAH++N SGVFTDDFPG P  P+NYT
Sbjct  360   VGLGLHTCDSCANGIRVVADINNVTFVMPKIALLQAHFFNXSGVFTDDFPGNPLNPYNYT  419

Query  1296  GTPPANLQTQNGTK  1337
             GT   N+QT+ GT+
Sbjct  420   GTQQTNMQTKKGTR  433



>ref|XP_009346884.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/435 (65%), Positives = 344/435 (79%), Gaps = 6/435 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalIC-PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSL  218
             M  W+R   +V L A +C P  VE +VRHY F VV KN +R+CSSKPIV VNG++PGP++
Sbjct  3     MVQWIR---VVLLVACLCFPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTI  59

Query  219   YAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTG  398
             YAREDDTV+V+VVNH + NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TG
Sbjct  60    YAREDDTVLVKVVNHAKYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITG  119

Query  399   QRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQA  578
             QRGTL WHAHI W RAT+HGA+V+LPK GVPYPFP P KE V++LGEWWKSD E VI QA
Sbjct  120   QRGTLWWHAHILWLRATIHGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQA  179

Query  579   MQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAG  755
             ++ G+APNVSDAHTINGH GP   C S+ G  L V  GKTY+LRI++AA+NEELFFK+A 
Sbjct  180   LKFGLAPNVSDAHTINGHTGPISTCQSQGGIKLPVRPGKTYMLRIINAALNEELFFKIAN  239

Query  756   HNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQ  932
             H LTVVEVDA Y KPFKTDTI I PGQTTN +++ +   GKYL+A SPFMD   +  DN+
Sbjct  240   HKLTVVEVDAVYTKPFKTDTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNK  299

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
             TAT TLHY GT   T+T+L   PP+NAT V + F   LRSLNS +FPA VPL+ DHSLLF
Sbjct  300   TATATLHYIGTLESTTTILTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLF  359

Query  1113  AIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNY  1292
              +G+G++ C++C NG+R V DINN++FVMP   LLQAH++NISGVFTDDFPG P  P+NY
Sbjct  360   TVGLGLHTCASCANGNRVVADINNVTFVMPKIGLLQAHFFNISGVFTDDFPGNPLNPYNY  419

Query  1293  TGTPPANLQTQNGTK  1337
             TGT P N+QT+ GT+
Sbjct  420   TGTQPTNMQTKKGTR  434



>ref|XP_004302643.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/439 (68%), Positives = 356/439 (81%), Gaps = 9/439 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MASW+R  VL+ L A + P  VES VR+Y F VV +NTTR+CS+KPIV +NG+FPGP+LY
Sbjct  1     MASWIR--VLLLLLACLLPALVESRVRNYKFNVVLRNTTRLCSTKPIVTINGRFPGPTLY  58

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+V NHV  NVSIHWHG+RQ+RTGWSDGPAYITQCPI  GQ+F YNFT+TGQ
Sbjct  59    AREDDTVLVKVTNHVTYNVSIHWHGIRQIRTGWSDGPAYITQCPIPQGQSFTYNFTITGQ  118

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAHI W RATVHGA+VILPKRGVPYPFP P KE  +VL EWWKSD EAVIN+A+
Sbjct  119   RGTLLWHAHILWLRATVHGALVILPKRGVPYPFPTPHKEVPVVLAEWWKSDTEAVINEAL  178

Query  582   QSGMAPNVSDAHTINGHPG-PTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAG  755
             + G+APNVSDAHTINGHPG  +PNC++  G+ L VESGKTYLLRI++AA+NEELFFK+AG
Sbjct  179   KGGLAPNVSDAHTINGHPGLVSPNCTTDGGFKLSVESGKTYLLRIINAALNEELFFKIAG  238

Query  756   HNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTI-VATDNQ  932
             H LT+VEVDA+YVKPFKTDTI I PGQTTNA++TA+Q  GKYL+  SPF+DT  +A DN 
Sbjct  239   HKLTIVEVDATYVKPFKTDTIVIAPGQTTNALITANQKSGKYLVTASPFLDTPGIAVDNL  298

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
             T+T T+HY GT + + T L + PP+NAT V ++F + LRSLN+ KFPA VPL+ DH+LLF
Sbjct  299   TSTATVHYSGTLSNSPTTLTSPPPQNATQVANSFTDSLRSLNTMKFPAKVPLKIDHNLLF  358

Query  1113  AIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPF  1286
              IG+GINPC +C   NGSR V  INN++FVMPTTALLQAH++   GVFT DFP  P   F
Sbjct  359   TIGLGINPCPSCKAGNGSRVVASINNVTFVMPTTALLQAHFFKTKGVFTTDFPANPPNAF  418

Query  1287  NYTGTPPAN--LQTQNGTK  1337
             N++G  PAN  L T NGTK
Sbjct  419   NFSGGLPANSSLATTNGTK  437



>emb|CDX74915.1| BnaA05g06610D [Brassica napus]
Length=558

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 332/418 (79%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCP+Q GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKPD E+VIVL EWWKSD E VIN+A++SG+APNVSDAH ING
Sbjct  137   VHGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLAPNVSDAHMING  196

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             H GP  NC S+GY L V +GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFKT
Sbjct  197   HSGPVNNCPSQGYKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKT  256

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DT+ I PGQTTN +LT  ++ GKYL+  SPFMD+ +A DN TAT T+HY GT + + T L
Sbjct  257   DTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTTL  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NAT + + F   LRSLNSKK+PA VP   DH L F +G+G+NPC TC   NGSR
Sbjct  317   TLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++F MP TALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   VVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  434



>ref|XP_010464832.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/413 (68%), Positives = 340/413 (82%), Gaps = 7/413 (2%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E+ +R Y F VV KN T++CS+KPIV +NGKFPGP+LYAREDD VIV + N+V  N++IH
Sbjct  22    EANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNITIH  81

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGV+QLRTGWSDGPAYITQCP+Q G TF+YNFTLTGQRGTLLWHAHI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFP+P  E++IV GEWW SDVEAVI+Q+ QSG+ PN+SD HTING  G  P
Sbjct  142   ILPKRGVPYPFPRPHTEKIIVFGEWWNSDVEAVISQSTQSGLPPNISDGHTINGLTGQVP  201

Query  648   NCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
              C S+GYTL VE+GK YLLRI++AAVN+ELFFK+ GHNLTVVEVDA+Y KPF T+T+F+G
Sbjct  202   GCKSRGYTLHVETGKKYLLRIINAAVNDELFFKITGHNLTVVEVDATYTKPFDTETLFLG  261

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYK--GTQALTSTVLATMP  1001
             PGQTTNA+LTA+   G +L+ +SPFMDT+V  +N TAT  L YK   TQ+L S   + +P
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAILRYKYTRTQSLKS---SKIP  318

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P NAT +   F + LRSLNS  +P NVPL+ DHSL FAIG+G+NPC+TC+NG++ + DIN
Sbjct  319   PVNATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADIN  378

Query  1182  NISFVMPTTALLQAHYYNIS-GVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N+SFVMPT A+LQAHY+N S GVFTDDFPG+P+ PFNYTG   +NLQT+NGTK
Sbjct  379   NVSFVMPTVAMLQAHYFNKSEGVFTDDFPGRPSTPFNYTGG-LSNLQTKNGTK  430



>ref|XP_010494695.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/413 (68%), Positives = 341/413 (83%), Gaps = 7/413 (2%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             ++ +R Y F VV KN T++CS+KPIV +NGKFPGP+LYAREDD VIV ++N+V  N++IH
Sbjct  22    DANIRRYRFNVVMKNMTKLCSTKPIVTINGKFPGPALYAREDDNVIVNLINNVNYNITIH  81

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGV+QLRTGWSDGPAYITQCP+Q G TF+YNFTLTGQRGTLLWHAHI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGV YPFP+P  E +IV GEWW SDVEAVI+Q+ QSG+ PN+SDAHTING  G  P
Sbjct  142   ILPKRGVLYPFPRPHTERIIVFGEWWNSDVEAVISQSTQSGLPPNISDAHTINGLIGQVP  201

Query  648   NCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
             +C S+GYTL VE+GK YLLRI++AAVN+ELFFK+ GHNLTVVEVDASY KPF T+T+F+G
Sbjct  202   SCKSRGYTLNVETGKKYLLRIINAAVNDELFFKITGHNLTVVEVDASYTKPFDTETLFLG  261

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKG--TQALTSTVLATMP  1001
             PGQTTNA+LTA+   G +L+ +SPFMDT+V  +N TAT  L YK   TQ L S   + +P
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAFLRYKDTRTQVLKS---SKIP  318

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P NAT +   F + LRSLNS+ +P NVPL+ DHSL FAIG+G+NPC+TC+NG++ + DIN
Sbjct  319   PVNATSIALGFSDSLRSLNSQDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADIN  378

Query  1182  NISFVMPTTALLQAHYYNIS-GVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N+SFVMPT A+LQAHY+N S GVFTDDFPG+P+ PFNYTG   +NL+T+NGTK
Sbjct  379   NVSFVMPTVAMLQAHYFNKSEGVFTDDFPGKPSTPFNYTGG-LSNLRTENGTK  430



>ref|XP_010033027.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
Length=553

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/411 (69%), Positives = 323/411 (79%), Gaps = 0/411 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE +VRHY F VV K T R+CSSKPIV VNG+FPGP++YAREDDTV V+VVNHV  NV+I
Sbjct  19    VEGMVRHYKFNVVEKRTDRLCSSKPIVTVNGRFPGPTIYAREDDTVFVKVVNHVSYNVTI  78

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGVRQLRT W+DGPAYITQCPIQ GQ + YNFT+TGQRGTLLWHAHI W RATVHGA+
Sbjct  79    HWHGVRQLRTCWADGPAYITQCPIQPGQIYTYNFTITGQRGTLLWHAHILWLRATVHGAL  138

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPKRGVPYPFPKP KE+VIVL EWWKSDVEAVI +A++SG APNVSDAHTIN HPGP 
Sbjct  139   VILPKRGVPYPFPKPHKEKVIVLAEWWKSDVEAVIGEAIKSGGAPNVSDAHTINSHPGPV  198

Query  645   PNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
              NC   GY L V  GKTY+LRI++AA+NEELFFK+A H LTVVEVDA+YVKP +TD I +
Sbjct  199   ANCPKGGYELAVRPGKTYMLRIINAALNEELFFKIARHQLTVVEVDAAYVKPLRTDAILV  258

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
             GPGQTT A+L A    GKYL+ VSPFMD  V+ DN TAT T+ Y GT A +  V    P 
Sbjct  259   GPGQTTTALLMAYHTTGKYLMIVSPFMDAPVSVDNVTATATVRYAGTPAASPAVPIAPPS  318

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
              NAT V   F+  LRSLN+  +PA VPL+ DHSL F +GIG+NPC+TC +G R V D NN
Sbjct  319   PNATWVAEGFVGSLRSLNTGAYPARVPLEIDHSLFFTVGIGVNPCATCASGFRVVADFNN  378

Query  1185  ISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             ISFVMP TALL AHYY ++GVFTDDFP +P I FNYTG  P NL T  GT+
Sbjct  379   ISFVMPKTALLSAHYYKMTGVFTDDFPAKPMIRFNYTGAQPVNLNTMTGTR  429



>emb|CDX91428.1| BnaC04g07220D [Brassica napus]
Length=558

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 331/418 (79%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCP+Q GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKPD E+VIVL EWWKSD E VIN+A++SG+A NVSDAH ING
Sbjct  137   VHGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLASNVSDAHMING  196

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             H GP  NC S+GY L V +GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFKT
Sbjct  197   HSGPVNNCPSQGYKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKT  256

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             DTI I PGQTTN +LT  ++ GKYL+  SPFMD+ +A DN TAT T+HY GT + + T L
Sbjct  257   DTILIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTTL  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSR  1163
                PP+NAT + + F   LRSLNSKK+PA VP   DH L F +G+G+NPC TC   NGSR
Sbjct  317   TLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++F MP TALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   VVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  434



>ref|XP_008775059.1| PREDICTED: laccase-22-like [Phoenix dactylifera]
Length=554

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/433 (67%), Positives = 346/433 (80%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M S+VR ++LVA+   + P   +   R Y F V  K  TR+C SKPIV VNG+FPGP+LY
Sbjct  1     MLSYVRALLLVAI---MLPVLADGRTRKYKFNVAVKKVTRLCYSKPIVTVNGRFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             A E D V+V VVN+V+ NV+IHWHGVRQ+RTGW+DGPAYITQCPIQ G +++YNFT+TGQ
Sbjct  58    AEEGDNVLVEVVNNVKYNVTIHWHGVRQIRTGWADGPAYITQCPIQPGHSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIV+LPK  VPYPFP P KEEVI+LGEWWKSD EAVIN+A+
Sbjct  118   RGTLFWHAHILWLRATVHGAIVVLPKPNVPYPFPAPQKEEVIILGEWWKSDTEAVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAH INGHPGP  +C +SKG+ L V+SGKTYLLRIV+AA+NEELFFKVAGH
Sbjct  178   KSGLAPNVSDAHIINGHPGPMSDCPTSKGFQLTVDSGKTYLLRIVNAALNEELFFKVAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA Y KPFKTDTI I PGQTTN +LTADQ  G YL+  SPFMD+ +A DN+TA
Sbjct  238   QLTVVEVDACYTKPFKTDTILITPGQTTNVLLTADQGAGSYLVTASPFMDSPIAVDNKTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
               T+HY  + A         PP+NATPV S F++ LRSLNS+++PA VPL  DHSLLF +
Sbjct  298   MATVHYTNSVATADLTTTNPPPQNATPVASKFIDSLRSLNSEQYPARVPLTVDHSLLFTV  357

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+NPC TC+NGSR V D+NN+SF MPTTA+LQAHY+NISGVF DDFPG+P I FNYTG
Sbjct  358   GLGVNPCPTCVNGSRVVADMNNVSFTMPTTAILQAHYFNISGVFADDFPGKPPIAFNYTG  417

Query  1299  TPPANLQTQNGTK  1337
               P N+QT +GT+
Sbjct  418   GGPKNMQTMSGTR  430



>ref|XP_006363052.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=561

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/426 (67%), Positives = 340/426 (80%), Gaps = 13/426 (3%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  VRHY F VV KNTTR+CSSK IV VNGKFPGP++YARE D V+++VVNHV+
Sbjct  15    LFPLVVECRVRHYKFNVVMKNTTRLCSSKSIVTVNGKFPGPTIYAREGDNVLIKVVNHVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
               VSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTL WHAHI W RAT
Sbjct  75    YIVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFPKP+ E V++L EWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  135   VHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGLAPNVSDAHTING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP  NC S+ GY L VE GKTY+LR+++AA+NEELFFK+AGH +TVVEVDA+Y+KPF+
Sbjct  195   HPGPVSNCPSQGGYKLNVEPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYIKPFQ  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGT------Q  968
             TDTI I PGQTTN ++ A++N GKY++  SPFMD+ +A DN TA  TLHY  T       
Sbjct  255   TDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDSPIAVDNVTAIATLHYSATLTNNPST  314

Query  969   ALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC  1148
              LTST     PP+NATP+ + F++ LRSLNSKK+PA VP++ DHSLLF + +GINPC +C
Sbjct  315   TLTST---NTPPKNATPIANNFLDSLRSLNSKKYPAKVPIKIDHSLLFTVSLGINPCPSC  371

Query  1149  L--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG-TPPANLQ  1319
                NGSR V  INN++FVMPT ALLQAH+  I GVFT DFPG P   +NYT  TPPAN+ 
Sbjct  372   KQGNGSRVVASINNVTFVMPTIALLQAHFSGIKGVFTADFPGNPPFVYNYTNTTPPANMG  431

Query  1320  TQNGTK  1337
             T +GTK
Sbjct  432   TTSGTK  437



>gb|AES98533.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=558

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 339/418 (81%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+++VRHY F VV KN TR+CS+KPIV +NG FPGP++YAREDDTV+V+VVNHV+
Sbjct  17    LLPLSVDAMVRHYKFNVVMKNATRLCSTKPIVTINGNFPGPTIYAREDDTVLVKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFTLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQVYMYNFTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFP+P  E+VI+L EWWKSD EA+IN+A++SG+APNVSDAHTING
Sbjct  137   VHGAIVILPKLGVPYPFPRPHMEQVIILSEWWKSDTEAIINEALKSGLAPNVSDAHTING  196

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP  +C+S+ G+  +VE GKTYLLRI++AA+NE+LFFK+AGH  TVVEVDA+Y KPFK
Sbjct  197   HPGPVQHCASQEGFKFQVEPGKTYLLRIINAALNEDLFFKIAGHKFTVVEVDAAYTKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TDTI I PGQTTN +L  +   GKY++A S FMD  +A DN TAT TLHY  T   T T 
Sbjct  257   TDTIVITPGQTTNVLLKTNHASGKYMVAASTFMDAPIAIDNVTATATLHYPNTLGSTITT  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L ++PP N+T + ++F + L+SLNS K+PA VP + DHSL F + +G+NPC+TC NGSR 
Sbjct  317   LTSLPPINSTKIANSFTDSLKSLNSHKYPARVPKKIDHSLFFTVSLGVNPCATCPNGSRV  376

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             V  INN++FVMP  +LLQAH++NISG+FTDDFP +P I +++TG   P+N +T  GT+
Sbjct  377   VAAINNVTFVMPKISLLQAHFFNISGIFTDDFPRKPEIVYDFTGNKQPSNFRTNKGTR  434



>gb|KFK36706.1| hypothetical protein AALP_AA4G158700 [Arabis alpina]
Length=560

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/419 (67%), Positives = 335/419 (80%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P E +VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+
Sbjct  18    VFPPPSECMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  77

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAH+ W RAT
Sbjct  78    YNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQAYTYNYTLTGQRGTLWWHAHVLWLRAT  137

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GA+VILPKRGVPYPFPKP+ E+VIVLGEWWKSD E VIN+A++SG+APNVSD+H ING
Sbjct  138   VYGALVILPKRGVPYPFPKPNHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDSHMING  197

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PG   NC S +GY L VE+GKTYLLRIV+AA+NEELFFKVAGH  TVVEVDA YVKPFK
Sbjct  198   RPGLAKNCPSDQGYKLSVENGKTYLLRIVNAALNEELFFKVAGHLFTVVEVDAVYVKPFK  257

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
              DT+ I PGQTTN +LTA ++ GKYL+A SPFMD  +A DN TAT TLHY GT + + T+
Sbjct  258   IDTVLIAPGQTTNVLLTASKSAGKYLVAASPFMDAPIAVDNVTATATLHYSGTLSSSPTI  317

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L   PP+NAT + + F   LRSLNSKK+PA VP   DH LLF +G+G+NPC TC   NGS
Sbjct  318   LTLPPPQNATSIANNFTNSLRSLNSKKYPAIVPTTIDHHLLFTVGLGLNPCPTCKAGNGS  377

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++F+MP TALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  378   RVVASINNVTFIMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTR  436



>ref|XP_010685615.1| PREDICTED: laccase-4 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/414 (68%), Positives = 336/414 (81%), Gaps = 3/414 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE  VRHY F VV KN TR+CS+KPIV +NGK+PGP++ AREDDTV+V+VVNHV+ N+SI
Sbjct  23    VECRVRHYKFNVVLKNHTRLCSTKPIVTINGKYPGPTIVAREDDTVLVKVVNHVKYNLSI  82

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQ+RTGWSDGPAYITQCPI+TGQT+ YNFTLTGQRGTL +HAHI W RATVHGAI
Sbjct  83    HWHGIRQIRTGWSDGPAYITQCPIETGQTYTYNFTLTGQRGTLFYHAHILWLRATVHGAI  142

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP KE VIVLGEWWKSDVEAVIN+A++SG+APNVSDAHTING+PGP 
Sbjct  143   VILPKLGVPYPFPKPHKENVIVLGEWWKSDVEAVINEALKSGLAPNVSDAHTINGYPGPV  202

Query  645   PNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              +C+S+  + L V  GK Y+LRI++AA+NEELFFK+AGH+LTVVEVDA+YVKPFKTDTI 
Sbjct  203   RSCNSQELFNLHVRPGKKYMLRIINAALNEELFFKIAGHHLTVVEVDATYVKPFKTDTIV  262

Query  822   IGPGQTTNAVLTADQNG-GKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALT-STVLAT  995
             I PGQTTN +L A+    GKYL+ VSPFMD  +  DN T   T+ Y  +++ T ST L  
Sbjct  263   ISPGQTTNVILEANNKVLGKYLMVVSPFMDAPIPVDNATGLATVRYTTSKSATLSTTLTA  322

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
              PP NAT V   F   L++LNSK+FPA VP + DHSL F IG+G+NPCSTC+NGSR V  
Sbjct  323   PPPINATKVADNFTNALKALNSKEFPAKVPQKIDHSLFFTIGLGVNPCSTCVNGSRVVAS  382

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             INN++F+MPT +LLQAHY+N+SGVFT DFP +P IPFNYTG    NL T  GTK
Sbjct  383   INNVTFIMPTISLLQAHYFNLSGVFTADFPSKPVIPFNYTGNQVTNLGTTTGTK  436



>ref|XP_009146739.1| PREDICTED: laccase-22-like [Brassica rapa]
Length=560

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 336/416 (81%), Gaps = 6/416 (1%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E+ +RHY F VV KN T++CS+KPIV +NGKFPGP+LYAREDD VIV + N V  NV+IH
Sbjct  21    EANIRHYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNSVSYNVTIH  80

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGV+QLRTGWSDGPAYITQCP+Q G  FIYNFTLTGQRGTLLWHAHI+W RATVHGAIV
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGNFIYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFP+P  ++VIV GEWWKSDVE VI Q+ QSG+ PN+SDAHTING  GP  
Sbjct  141   ILPKRGVPYPFPRPHTDKVIVFGEWWKSDVEDVIKQSTQSGLPPNLSDAHTINGLTGPIT  200

Query  648   NC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
              C +S GYT+ VE+GK+YLLRI++AAVN+ELFFK+A HNLTVVEVDASY KP+ T+T+F+
Sbjct  201   GCNNSHGYTIHVETGKSYLLRIINAAVNDELFFKIAQHNLTVVEVDASYTKPYNTETLFL  260

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
             GPGQT NAVLTA+   G +L+ +SPFMDT+V  DN TAT  L YK T    S  ++  PP
Sbjct  261   GPGQTANAVLTANHPTGNFLMTISPFMDTVVPVDNATATAFLRYKNTTTTDSLTMSNTPP  320

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
              NAT +   F + LRSLNS K+P NVPL+ DHSL FAIG+G+NPC+TC+NG++ + DINN
Sbjct  321   INATSIAQNFSDSLRSLNSLKYPTNVPLKIDHSLFFAIGVGVNPCATCINGTKTIADINN  380

Query  1185  ISFVMPTTALLQAHYYNIS-GVFTDDFPGQPAIPFNYTG----TPPANLQTQNGTK  1337
             ++FVMP  ALLQAHY+N S GVFT+DFPG+P  PF+YTG     P +NLQT+NGT+
Sbjct  381   VTFVMPAMALLQAHYFNKSQGVFTNDFPGRPLTPFDYTGGNNSIPLSNLQTKNGTQ  436



>ref|XP_006663136.1| PREDICTED: laccase-22-like [Oryza brachyantha]
Length=566

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/415 (65%), Positives = 335/415 (81%), Gaps = 5/415 (1%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
              ++ RHY F VV +N TR+CS+KP++ VNGKFPGP+LYARE D V+V+VVNHV  NV+IH
Sbjct  28    HAITRHYKFNVVMRNMTRLCSTKPVLTVNGKFPGPTLYAREGDNVLVKVVNHVANNVTIH  87

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGVRQ+RTGW DGPAYITQCPIQ G +F+YNFT+TGQRGTLLWHAHINW RAT+HGAIV
Sbjct  88    WHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGTLLWHAHINWLRATIHGAIV  147

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPK GVPYPFP P KE+VIVLGEWWK D E VINQAMQ G+ PN+SD+HTINGHPGP  
Sbjct  148   ILPKLGVPYPFPAPHKEDVIVLGEWWKEDTENVINQAMQLGVGPNISDSHTINGHPGPLS  207

Query  648   NCSSK--GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              C+S   G+ L+VE+GKTY+LRI++AA+N++LFFKVAGH LTVVEVDA Y KPF TDT+ 
Sbjct  208   ECASSQDGFKLKVENGKTYMLRIINAALNDDLFFKVAGHELTVVEVDAVYTKPFTTDTLL  267

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTST---VLA  992
             I PGQTT+ +L A+Q+ G+YL++VSPFMD+ +  DN+T T TLHY  T + +     +L 
Sbjct  268   ITPGQTTSVLLRANQSAGRYLLSVSPFMDSPLQVDNKTGTATLHYANTVSSSMAAPLILI  327

Query  993   TMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVG  1172
              +PP+NAT + S F + L SLNSK++PANVP   DHSLL  +G+G+NPC +C+NG+R VG
Sbjct  328   KLPPQNATSIVSKFADRLHSLNSKEYPANVPQTIDHSLLLTVGVGVNPCPSCINGTRVVG  387

Query  1173  DINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              INN++F+MP+T +LQA+YYNI GVFT DFP  P   FNYTG+ P NLQT NGT+
Sbjct  388   TINNVTFIMPSTPILQAYYYNIPGVFTQDFPATPLHKFNYTGSGPKNLQTMNGTR  442



>ref|XP_009141718.1| PREDICTED: laccase-4-like [Brassica rapa]
Length=559

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/419 (68%), Positives = 334/419 (80%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GAIVILPKRGVPYPFPKPD E+VIVLGEWWKSD E VIN+A++SG+APNVSDAH ING
Sbjct  137   VYGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDAHMING  196

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PG   NC S +GY L V++GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFK
Sbjct  197   RPGLAKNCPSDQGYKLSVKNGKTYLLRVVNAALNEELFFKVAGHLFTVVEVDAVYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
              DTI I PGQTTN +LTA ++ GKYL+  SPFMD+ +A DN TAT T+HY GT + + T+
Sbjct  257   IDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTI  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L   PP+NAT V + F   LRSLNSKK+PA VP   DH L F +G+G+NPC TC   NGS
Sbjct  317   LTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++FVMP  ALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   RVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKIPPHVFNYSGGSLTNMATETGTR  435



>emb|CDY18406.1| BnaA04g21810D [Brassica napus]
Length=559

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/419 (68%), Positives = 334/419 (80%), Gaps = 3/419 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    VFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GAIVILPKRGVPYPFPKPD E+VIVLGEWWKSD E VIN+A++SG+APNVSDAH ING
Sbjct  137   VYGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDAHMING  196

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PG   NC S +GY L V++GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFK
Sbjct  197   RPGLAKNCPSDQGYKLSVKNGKTYLLRVVNAALNEELFFKVAGHLFTVVEVDAVYVKPFK  256

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
              DTI I PGQTTN +LTA ++ GKYL+  SPFMD+ +A DN TAT T+HY GT + + T+
Sbjct  257   IDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTI  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGS  1160
             L   PP+NAT V + F   LRSLNSKK+PA VP   DH L F +G+G+NPC TC   NGS
Sbjct  317   LTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++FVMP  ALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  377   RVVASINNVTFVMPKIALLPAHYFNISGVFTPDFPKIPPHVFNYSGGSLTNMATETGTR  435



>ref|XP_009143427.1| PREDICTED: laccase-4 [Brassica rapa]
Length=561

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/421 (67%), Positives = 332/421 (79%), Gaps = 5/421 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P P ES+VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+
Sbjct  17    MFPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQ+RTGW+DGPAYITQCP+Q GQ + YN+TLTGQRGTL WHAHI W RAT
Sbjct  77    YNVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  136

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKPD E+VIVL EWWKSD E VIN+A++SG+APNVSDAH ING
Sbjct  137   VHGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLAPNVSDAHMING  196

Query  630   HPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK-  806
             H GP  NC S+GY L V +GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA +VKPFK 
Sbjct  197   HSGPVNNCPSQGYKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVFVKPFKT  256

Query  807   --TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS  980
               TDT+ I PGQTTN +LT  ++ GKYL+  SPFMD+ +A DN TAT T+HY GT + + 
Sbjct  257   ATTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSP  316

Query  981   TVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--N  1154
             T L   PP+NAT + + F   LRSLNSKK+PA VP   DH L F +G+G+NPC TC   N
Sbjct  317   TTLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGN  376

Query  1155  GSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGT  1334
             GSR V  INN++F MP TALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT
Sbjct  377   GSRVVASINNVTFTMPKTALLPAHYFNISGVFTTDFPKNPPHVFNYSGGSVTNMATETGT  436

Query  1335  K  1337
             +
Sbjct  437   R  437



>dbj|BAJ98144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/414 (66%), Positives = 333/414 (80%), Gaps = 3/414 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V ++ RHY F VV +N T +CS+K I+ VNGKFPGP+LYARE D V+V+VVNH   NV+I
Sbjct  27    VHAIARHYKFNVVMRNMTLLCSTKSILTVNGKFPGPTLYAREGDNVLVKVVNHAPHNVTI  86

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGVRQ+RTGW DGPAYITQCPIQ G +F+YNFT+TGQRGTLLWHAHINW RATVHGAI
Sbjct  87    HWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHINWLRATVHGAI  146

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFP P KE V+VLGEWWK+D E VINQAMQ G+ PN+SD+HTINGHPGP 
Sbjct  147   VILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISDSHTINGHPGPM  206

Query  645   PNCSSK--GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
               C+S   G+ L+VE+ KTY+LRI++A +N++LFFK+AGH LTVVEVDA Y KP+KTD +
Sbjct  207   SACASSQDGFKLDVENSKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDAVYTKPYKTDIL  266

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV-LAT  995
              I PGQTTN ++TADQ+ G+YL++VSPFMD  +  DN+T T TLHY  T + T+ + L  
Sbjct  267   LITPGQTTNVLVTADQSAGRYLLSVSPFMDAPLQVDNKTGTATLHYANTVSTTARLTLVN  326

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
              PP+NATP+ STF E LRSLNSK++PANVP   DHSL F IG+G+NPC+ C+NG+R VG 
Sbjct  327   PPPQNATPIASTFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCANCINGTRVVGT  386

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             INN +FVMP+T +LQA YY+I GVFT+DFP  P   FNYTG+ P NLQT NGT+
Sbjct  387   INNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTGSGPNNLQTMNGTR  440



>gb|EMS48198.1| Laccase-22 [Triticum urartu]
Length=537

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/414 (65%), Positives = 332/414 (80%), Gaps = 3/414 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V ++ RHY F VV +N TR+CS+K I+ VNGKFPGP+LYARE D V+V+VVN    NV+I
Sbjct  26    VHAITRHYKFNVVMRNMTRLCSTKSILTVNGKFPGPTLYAREGDNVLVKVVNQASHNVTI  85

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGVRQ+RTGW DGPAYITQCPIQ G +F+YNFT+TGQRGTLLWHAHINW RATVHGAI
Sbjct  86    HWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHINWLRATVHGAI  145

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFP P KE V+VLGEWWK+D E VINQAMQ G+ PN+SD+HTINGHPGP 
Sbjct  146   VILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISDSHTINGHPGPM  205

Query  645   PNCSSK--GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
              +C+S   G+ L+VE+ KTY+LRI++A +N++LFFK+AGH LTVVEVDA Y KP+KTD +
Sbjct  206   SDCASSQDGFNLDVENDKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDAVYTKPYKTDIL  265

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV-LAT  995
              I PGQTTN ++TADQ+ G+YL++VSPF+D  +  DN+T T TLHY  T + T+ + L  
Sbjct  266   LITPGQTTNVLVTADQSAGRYLLSVSPFLDAPLQVDNKTGTATLHYANTVSATARLTLVK  325

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
              PP+NATP+ S F E LRSLNSK++PANVP   DHSL F IG+G+NPC+ C+NG+R VG 
Sbjct  326   PPPQNATPIASKFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCANCINGTRVVGT  385

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             INN +FVMP+T +LQA YY+I GVFT+DFP  P   FNYTG+ P NLQT  GT+
Sbjct  386   INNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTGSGPKNLQTMKGTR  439



>ref|XP_003558760.1| PREDICTED: laccase-22 [Brachypodium distachyon]
Length=561

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/414 (65%), Positives = 330/414 (80%), Gaps = 3/414 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V ++ RHY F VV +  +R+CS+K I+ VNGKFPGP+LYARE D V+V+VVNHV  NV+I
Sbjct  24    VHAITRHYKFNVVMRKMSRLCSTKTILTVNGKFPGPTLYAREGDNVLVKVVNHVPHNVTI  83

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGVRQ+RTGW DGPAYITQCPIQ G +F+YNFT+TGQRGTLLWHAHINW RATVHGAI
Sbjct  84    HWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGTLLWHAHINWLRATVHGAI  143

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFP P KE V+VLGEWWK+D+E +IN+AMQ G+ PN+SD+HTINGHPGP 
Sbjct  144   VILPKLGVPYPFPAPHKEAVVVLGEWWKADIETIINRAMQLGVGPNISDSHTINGHPGPM  203

Query  645   PNCSSK--GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
              +C+S   G+ L VESGKTY+LRI++AA+N++LFFK+AGH LTVVEVDA Y KP+KTD +
Sbjct  204   SDCASSQDGFKLNVESGKTYMLRIINAALNDDLFFKIAGHKLTVVEVDAVYTKPYKTDIL  263

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGT-QALTSTVLAT  995
              I PGQTTN +L ADQ+ G+YL+++SPFMD  V  DN T T  LHY  T  A     L  
Sbjct  264   LITPGQTTNVLLAADQSAGRYLLSISPFMDAPVQVDNTTGTAILHYTNTVSAAARLTLFK  323

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
              PP+NAT + S F + LRSLNSK++PANVP   DHSL F IG+G+NPC  C+NG+R VG 
Sbjct  324   PPPQNATLIASKFADSLRSLNSKEYPANVPRTVDHSLFFTIGVGVNPCPNCINGTRVVGT  383

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             INN++FVMP+T +LQA+YYNI GVFT+DFP  P   FNYTG+ P NL+T NGT+
Sbjct  384   INNLTFVMPSTPILQAYYYNIPGVFTEDFPATPPHKFNYTGSGPKNLRTMNGTR  437



>emb|CDX93330.1| BnaC04g45660D [Brassica napus]
Length=560

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/413 (68%), Positives = 332/413 (80%), Gaps = 3/413 (1%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             ES+VRHY F VV KN TR+CSSKP V VNG++PGP++YAREDDT++++VVNHV+ NVSIH
Sbjct  24    ESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKYNVSIH  83

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGVRQ+RTGW+DGPAYITQCPIQ GQ + YN+TLTGQRGTL WHAHI W RATV+GAIV
Sbjct  84    WHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIV  143

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFPKPD E+VIVLGEWWKSD E VIN+A++SG+APNVSDAH ING PG   
Sbjct  144   ILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDAHMINGRPGLAK  203

Query  648   NCSS-KGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
             NCSS +GY L V++GKTYLLR+V+AA+NEELFFKVAGH  TVVEVDA YVKPFK DTI I
Sbjct  204   NCSSDQGYKLSVKNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKIDTIVI  263

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTTN +LTA ++ GKYL+  SPFMD+ +A DN TAT T+HY GT + + T+L   PP
Sbjct  264   APGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTILTLPPP  323

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRAVGDI  1178
             +NAT V + F   LRSLNSKK+PA VP   DH L F +G+G+NPC TC   NGSR V  I
Sbjct  324   QNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSRVVASI  383

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             NN++FVMP  ALL AHY+NISGVFT DFP  P   FNY+G    N+ T+ GT+
Sbjct  384   NNVTFVMPKIALLPAHYFNISGVFTPDFPKNPPHVFNYSGGSVTNMATETGTR  436



>ref|XP_003604619.1| Laccase 1a [Medicago truncatula]
 gb|AES86816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=557

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/436 (67%), Positives = 345/436 (79%), Gaps = 7/436 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SW+R   ++ L   I P  VE  VRHY F VV+KNT+R+CSSK IV VNGKFPGP+LY
Sbjct  1     MVSWIR---VLLLICCIFPALVECKVRHYKFHVVAKNTSRLCSSKAIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTVIV+V N V  N++IHWHG+RQLRTGW+DGPAYITQCPIQ G ++ YNFT+TGQ
Sbjct  58    AREDDTVIVKVRNQVNNNITIHWHGIRQLRTGWADGPAYITQCPIQPGHSYTYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAH+NW R+TVHGAIVILPK+GVPYPFPKPD E V+VLGEWWKSD EAVIN+A+
Sbjct  118   RGTLLWHAHVNWLRSTVHGAIVILPKKGVPYPFPKPDDELVLVLGEWWKSDTEAVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SG+APNVSDAHTING PG   NCS++  Y L VESGKTYLLRI++AA+NEELFFK+AGH
Sbjct  178   KSGLAPNVSDAHTINGLPGTVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDA+Y KPF+ +TI I PGQTTN +L A+Q  GKYL+A SPFMD  VA DN TA
Sbjct  238   KLTVVEVDATYTKPFQIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTA  297

Query  939   TGTLHYKG-TQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             T TLHY G T   T T L T PP NAT + + F+  L+ LNSKK+P NVPL+ DHSL F 
Sbjct  298   TATLHYSGTTLTNTPTFLTTPPPTNATQIANNFLNSLKGLNSKKYPVNVPLKIDHSLFFT  357

Query  1116  IGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFN  1289
             +G+G+NPC +C   NGSR V  INN++FVMPTTALLQAHY+NI  VFT DFP  P   +N
Sbjct  358   VGLGVNPCPSCKAGNGSRVVAAINNVTFVMPTTALLQAHYFNIKNVFTADFPPNPPHIYN  417

Query  1290  YTGTPPANLQTQNGTK  1337
             +TG  P NL T +GTK
Sbjct  418   FTGAGPKNLNTTSGTK  433



>ref|XP_007134763.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
 gb|ESW06757.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
Length=527

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/403 (71%), Positives = 332/403 (82%), Gaps = 3/403 (1%)
 Frame = +3

Query  138   VVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTG  317
             VV+K T R+CSSK IV +NGKFPGP+LYAREDDTV+V+V+N V  NV+IHWHGVRQLRTG
Sbjct  1     VVAKQTPRLCSSKSIVTINGKFPGPTLYAREDDTVLVKVINQVNHNVTIHWHGVRQLRTG  60

Query  318   WSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYP  497
             W+DGPAY+TQCPIQ GQT++YNFTLTGQRGTLL+HAH+NW R+T+HGA+VILPKRGVPYP
Sbjct  61    WADGPAYVTQCPIQPGQTYLYNFTLTGQRGTLLYHAHVNWLRSTLHGALVILPKRGVPYP  120

Query  498   FPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSKG-YTL  674
             FPKPD E V+VLGEWWKSD EA+IN+A++SG+APNVSDAHTING PG   NCSSK  Y L
Sbjct  121   FPKPDDELVVVLGEWWKSDTEAIINEALKSGLAPNVSDAHTINGLPGTVTNCSSKDVYNL  180

Query  675   EVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVL  854
              VE GKTYLLRIV+AA+NEELFFK+AGH LTVVEVDA+YVKPFK +TI I PGQTTN +L
Sbjct  181   PVEGGKTYLLRIVNAALNEELFFKIAGHKLTVVEVDATYVKPFKIETIVIAPGQTTNVLL  240

Query  855   TADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTF  1034
             +ADQ  GKYL+A SPFM+  VA DN TAT TLHY GT A T TVL T PP+NAT V + F
Sbjct  241   SADQKSGKYLVAASPFMNAPVAVDNLTATATLHYTGTLATTPTVLTTPPPKNATQVATNF  300

Query  1035  MEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGSRAVGDINNISFVMPTT  1208
             +  LR LNSKK+P NVPL  DHSL F  G+GINPC +C   NGSR V  INN++F+MPT 
Sbjct  301   ISSLRGLNSKKYPVNVPLTVDHSLFFTAGLGINPCPSCKAANGSRVVASINNVTFLMPTI  360

Query  1209  ALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             ALLQAHY+NI GVFT DFP  P   FNY+G  PANL T+ GTK
Sbjct  361   ALLQAHYFNIKGVFTTDFPANPPHVFNYSGPGPANLNTETGTK  403



>emb|CDY01010.1| BnaC05g41900D [Brassica napus]
Length=559

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 340/416 (82%), Gaps = 7/416 (2%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E+ +RHY F VV KN T++CS+KPIV +NGKFPGP+LYAREDD VIV + N+V  NV+IH
Sbjct  21    EANIRHYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVSYNVTIH  80

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGV+QLRTGWSDGPAYITQCP+Q G TF+YNFTLTGQRGTLLWHAHI+W RATVHGAIV
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFP+P  +++IV GEWWKSDVE VI Q+ QSG+ PN+SDAHTING  GP  
Sbjct  141   ILPKRGVPYPFPRPHTDKIIVFGEWWKSDVEDVIKQSTQSGLPPNLSDAHTINGLTGPIT  200

Query  648   NC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
              C +S GYT+ VE+GK+YLLRI++AAVN+ELFFK+A HNLTVVEVDASY KPF T+T+F+
Sbjct  201   GCNNSHGYTIHVETGKSYLLRIINAAVNDELFFKIAQHNLTVVEVDASYTKPFNTETLFL  260

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
             GPGQT NA+LTA+   G +L+ +SPFMDT+V  +N TAT  L YK T    S  L+ +PP
Sbjct  261   GPGQTANAILTANHPTGNFLMTISPFMDTVVPVNNATATAFLRYK-TTTTQSLTLSKIPP  319

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
              NAT +   F + LRSLNS+ +P NVPL+ DHSL FAIG+G+NPC+TC+NG++ + DINN
Sbjct  320   INATSIAQNFSDALRSLNSRDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKNIADINN  379

Query  1185  ISFVMPTTALLQAHYYNIS-GVFTDDFPGQPAIPFNYTG----TPPANLQTQNGTK  1337
             ++FVMPT ALLQAHY+N S GVFTDDFPG+P  PF+YTG     P +NLQT+NGT+
Sbjct  380   VTFVMPTMALLQAHYFNKSKGVFTDDFPGRPLTPFDYTGGNKSIPLSNLQTKNGTQ  435



>ref|XP_009416212.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/422 (69%), Positives = 348/422 (82%), Gaps = 6/422 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P   + + RHY F VV K+ TR+CS+K IV VNG+FPGP+LYAREDDTV+V+VVN V+
Sbjct  17    LLPLLAQGMTRHYKFDVVEKSFTRLCSTKSIVTVNGQFPGPTLYAREDDTVVVKVVNRVK  76

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQLRTGW+DGPAYITQCPIQ GQ+++YNFTL GQRGTLLWHAHI+WQRAT
Sbjct  77    VNVTIHWHGVRQLRTGWADGPAYITQCPIQPGQSYVYNFTLAGQRGTLLWHAHISWQRAT  136

Query  450   VHGAIVILPKRGVPYP-FPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTIN  626
             VHGAIVILPKRGV YP FP P KE V+VL EWW+SDVEAVI++AM SG APNVSDAHTIN
Sbjct  137   VHGAIVILPKRGVAYPFFPTPHKEVVLVLAEWWRSDVEAVIDEAMNSGRAPNVSDAHTIN  196

Query  627   GHPGPTPNCSS---KGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVK  797
             GH GP   C+S    G T+ V+ GKTYL RI++AA+NE+LFFKVAGH LTVVEVDA+Y K
Sbjct  197   GHAGPVSGCASSAQDGLTVRVDKGKTYLFRIINAALNEDLFFKVAGHQLTVVEVDATYTK  256

Query  798   PFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQAL  974
             PF TDT+ I PGQTTN +LTADQ  G+YL+A SPF D+ +VA DN+TAT T+ Y  + + 
Sbjct  257   PFTTDTLLITPGQTTNVLLTADQGAGRYLVAASPFADSPLVAVDNRTATATVQYASSVSA  316

Query  975   TSTVLATM-PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL  1151
             ++ V  T  PP+NATPV S+F++ LRSLNSK++PA VPL  D SLLF +G+G+NPC+TC 
Sbjct  317   SAVVTTTKPPPQNATPVASSFVDTLRSLNSKQYPAKVPLMVDRSLLFTVGLGVNPCATCT  376

Query  1152  NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNG  1331
             NGSR V DINN++FVMPTTALLQAHY+N SGVFTDDFPGQP I FNYTG+ P+N+QT NG
Sbjct  377   NGSRVVADINNVTFVMPTTALLQAHYFNTSGVFTDDFPGQPPIAFNYTGSGPSNMQTMNG  436

Query  1332  TK  1337
             T+
Sbjct  437   TR  438



>ref|XP_008441433.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=553

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/416 (65%), Positives = 331/416 (80%), Gaps = 1/416 (0%)
 Frame = +3

Query  93    CPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQE  272
             C   VES+VRHY+F V+ KN  ++C  K I+ VNGKFPGP+LYAREDDTVIVRV N    
Sbjct  14    CGVVVESLVRHYSFIVLLKNEKKVCGRKNIMTVNGKFPGPTLYAREDDTVIVRVTNRANH  73

Query  273   NVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATV  452
             N++IHWHGVRQLR+GW+DGPAYITQCPIQ GQ ++YNFTL  QRGTLLWHAHI+W RATV
Sbjct  74    NLTIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLNSQRGTLLWHAHISWIRATV  133

Query  453   HGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGH  632
             HGAIVILPK GVPYPFP+P K+++I+LGEWWKSDVEA++N++ Q G  PNVSDAHTINGH
Sbjct  134   HGAIVILPKLGVPYPFPRPHKQKIIILGEWWKSDVEAMVNKSTQLGQPPNVSDAHTINGH  193

Query  633   PGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             PG  P C++K G+TL VE+GKTYLLRI++AA+NE+ FFK+A H+ T+VEVDASY KPFKT
Sbjct  194   PGHVPGCAAKGGFTLNVETGKTYLLRIINAALNEDFFFKIASHHFTIVEVDASYTKPFKT  253

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             +TIFI PGQTTNA++TA +  GKYLI  SPFMD  VA DN TAT  L YK T   +  V 
Sbjct  254   NTIFISPGQTTNALITAHKPIGKYLITASPFMDAPVAIDNLTATAFLRYKRTPRNSPIVF  313

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
               +PP N+T +T+ F+  LRSLNS+++PA VPL  DH+L F +G+G NPC TC+NG R V
Sbjct  314   TKIPPPNSTFLTNQFINSLRSLNSEEYPAKVPLFIDHNLFFTVGVGANPCETCVNGMRLV  373

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
               +NN++F+MP  +LLQ+HYYNI G+FTDDFP  P   +NYTG PPAN QT NGTK
Sbjct  374   AAVNNVTFIMPKISLLQSHYYNIPGIFTDDFPANPPFVYNYTGKPPANNQTSNGTK  429



>gb|EMT26873.1| Laccase-22 [Aegilops tauschii]
Length=563

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/414 (65%), Positives = 331/414 (80%), Gaps = 3/414 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V ++ RHY F VV +N T +CS+K I+ VNGKFPGP+LYARE D V+V+VVNH   NV+I
Sbjct  26    VHAITRHYKFNVVMRNMTLLCSTKSILTVNGKFPGPTLYAREGDDVLVKVVNHSPHNVTI  85

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHGVRQ+RTGW DGPAYITQCPIQ G +F+YNFT+TGQRGTLLWHAHINW RATVHGAI
Sbjct  86    HWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHINWLRATVHGAI  145

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFP P KE V+VLGEWWK+D E VINQAMQ G+ PN+SD+HTINGHPGP 
Sbjct  146   VILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISDSHTINGHPGPM  205

Query  645   PNCSS--KGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
              +C+S   G+ L+VE+GKTY+LRI++A +N++LFFK+AGH LTVVEVDA Y KP+KTD +
Sbjct  206   SDCASSQDGFNLDVENGKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDAVYTKPYKTDIL  265

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV-LAT  995
              I PGQTTN ++T DQ+ G+YL++VSPF+D  +  DN+T T TL Y  T + T+ + L  
Sbjct  266   LITPGQTTNVLVTTDQSAGRYLLSVSPFLDAPLQVDNKTGTATLQYANTVSATARLTLVK  325

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
              PP+NATP+ S F E LRSLNSK++PANVP   DHSL F IG+G+NPC+ C+NG+R VG 
Sbjct  326   PPPQNATPIASKFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCANCINGTRVVGT  385

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             INN +FVMP+T +LQA YY+I GVFT+DFP  P   FNYTG+ P NLQT  GT+
Sbjct  386   INNSTFVMPSTPILQARYYSIPGVFTEDFPATPPHKFNYTGSGPKNLQTMKGTR  439



>gb|KCW52562.1| hypothetical protein EUGRSUZ_J01941, partial [Eucalyptus grandis]
Length=524

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/400 (69%), Positives = 315/400 (79%), Gaps = 0/400 (0%)
 Frame = +3

Query  138   VVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTG  317
             VV K T R+CSSKPIV VNG+FPGP++YAREDDTV V+VVNHV  NV+IHWHGVRQLRT 
Sbjct  1     VVEKRTDRLCSSKPIVTVNGRFPGPTIYAREDDTVFVKVVNHVSYNVTIHWHGVRQLRTC  60

Query  318   WSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYP  497
             W+DGPAYITQCPIQ GQ + YNFT+TGQRGTLLWHAHI W RATVHGA+VILPKRGVPYP
Sbjct  61    WADGPAYITQCPIQPGQIYTYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYP  120

Query  498   FPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSKGYTLE  677
             FPKP KE+VIVL EWWKSDVEAVI +A++SG APNVSDAHTIN HPGP  NC   GY L 
Sbjct  121   FPKPHKEKVIVLAEWWKSDVEAVIGEAIKSGGAPNVSDAHTINSHPGPVANCPKGGYELA  180

Query  678   VESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLT  857
             V  GKTY+LRI++AA+NEELFFK+A H LTVVEVDA+YVKP +TD I +GPGQTT A+L 
Sbjct  181   VRPGKTYMLRIINAALNEELFFKIARHQLTVVEVDAAYVKPLRTDAILVGPGQTTTALLM  240

Query  858   ADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFM  1037
             A    GKYL+ VSPFMD  V+ DN TAT T+ Y GT A +  V    P  NAT V   F+
Sbjct  241   AYHTTGKYLMIVSPFMDAPVSVDNVTATATVRYAGTPAASPAVPIAPPSPNATWVAEGFV  300

Query  1038  EGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALL  1217
               LRSLN+  +PA VPL+ DHSL F +GIG+NPC+TC +G R V D NNISFVMP TALL
Sbjct  301   GSLRSLNTGAYPARVPLEIDHSLFFTVGIGVNPCATCASGFRVVADFNNISFVMPKTALL  360

Query  1218  QAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              AHYY ++GVFTDDFP +P I FNYTG  P NL T  GT+
Sbjct  361   SAHYYKMTGVFTDDFPAKPMIRFNYTGAQPVNLNTMTGTR  400



>gb|KHN04832.1| Laccase-4 [Glycine soja]
Length=524

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/419 (67%), Positives = 327/419 (78%), Gaps = 28/419 (7%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  VE  VRHY F VVSK T R+CSSK IV +NGKFPGP+LYAREDDTV+V+V+N V 
Sbjct  7     ILPALVECRVRHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYAREDDTVLVKVINQVN  66

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NV+IHWHGVRQLRTGW+DGPAY+TQCPIQ GQT++YNFTLTGQRGTLL+HAH+NW R+T
Sbjct  67    HNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYVYNFTLTGQRGTLLYHAHVNWLRST  126

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             ++GA+VILPKRGVPYPFPKPD E V+VLGEWWKSD EAVIN+A++SG+APNVSDAHTING
Sbjct  127   LYGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAVINEALKSGLAPNVSDAHTING  186

Query  630   HPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PG   NCS++  Y L VESGKTYLLRIV+AA+NEELFFK+AGH LTVVEVDA+YVKPFK
Sbjct  187   LPGTVTNCSTQDVYNLPVESGKTYLLRIVNAALNEELFFKIAGHKLTVVEVDATYVKPFK  246

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
              +TI I PGQTTN +L A+Q  GKYL+A SPFMD  VA                      
Sbjct  247   IETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVA----------------------  284

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC--LNGS  1160
                +PP+NAT + + F+  LR LNSKK+P NVPL  DHSL+F +G+GINPC +C   NGS
Sbjct  285   ---VPPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFTVGLGINPCPSCKAANGS  341

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INN++F+MPT ALLQAHY+NI GVFT DFP  P   FNY+G  PANL T+ GTK
Sbjct  342   RVVAAINNVTFIMPTIALLQAHYFNIKGVFTTDFPANPPHVFNYSGPGPANLNTETGTK  400



>ref|XP_006300062.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
 gb|EOA32960.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
Length=548

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/411 (67%), Positives = 328/411 (80%), Gaps = 8/411 (2%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E+ +R Y F VV KN T++CS+KPIV +NGKFPGP+LYAREDD VIV + N+V  NV+IH
Sbjct  21    EANIRRYKFNVVMKNITKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNVTIH  80

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGV+QLRTGWSDGPAYITQCP+Q G TF+YNFTLTGQRGTLLWHAHI+W RATVHGAIV
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPKRGVPYPFP+P  E++IV GEWWKSDVEAVINQ+ QSG+ PN+SDAHTING  G   
Sbjct  141   ILPKRGVPYPFPRPHTEKIIVFGEWWKSDVEAVINQSTQSGLPPNISDAHTINGLTG---  197

Query  648   NCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
                  GYTL V++GK YLLRI++AAVN+ELFFK+AGHN TVVEVDASY KPF TDT+F+G
Sbjct  198   ---RSGYTLHVKTGKKYLLRIINAAVNDELFFKIAGHNFTVVEVDASYTKPFNTDTLFLG  254

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPR  1007
             PGQTTNA+LTA    G +L+ +SPFMDT+V  +N T T  L YK T    S   + +PP 
Sbjct  255   PGQTTNAILTATHPPGNFLMTISPFMDTVVPVNNATGTALLRYKDTTTTQSLTSSKIPPI  314

Query  1008  NATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNI  1187
             NAT +   F + LRSLNS  +P  VPL+ DHSL F IG+G+NPC+TC+NG++ + DINN+
Sbjct  315   NATSIALGFSDSLRSLNSPDYPTKVPLKIDHSLFFTIGVGVNPCTTCINGTKTIADINNV  374

Query  1188  SFVMPTTALLQAHYYNIS-GVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             SFVMPT A+LQAHY+N S GVFTDDFPG+P  PFNYTG    NL+T+ GTK
Sbjct  375   SFVMPTVAMLQAHYFNKSEGVFTDDFPGRPLTPFNYTGG-LNNLRTKKGTK  424



>ref|XP_003615575.1| Laccase 1a [Medicago truncatula]
Length=593

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/413 (65%), Positives = 333/413 (81%), Gaps = 2/413 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V++V+      VV KN TR+CS+KPIV +NG FPGP++YAREDDTV+V+VVNHV+ NVSI
Sbjct  57    VDNVLLLLLIQVVMKNATRLCSTKPIVTINGNFPGPTIYAREDDTVLVKVVNHVKYNVSI  116

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFTLTGQRGTL WHAHI W RATVHGAI
Sbjct  117   HWHGIRQLRTGWADGPAYITQCPIQPGQVYMYNFTLTGQRGTLWWHAHILWLRATVHGAI  176

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFP+P  E+VI+L EWWKSD EA+IN+A++SG+APNVSDAHTINGHPGP 
Sbjct  177   VILPKLGVPYPFPRPHMEQVIILSEWWKSDTEAIINEALKSGLAPNVSDAHTINGHPGPV  236

Query  645   PNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              +C+S+ G+  +VE GKTYLLRI++AA+NE+LFFK+AGH  TVVEVDA+Y KPFKTDTI 
Sbjct  237   QHCASQEGFKFQVEPGKTYLLRIINAALNEDLFFKIAGHKFTVVEVDAAYTKPFKTDTIV  296

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
             I PGQTTN +L  +   GKY++A S FMD  +A DN TAT TLHY  T   T T L ++P
Sbjct  297   ITPGQTTNVLLKTNHASGKYMVAASTFMDAPIAIDNVTATATLHYPNTLGSTITTLTSLP  356

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
             P N+T + ++F + L+SLNS K+PA VP + DHSL F + +G+NPC+TC NGSR V  IN
Sbjct  357   PINSTKIANSFTDSLKSLNSHKYPARVPKKIDHSLFFTVSLGVNPCATCPNGSRVVAAIN  416

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             N++FVMP  +LLQAH++NISG+FTDDFP +P I +++TG   P+N +T  GT+
Sbjct  417   NVTFVMPKISLLQAHFFNISGIFTDDFPRKPEIVYDFTGNKQPSNFRTNKGTR  469



>ref|XP_011080855.1| PREDICTED: laccase-4 [Sesamum indicum]
Length=554

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/433 (63%), Positives = 334/433 (77%), Gaps = 4/433 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MA+WVR   ++ L   + P  VES +R Y F VV +N +R+CSSKP+V VNG+FPGP++Y
Sbjct  1     MAAWVR---VLLLFTCLLPGMVESDLRRYKFNVVMRNKSRLCSSKPVVTVNGRFPGPNIY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDT++++VVNHV  N+SIHWHG++QL TGW+DGPAYITQCPIQ GQ+++YNFT+ GQ
Sbjct  58    AREDDTLLIKVVNHVNYNISIHWHGIKQLGTGWADGPAYITQCPIQPGQSYVYNFTVNGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGT LWHAHI W RATVHGAIV+LPK GVPYPFPKP +E V +LGEWWKSDVE VIN+AM
Sbjct  118   RGTFLWHAHILWLRATVHGAIVVLPKPGVPYPFPKPHQEAVFILGEWWKSDVEDVINEAM  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
               G+APNVSDAHTINGHPGP  +C  + G+ L V  GKTYLLR+++AA+NEELFFK+AGH
Sbjct  178   DLGVAPNVSDAHTINGHPGPISSCVGQGGFDLGVMPGKTYLLRVINAALNEELFFKIAGH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              L VVE+DA+YVKPF TDT+ I PGQTTNA+LTAD   G+Y +  SPFMD+ +  DN+TA
Sbjct  238   KLRVVEIDAAYVKPFDTDTLLIAPGQTTNALLTADLPIGRYQVVASPFMDSPIDIDNRTA  297

Query  939   TGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAI  1118
             T TLHY GT   T  VL   P RNAT   + F   LRSLNS ++P  VP + DH LLFAI
Sbjct  298   TATLHYTGTLPSTPAVLTDPPSRNATATATKFAHSLRSLNSAEYPCRVPREVDHHLLFAI  357

Query  1119  GIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG  1298
             G+G+N CSTC NG R V DINN++F MP+ +LL AH++NI GVFTDDFPG P  P++YT 
Sbjct  358   GLGLNRCSTCANGYRVVADINNVTFAMPSVSLLNAHFFNIPGVFTDDFPGDPPTPYDYTA  417

Query  1299  TPPANLQTQNGTK  1337
                 N+ T  GT+
Sbjct  418   RRVVNMGTTTGTR  430



>ref|XP_010676357.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=561

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/415 (67%), Positives = 326/415 (79%), Gaps = 4/415 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE  VRHY F VV KN TR CS+K IV VNGKFPGP++ AREDDTV+V+VVNHV+ N++I
Sbjct  23    VECRVRHYKFNVVMKNHTRQCSTKSIVTVNGKFPGPTIVAREDDTVLVKVVNHVKYNLTI  82

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQ+RTGWSDGPAYI QCPIQ GQT+ YNFT+TGQRGTL +HAHI W RATVHGAI
Sbjct  83    HWHGIRQIRTGWSDGPAYIAQCPIQPGQTYTYNFTVTGQRGTLFYHAHILWLRATVHGAI  142

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKPDKE +IVLGEWWKSDVEAVIN+A++SG+APNVSDAHTING+  P 
Sbjct  143   VILPKLGVPYPFPKPDKENIIVLGEWWKSDVEAVINEALKSGLAPNVSDAHTINGYTRPV  202

Query  645   PNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              NC+SK  + + V+ GK Y+LRI++AA+NEELFFK+A H LTVVEVDA+YVKPFKTDTI 
Sbjct  203   KNCNSKEMFNIHVKPGKRYMLRIINAALNEELFFKIADHKLTVVEVDATYVKPFKTDTIV  262

Query  822   IGPGQTTNAVLTADQNG-GKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALT-STVLAT  995
             I PGQTTN +L A+    GKYL+ VSPFMD  V  DN T   TL Y   +  T S  L  
Sbjct  263   ISPGQTTNVILEANNKAMGKYLVVVSPFMDAPVPVDNATGFATLRYPAFRHKTLSATLTA  322

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
              PP NAT V   F   LRSLN+K+FPA VP + DHSL F +G+G+NPC TC+NGSR V D
Sbjct  323   PPPINATAVADNFTNALRSLNTKEFPAKVPQKVDHSLFFTVGLGVNPCKTCVNGSRIVAD  382

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPA-NLQTQNGTK  1337
             INNI+FVMP  ++LQAHYYNISGVFTDDFP +P  PFN+TG     N+ T  GTK
Sbjct  383   INNITFVMPDISILQAHYYNISGVFTDDFPAKPPTPFNFTGNNQVTNVGTTKGTK  437



>ref|XP_010543228.1| PREDICTED: laccase-10 [Tarenaya hassleriana]
Length=558

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 338/420 (80%), Gaps = 4/420 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             I P  V+  VR Y F VV+K  TR+CS+K IV VNGKFPGP++YAREDDT++V VVN+V+
Sbjct  15    ILPVTVQGDVRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYAREDDTILVNVVNNVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPI+ GQ ++YNFT+TGQRGTL WHAHI W RAT
Sbjct  75    YNVSIHWHGIRQLRTGWADGPAYITQCPIRPGQNYVYNFTVTGQRGTLWWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK G+PYPFPKP +EEVI+LGEWWKSD EAVIN+A++SG+APNVSDAH ING
Sbjct  135   VHGAIVILPKPGLPYPFPKPHREEVIMLGEWWKSDTEAVINEALKSGLAPNVSDAHIING  194

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             HPGP   C S+ G+ L VE+GKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF 
Sbjct  195   HPGPVSTCPSQGGFKLSVETGKTYMLRLINAAMNEELFFKIAGHRFTVVEVDAVYVKPFS  254

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMD-TIVATDNQTATGTLHYKGTQALTST  983
             TDTI I PGQTT A+++A +  GKYLIA SPF D   VA DN+TAT T+HY GT +   T
Sbjct  255   TDTILIAPGQTTTALVSAVRTSGKYLIAASPFQDAAAVAVDNRTATATVHYSGTLSAAPT  314

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NG  1157
              L + PPRNAT V ++F+  LRSLNSK FPANVP   DH LLFA+G+GIN C +C   NG
Sbjct  315   SLTSPPPRNATSVANSFIGSLRSLNSKNFPANVPATVDHDLLFAVGLGINRCHSCKAGNG  374

Query  1158  SRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             +R V  INN++F MPTTALLQAHY+N+SGV+T DFPG+P   F++TG PP+NL T   TK
Sbjct  375   TRVVAGINNVTFKMPTTALLQAHYFNLSGVYTTDFPGKPHHAFDFTGKPPSNLATMKATK  434



>gb|KFK27419.1| hypothetical protein AALP_AA8G380300 [Arabis alpina]
Length=524

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/422 (66%), Positives = 330/422 (78%), Gaps = 6/422 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V S++RHY F VV  NTT++CSSKPIV VNG+FPGP++ AREDDTV+++VVNHV+
Sbjct  20    LSPITVHSMIRHYKFNVVLTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVK  79

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ +IYNFT+TGQRGTL WHAHI W RAT
Sbjct  80    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYIYNFTVTGQRGTLWWHAHILWLRAT  139

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFPKP KE+ IVL EWWKSDVE +IN+A + G AP  SDAHTING
Sbjct  140   VHGAIVILPKLGVPYPFPKPYKEKTIVLSEWWKSDVEELINEASKIGTAPIASDAHTING  199

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP  NC S+ GY L V  GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KPFK
Sbjct  200   HSGPVSNCPSQNGYGLPVRLGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPFK  259

Query  807   TDTIFIGPGQTTNAVLTADQNGG-KYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS-  980
             TDT+ I PGQTTN +LTA+ N G KY++A + FMD  +  DN TAT  LHY G    TS 
Sbjct  260   TDTVLIAPGQTTNVLLTANANAGSKYMVAATTFMDAPLPFDNVTATAILHYIGHTVPTSK  319

Query  981   -TVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG  1157
              TVLA++PP+NAT V S F+  LRSLNS+++P  VP + DHSL F +G+G NPC +C+NG
Sbjct  320   KTVLASLPPQNATWVASKFIRSLRSLNSREYPVRVPTKIDHSLSFTVGLGANPCPSCING  379

Query  1158  SRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNG  1331
             +R V  INNI+F MP TALLQAH++NIS VFTDDFP +P  P++YT   P   N  T  G
Sbjct  380   TRLVAGINNITFTMPKTALLQAHFFNISNVFTDDFPAKPLNPYDYTAPVPQSVNAATMKG  439

Query  1332  TK  1337
             TK
Sbjct  440   TK  441



>ref|XP_009120399.1| PREDICTED: laccase-16 [Brassica rapa]
Length=565

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/422 (66%), Positives = 330/422 (78%), Gaps = 6/422 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V S++RHY F VV  NTT++CSSKPIV VNG+FPGP++ AREDDTV+++VVNHV+
Sbjct  20    LSPTTVHSIIRHYKFNVVMTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVK  79

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ  Q ++YNFTLTGQRGTL WHAHI W RAT
Sbjct  80    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPRQNYLYNFTLTGQRGTLWWHAHILWLRAT  139

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFPKP KE+ IVL EWWKSDVE +IN+A ++G APN SDAHTING
Sbjct  140   VHGAIVILPKLGVPYPFPKPYKEKTIVLAEWWKSDVEQLINEATKNGTAPNASDAHTING  199

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP  NC S+ GY L V  GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+K
Sbjct  200   HSGPISNCPSQSGYGLPVRPGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPYK  259

Query  807   TDTIFIGPGQTTNAVLTADQN-GGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS-  980
             TDT+ I PGQTTN +LTA+ N G KY++A + FMD  ++ DN TAT TLHY G    +S 
Sbjct  260   TDTVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATATLHYIGHTVSSSK  319

Query  981   -TVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG  1157
              TVLA++P  NAT V S F++ LRSLNS+++PA VP   DHSL F +G+G NPC +C NG
Sbjct  320   KTVLASLPQPNATLVASKFIKSLRSLNSREYPAKVPTTVDHSLFFTVGLGANPCPSCNNG  379

Query  1158  SRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG--TPPANLQTQNG  1331
              R V  INN++F MP TALLQAHY+NIS VFTDDFP +P+ PFNYT       N  T  G
Sbjct  380   FRLVAGINNVTFTMPETALLQAHYFNISHVFTDDFPAKPSNPFNYTAPVDQSVNAATMTG  439

Query  1332  TK  1337
             TK
Sbjct  440   TK  441



>gb|KGN45770.1| hypothetical protein Csa_6G009490 [Cucumis sativus]
Length=555

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/416 (64%), Positives = 326/416 (78%), Gaps = 1/416 (0%)
 Frame = +3

Query  93    CPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQE  272
             C   VES+VRHY+F V+ KN  + C  K I+ VNGKFPGP+LYAREDDTVIVRV N    
Sbjct  16    CGVVVESLVRHYSFIVLLKNERKACGRKDIMTVNGKFPGPTLYAREDDTVIVRVTNRANH  75

Query  273   NVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATV  452
             N++IHWHGVRQLR+GW+DGPAYITQCPIQ GQ ++YNFTL+ QRGTLLWHAH +W RATV
Sbjct  76    NLTIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLSSQRGTLLWHAHFSWIRATV  135

Query  453   HGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGH  632
             HGAIVI PK GVPYPFP P K++ I+LGEWWKSDVEA++N++ Q G  PNVSDA TINGH
Sbjct  136   HGAIVIFPKHGVPYPFPHPYKQKTIILGEWWKSDVEAMVNKSTQLGQPPNVSDAQTINGH  195

Query  633   PGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             PG  P C++K G+TL VE+GKTYLLRI++AA+NE+ FFK+A H+ T+VEVDASY KPFKT
Sbjct  196   PGHVPGCATKRGFTLHVETGKTYLLRIINAALNEDFFFKIASHHFTIVEVDASYTKPFKT  255

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVL  989
             +TIFI PGQTTNA++ A +  GKYLIA SPFMD  VA DN TAT  L YK T   +  V 
Sbjct  256   NTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLTATAFLRYKRTPKNSPIVF  315

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAV  1169
               +PP N+T +T+ F + LRSLNS+++PA VPL  DH+L F +G+G+NPC TC+NG R V
Sbjct  316   THIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFTVGVGVNPCETCVNGVRLV  375

Query  1170  GDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
               +NN++F+MP  +LLQ+HYYNI GVFTDDFP  P   ++YTG PP N QT NGTK
Sbjct  376   AAVNNVTFLMPQISLLQSHYYNIPGVFTDDFPANPPFVYDYTGKPPTNNQTSNGTK  431



>ref|XP_006840270.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
 gb|ERN01945.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
Length=565

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/429 (68%), Positives = 336/429 (78%), Gaps = 15/429 (3%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  VE  VRHY F VV KNTTR+C +KPIV VNG FPGP++YARE D V+V+VVNHV+
Sbjct  15    LLPALVECRVRHYKFNVVVKNTTRLCQTKPIVTVNGGFPGPTVYAREGDNVLVKVVNHVK  74

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHG+RQ+RTGW+DGPAYITQCPIQTGQT+ YNFT+TGQRGTLLWHAHI W RAT
Sbjct  75    YNLSIHWHGIRQVRTGWADGPAYITQCPIQTGQTYTYNFTITGQRGTLLWHAHILWLRAT  134

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPKRGVPYPFPKP KE V++L EWW SDVEAVIN AM+SG APNVSDAHTING
Sbjct  135   VHGAIVILPKRGVPYPFPKPHKEVVVILAEWWNSDVEAVINTAMKSGAAPNVSDAHTING  194

Query  630   HPGPTPNCSSK---GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKP  800
             HPGP  NCSS+   G+ LEVESGKTYLLRI++AA+NEELFF VAGH LTVVEVDA+Y KP
Sbjct  195   HPGPLSNCSSQGGGGFKLEVESGKTYLLRIINAALNEELFFGVAGHPLTVVEVDATYNKP  254

Query  801   FKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGT--QAL  974
             F T T+ I PGQTTN +L AD++GG+Y+ A SPFMD  +A DN TAT  LHY  T   + 
Sbjct  255   FTTTTVLIAPGQTTNVLLKADKSGGRYIAAASPFMDAPIAVDNATATALLHYTDTPSSSS  314

Query  975   TSTVLATMPPRNATPVTSTFMEGLRSLNSKKFP-ANVPLQT--DHSLLFAIGIGINPCST  1145
              ST   ++PP NATPV S FM+ LRSL  KK P +++P  +  DHSL   +G+GI PC T
Sbjct  315   VSTTFVSLPPLNATPVASKFMDSLRSL--KKPPSSSLPRHSRVDHSLFITVGLGIFPCPT  372

Query  1146  CL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PAN-  1313
             C   NGSR +  +NNISFVMPT  LLQAHY+NISGVFTDDFP +P  PFNYT  P P N 
Sbjct  373   CTANNGSRVLAAMNNISFVMPTFNLLQAHYFNISGVFTDDFPAKPPTPFNYTQNPTPQNT  432

Query  1314  -LQTQNGTK  1337
              +   NGT+
Sbjct  433   SIVLSNGTR  441



>ref|XP_010690098.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=565

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/442 (64%), Positives = 336/442 (76%), Gaps = 9/442 (2%)
 Frame = +3

Query  30    RTRIMASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPG  209
             R   M  W+R V LV +   + P   E+ VRHYNF VV KN T++CS+KPI  VNGKFPG
Sbjct  3     RETTMEPWIRAVFLVMV---LFPALAEAKVRHYNFKVVMKNYTKLCSTKPIATVNGKFPG  59

Query  210   PSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFT  389
             P+L ARE D V+V+V+N V  NV+IHWHG+RQLRTGWSDGPAYI QCPIQ GQ+++YNF+
Sbjct  60    PTLRAREGDNVLVKVINDVSYNVTIHWHGIRQLRTGWSDGPAYIAQCPIQPGQSYLYNFS  119

Query  390   LTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVI  569
             + GQRGTL WHAHI+W RAT+HGAIVILPK+G PYPFP+P KE++IVL EWWK+D EAVI
Sbjct  120   IIGQRGTLFWHAHISWLRATMHGAIVILPKKGTPYPFPQPVKEKIIVLAEWWKADTEAVI  179

Query  570   NQAMQSGMAPNVSDAHTINGHPGPTPNC--SSKG-YTLEVESGKTYLLRIVSAAVNEELF  740
             NQ   SGM PNVSDAHT+NG+ GP  NC  SS+G YTL VE  KTYLLRI++AA+N+E+F
Sbjct  180   NQGTLSGMPPNVSDAHTMNGYTGPIRNCSISSQGTYTLHVEHNKTYLLRIINAAINDEIF  239

Query  741   FKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQN-GGKYLIAVSPFMDT-I  914
             F++AGH  TVVEVDASY KPF TDTI+I PGQTTNA+L ADQ+   KYLI +S FMD   
Sbjct  240   FRIAGHKFTVVEVDASYTKPFVTDTIYIAPGQTTNALLKADQSPSKKYLIGMSSFMDAPS  299

Query  915   VATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQT  1094
             VA DN T  G L Y G    +  VL TMPP NAT     F   LRSLNSKK+PA VPL  
Sbjct  300   VAVDNTTNYGLLRYNGGPLGSRLVLTTMPPINATKAQLNFSNALRSLNSKKYPAQVPLTI  359

Query  1095  DHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQP  1274
             DHSLLF  G+G+NPC+TCLNGS+ VG+INN++FVMP+ ALLQA+YYNISGVFTDDFP +P
Sbjct  360   DHSLLFTTGVGVNPCATCLNGSKLVGNINNVTFVMPSIALLQAYYYNISGVFTDDFPSKP  419

Query  1275  AIPFNYT-GTPPANLQTQNGTK  1337
                F+YT       L T NGTK
Sbjct  420   PTNFDYTIANYTGGLATMNGTK  441



>ref|XP_004506788.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=557

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/436 (66%), Positives = 346/436 (79%), Gaps = 7/436 (2%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M  WVR   ++ L + I P  VE  VR Y F VV+KN +R+CSSK IV VNG+FPGP+LY
Sbjct  1     MNYWVR---VLLLISCILPALVECKVRRYKFHVVAKNISRLCSSKSIVTVNGEFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+VRVVN V  N++IHWHG+RQLRTGW+DGPAY+TQCPI  G +++YNFT+TGQ
Sbjct  58    AREDDTVLVRVVNKVNHNITIHWHGIRQLRTGWADGPAYVTQCPILPGHSYVYNFTITGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAH+NW R+TVHGAIVILPKRGVPYPFPKPD+E V+VLGEWWKSD EA+IN+A+
Sbjct  118   RGTLLWHAHVNWLRSTVHGAIVILPKRGVPYPFPKPDEELVLVLGEWWKSDTEAIINEAL  177

Query  582   QSGMAPNVSDAHTINGHPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             +SGMAPNVSD+HTING PG   NCS++  Y L VESGK+YLLRI++AA+NEELFFK+A H
Sbjct  178   KSGMAPNVSDSHTINGFPGKVSNCSNQEVYNLPVESGKSYLLRIINAALNEELFFKIANH  237

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LT+VEVDA+YVKPF+ +TI I PGQTTN +L A+Q  GKYL+A SPFMD  VA DN TA
Sbjct  238   KLTIVEVDATYVKPFEIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTA  297

Query  939   TGTLHYKG-TQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             T TLHY G T + T T L T PP+N+T   + F+  LR LNSK +P N+PL+ DHSL F 
Sbjct  298   TATLHYSGLTLSNTPTFLTTPPPKNSTENANNFLNSLRGLNSKTYPVNLPLKIDHSLYFT  357

Query  1116  IGIGINPCSTC--LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFN  1289
             IG+G+ PC +C   NGSR V  +NN++FVMPTTALLQAHY+NI GVFT DFP  P   FN
Sbjct  358   IGLGLQPCPSCKAANGSRVVAAVNNVTFVMPTTALLQAHYFNIGGVFTTDFPPNPPFFFN  417

Query  1290  YTGTPPANLQTQNGTK  1337
             +TG+ P NL T +GTK
Sbjct  418   FTGSGPKNLNTDSGTK  433



>ref|XP_004138572.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis sativus]
Length=561

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/422 (63%), Positives = 325/422 (77%), Gaps = 7/422 (2%)
 Frame = +3

Query  93    CPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQE  272
             C   VES+VRHY+F V+ KN  + C  K I+ VNGKFPGP+LYAREDDTVIVRV N    
Sbjct  16    CGVVVESLVRHYSFIVLLKNERKACGRKDIMTVNGKFPGPTLYAREDDTVIVRVTNRANH  75

Query  273   NVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATV  452
             N++IHWHGVRQLR+GW+DGPAYITQCPIQ GQ ++YNFTL+ QRGTLLWHAH +W RATV
Sbjct  76    NLTIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLSSQRGTLLWHAHFSWIRATV  135

Query  453   HGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVIN-------QAMQSGMAPNVSD  611
             HGAIVI PK GVPYPFP P K++ I+LGEWWKSDVEA++N       ++ Q G  PNVSD
Sbjct  136   HGAIVIFPKHGVPYPFPHPYKQKTIILGEWWKSDVEAMVNDVEAMVNKSTQLGQPPNVSD  195

Query  612   AHTINGHPGPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASY  791
             A TINGHPG  P C++K +TL VE+GKTYLLRI++AA+NE+ FFK+A H+ T+VEVDASY
Sbjct  196   AQTINGHPGHVPGCATKSFTLHVETGKTYLLRIINAALNEDFFFKIASHHFTIVEVDASY  255

Query  792   VKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQA  971
              KPFKT+TIFI PGQTTNA++ A +  GKYLIA SPFMD  VA DN TAT  L YK T  
Sbjct  256   TKPFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLTATAFLRYKRTPK  315

Query  972   LTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL  1151
              +  V   +PP N+T +T+ F + LRSLNS+++PA VPL  DH+L F +G+G+NPC TC+
Sbjct  316   NSPIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFTVGVGVNPCETCV  375

Query  1152  NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNG  1331
             NG R V  +NN++F+MP  +LLQ+HYYNI GVFTDDFP  P   ++YTG PP N QT NG
Sbjct  376   NGVRLVAAVNNVTFLMPQISLLQSHYYNIPGVFTDDFPANPPFVYDYTGKPPTNNQTSNG  435

Query  1332  TK  1337
             TK
Sbjct  436   TK  437



>emb|CDX80325.1| BnaC09g34170D [Brassica napus]
Length=570

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/427 (65%), Positives = 330/427 (77%), Gaps = 11/427 (3%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V S++RHY F VV  NTT++CSSKPIV VNG+FPGP++ AREDDTV+++VVNHV+
Sbjct  20    LSPTTVHSIIRHYKFNVVMTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVK  79

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQ  Q + YNFTLTGQRGTL WHAHI W RAT
Sbjct  80    YNVSIHWHGVRQLRTGWADGPAYITQCPIQPRQNYFYNFTLTGQRGTLWWHAHILWLRAT  139

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFPKP KE+ IVLGEWWKSDVE +IN+A + G APN SDAHTING
Sbjct  140   VHGAIVILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEQLINEATKHGTAPNASDAHTING  199

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H GP  NC S+ GY L V  GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+K
Sbjct  200   HSGPISNCPSQSGYGLPVRPGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPYK  259

Query  807   TDTIFIGPGQTTNAVLTADQN-GGKYLIAVSPFMDTIVATDNQTATGT-----LHYKGTQ  968
             TDT+ I PGQTTN +LTA+ N G KY++A + FMD  ++ DN TAT T     LHY G  
Sbjct  260   TDTVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATATLHSNALHYIGHT  319

Query  969   ALTS--TVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCS  1142
               +S  TVLA++P  NAT V+S F++ LRSLNS+++PA VP   DHSL F +G+G NPC 
Sbjct  320   VSSSKKTVLASLPQPNATLVSSKFIKSLRSLNSREYPAKVPTTVDHSLFFTVGLGANPCP  379

Query  1143  TCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTG--TPPANL  1316
             +C NG R V  INN++F MP TALLQAHY+NIS VFTDDFP +P+ P+NYT       N 
Sbjct  380   SCNNGIRLVAGINNVTFTMPETALLQAHYFNISHVFTDDFPAKPSNPYNYTAPVDQSVNA  439

Query  1317  QTQNGTK  1337
              T  GTK
Sbjct  440   ATMTGTK  446



>ref|XP_004150626.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004169234.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=517

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/399 (66%), Positives = 322/399 (81%), Gaps = 9/399 (2%)
 Frame = +3

Query  147   KNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSD  326
             +  TR+CSSKPIV +NGKFPGP++YAREDDTV+++VVNHV  NVSIHW       TGW+D
Sbjct  2     RKVTRLCSSKPIVTINGKFPGPTIYAREDDTVLIKVVNHVPYNVSIHW-------TGWAD  54

Query  327   GPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPK  506
             GPAYITQCP+QTGQ+++YNFT+TGQRGTL WHAHI W RAT++GA+VILPK GVPYPFP 
Sbjct  55    GPAYITQCPLQTGQSYVYNFTITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFPT  114

Query  507   PDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSKGY-TLEVE  683
             P KE V++LGEWWKSDVEAV+++A +SG+APNVSDAHTINGHPGP   C ++G   + V+
Sbjct  115   PHKELVLILGEWWKSDVEAVVHEAAKSGLAPNVSDAHTINGHPGPVNGCLTRGKGIMPVQ  174

Query  684   SGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTAD  863
              GKTYLLRI++AA+NEELFFKVAGH LTVVEVDA+Y KPF TDTIFI PGQTTNA+LTAD
Sbjct  175   PGKTYLLRIINAALNEELFFKVAGHKLTVVEVDAAYTKPFITDTIFIAPGQTTNALLTAD  234

Query  864   QNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTSTFME  1040
                GKY I+ SPF DT IVA DN TAT TLHY GT + + T    +PP+NAT + + F  
Sbjct  235   LKSGKYAISASPFRDTPIVAVDNVTATATLHYTGTISTSPTSFTGLPPQNATLIATKFTN  294

Query  1041  GLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQ  1220
              LRSLNSK++PA V L+ DHSL F +G+G+N C TC +G++ V DINN++FVMPT +LLQ
Sbjct  295   SLRSLNSKQYPARVSLEVDHSLFFTVGLGVNRCKTCSSGTQVVADINNVTFVMPTISLLQ  354

Query  1221  AHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             AHY+NI GVFTDDFP  P I ++YTG  P+NLQT  GT+
Sbjct  355   AHYFNIDGVFTDDFPANPPIRYDYTGKQPSNLQTTKGTR  393



>gb|EPS60103.1| laccase 1a, partial [Genlisea aurea]
Length=546

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 331/421 (79%), Gaps = 5/421 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+S VRHY F VV KNTT++CS+K I+ VNG+FPGP++YAREDDTV+V+VVN V 
Sbjct  2     LFPLIVQSRVRHYKFHVVLKNTTKICSTKQILTVNGRFPGPTIYAREDDTVLVKVVNLVN  61

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGWSDGPAYITQCPI+   +F+YNFT+ GQRGTLLWHAH+ W RAT
Sbjct  62    YNVSIHWHGVRQLRTGWSDGPAYITQCPIRPDGSFVYNFTIAGQRGTLLWHAHVLWLRAT  121

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGA+V+LP+ GVPYPFPKPD E V+VL EWWKSD EAVIN+AM SG+APNVSD HTING
Sbjct  122   VHGALVVLPRIGVPYPFPKPDHERVVVLAEWWKSDTEAVINEAMSSGLAPNVSDGHTING  181

Query  630   HPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
               GP   C SS+ Y L V  GKTYLLR+++AA+NEELFFK+AGH+LTVVE DA YVKPF+
Sbjct  182   LTGPVEGCSSSESYNLAVAPGKTYLLRLINAALNEELFFKIAGHSLTVVEADAVYVKPFQ  241

Query  807   TDTIFIGPGQTTNAVLTA-DQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTST  983
             TD I I PGQTTNA+LTA D+  GK+ I  +PF D  +  DN+TAT T++Y GT   +S 
Sbjct  242   TDVIVIAPGQTTNAILTASDKLAGKFTILATPFQDAPLPVDNRTATATVNYAGTVLSSSA  301

Query  984   VLATMPPR-NATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--N  1154
             +    PPR NATP+ + F + LRSLNSK FPANVPL+ DHSL F +G+G+ PC+TC   N
Sbjct  302   LTLATPPRVNATPIANGFTDSLRSLNSKNFPANVPLEIDHSLFFTVGLGVIPCATCRAGN  361

Query  1155  GSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGT  1334
             GSR V DINN++FVMPTTALLQAH++   GVFT DFPG P   F+YTG  P NL T NGT
Sbjct  362   GSRIVADINNVTFVMPTTALLQAHFFKTKGVFTTDFPGNPPSSFDYTGRSPRNLATTNGT  421

Query  1335  K  1337
             K
Sbjct  422   K  422



>gb|EPS65618.1| hypothetical protein M569_09159, partial [Genlisea aurea]
Length=539

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/415 (64%), Positives = 322/415 (78%), Gaps = 4/415 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V+S +R Y F V+   TTR+CS+K I+ VNGKFPGP++YAREDDT+ VRV+N    N+SI
Sbjct  1     VQSKIRRYQFNVMMTKTTRLCSTKSILTVNGKFPGPTIYAREDDTLHVRVINSSPYNISI  60

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+ GQRGTLLWHAHI+W RATVHG +
Sbjct  61    HWHGIRQLRTGWADGPAYITQCPIRPGHSYVYNFTIAGQRGTLLWHAHISWLRATVHGGL  120

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             V+LPK G PYPF KPD E V+VLGEWWKSD EAV+NQA  SG+APN+SDAHTING PG  
Sbjct  121   VVLPKAGAPYPFTKPDHERVVVLGEWWKSDTEAVVNQATTSGLAPNISDAHTINGQPGLR  180

Query  645   PNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              NC SS G+TL V  GK Y+LR+++AA+N+ELFFK+AGH +TVVEVDA YVKPF T T+ 
Sbjct  181   SNCASSGGFTLGVSPGKRYMLRLINAALNDELFFKIAGHEMTVVEVDAVYVKPFTTHTVL  240

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVLATM  998
             + PGQTTN +++A Q  GKY++AVSPFMD   +A DN TAT TL Y GT   + T  A  
Sbjct  241   LTPGQTTNVIISATQGSGKYMVAVSPFMDNPSLAVDNITATATLQYYGTLTDSPTAPARP  300

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRAVG  1172
             P +NAT +   F   LRSLNS +FPA VPL+ DHSLLF +G+GINPC+TC   NGSR V 
Sbjct  301   PSQNATTIAEAFASSLRSLNSARFPALVPLKVDHSLLFTVGLGINPCATCRAGNGSRVVA  360

Query  1173  DINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              +NN++F MPTT++LQAHYY I+GVFT DFPG+P  PFNYTG    N+ T  GTK
Sbjct  361   SVNNVTFAMPTTSILQAHYYKIAGVFTADFPGKPLNPFNYTGAYKGNMATVTGTK  415



>ref|XP_009789473.1| PREDICTED: laccase-4-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/434 (63%), Positives = 337/434 (78%), Gaps = 3/434 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MA W+R +V++AL+  +  E     +RHY F VV KN TR+CS+K  V VNGKFPGP++Y
Sbjct  1     MAEWLRIMVVLALSWPVLVE-CRGNIRHYKFNVVMKNITRLCSTKATVTVNGKFPGPTIY  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDT++++VVN V  N++IHWHGV+Q+RTGW+DGPAYITQCPIQ G++++YNFT+T Q
Sbjct  60    AREDDTLLIKVVNQVHYNLTIHWHGVKQIRTGWADGPAYITQCPIQPGKSYVYNFTVTDQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPK  +PYPFP P KE +I+LGEWWKSDVEAV+++A 
Sbjct  120   RGTLFWHAHILWLRATVHGAIVILPKLALPYPFPNPQKEILIILGEWWKSDVEAVVDEAT  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             Q G+ PN+SDAHTING PGP   C S +G+T  VE GK YLLRIV+AA+NEELFFK+AGH
Sbjct  180   QLGLPPNISDAHTINGLPGPVSTCLSQEGFTFLVEPGKKYLLRIVNAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDASYVKPFK DTI   PGQTTN +L+AD   GKYL+  SP+MD+ +  +N+TA
Sbjct  240   KLTVVEVDASYVKPFKADTILTTPGQTTNVILSADLGTGKYLMVTSPYMDSPILVNNRTA  299

Query  939   TGTLHYKG-TQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             T TL Y G   + T+T L   PP NATP+   FM+ LRSLNS+K+PA VPL  DHSL F 
Sbjct  300   TATLQYVGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLTIDHSLFFT  359

Query  1116  IGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             I +G+NPC +C  G R V  INN++FVMP+ +LL AH++N SGVFTDDFPG PA  F+YT
Sbjct  360   ISLGLNPCESCYRGFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFTDDFPGNPAYTFDYT  419

Query  1296  GTPPANLQTQNGTK  1337
             G PP NL+T  GT+
Sbjct  420   GIPPENLRTMEGTR  433



>ref|XP_010483503.1| PREDICTED: laccase-16-like isoform X3 [Camelina sativa]
Length=567

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/418 (64%), Positives = 323/418 (77%), Gaps = 7/418 (2%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V++++RHY F VV  NTT++CSSKPIV VNGKFPGP++ ARE DT++++VVNHV+ NVSI
Sbjct  26    VQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVKYNVSI  85

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPIQ GQ +I+NFTLTGQRGTL WHAHI W RATVHGAI
Sbjct  86    HWHGIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAI  145

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP KE+ IVLGEWWKSDVE +IN A + G AP+ SDAHTINGH G  
Sbjct  146   VILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGSI  205

Query  645   PNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              NC S+  Y L V +GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT++
Sbjct  206   SNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVY  265

Query  822   IGPGQTTNAVLTADQNGGK-YLIAVSPFMDTIVATDNQTATGTLHYKGTQA-----LTST  983
             I PGQTTN +LTA+ N G  Y++A + F D  +  DN TAT TLHY G  A        T
Sbjct  266   IAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGPTATSVPTFKKT  325

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSR  1163
             +LA++PP+NAT V + F + LRSLNS+++PA VP   D SL F +G+G NPC +C  G R
Sbjct  326   ILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGANPCPSCSKGIR  385

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INN++F MP TALLQAH++NISGVFTDDFP +P  P++YT     N  T  GTK
Sbjct  386   LVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNPYDYTAPLGVNAATMKGTK  443



>ref|XP_009589148.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/434 (62%), Positives = 336/434 (77%), Gaps = 3/434 (1%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             MA W+R +V++AL   +  E     +RHY F VV KN TR+CS+K  V VNGKFPGP++Y
Sbjct  1     MAEWLRIMVVLALLWPVLVE-CRGNIRHYKFNVVMKNITRLCSTKATVTVNGKFPGPTIY  59

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
              REDDT++++VVN V  N++IHWHGV+Q+RTGW+DGPAYITQCPIQ G++++YNFT+T Q
Sbjct  60    TREDDTLLIKVVNQVHYNLTIHWHGVKQIRTGWADGPAYITQCPIQPGKSYVYNFTVTDQ  119

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTL WHAHI W RATVHGAIVILPK   PYPFPKP KE +I+LGEWWKSDVEAVI++A 
Sbjct  120   RGTLFWHAHILWLRATVHGAIVILPKLVFPYPFPKPQKEILIILGEWWKSDVEAVIDEAT  179

Query  582   QSGMAPNVSDAHTINGHPGPTPNC-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGH  758
             + G+ PN+SDAHTING PGP   C S +G+T  VE GK YLLRIV+AA+NEELFFK+AGH
Sbjct  180   KLGLPPNISDAHTINGLPGPLSTCLSQEGFTFLVEPGKKYLLRIVNAALNEELFFKIAGH  239

Query  759   NLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTA  938
              LTVVEVDASYVKPFKT+TI   PGQTTN +L+AD   GKYL+  S +MD+ +  +N+TA
Sbjct  240   KLTVVEVDASYVKPFKTETILTTPGQTTNVILSADLESGKYLMVTSAYMDSPILVNNRTA  299

Query  939   TGTLHYKG-TQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFA  1115
             T TL Y+G   + T+T L   PP NATP+   FM+ LRSLNS+K+PA VPL+ DHSL F 
Sbjct  300   TATLQYRGTNTSSTTTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLKIDHSLFFT  359

Query  1116  IGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYT  1295
             I +G+NPC +C    R V  INN++FVMP+ +LL AH++N SGVFTDDFPG PA  F+YT
Sbjct  360   ISLGLNPCESCYREFRIVAAINNVTFVMPSVSLLNAHFFNKSGVFTDDFPGNPAYTFDYT  419

Query  1296  GTPPANLQTQNGTK  1337
             G PP NL+T  GT+
Sbjct  420   GIPPENLRTMEGTR  433



>ref|XP_006398646.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
 gb|ESQ40099.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
Length=558

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 333/418 (80%), Gaps = 4/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F V++K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ N
Sbjct  17    PACVHGAIRKYTFNVITKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVIVLGEWWKSD E V+N+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPKPGLPYPFPKPHREEVIVLGEWWKSDTETVVNEALKSGLAPNVSDAHVINGHP  196

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+V+AA+NEELFFK+AGH  TVVEVDA YVKPF TD
Sbjct  197   GLVPNCPSQGNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTVVEVDAVYVKPFTTD  256

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T+T  
Sbjct  257   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTFSATATKT  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V ++F+  LRSLNS  +PA VP+  DH LLF +G+GIN C +C  G  SR
Sbjct  317   TSPPPQNATSVANSFVNSLRSLNSITYPAKVPITVDHDLLFTVGLGINRCHSCKAGNFSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MP TALLQAHY+N++G++T DFP +P   F++TG PP+NL T   TK
Sbjct  377   VVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRFFDFTGKPPSNLATMKATK  434



>ref|XP_010454388.1| PREDICTED: laccase-16 [Camelina sativa]
Length=540

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/416 (64%), Positives = 323/416 (78%), Gaps = 8/416 (2%)
 Frame = +3

Query  114   VVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWH  293
             ++RHY F VV  NTT++CSSKPIV VNGKFPGP++ ARE DTV+++VVNHV+ NVSIHWH
Sbjct  1     MIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTVLIKVVNHVKYNVSIHWH  60

Query  294   GVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVIL  473
             G+RQLRTGW+DGPAYITQCPIQ GQ +I+NFTLTGQRGTL WHAHI W RATVHGAIVIL
Sbjct  61    GIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAIVIL  120

Query  474   PKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNC  653
             PK GVPYPFPKP KE+ IVLGEWWKSDVE +IN+A + G AP+ SDAHTINGH G   NC
Sbjct  121   PKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINEASKIGTAPSASDAHTINGHSGSISNC  180

Query  654   SSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGP  830
              S+  Y L V +GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT++I P
Sbjct  181   PSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAP  240

Query  831   GQTTNAVLTADQNGG-KYLIAVSPFMDTIVATDNQTATGTLHYKGTQA----LTSTVLAT  995
             GQTTN +LTA+ N G  Y+IA + F D  +  DN TAT TLHY G  A       T+LA+
Sbjct  241   GQTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATATLHYIGPTATVPTFKKTILAS  300

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +PP+NAT V + F + LRSLNS+++PA VP   D SL F +G+G NPC +C NG R V  
Sbjct  301   LPPQNATWVAAKFTKSLRSLNSREYPARVPTTVDRSLFFTVGLGANPCPSCSNGIRLVAG  360

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
             INN++F MP TALLQAH++NISGVFTDDFP +P+ P++YT       N  T  GT+
Sbjct  361   INNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTR  416



>ref|XP_006401026.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
 gb|ESQ42479.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
Length=512

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/403 (67%), Positives = 316/403 (78%), Gaps = 7/403 (2%)
 Frame = +3

Query  150   NTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDG  329
             NTT++CSSKPIV VNG+FPGP++ AREDDTV+++VVNHV+ NVSIHWHG+RQLRTGW+DG
Sbjct  3     NTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWADG  62

Query  330   PAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKP  509
             PAYITQCPIQ GQ +IYNFTLTGQRGTL WHAHI W RATVHGAIVILPK GV YPFPKP
Sbjct  63    PAYITQCPIQPGQNYIYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVTYPFPKP  122

Query  510   DKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNC-SSKGYTLEVES  686
              KE+ IVLGEWWKSDVE +IN A + G AP  SDAHTINGH GP  NC S +GY L V  
Sbjct  123   YKEKTIVLGEWWKSDVEQLINDASRIGTAPIASDAHTINGHSGPISNCPSQRGYNLPVRP  182

Query  687   GKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQ  866
             GKTY+LRI++AA+NE+LFFK+AGH LTVVEVDA Y KPFKTDT+ I PGQTTN +LTA+ 
Sbjct  183   GKTYMLRIINAALNEDLFFKIAGHELTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLTANA  242

Query  867   NGG-KYLIAVSPFMDTIVATDNQTATGTLHYKGTQ---ALTSTVLATMPPRNATPVTSTF  1034
             N G KY++A + FMD  +  DN TAT TLHY G     A   TVLA++PP+NAT V + F
Sbjct  243   NAGSKYMVAATTFMDAPILFDNVTATATLHYIGNTTVPASKKTVLASLPPQNATWVATRF  302

Query  1035  MEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTAL  1214
                LRSLNS+++PA VP   +HSLLF +G+G NPC +C+NG R V  INN++F MP+TAL
Sbjct  303   TRSLRSLNSREYPARVPTTVEHSLLFTVGLGANPCRSCINGVRLVAGINNVTFTMPSTAL  362

Query  1215  LQAHYYNISGVFTDDFPGQPAIPFNYTG--TPPANLQTQNGTK  1337
             LQAH++NI  VFTDDFP +P  P+NYT   T   N  T  GTK
Sbjct  363   LQAHFFNIPHVFTDDFPARPLNPYNYTAPVTQSVNAATMKGTK  405



>ref|XP_004241179.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=560

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/408 (63%), Positives = 317/408 (78%), Gaps = 2/408 (0%)
 Frame = +3

Query  117   VRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHG  296
             +RHY F V+  N TR+CS+KP V VNGKFPGPS+YAREDDT++++VVN V  N+SIHWHG
Sbjct  29    IRHYKFNVMMTNVTRLCSTKPTVTVNGKFPGPSIYAREDDTLLIKVVNQVHYNLSIHWHG  88

Query  297   VRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILP  476
             V+QLRT W+DGPAYI QCPIQ G++++YNFT+  QRGTL WHAHI W RATVHGAIVILP
Sbjct  89    VKQLRTCWADGPAYIAQCPIQPGKSYVYNFTVREQRGTLFWHAHILWLRATVHGAIVILP  148

Query  477   KRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNC-  653
             K  +PYPF KP KE VI+LGEWWKSDVEAV+++A QSG+ PN+SDAHTING  GP   C 
Sbjct  149   KLALPYPFSKPKKEVVIILGEWWKSDVEAVVDEATQSGLPPNISDAHTINGLTGPVSTCL  208

Query  654   SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPG  833
             S +G+  +VE GK YLLRI++AA+NEELFFK+AGHNLTV EVDA+YVKPF+T+TI   PG
Sbjct  209   SQEGFNFQVEPGKKYLLRIINAALNEELFFKIAGHNLTVEEVDAAYVKPFETETILTAPG  268

Query  834   QTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNA  1013
             QTTN +L+ +   GKYL+  SP+MD+ +  +N+ AT TL Y GT   +ST     PPRNA
Sbjct  269   QTTNVILSTNHKNGKYLMVTSPYMDSPILVNNKAATATLQYTGTNN-SSTTFTVPPPRNA  327

Query  1014  TPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISF  1193
             T +   FM+ L+SLNSK++PA VP++ +HSL F I +G+NPC+TC  G R V  INN++F
Sbjct  328   TSIAFNFMDSLQSLNSKRYPAKVPIKINHSLFFIISLGLNPCATCYRGFRIVAAINNVTF  387

Query  1194  VMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             VMP+ +LL  H+ N SGVFTDDFPG P   F+YTG PP NL+T  GTK
Sbjct  388   VMPSVSLLGTHFLNKSGVFTDDFPGNPQNVFDYTGVPPENLRTIEGTK  435



>ref|XP_009125430.1| PREDICTED: laccase-10 [Brassica rapa]
Length=559

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/415 (65%), Positives = 331/415 (80%), Gaps = 4/415 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ NVSI
Sbjct  21    VHGAIRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYNVSI  80

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVHGAI
Sbjct  81    HWHGIRQLRTGWADGPAYITQCPIKPGHSYMYNFTVTGQRGTLWWHAHVLWLRATVHGAI  140

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK G+PYPFPKP +EEVIVLGEWWKSD E VIN+A++SG+APNVSDAH INGHPG  
Sbjct  141   VILPKPGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLAPNVSDAHVINGHPGLV  200

Query  645   PNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
             PNC S+G + L VESGKTY+LR+V+AA+NEELFFK+AGH  T+VEVDA YVKPF TDTI 
Sbjct  201   PNCPSQGNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIVEVDAVYVKPFTTDTIL  260

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVLATM  998
             I PGQTT A+++A +  GKYLIA +PF D+ +VA DN+TAT T+HY GT + T T   + 
Sbjct  261   IAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKTTSP  320

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SRAVG  1172
             P +NAT V ++F+  LRSLNS  +PA VP++ DH LLF +G+GIN C +C  G  SR V 
Sbjct  321   PAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTVGLGINRCHSCKAGNLSRVVA  380

Query  1173  DINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              INNI+F MP TALLQAHY+N++G++T DFP +P   F++TG PP+NL T   TK
Sbjct  381   AINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTGKPPSNLATMKATK  435



>ref|XP_010443638.1| PREDICTED: laccase-16-like [Camelina sativa]
Length=568

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/419 (64%), Positives = 323/419 (77%), Gaps = 8/419 (2%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V++++RHY F VV  NTT++CSSKPIV VNGKFPGP++ ARE DTV+++VVNHV+ NVSI
Sbjct  26    VQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTVLIKVVNHVKYNVSI  85

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+D PAYITQCPIQ GQ +I+NFTLTGQRGTL WHAHI W RATVHGAI
Sbjct  86    HWHGIRQLRTGWADEPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAI  145

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP KE+ IVLGEWWKSDVE +IN A + G AP+ SDAHTINGH G  
Sbjct  146   VILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGSL  205

Query  645   PNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              NC S+  Y L V +GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT++
Sbjct  206   SNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVY  265

Query  822   IGPGQTTNAVLTADQNGGK-YLIAVSPFMDTIVATDNQTATGTLHYKGTQA----LTSTV  986
             I PGQTTN +LTA+ N G  Y+IA + F D  +  DN TAT TLHY G  A       T+
Sbjct  266   IAPGQTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATATLHYIGPTATVPTFKKTI  325

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             LA++PP+NAT V + F + LRSLNS+++PA VP   D SL F +G+G NPC +C NG R 
Sbjct  326   LASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGSNPCPSCSNGIRL  385

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
             V  INN++F MP TALLQAH++NISGVFTDDFP +P  P++YT       N  T  GTK
Sbjct  386   VAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNPYDYTAPVKLGVNAATMKGTK  444



>ref|XP_010483501.1| PREDICTED: laccase-16-like isoform X1 [Camelina sativa]
 ref|XP_010483502.1| PREDICTED: laccase-16-like isoform X2 [Camelina sativa]
Length=569

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/420 (64%), Positives = 323/420 (77%), Gaps = 9/420 (2%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V++++RHY F VV  NTT++CSSKPIV VNGKFPGP++ ARE DT++++VVNHV+ NVSI
Sbjct  26    VQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVKYNVSI  85

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPIQ GQ +I+NFTLTGQRGTL WHAHI W RATVHGAI
Sbjct  86    HWHGIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAI  145

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK GVPYPFPKP KE+ IVLGEWWKSDVE +IN A + G AP+ SDAHTINGH G  
Sbjct  146   VILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGSI  205

Query  645   PNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
              NC S+  Y L V +GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT++
Sbjct  206   SNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVY  265

Query  822   IGPGQTTNAVLTADQNGGK-YLIAVSPFMDTIVATDNQTATGTLHYKGTQA-----LTST  983
             I PGQTTN +LTA+ N G  Y++A + F D  +  DN TAT TLHY G  A        T
Sbjct  266   IAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGPTATSVPTFKKT  325

Query  984   VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSR  1163
             +LA++PP+NAT V + F + LRSLNS+++PA VP   D SL F +G+G NPC +C  G R
Sbjct  326   ILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGANPCPSCSKGIR  385

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
              V  INN++F MP TALLQAH++NISGVFTDDFP +P  P++YT       N  T  GTK
Sbjct  386   LVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPLNPYDYTAPVKLGVNAATMKGTK  445



>ref|NP_195739.2| laccase 10 [Arabidopsis thaliana]
 sp|Q6ID18.1|LAC10_ARATH RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41838.1| At5g01190 [Arabidopsis thaliana]
 gb|AED90308.1| laccase 10 [Arabidopsis thaliana]
Length=558

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/418 (65%), Positives = 334/418 (80%), Gaps = 4/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ N
Sbjct  17    PACVHGAIRKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVI+LGEWWKSD E V+N+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPKLGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGHP  196

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF TD
Sbjct  197   GFVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNTD  256

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T  
Sbjct  257   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V +TF+  LRSLNSK +PANVP+  DH LLF +G+GIN C +C  G  SR
Sbjct  317   TSPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGLGINRCHSCKAGNFSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MP TALLQAHY+N++G++T DFP +P   F++TG PP+NL T   TK
Sbjct  377   VVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRVFDFTGKPPSNLATMKATK  434



>sp|Q1PDH6.2|LAC16_ARATH RecName: Full=Laccase-16; AltName: Full=Benzenediol:oxygen oxidoreductase 
16; AltName: Full=Diphenol oxidase 16; AltName: 
Full=Urishiol oxidase 16; Flags: Precursor [Arabidopsis thaliana]
Length=566

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/424 (63%), Positives = 327/424 (77%), Gaps = 9/424 (2%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V S++RHY F V++ NTT++CSSKPIV VNG+FPGP++ ARE DT++++VVNHV+
Sbjct  20    LSPTTVHSIIRHYKFNVMT-NTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVK  78

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHG+RQLRTGW+DGPAYITQCPIQ GQ +++NFTLTGQRGTL WHAHI W RAT
Sbjct  79    YNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRAT  138

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVILPK GVPYPFPKP KE+ IVL EWWKSDVE +IN+A + G AP+ SDAHTING
Sbjct  139   VHGAIVILPKLGVPYPFPKPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTING  198

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
             H G   NC S+  Y L V +GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+K
Sbjct  199   HSGSISNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYK  258

Query  807   TDTIFIGPGQTTNAVLTADQNGGK-YLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS-  980
             TDT+FI PGQTTN +LTA+ N G  Y++A + F D  +  DN TAT TLHY G  +  S 
Sbjct  259   TDTVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVST  318

Query  981   ---TVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL  1151
                TVLA++PP+NAT V + F   LRSLNS ++PA VP   +HSL F +G+G NPC +C 
Sbjct  319   SKKTVLASLPPQNATWVATKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCN  378

Query  1152  NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQ  1325
             NG R V  INN++F MP TALLQAH++NISGVFTDDFP +P+ P++YT       N  T 
Sbjct  379   NGVRLVAGINNVTFTMPKTALLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATM  438

Query  1326  NGTK  1337
              GTK
Sbjct  439   KGTK  442



>ref|XP_002873023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/418 (64%), Positives = 334/418 (80%), Gaps = 4/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ N
Sbjct  18    PACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYN  77

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  78    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  137

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVI+LGEWWKSD E V+N+A++SG+APNVSDAH INGHP
Sbjct  138   GAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGHP  197

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF TD
Sbjct  198   GLVPNCPSQGNFKLAVESGKTYMLRLINAAMNEELFFKIAGHRFTVVEVDAVYVKPFNTD  257

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T  
Sbjct  258   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  317

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V +TF+  LRSLNSK +PA VP+  DH LLF +G+G+N C +C  G  SR
Sbjct  318   TSPPPQNATSVANTFINSLRSLNSKTYPAKVPITVDHDLLFTVGLGVNRCHSCKAGNFSR  377

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MP TALLQAHY+N++G++T DFPG+P   F++TG PP+NL T   TK
Sbjct  378   VVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPGKPRRFFDFTGKPPSNLATMKATK  435



>emb|CDY55905.1| BnaAnng13970D [Brassica napus]
Length=563

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/419 (64%), Positives = 331/419 (79%), Gaps = 8/419 (2%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ NVSI
Sbjct  21    VHGAIRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYNVSI  80

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVHGAI
Sbjct  81    HWHGIRQLRTGWADGPAYITQCPIKPGHSYMYNFTVTGQRGTLWWHAHVLWLRATVHGAI  140

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK G+PYPFPKP +EEVIVLGEWWKSD E VIN+A++SG+APNVSDAH INGHPG  
Sbjct  141   VILPKPGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLAPNVSDAHVINGHPGLV  200

Query  645   PNCSSKG-----YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             PNC S+G     + L VESGKTY+LR+V+AA+NEELFFK+AGH  T+VEVDA YVKPF T
Sbjct  201   PNCPSQGSLSCNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIVEVDAVYVKPFTT  260

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTV  986
             DTI I PGQTT A+++A +  GKYLIA +PF D+ +VA DN+TAT T+HY GT + T T 
Sbjct  261   DTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  320

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--S  1160
               + P +NAT V ++F+  LRSLNS  +PA VP++ DH LLF +G+GIN C +C  G  S
Sbjct  321   TTSPPAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTVGLGINRCHSCKAGNLS  380

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INNI+F MP TALLQAHY+N++G++T DFP +P   F++TG PP+NL T   TK
Sbjct  381   RVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTGKPPSNLATMKATK  439



>ref|XP_006287399.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
 gb|EOA20297.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
Length=558

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/418 (65%), Positives = 335/418 (80%), Gaps = 4/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ N
Sbjct  17    PACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVI+LGEWWKSD E VIN+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVINEALRSGLAPNVSDAHVINGHP  196

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA+YVKPF TD
Sbjct  197   GLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAAYVKPFNTD  256

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T  
Sbjct  257   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V ++F++ LRSLNS  +PA VP+  DH LLF +G+GIN C +C  G  SR
Sbjct  317   TSPPPQNATSVANSFVKSLRSLNSNTYPAKVPVTVDHDLLFTVGLGINRCHSCKAGNFSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MPTTALLQAHY+N +GV+T DFPG+P   F++TG PP+NL T   TK
Sbjct  377   VVAAINNITFKMPTTALLQAHYFNQTGVYTTDFPGRPRRVFDFTGKPPSNLATMKATK  434



>ref|XP_010490598.1| PREDICTED: laccase-10-like isoform X1 [Camelina sativa]
 ref|XP_010490599.1| PREDICTED: laccase-10-like isoform X2 [Camelina sativa]
Length=558

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/418 (65%), Positives = 335/418 (80%), Gaps = 4/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDTV+V VVN+V+ N
Sbjct  17    PACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTVLVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVI+LGEWWKSD E VIN+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVINEALKSGLAPNVSDAHVINGHP  196

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF TD
Sbjct  197   GLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNTD  256

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T  
Sbjct  257   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V ++F+  LRSLNS  +PANVP+  DH LLF +G+GIN C +C  G  SR
Sbjct  317   TSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINRCHSCKAGNFSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MPTTALLQAHY+N++GV+T DFPG+P   F++TG PP+NL T   TK
Sbjct  377   VVAAINNITFKMPTTALLQAHYFNLTGVYTTDFPGKPRRFFDFTGKPPSNLATMKATK  434



>ref|XP_010452014.1| PREDICTED: laccase-10 isoform X1 [Camelina sativa]
 ref|XP_010452015.1| PREDICTED: laccase-10 isoform X2 [Camelina sativa]
Length=559

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/418 (65%), Positives = 335/418 (80%), Gaps = 4/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDTV+V VVN+V+ N
Sbjct  18    PACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTVLVNVVNNVKYN  77

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  78    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  137

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVI+LGEWWKSD E V+N+A++SG+APNVSDAH INGHP
Sbjct  138   GAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVVNEALKSGLAPNVSDAHVINGHP  197

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF TD
Sbjct  198   GLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNTD  257

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T  
Sbjct  258   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  317

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V ++F+  LRSLNS  +PANVP+  DH LLF +G+GIN C +C  G  SR
Sbjct  318   TSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINRCHSCKAGNFSR  377

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MPTTALLQAHY+N++GV+T DFPG+P   F++TG PP+NL T   TK
Sbjct  378   VVAAINNITFKMPTTALLQAHYFNLTGVYTTDFPGKPRRFFDFTGKPPSNLATMKATK  435



>ref|XP_006350822.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=559

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/408 (62%), Positives = 315/408 (77%), Gaps = 2/408 (0%)
 Frame = +3

Query  117   VRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHG  296
             +R Y F V+  N TR+CS+KP V VNGKFPGP++YAREDDT++++VVN V  N+SIHWHG
Sbjct  29    IRQYKFNVMMTNVTRLCSTKPTVTVNGKFPGPTIYAREDDTLLIKVVNQVHYNLSIHWHG  88

Query  297   VRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILP  476
             V+QLRT W+DGPAYI QCPIQ G++++YNFT+T QRGTL WHAHI W RATVHGA+VILP
Sbjct  89    VKQLRTCWADGPAYIAQCPIQPGKSYVYNFTVTEQRGTLFWHAHILWLRATVHGAVVILP  148

Query  477   KRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNC-  653
             K  +PYPF KP KE VI+LGEWWKSDVEAV+++A QSG+ PN+SDAHTING  GP   C 
Sbjct  149   KHTLPYPFSKPKKEVVIILGEWWKSDVEAVVDEATQSGLPPNISDAHTINGLTGPVSTCL  208

Query  654   SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPG  833
             S +G+   VE GK YLLRI++AA+NEELFFK+AGHNLTVVEVDA+YVKPF+T+TI   PG
Sbjct  209   SQEGFNFLVEPGKKYLLRIINAALNEELFFKIAGHNLTVVEVDAAYVKPFETETILTAPG  268

Query  834   QTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNA  1013
             QTTN +L+     GKY +  SP+MD+ +  +N+ AT TL Y GT   +ST     PPRNA
Sbjct  269   QTTNVILSTTYKNGKYSMVTSPYMDSPILVNNKAATATLQYIGTNN-SSTTFTVPPPRNA  327

Query  1014  TPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISF  1193
             T +   FM+ L+SLNSKK+PA VP++ +HSL F I +G+NPC+TC  G R V  INN++F
Sbjct  328   TFIAFNFMDSLKSLNSKKYPAKVPIKINHSLFFIISLGLNPCATCYRGFRIVAAINNVTF  387

Query  1194  VMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             VMP+ +LL  H+ N SGVFTDDFPG P   F+YTG PP NL+T  GTK
Sbjct  388   VMPSVSLLSTHFLNKSGVFTDDFPGNPQNAFDYTGVPPENLRTMEGTK  435



>emb|CDY48114.1| BnaC02g03710D [Brassica napus]
Length=559

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/419 (65%), Positives = 331/419 (79%), Gaps = 5/419 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   VR Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ N
Sbjct  17    PACVHGAVRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVIVLGEWWKSD E VIN+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPKLGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLAPNVSDAHVINGHP  196

Query  636   GPTPNCSSKG--YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKT  809
             G  PNC S+G  + L VESGKTY+LR+V+AA+NEELFFK+AGH  T+VEVDA YVKPF T
Sbjct  197   GLVPNCPSQGSNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIVEVDAVYVKPFTT  256

Query  810   DTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTV  986
             DTI I PGQTT A+++A +  GKYLIA +PF D+ +VA DN+TAT T+HY GT + T T 
Sbjct  257   DTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  316

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--S  1160
               + PP+NAT V ++F+  LRSLNS  +PA VP   DH LLF +G+GIN C +C  G  S
Sbjct  317   TTSPPPQNATSVANSFVNSLRSLNSATYPAKVPTTVDHDLLFTVGLGINRCHSCKAGNFS  376

Query  1161  RAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             R V  INNI+F MP TALLQAHY+N++G++T DFP +P   F++TG PP+NL T   TK
Sbjct  377   RVVAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPHHVFDFTGKPPSNLATMKATK  435



>ref|XP_010423919.1| PREDICTED: laccase-10-like [Camelina sativa]
Length=558

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/418 (65%), Positives = 334/418 (80%), Gaps = 4/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDTV+V VVN+V+ N
Sbjct  17    PACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTVLVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVI+LGEWWKSD E V+N+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVVNEALKSGLAPNVSDAHVINGHP  196

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF TD
Sbjct  197   GLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNTD  256

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T  
Sbjct  257   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  316

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V ++F+  LRSLNS  +PANVP+  DH LLF +G+GIN C +C  G  SR
Sbjct  317   TSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINRCHSCKAGNFSR  376

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MPTTALL+AHY+N++GV+T DFPG+P   F++ G PP+NL T   TK
Sbjct  377   VVAAINNITFKMPTTALLEAHYFNLTGVYTTDFPGKPRRFFDFNGKPPSNLSTMKATK  434



>emb|CAB69847.1| laccase-like protein [Arabidopsis thaliana]
Length=553

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/417 (64%), Positives = 331/417 (79%), Gaps = 7/417 (2%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ N
Sbjct  17    PACVHGAIRKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G +++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK G+PYPFPKP +EEVI+LGEWWKSD E V+N+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPKLGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGHP  196

Query  636   GPTPNCSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             G  PNC S+     VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF TDT
Sbjct  197   GFVPNCPSQA----VESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNTDT  252

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVLA  992
             I I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T   
Sbjct  253   ILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKTT  312

Query  993   TMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SRA  1166
             + PP+NAT V +TF+  LRSLNSK +PANVP+  DH LLF +G+GIN C +C  G  SR 
Sbjct  313   SPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGLGINRCHSCKAGNFSRV  372

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             V  INNI+F MP TALLQAHY+N++G++T DFP +P   F++TG PP+NL T   TK
Sbjct  373   VAAINNITFKMPKTALLQAHYFNLTGIYTTDFPAKPRRVFDFTGKPPSNLATMKATK  429



>ref|XP_009789474.1| PREDICTED: laccase-4-like isoform X2 [Nicotiana sylvestris]
Length=524

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/399 (65%), Positives = 316/399 (79%), Gaps = 2/399 (1%)
 Frame = +3

Query  147   KNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSD  326
             KN TR+CS+K  V VNGKFPGP++YAREDDT++++VVN V  N++IHWHGV+Q+RTGW+D
Sbjct  2     KNITRLCSTKATVTVNGKFPGPTIYAREDDTLLIKVVNQVHYNLTIHWHGVKQIRTGWAD  61

Query  327   GPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPK  506
             GPAYITQCPIQ G++++YNFT+T QRGTL WHAHI W RATVHGAIVILPK  +PYPFP 
Sbjct  62    GPAYITQCPIQPGKSYVYNFTVTDQRGTLFWHAHILWLRATVHGAIVILPKLALPYPFPN  121

Query  507   PDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNC-SSKGYTLEVE  683
             P KE +I+LGEWWKSDVEAV+++A Q G+ PN+SDAHTING PGP   C S +G+T  VE
Sbjct  122   PQKEILIILGEWWKSDVEAVVDEATQLGLPPNISDAHTINGLPGPVSTCLSQEGFTFLVE  181

Query  684   SGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTAD  863
              GK YLLRIV+AA+NEELFFK+AGH LTVVEVDASYVKPFK DTI   PGQTTN +L+AD
Sbjct  182   PGKKYLLRIVNAALNEELFFKIAGHKLTVVEVDASYVKPFKADTILTTPGQTTNVILSAD  241

Query  864   QNGGKYLIAVSPFMDTIVATDNQTATGTLHYKG-TQALTSTVLATMPPRNATPVTSTFME  1040
                GKYL+  SP+MD+ +  +N+TAT TL Y G   + T+T L   PP NATP+   FM+
Sbjct  242   LGTGKYLMVTSPYMDSPILVNNRTATATLQYVGTNTSSTTTTLTVPPPTNATPIAIKFMD  301

Query  1041  GLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTALLQ  1220
              LRSLNS+K+PA VPL  DHSL F I +G+NPC +C  G R V  INN++FVMP+ +LL 
Sbjct  302   SLRSLNSRKYPAKVPLTIDHSLFFTISLGLNPCESCYRGFRIVAAINNVTFVMPSVSLLN  361

Query  1221  AHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             AH++N SGVFTDDFPG PA  F+YTG PP NL+T  GT+
Sbjct  362   AHFFNKSGVFTDDFPGNPAYTFDYTGIPPENLRTMEGTR  400



>ref|XP_006282033.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
 gb|EOA14931.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
Length=530

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 313/404 (77%), Gaps = 8/404 (2%)
 Frame = +3

Query  150   NTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDG  329
             NTT++CSSKPIV VNGKFPGP++ ARE DT++++VVNHV  NVSIHWHG+RQLRTGW+DG
Sbjct  3     NTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVNYNVSIHWHGIRQLRTGWADG  62

Query  330   PAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKP  509
             PAYITQCPIQ GQ +++NFTLTGQRGTL WHAHI W RATVHGAIVILPK GVPYPFPKP
Sbjct  63    PAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKP  122

Query  510   DKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVES  686
              KE+ IVLGEWWKSDVE ++N+A + G AP  SDAHTINGH G  PNC S+  Y L V +
Sbjct  123   YKEKTIVLGEWWKSDVEELVNEASKIGTAPMASDAHTINGHSGSIPNCPSQSSYGLPVRA  182

Query  687   GKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQ  866
             GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT++I PGQTTN +LTA+ 
Sbjct  183   GKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTANA  242

Query  867   NGG-KYLIAVSPFMDTIVATDNQTATGTLHYKG----TQALTSTVLATMPPRNATPVTST  1031
             N G  Y++A + F D  +  DN TAT TLHY G      A   TVLA++PP+NAT V + 
Sbjct  243   NAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSASKKTVLASLPPQNATWVATK  302

Query  1032  FMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTA  1211
             F   LRSLNS ++PA VP   DHSL F +G+G NPC +C NG R V  INN++F MP TA
Sbjct  303   FTRSLRSLNSHEYPARVPTTVDHSLFFTVGLGANPCPSCSNGVRLVAGINNVTFTMPKTA  362

Query  1212  LLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
             LLQAH++NISGVFTDDFP +PA P++YT       N  T  GTK
Sbjct  363   LLQAHFFNISGVFTDDFPAKPANPYDYTAPVKLGVNAATMKGTK  406



>gb|KFK44563.1| hypothetical protein AALP_AA1G273400 [Arabis alpina]
Length=556

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 331/418 (79%), Gaps = 6/418 (1%)
 Frame = +3

Query  96    PEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQEN  275
             P  V   +R Y F VV+K  TR+CS+K IV VNGKFPGP++YA EDDT++V VVN+V+ N
Sbjct  17    PACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYN  76

Query  276   VSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVH  455
             VSIHWHG+RQLRTGW+DGPAYITQCPI+ G  ++YNFT+TGQRGTL WHAH+ W RATVH
Sbjct  77    VSIHWHGIRQLRTGWADGPAYITQCPIKPGHNYVYNFTVTGQRGTLWWHAHVLWLRATVH  136

Query  456   GAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHP  635
             GAIVILPK  +PYPFPKP +EEVI+LGEWW SD EAV+N+A++SG+APNVSDAH INGHP
Sbjct  137   GAIVILPK--LPYPFPKPHREEVIILGEWWISDTEAVVNEALRSGLAPNVSDAHVINGHP  194

Query  636   GPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTD  812
             G  PNC S+G + L VESGKTY+LR+++AA+NEELFFK+AGH  TVVEVDA YVKPF TD
Sbjct  195   GLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNTD  254

Query  813   TIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDT-IVATDNQTATGTLHYKGTQALTSTVL  989
             TI I PGQTT A+++A +  G+YLIA +PF D+ +VA DN+TAT T+HY GT + T T  
Sbjct  255   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  314

Query  990   ATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNG--SR  1163
              + PP+NAT V +TF+  LRSLNS  +PA VP+  DH LLF +G+GIN C +C  G  SR
Sbjct  315   TSPPPQNATSVANTFVNSLRSLNSNTYPAKVPITIDHDLLFTVGLGINRCHSCKKGNFSR  374

Query  1164  AVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
              V  INNI+F MPTT LLQAHY+N++GV+T DFPG+P   +++TG PP+NL T   TK
Sbjct  375   VVAAINNITFKMPTTGLLQAHYFNLTGVYTTDFPGKPRRFYDFTGKPPSNLATMKATK  432



>gb|KHN24301.1| Laccase-4 [Glycine soja]
Length=522

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/438 (65%), Positives = 327/438 (75%), Gaps = 46/438 (11%)
 Frame = +3

Query  42    MASWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLY  221
             M SWVR   ++ L A I P  VE  VRHY F VV KNTTR+CSSKPIV VNGKFPGP+LY
Sbjct  1     MDSWVR---MLFLIACIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLY  57

Query  222   AREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQ  401
             AREDDTV+V+V N V  NV+IHWHGVRQLRTGW+DGPAYITQCPI +GQ+++YNFTLTGQ
Sbjct  58    AREDDTVLVKVNNLVNHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQ  117

Query  402   RGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAM  581
             RGTLLWHAH+NW R+T+HGAIVILPKRGVPYPFPKPDKE V++LGEWWKSD E VIN+A+
Sbjct  118   RGTLLWHAHVNWLRSTLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEAL  177

Query  582   QSGMAPNVSDAHTINGHPG--PTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVA  752
             +SG+APNVSDAHTING PG     NCS++  Y L VESGKTYLLRI++AA+NEELFFK+A
Sbjct  178   KSGLAPNVSDAHTINGLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIA  237

Query  753   GHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQ  932
             GH  TVVEVDASYVKPFKTDT+ I P                                  
Sbjct  238   GHPFTVVEVDASYVKPFKTDTLSIAP----------------------------------  263

Query  933   TATGTLHYKGTQALTSTVLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLF  1112
                 TLHY GT A T T+L T PPRNAT V + F   L+SLNSKK+PA VP + DHSLL 
Sbjct  264   ---ATLHYTGTLATTPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLL  320

Query  1113  AIGIGINPCSTCL--NGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPF  1286
              +G+GINPC +C   NGSR V  +NN++FVMPTTALLQAHY+NI GVFT DFPG P+  +
Sbjct  321   TVGLGINPCPSCTAGNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVFTTDFPGNPSHVY  380

Query  1287  NYTGTPPANL-QTQNGTK  1337
             NYT TPPA   QT NGTK
Sbjct  381   NYTATPPAAAWQTTNGTK  398



>gb|ABE66261.1| laccase/diphenol oxidase [Arabidopsis thaliana]
Length=530

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/404 (64%), Positives = 314/404 (78%), Gaps = 8/404 (2%)
 Frame = +3

Query  150   NTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDG  329
             NTT++CSSKPIV VNG+FPGP++ ARE DT++++VVNHV+ NVSIHWHG+RQLRTGW+DG
Sbjct  3     NTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHWHGIRQLRTGWADG  62

Query  330   PAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKP  509
             PAYITQCPIQ GQ +++NFTLTGQRGTL WHAHI W RATVHGAIVILPK GVPYPFPKP
Sbjct  63    PAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKP  122

Query  510   DKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVES  686
              KE+ IVL EWWKSDVE +IN+A + G AP+ SDAHTINGH G   NC S+  Y L V +
Sbjct  123   YKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRA  182

Query  687   GKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQ  866
             GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT+FI PGQTTN +LTA+ 
Sbjct  183   GKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANA  242

Query  867   NGG-KYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS----TVLATMPPRNATPVTST  1031
             N G  Y++A + F D  +  DN TAT TLHY G  +  S    TVLA++PP+NAT V + 
Sbjct  243   NAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATK  302

Query  1032  FMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTA  1211
             F   LRSLNS ++PA VP   +HSL F +G+G NPC +C NG R V  INN++F MP TA
Sbjct  303   FTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPKTA  362

Query  1212  LLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
             LLQAH++NISGVFTDDFP +P+ P++YT       N  T  GTK
Sbjct  363   LLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTK  406



>gb|ABK28766.1| unknown [Arabidopsis thaliana]
Length=531

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/404 (64%), Positives = 314/404 (78%), Gaps = 8/404 (2%)
 Frame = +3

Query  150   NTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDG  329
             NTT++CSSKPIV VNG+FPGP++ ARE DT++++VVNHV+ NVSIHWHG+RQLRTGW+DG
Sbjct  3     NTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHWHGIRQLRTGWADG  62

Query  330   PAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKP  509
             PAYITQCPIQ GQ +++NFTLTGQRGTL WHAHI W RATVHGAIVILPK GVPYPFPKP
Sbjct  63    PAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKP  122

Query  510   DKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVES  686
              KE+ IVL EWWKSDVE +IN+A + G AP+ SDAHTINGH G   NC S+  Y L V +
Sbjct  123   YKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRA  182

Query  687   GKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQ  866
             GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT+FI PGQTTN +LTA+ 
Sbjct  183   GKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANA  242

Query  867   NGGK-YLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS----TVLATMPPRNATPVTST  1031
             N G  Y++A + F D  +  DN TAT TLHY G  +  S    TVLA++PP+NAT V + 
Sbjct  243   NAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATK  302

Query  1032  FMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTA  1211
             F   LRSLNS ++PA VP   +HSL F +G+G NPC +C NG R V  INN++F MP TA
Sbjct  303   FTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPKTA  362

Query  1212  LLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
             LLQAH++NISGVFTDDFP +P+ P++YT       N  T  GTK
Sbjct  363   LLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTK  406



>gb|KHG22893.1| Laccase-4 -like protein [Gossypium arboreum]
Length=486

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/350 (71%), Positives = 294/350 (84%), Gaps = 1/350 (0%)
 Frame = +3

Query  291   HGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVI  470
             HG+RQLRTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTL WHAHI W RATVHGAIVI
Sbjct  13    HGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTVTGQRGTLFWHAHILWLRATVHGAIVI  72

Query  471   LPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPN  650
             LPKRGVPYPFPKP KEE+++LGEWWKSDVEAVIN+A++SG+APNVSDAHTINGHPG TP+
Sbjct  73    LPKRGVPYPFPKPHKEEIVILGEWWKSDVEAVINEALKSGLAPNVSDAHTINGHPGSTPS  132

Query  651   CSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
             C SKG YTL V+ GKTY+LRI++AA+NEELFF +AGH LTVVEVDA+YVKPFKTDTI I 
Sbjct  133   CPSKGGYTLAVKPGKTYMLRIINAALNEELFFMIAGHQLTVVEVDATYVKPFKTDTIVIS  192

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPR  1007
             PGQTTN ++T  +  GKYL+A SPFMD  +A DN TAT TLHY G+   ++T L + PP+
Sbjct  193   PGQTTNVLVTTHRRAGKYLVAASPFMDAPIAVDNLTATATLHYAGSLTSSATTLVSPPPK  252

Query  1008  NATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNI  1187
             NAT V + F   LRSLNS+K+PA VPL+ DHSLLF IG+GINPCSTC+NGSR V  +NNI
Sbjct  253   NATSVAANFTNALRSLNSEKYPAKVPLKIDHSLLFTIGLGINPCSTCVNGSRVVASVNNI  312

Query  1188  SFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             +FVMP TALLQAH++NI+GVF  +FPG+P +PFNYT     NL T+  TK
Sbjct  313   TFVMPKTALLQAHFFNINGVFATNFPGRPPVPFNYTSIQLTNLGTKQATK  362



>ref|XP_007026782.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY07284.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
Length=490

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/352 (71%), Positives = 297/352 (84%), Gaps = 3/352 (1%)
 Frame = +3

Query  291   HGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVI  470
             HGVRQLRTGW+DGPAYITQCPI TGQ+++YNFT+TGQRGTLLWHAHI W R+TVHGAIVI
Sbjct  15    HGVRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVI  74

Query  471   LPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPN  650
             LPKRGVPYPFPKP KE V++L EWWKSD EAVIN+A++SG+APNVSDAHTINGH GP  +
Sbjct  75    LPKRGVPYPFPKPHKEVVVILAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHTGPVSS  134

Query  651   CSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
             C S+G +TL VE+GKTYLLR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFKT T+ I 
Sbjct  135   CPSQGGFTLPVENGKTYLLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFKTKTVIIA  194

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPR  1007
             PGQTTN +++AD++ GKYL+A SPFMD  +A DN TAT TLHY GT A T T L ++PP+
Sbjct  195   PGQTTNVLVSADKSSGKYLVAASPFMDAPIAVDNLTATATLHYSGTLANTPTTLTSLPPK  254

Query  1008  NATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRAVGDIN  1181
             NATPV + F+  LR+LNSK++PA VP   DH+L F +G+GINPC TC   NGSRAV  IN
Sbjct  255   NATPVANNFINSLRALNSKQYPALVPQSIDHNLFFTVGLGINPCPTCKAGNGSRAVASIN  314

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N++FVMPTTALLQAH++NISGVFT DFP  P   FNY+GTPP NLQT NGTK
Sbjct  315   NVTFVMPTTALLQAHFFNISGVFTTDFPANPPNVFNYSGTPPTNLQTTNGTK  366



>gb|ACN39933.1| unknown [Picea sitchensis]
Length=559

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/412 (62%), Positives = 306/412 (74%), Gaps = 2/412 (0%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E   RHY F V  KN +R+C +KPIV VNG+FPGP++YARE DTVIV V NHV+ NVSIH
Sbjct  24    EGKTRHYKFDVGLKNVSRLCQTKPIVTVNGEFPGPTIYAREGDTVIVNVTNHVKYNVSIH  83

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHGVRQLRTGW+DGPAYITQCPIQTGQ++ YNFT+TGQRGTL WHAHI W RAT+HGAIV
Sbjct  84    WHGVRQLRTGWADGPAYITQCPIQTGQSYAYNFTITGQRGTLWWHAHILWLRATIHGAIV  143

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILP +   YPFPKP KE  ++LGEWW +DVEAVIN+A++SG APNVSDAHTING PGP  
Sbjct  144   ILPPKHHLYPFPKPHKEITLLLGEWWNADVEAVINEALKSGGAPNVSDAHTINGKPGPLF  203

Query  648   NCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
              C +K  + + VE GKTYLLRI++ A+N+ELFF VA H+L VVEVDA Y KP +T +I I
Sbjct  204   KCPTKDTFVVSVEHGKTYLLRIINVALNDELFFDVADHHLKVVEVDAVYTKPLRTKSIVI  263

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV-LATMP  1001
              PGQTTNA+L A++  G+Y IA   FMD  VA DN+TAT  L Y  + + T  + +  +P
Sbjct  264   APGQTTNALLYANKGSGRYFIATRTFMDAPVAVDNKTATAILQYVNSNSNTDFIAMPRIP  323

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
              +N T   + F   LRSLNS +FPA VP   D  LLF +G+ ++ C TC NGSR    IN
Sbjct  324   SQNDTSFATNFSNSLRSLNSARFPAKVPQTVDRHLLFTVGLAMDSCPTCNNGSRVAASIN  383

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             NISFVMP  +LLQAH++NI+GVFT DFP +P  PFNYTG PP N  T  GT+
Sbjct  384   NISFVMPKISLLQAHFFNITGVFTTDFPDRPPTPFNYTGAPPQNPMTSKGTR  435



>gb|KDP24484.1| hypothetical protein JCGZ_25048 [Jatropha curcas]
Length=486

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/352 (70%), Positives = 294/352 (84%), Gaps = 3/352 (1%)
 Frame = +3

Query  291   HGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVI  470
             HG+RQLRTGW+DGPAYITQCPIQ GQ ++YNFT+TGQRGTLLWHAHI W R+TVHG +VI
Sbjct  11    HGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLLWHAHILWLRSTVHGGLVI  70

Query  471   LPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPN  650
             LPKRGVPYPFP P KE V+VL EWWKSD EAVIN+A++SG+APNVSDAHTINGHPG   N
Sbjct  71    LPKRGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGAVAN  130

Query  651   CSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
             C S+ G+ L VE+GKTYLLR+V+AA+NEELFFK+AGH LTVVEVDA+YVKPFKTDT+ I 
Sbjct  131   CPSQDGFNLPVENGKTYLLRLVNAALNEELFFKIAGHQLTVVEVDATYVKPFKTDTVLIA  190

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPR  1007
             PGQTTN ++TADQ+ GKYL+A +PFMD  VA DN+TAT TLHY    + T+T+L   PP+
Sbjct  191   PGQTTNVLVTADQSSGKYLVAAAPFMDAPVAVDNKTATATLHYSAALSSTTTILTKPPPQ  250

Query  1008  NATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRAVGDIN  1181
             NAT V + F+  LRSLNSKK+PA VPL+ DH+LLF +G+G+NPC TC   NGSR V  IN
Sbjct  251   NATAVANKFINSLRSLNSKKYPAKVPLKIDHNLLFTVGLGVNPCPTCKAGNGSRVVASIN  310

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N++FVMPTTALLQAH++NI+GVFT DFP  P   FN+TG  PANLQT+NGT+
Sbjct  311   NVTFVMPTTALLQAHFFNINGVFTTDFPANPPHVFNFTGKGPANLQTKNGTR  362



>gb|AAK37829.1|AF132125_1 laccase [Pinus taeda]
Length=555

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/412 (61%), Positives = 305/412 (74%), Gaps = 3/412 (1%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE+  RHY F +  KN TR+C ++PIV  NGKFPGP+++ARE DTV V+V NHV  NVSI
Sbjct  22    VEAETRHYKFDIKFKNVTRLCHTEPIVTANGKFPGPTIHAREGDTVTVKVTNHVTYNVSI  81

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG+RQLRTGW+DGPAYITQCPIQTGQTF+YNFT+TGQRGTL WHAHI W RAT++G I
Sbjct  82    HWHGIRQLRTGWADGPAYITQCPIQTGQTFVYNFTITGQRGTLFWHAHILWLRATLYGPI  141

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILP +G PYPFPKP KE +++LGEWW SD E VINQAM SG+APN SD+HTING  GP 
Sbjct  142   VILPPKG-PYPFPKPHKEVILILGEWWNSDTETVINQAMNSGLAPNSSDSHTINGKAGPL  200

Query  645   PNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
               C +K  + L VE  KTYLLRI+ A +N+E+FF VA H+LTVVEVDA Y KPF+T  I 
Sbjct  201   FYCPTKDTFALSVEPDKTYLLRIIKA-LNQEVFFGVANHHLTVVEVDAVYTKPFETKAIV  259

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
               PGQTTNA+L  D+  G+Y +A   FMD  +A DN+TAT  L Y G+    + V+  +P
Sbjct  260   SAPGQTTNALLHTDKKAGRYFMAARVFMDAPIAVDNKTATAILQYTGSSNSLNPVMPLIP  319

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
               N T  +S F   L+SLNS ++PA VP   D +L F +G+ +N C TC+NG+R    +N
Sbjct  320   ALNDTAFSSNFSNALKSLNSPQYPAKVPQSIDRNLFFTVGLALNACPTCINGARPAASVN  379

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             NISF MPT ALLQ+HY+NISGVFT DFP  P   FNYTGTPP NLQ+ NGT+
Sbjct  380   NISFTMPTIALLQSHYFNISGVFTTDFPDNPPATFNYTGTPPKNLQSSNGTR  431



>gb|KHG17519.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/349 (70%), Positives = 289/349 (83%), Gaps = 0/349 (0%)
 Frame = +3

Query  291   HGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVI  470
             HG+RQ+RTGW+DGPAYITQCPIQ GQ ++YNFTLTGQRGTL +HAHI W RATVHGAIVI
Sbjct  31    HGIRQIRTGWADGPAYITQCPIQPGQNYVYNFTLTGQRGTLWYHAHILWLRATVHGAIVI  90

Query  471   LPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPN  650
             LPKR VPYPFPKP KEE++VLGEWWKSDVEAVIN+A++SG+APNVSDAHTINGHPGP P 
Sbjct  91    LPKRDVPYPFPKPHKEEIVVLGEWWKSDVEAVINEALKSGLAPNVSDAHTINGHPGPVPG  150

Query  651   CSSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGP  830
             C SKGY L V  GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA+YVKPFKTDTI I P
Sbjct  151   CPSKGYMLPVTPGKTYMLRIINAALNEELFFKIAGHQLTVVEVDATYVKPFKTDTIVIAP  210

Query  831   GQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRN  1010
             GQTTN ++T  + GGKY++A S FMD  +A DN TAT TLHY G+    +T L + PP+N
Sbjct  211   GQTTNVLVTTHRGGGKYMVAASTFMDAPIAVDNVTATATLHYSGSLTSAATTLTSTPPKN  270

Query  1011  ATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNIS  1190
             AT V + F+  LRSLNSK++PANVPL+ DHSLLF +G+G+NPC TC+NGSR V  INN++
Sbjct  271   ATSVATNFISSLRSLNSKQYPANVPLKIDHSLLFTVGLGVNPCPTCVNGSRVVASINNVT  330

Query  1191  FVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             FVMP  +LLQAH++NISGVFT DFPG P  PFNYT T   N  T+ GT+
Sbjct  331   FVMPKISLLQAHFFNISGVFTSDFPGNPPAPFNYTSTQVTNFATKQGTR  379



>ref|XP_009764219.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/414 (59%), Positives = 306/414 (74%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F +   N +R+C +KPIV VNG+FPGP++Y RE D V + V+NH Q N+S
Sbjct  25    PAEAAIKKYQFDIQVANVSRLCHAKPIVTVNGRFPGPTIYIREGDRVQINVINHAQYNIS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG +++Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILP++G P+PFP+PD+EEVIVLGEWW +DVE V NQ    G+ PN+SDAHTING PGP
Sbjct  145   IVILPQQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGLPPNMSDAHTINGKPGP  204

Query  642   TPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y +EVE GKTYLLRI++AA+N+ELFF VA H LTVVE+DA Y KPF T+ I
Sbjct  205   LFPCSEKYTYAMEVEKGKTYLLRIINAALNDELFFSVANHTLTVVEIDAVYTKPFSTNAI  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PFMD  ++ DN+TAT    YKG        L  +
Sbjct  265   LIAPGQTTNVLVRANQIPGRYFMAARPFMDAPISVDNKTATAIFQYKGVSETVIPKLPDL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    ++   LRSLNS K+PANVPL+ D +L + IG+GIN C TCLNG+R    +
Sbjct  325   PAPNDTEFALSYDNKLRSLNSPKYPANVPLKVDRNLFYTIGLGINACPTCLNGTRLTASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNISFVMP TALLQAHY+NI GV+T DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  385   NNISFVMPQTALLQAHYFNIKGVYTTDFPDKPPTPFNYTGAPLTANLKTTQGTR  438



>ref|XP_009590676.1| PREDICTED: laccase-11-like [Nicotiana tomentosiformis]
Length=559

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/414 (59%), Positives = 305/414 (74%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F +   N +R+C +KPIV VNG+FPGP++Y RE D V + V NH Q N+S
Sbjct  22    PAEAAIKKYQFDIQVANVSRLCHAKPIVTVNGRFPGPTIYVREGDRVQINVTNHAQYNMS  81

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG +++Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  82    IHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYGA  141

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILP++G P+PFP+PD+EEVIVLGEWW +DVE V NQ    G+ PN+SDAHTING PGP
Sbjct  142   IVILPQQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGLPPNMSDAHTINGKPGP  201

Query  642   TPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y +EVE GKTYLLRI++AA+N+ELFF VA H LTVVE+DA Y KPF T+ I
Sbjct  202   LFPCSEKYTYAMEVEKGKTYLLRIINAALNDELFFSVANHTLTVVEIDAVYTKPFSTEAI  261

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PFMD  ++ DN+TAT    YKG        L  +
Sbjct  262   LIAPGQTTNVLVRANQIPGRYFMAARPFMDAPISVDNKTATAIFQYKGVSETVIPKLPDL  321

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    ++   LRSLNS K+PANVPL+ D +L + IG+GIN C TCLNG+R    +
Sbjct  322   PAPNDTEFALSYDNKLRSLNSPKYPANVPLKVDRNLFYTIGLGINACPTCLNGTRLTASL  381

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNISFVMP TALLQAHY+NI GV+T DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  382   NNISFVMPQTALLQAHYFNIKGVYTTDFPDKPPTPFNYTGAPLTANLKTTQGTR  435



>dbj|BAN10308.1| laccase [Chamaecyparis obtusa]
Length=555

 Score =   528 bits (1360),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 247/411 (60%), Positives = 304/411 (74%), Gaps = 1/411 (0%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E     Y F +  KN +RMC +KPIV VNG+FPGP++YARE DTV++ V NHV+ N+SIH
Sbjct  21    EGKTNTYKFDIQLKNVSRMCQAKPIVTVNGQFPGPTIYAREGDTVLINVTNHVKYNMSIH  80

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHG+RQLRTGW+DGPAYITQCPIQT Q+F+YNFT+TGQRGTLL+HAHI W RAT+HG IV
Sbjct  81    WHGIRQLRTGWADGPAYITQCPIQTRQSFVYNFTITGQRGTLLYHAHILWLRATLHGPIV  140

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             ILPK+ VPYPFPKP KE  +VLGEWW +D EAVINQAM++G APN S+AHTING PGP  
Sbjct  141   ILPKKHVPYPFPKPHKEVTLVLGEWWNADTEAVINQAMKTGGAPNASNAHTINGKPGPLF  200

Query  648   NCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
             NCS+K  + L VE  KTYLLRI++AA+N+++FF +  H+L VVEVDA Y KPF+T  I I
Sbjct  201   NCSTKDTHALAVEPDKTYLLRIINAALNDQVFFSIGNHHLKVVEVDAVYTKPFETKAIAI  260

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTTN +L   +  G+Y + V  FMD  +  DN T+ G L Y GT   ++ ++  +P 
Sbjct  261   SPGQTTNVLLDTSKKTGRYFMTVRAFMDAPIPVDNLTSAGILQYIGTSNTSNPIMPVIPK  320

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
              N T   + F   ++SLNS  +PA VP   D +L FA+G+ ++ CSTC+NGSRA   INN
Sbjct  321   INDTAFYTNFSSSIKSLNSALYPAKVPQTVDRNLFFAMGLALDKCSTCVNGSRASASINN  380

Query  1185  ISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             +SFVMPT ALLQAH  NISGVFT DFP  P  PFNYTGTPP NL T  GT+
Sbjct  381   VSFVMPTIALLQAHVNNISGVFTKDFPDNPPTPFNYTGTPPKNLFTSKGTR  431



>gb|KHG11130.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   525 bits (1352),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 253/352 (72%), Positives = 294/352 (84%), Gaps = 3/352 (1%)
 Frame = +3

Query  291   HGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVI  470
             HGVRQLRTGW+DGPAYITQCPI TGQ+++YNFT+TGQRGTLLWHAHI W R+TVHGAIVI
Sbjct  28    HGVRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTLLWHAHILWLRSTVHGAIVI  87

Query  471   LPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPN  650
             LPKRGVPYPFPKP KE V+VLGEWWKSD EAVIN+A++SG+APNVSDAHTINGHPGP  +
Sbjct  88    LPKRGVPYPFPKPHKEAVVVLGEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPISS  147

Query  651   C-SSKGYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIG  827
             C S +G+TL VE+GKTYLLR+++AA+NEELFFK+AGH LTVVEVDA+YVKPFK DT+ I 
Sbjct  148   CPSQRGFTLAVENGKTYLLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFKIDTVVIA  207

Query  828   PGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPR  1007
             PGQTTN +L+ADQ+ GKYL+A SPFMD  VA DN TAT T+HY GT A T T L   PP+
Sbjct  208   PGQTTNVLLSADQSSGKYLVAASPFMDAPVAVDNLTATATVHYSGTLANTPTTLTAPPPK  267

Query  1008  NATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCL--NGSRAVGDIN  1181
             NAT V + F+  LR+LNSK+FPA VP   DHSL F +G+GINPC TC   NGSRAV  +N
Sbjct  268   NATAVANKFINSLRALNSKQFPALVPQTIDHSLYFTVGLGINPCPTCKAGNGSRAVASVN  327

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQNGTK  1337
             N++F MPTTALLQAH++NISGVFT DFP  P   FNY+GTPP NL+T  GTK
Sbjct  328   NLTFTMPTTALLQAHFFNISGVFTTDFPANPPHKFNYSGTPPTNLKTMTGTK  379



>ref|XP_002866298.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42557.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   525 bits (1352),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 258/404 (64%), Positives = 307/404 (76%), Gaps = 15/404 (4%)
 Frame = +3

Query  150   NTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDG  329
             NTT++CSSKPIV VNGKFPGP++ AREDDT++++VVNHV  NVSIHW       TGW+DG
Sbjct  3     NTTKLCSSKPIVTVNGKFPGPTIVAREDDTLLIKVVNHVNYNVSIHW-------TGWADG  55

Query  330   PAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKP  509
             PAYITQCPIQ GQ +++NFTLTGQRGTL WHAHI W RATVHGAIVILPK GVPYPFPKP
Sbjct  56    PAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKP  115

Query  510   DKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVES  686
              KE+ IVL EWWKSDVE +IN+A + G AP+ SDAHTINGH G   NC S+  Y L V +
Sbjct  116   YKEKTIVLSEWWKSDVEELINEASKIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRA  175

Query  687   GKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQ  866
             GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT+FI PGQTTN +LTA+ 
Sbjct  176   GKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANA  235

Query  867   NGG-KYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS----TVLATMPPRNATPVTST  1031
             N G  Y++A + F D  +  DN TAT TLHY G  A  S    TVLA++PP+NAT V + 
Sbjct  236   NAGSNYMVAATTFTDAQIPYDNVTATATLHYIGHTATVSASKKTVLASLPPQNATWVATK  295

Query  1032  FMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTA  1211
             F   LRSLNS+++PA VP   DHSL F +G+G NPC +C NG R V  INN++F MP TA
Sbjct  296   FTRSLRSLNSREYPARVPTTVDHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPETA  355

Query  1212  LLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
             LLQAH++NISGVFTDDFP  P+ P++YT       N  T  GTK
Sbjct  356   LLQAHFFNISGVFTDDFPANPSNPYDYTAPVKIGVNAATMKGTK  399



>ref|XP_004233973.1| PREDICTED: laccase-11 [Solanum lycopersicum]
Length=563

 Score =   526 bits (1355),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 244/415 (59%), Positives = 307/415 (74%), Gaps = 2/415 (0%)
 Frame = +3

Query  99    EPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENV  278
             +P E+ ++ Y F +   N +R+C +KP+V VNG+FPGP++YARE D V + V NH Q N+
Sbjct  25    QPAEAAIKKYQFDIQVANVSRLCHAKPMVTVNGRFPGPTIYAREGDRVQINVTNHAQYNM  84

Query  279   SIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHG  458
             SIHWHG++Q R GW+DGPAYITQCPI+TG +++Y+F +TGQRGTL WHAHI W RATV+G
Sbjct  85    SIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYG  144

Query  459   AIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPG  638
             AIVILP +G P+PFP+PD+EEVIVLGEWW +DVE V NQ    G+ PN+SDAHTING PG
Sbjct  145   AIVILPSQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGIPPNMSDAHTINGKPG  204

Query  639   PTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             P   CS K  + +EVE GKTYLLRIV+AA+N+ELFF +A H LTVVE+DA Y KPF T+ 
Sbjct  205   PLFPCSEKYTFAMEVEKGKTYLLRIVNAALNDELFFTIANHTLTVVEIDAVYTKPFSTEA  264

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             I I PGQTTN ++ A+Q  G+Y +A  PFMD  V  DN+TAT    YKG        L  
Sbjct  265   ILIAPGQTTNVLVRANQVPGRYFMAARPFMDAPVPVDNKTATAIFQYKGIPETVLPKLPN  324

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +P  N T    ++ + LRSLNS+K+PANVPL+ D +L + IG+GIN C TC+NG+R    
Sbjct  325   LPAPNDTEFALSYDKKLRSLNSQKYPANVPLKVDRNLFYTIGLGINACPTCINGTRFSAS  384

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             +NNISFVMP TALLQAHY+NI GV+T DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  385   LNNISFVMPKTALLQAHYFNIKGVYTTDFPDKPPTPFNYTGAPLTANLRTTQGTR  439



>ref|XP_010924287.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=559

 Score =   525 bits (1353),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 241/414 (58%), Positives = 306/414 (74%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ +++Y F VV KN +R+C +KPIV VNG+FPGP++YARE D V++ V N+ Q N+S
Sbjct  22    PAEAAIKNYQFDVVLKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVVINVTNYAQYNIS  81

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPIQ+G+++ Y+F +TGQRGTL WHAHI W RAT+HGA
Sbjct  82    IHWHGLKQFRNGWADGPAYITQCPIQSGRSYTYDFNVTGQRGTLWWHAHILWLRATIHGA  141

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK GVPYPFP+P  E  +VLGEWW +DVE V  Q    G+ PN+SDAHTING PGP
Sbjct  142   IVIMPKEGVPYPFPQPHAEAELVLGEWWHADVEEVEKQGNMLGLPPNMSDAHTINGKPGP  201

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVE GKTYLLRIV+AA+N+ELFF +AGH++T+VE+DA Y KPF T+ I
Sbjct  202   LFPCSEKHTFAMEVEWGKTYLLRIVNAALNDELFFAIAGHSMTMVEIDAVYCKPFTTNAI  261

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTT+ ++ AD+N G+Y +A  PFMD  +A DN+TAT  L YKG       +L  +
Sbjct  262   VIAPGQTTSVLVKADKNPGRYFMAARPFMDAPIAVDNRTATAILQYKGIPTTIVPILPQL  321

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T   + F++ LRSLNS +FPANVPL  D  L +   +G++PC TCLNG+R    +
Sbjct  322   PAPNDTEFVNDFLDKLRSLNSPQFPANVPLSVDRHLFYTASLGVDPCPTCLNGTRLTASL  381

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+FVMPT  LLQAHY+NI GVF  DFP +PA  FNYTG P  ANL T  GT+
Sbjct  382   NNITFVMPTIGLLQAHYFNIKGVFRLDFPDKPATTFNYTGAPLTANLGTSLGTR  435



>ref|XP_006347000.1| PREDICTED: laccase-11-like [Solanum tuberosum]
Length=563

 Score =   524 bits (1350),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 243/415 (59%), Positives = 306/415 (74%), Gaps = 2/415 (0%)
 Frame = +3

Query  99    EPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENV  278
             +P E+ ++ Y F +   N +R+C +KP+V VNG+FPGP++YARE D V + V NH Q N+
Sbjct  25    QPAEAAIKKYQFDIQVANVSRLCHAKPMVTVNGRFPGPTIYAREGDRVQINVTNHAQYNM  84

Query  279   SIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHG  458
             SIHWHG++Q R GW+DGPAYITQCPI+TG +++Y+F +TGQRGTL WHAHI W RATV+G
Sbjct  85    SIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYG  144

Query  459   AIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPG  638
             AIVILP +G P+PFP+PD+EEVIVLGEWW +DVE V NQ    G+ PN+SDAHTING PG
Sbjct  145   AIVILPSQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGIPPNMSDAHTINGKPG  204

Query  639   PTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             P   CS K  + +EVE GK+YLLRIV+AA+N+ELFF +A H LTVVE+DA Y KPF T+ 
Sbjct  205   PLFPCSEKYTFAMEVEKGKSYLLRIVNAALNDELFFTIANHTLTVVEIDAVYTKPFSTEA  264

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             I I PGQTTN ++ A+Q  G+Y +A  PFMD  V  DN+TAT    YKG        L  
Sbjct  265   ILIAPGQTTNVLVRANQIPGRYFMAARPFMDAPVPVDNKTATAIFQYKGIPETVIPKLPN  324

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +P  N T    ++ + LRSLNS K+PANVPL+ D +L + IG+GIN C TC+NG+R    
Sbjct  325   LPAPNDTEFALSYDKKLRSLNSPKYPANVPLKVDRNLFYTIGLGINACPTCINGTRFSAS  384

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             +NNISFVMP TALLQAHY+NI GV+T DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  385   LNNISFVMPKTALLQAHYFNIKGVYTTDFPDKPPTPFNYTGAPLTANLRTTQGTR  439



>gb|KHG01609.1| Laccase-11 -like protein [Gossypium arboreum]
Length=562

 Score =   523 bits (1348),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 304/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ VR Y F +  KN +R+C +KPIV VNG+FPGP++YARE D VIV V NH + N+S
Sbjct  25    PAEAAVRKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVIVNVTNHAKYNMS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG +++Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK+G+PYPFPKP+ E+++VLGEWW  DVE ++ Q    G+ PN+SDAHTING PGP
Sbjct  145   IVIMPKQGMPYPFPKPNMEQLVVLGEWWHKDVEEIVKQGNNMGLPPNMSDAHTINGKPGP  204

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVESGKTYLLRI++AA+N+ELFF +A HN+TVVEVDA Y KPF T  I
Sbjct  205   LFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIASHNMTVVEVDAVYTKPFVTQAI  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q+ G+Y +A  PFMD  +  DN+TATG   Y G        L  +
Sbjct  265   LIAPGQTTNVLIQANQSPGRYFMAARPFMDAPIPVDNKTATGIFQYNGIPNTVLPTLPQL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    ++ + L+SLNS  FPANVPL+ D  L + +G G + C TC+NG+R +  +
Sbjct  325   PASNDTDFALSYNKKLKSLNSANFPANVPLKVDRKLFYTVGFGKDSCPTCVNGTRILASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNISFVMP   LLQAHY+NISGVF  DFP +P  PFNYTG P  ANL T +GT+
Sbjct  385   NNISFVMPKIGLLQAHYFNISGVFRTDFPDKPPKPFNYTGAPLTANLGTAHGTR  438



>gb|AAK37830.1|AF132126_1 laccase [Pinus taeda]
Length=577

 Score =   523 bits (1348),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 253/423 (60%), Positives = 306/423 (72%), Gaps = 7/423 (2%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             + P  V+   RHY F +  KN TR+C +KPIV VNG+FPGP++ ARE DT++++V NHV+
Sbjct  31    LLPAAVQGETRHYKFNIQLKNVTRICRTKPIVTVNGEFPGPTIEAREGDTLLIKVTNHVK  90

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              NVSIHWHGVRQLRTGW+DGPAYITQCPIQTGQT++YNFT+TGQRGTL WHAHI W RAT
Sbjct  91    YNVSIHWHGVRQLRTGWADGPAYITQCPIQTGQTYVYNFTVTGQRGTLWWHAHILWLRAT  150

Query  450   VHGAIVILPKRGVPYPF-PKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTIN  626
             ++GAIVILP   VPYPF PKP KE  +VLGEWW +DVEAVIN+A+Q+G APN+SDAHTIN
Sbjct  151   LYGAIVILPPPNVPYPFEPKPHKEITLVLGEWWNADVEAVINEALQTGAAPNISDAHTIN  210

Query  627   GHPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPF  803
             G PG    C  K  +TL VE GK YLLRIV+AA+N+ELFF+VA H + VVEVDA Y KPF
Sbjct  211   GKPGEIFKCPVKDTFTLPVEHGKVYLLRIVNAALNDELFFEVANHLVKVVEVDAVYTKPF  270

Query  804   KTDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTST  983
              T  I I PGQTTN +L A++  G Y +A  PFMD  V  +N+TAT  LHY    + +  
Sbjct  271   DTKAIVIAPGQTTNVLLEANKRSGSYFVAARPFMDAPVTVNNKTATAILHYISRNSESDI  330

Query  984   -----VLATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTC  1148
                  ++  +P  N T   ++F   LRSLNS +FPA VP   D +L FA+G+    C TC
Sbjct  331   PAVNPLMPRLPLLNDTAFATSFTSKLRSLNSVQFPAKVPQTIDRNLFFAVGLATESCQTC  390

Query  1149  LNGSRAVGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTPPANLQTQN  1328
               G RA   INNISFVMP+ +LL AH +NISGVFT DFP +P  PFNYTGTPP NL T  
Sbjct  391   NGGLRASASINNISFVMPSISLLDAHIFNISGVFTADFPDKPPTPFNYTGTPPKNLITSK  450

Query  1329  GTK  1337
             GT+
Sbjct  451   GTR  453



>ref|XP_010024157.1| PREDICTED: laccase-11 [Eucalyptus grandis]
 gb|KCW60585.1| hypothetical protein EUGRSUZ_H03315 [Eucalyptus grandis]
Length=562

 Score =   522 bits (1345),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 239/418 (57%), Positives = 305/418 (73%), Gaps = 2/418 (0%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             +C    E+ ++ Y F +  KN +R+C +KPIV VNG +PGP++YARE D V++ V NH Q
Sbjct  21    VCFTSSEAAIKKYQFDIQVKNVSRLCHAKPIVTVNGMYPGPTIYAREGDRVLINVTNHAQ  80

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHG++Q R GW+DGPAYITQCPIQTG ++ Y+F +TGQRGTL WHAHI W RAT
Sbjct  81    YNMSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYTYDFNVTGQRGTLWWHAHILWLRAT  140

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             VHGAIVI+P +G P+PFP+P  E++I+LGEWW +DVEA+  Q  Q G+ PN+SDAHTING
Sbjct  141   VHGAIVIMPPQGTPFPFPQPHSEQIILLGEWWNADVEAIEKQGNQMGLPPNMSDAHTING  200

Query  630   HPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PGP   CS K  + +EVE GKTYLLRI++AA+N+ELFF +AGHN+TVVEVDA Y KPF 
Sbjct  201   KPGPLFPCSEKHTFAMEVEPGKTYLLRIINAALNDELFFAIAGHNMTVVEVDAVYAKPFS  260

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TD+I I PGQTTN ++ A++  G+Y +A   F+D  V  DN+TAT  L YKG        
Sbjct  261   TDSILIAPGQTTNVLVQANRVPGRYFMAARSFIDAPVPVDNKTATAILQYKGIPNTVMPA  320

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             LA +P  N T    ++ + LRSLNS +FPANVPL    +L + +G+G NPC+TCLNG+R 
Sbjct  321   LAELPAPNDTAFALSYSQKLRSLNSPQFPANVPLNVSRNLFYTVGLGKNPCATCLNGTRF  380

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             +  +NNISF MP   LLQAHY+N  GVFT DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  381   LASLNNISFTMPQVGLLQAHYFNTKGVFTADFPDKPPTPFNYTGAPLTANLKTSQGTR  438



>ref|XP_007046899.1| Laccase 11 [Theobroma cacao]
 gb|EOX91056.1| Laccase 11 [Theobroma cacao]
Length=562

 Score =   520 bits (1339),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 241/414 (58%), Positives = 301/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ V+ Y F +  KN +R+C +KPIV VNG+FPGP++Y RE D VIV V NH + N+S
Sbjct  25    PAEAAVKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVIVNVTNHAKYNMS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIKTGNSYSYDFNVTGQRGTLWWHAHILWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK G P+PFP P+ E++I+LGEWW  DVE ++ Q    G+ PN+SDAHTING PGP
Sbjct  145   IVIMPKEGTPFPFPHPNMEQIIILGEWWHKDVEEIVKQGTNMGLPPNMSDAHTINGKPGP  204

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVESGKTYLLRI++AA+N+ELFF +AGHN+TVVEVDA Y KPF T  I
Sbjct  205   LFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNMTVVEVDAVYTKPFITQAI  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PFMD  +  DN+TATG L YKG        L  +
Sbjct  265   LIAPGQTTNVLVRANQMPGRYFMASRPFMDAPLPIDNKTATGILQYKGIPNTVLPTLPQL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    ++ + LRSLNS KFPANVPL+ D  L + IG G + C TCLNG+R +  +
Sbjct  325   PDPNDTTFALSYNKKLRSLNSAKFPANVPLKVDRKLFYTIGFGKDTCPTCLNGTRLLASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNISFVMP   LLQAHY+N+ GVF  DFP +P  PFNYTG P  ANL T +GT+
Sbjct  385   NNISFVMPEVGLLQAHYFNMKGVFRTDFPDKPPKPFNYTGAPLTANLGTAHGTR  438



>ref|XP_003632636.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI32739.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   520 bits (1338),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 243/414 (59%), Positives = 302/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P ++ V+ Y F +  KN +R+C +KPIV VNG FPGP++Y RE D V+V V NH Q N+S
Sbjct  25    PADAAVKKYQFDIQVKNVSRLCHAKPIVTVNGMFPGPTIYVREGDQVLVNVTNHAQYNIS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ YNF ++GQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQFRNGWADGPAYITQCPIKTGHSYTYNFQVSGQRGTLWWHAHILWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK+G P+PFP+P  E  IVLGEWW SDVE ++NQA + G+ P +SDAHTING PGP
Sbjct  145   IVIMPKQGTPFPFPQPYFEANIVLGEWWSSDVETIVNQANKLGLPPPMSDAHTINGKPGP  204

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVESGKTYLLRIV+AA+N+ELFF +AGHN+TVVE+DA Y KPF T  +
Sbjct  205   LFPCSEKHTFAMEVESGKTYLLRIVNAALNDELFFAIAGHNMTVVEIDAVYTKPFTTQAL  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ ADQ+  +Y +AV PFMD  V  DN+TAT  L YKG        LA +
Sbjct  265   LIAPGQTTNVLVKADQSPSRYFMAVRPFMDAPVPVDNKTATAILQYKGIPNTVLPTLAQL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    ++   L+SLN+ +FPANVPLQ D  L + IG+G NPC TC NG++    +
Sbjct  325   PAPNDTNFALSYNSKLKSLNTPQFPANVPLQVDRHLFYTIGLGQNPCPTCQNGTQLTASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+FVMP  ALLQAHY+NI GVF  DFP +P  PFNYTG P  ANL T  GT+
Sbjct  385   NNITFVMPKVALLQAHYFNIKGVFRTDFPDRPLAPFNYTGAPLTANLGTSLGTR  438



>ref|XP_007198990.1| hypothetical protein PRUPE_ppa003590mg [Prunus persica]
 gb|EMJ00189.1| hypothetical protein PRUPE_ppa003590mg [Prunus persica]
Length=563

 Score =   519 bits (1337),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 246/414 (59%), Positives = 305/414 (74%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P ++ ++ Y F V  KN +R+C SKPIV VNG FPGP++YARE DT++V V NH Q N+S
Sbjct  26    PAKAALKTYQFDVQVKNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLLVNVTNHAQYNMS  85

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ YN T+TGQRGTL WHAHI W RATV+GA
Sbjct  86    IHWHGLKQYRNGWADGPAYITQCPIKTGHSYTYNITITGQRGTLWWHAHIFWLRATVYGA  145

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILPK+G  +PF +P KE  IVLGEWW +DVE V+ Q  + G+ PN+SDAHTING PGP
Sbjct  146   IVILPKQGTGFPFLQPYKEANIVLGEWWNNDVEEVVKQGNKLGLPPNMSDAHTINGKPGP  205

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y LEVE GKTYLLRI++AA+N+ELFF +AGHNLTVVE+DA Y KPF +  I
Sbjct  206   LFPCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTSQAI  265

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PFMD  V+ DN+TATG L YKG       VL  +
Sbjct  266   LIAPGQTTNVLVQANQVPGRYFMAARPFMDAPVSIDNKTATGILQYKGIPNTVQPVLPQL  325

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    +F   LRSLN+ +FPA+VPL+ D  L + IG+GIN C+TCLNG++    +
Sbjct  326   PALNNTAFALSFNAKLRSLNTAQFPASVPLKVDRHLFYTIGLGINQCTTCLNGTQLTASL  385

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+FVMP   LLQAHY+N  GVFT DFP +P  PFNYTG+P  ANL T+ GT+
Sbjct  386   NNITFVMPQIGLLQAHYFNTKGVFTTDFPDRPPTPFNYTGSPLTANLGTKLGTR  439



>ref|NP_200699.1| laccase 16 [Arabidopsis thaliana]
 gb|AED97116.1| laccase 16 [Arabidopsis thaliana]
Length=523

 Score =   518 bits (1333),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 254/404 (63%), Positives = 307/404 (76%), Gaps = 15/404 (4%)
 Frame = +3

Query  150   NTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDG  329
             NTT++CSSKPIV VNG+FPGP++ ARE DT++++VVNHV+ NVSIHW       TGW+DG
Sbjct  3     NTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHW-------TGWADG  55

Query  330   PAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKP  509
             PAYITQCPIQ GQ +++NFTLTGQRGTL WHAHI W RATVHGAIVILPK GVPYPFPKP
Sbjct  56    PAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPKP  115

Query  510   DKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSK-GYTLEVES  686
              KE+ IVL EWWKSDVE +IN+A + G AP+ SDAHTINGH G   NC S+  Y L V +
Sbjct  116   YKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPVRA  175

Query  687   GKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNAVLTADQ  866
             GKTY+LRI++AA+NEELFFK+AGH LTVVEVDA Y KP+KTDT+FI PGQTTN +LTA+ 
Sbjct  176   GKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTANA  235

Query  867   NGGK-YLIAVSPFMDTIVATDNQTATGTLHYKGTQALTS----TVLATMPPRNATPVTST  1031
             N G  Y++A + F D  +  DN TAT TLHY G  +  S    TVLA++PP+NAT V + 
Sbjct  236   NAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVATK  295

Query  1032  FMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTTA  1211
             F   LRSLNS ++PA VP   +HSL F +G+G NPC +C NG R V  INN++F MP TA
Sbjct  296   FTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPKTA  355

Query  1212  LLQAHYYNISGVFTDDFPGQPAIPFNYTGTPP--ANLQTQNGTK  1337
             LLQAH++NISGVFTDDFP +P+ P++YT       N  T  GTK
Sbjct  356   LLQAHFFNISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTK  399



>ref|XP_008236999.1| PREDICTED: laccase-11-like [Prunus mume]
Length=563

 Score =   518 bits (1335),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/414 (59%), Positives = 304/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P ++ ++ Y F V  KN +R+C SKPIV VNG FPGP++YARE DT++V V NH Q N+S
Sbjct  26    PAKAALKTYQFDVQVKNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLLVNVTNHAQYNMS  85

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ YN T+TGQRGTL WHAHI W RATV+GA
Sbjct  86    IHWHGLKQYRNGWADGPAYITQCPIRTGHSYTYNITITGQRGTLWWHAHIFWLRATVYGA  145

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILPK+G  +PF +P KE  IVLGEWW +DVE V+ Q  + G+ PN+SDAHTING PGP
Sbjct  146   IVILPKQGTGFPFLQPYKEANIVLGEWWNNDVEEVVKQGNKLGLPPNMSDAHTINGKPGP  205

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y LEVE GKTYLLRI++AA+N+ELFF +AGHNLTVVE+DA Y KPF +  I
Sbjct  206   LFPCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTSQAI  265

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PFMD  V+ DN+TATG L YKG       VL  +
Sbjct  266   LIAPGQTTNVLVQANQAPGRYFMAARPFMDAPVSIDNKTATGILQYKGIPNSVQPVLPQL  325

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    +F   LRSLN+ +FPA+VPL+ D  L + IG+GIN C+TCLNG++    +
Sbjct  326   PALNDTAFALSFNAKLRSLNTAQFPASVPLKVDRHLFYTIGLGINQCTTCLNGTQLTASL  385

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+FVMP   LLQAHY+N  GVFT DFP +P  PFNYTG P  ANL T+ GT+
Sbjct  386   NNITFVMPQIGLLQAHYFNTKGVFTTDFPDRPPTPFNYTGAPLNANLGTKIGTR  439



>ref|XP_011099634.1| PREDICTED: laccase-11-like [Sesamum indicum]
Length=565

 Score =   518 bits (1333),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 238/415 (57%), Positives = 300/415 (72%), Gaps = 2/415 (0%)
 Frame = +3

Query  99    EPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENV  278
              PVE+ V+ Y F +  KN +R+C +KPIV VNG FPGP++Y RE D V+V V NH Q N+
Sbjct  27    SPVEAAVKRYQFDIQVKNVSRLCHAKPIVTVNGMFPGPTIYVREGDRVLVNVTNHAQYNM  86

Query  279   SIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHG  458
             SIHWHG++Q R GW+DGPAYITQCPI  G +++Y+F +TGQRGTL WHAHI W RATV+G
Sbjct  87    SIHWHGLKQYRNGWADGPAYITQCPIMMGSSYVYDFNVTGQRGTLWWHAHILWLRATVYG  146

Query  459   AIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPG  638
             AIVI+PK+G P+PFP+PD+EEVI+LGEWW +DVEAV  Q    G+ PN+SDAHTING PG
Sbjct  147   AIVIMPKQGTPFPFPQPDREEVILLGEWWNADVEAVEKQGNSLGLPPNMSDAHTINGKPG  206

Query  639   PTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDT  815
             P   CS K  + +EVE GKTYLLR+++AA+N+ELFF +AGHN+TVVE+DA Y KPF T  
Sbjct  207   PLFPCSEKYTFAMEVEQGKTYLLRLINAALNDELFFAIAGHNMTVVEIDAVYTKPFSTQA  266

Query  816   IFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLAT  995
             + I PGQTTN ++ A+Q  G+Y +A  PFMD  +  DN+TAT  L YKG        L  
Sbjct  267   LLIAPGQTTNVLVRANQIPGRYFMATRPFMDVPIPIDNKTATAILQYKGIPNTIIPTLPN  326

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +P  N +    ++ E LRSLNS +FPA VPL+ D  L + IG+G N C +C+NG+R    
Sbjct  327   LPRPNDSAFAFSYEEKLRSLNSPQFPAKVPLKVDRHLFYTIGLGRNACPSCINGTRLTAS  386

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             +NNISFVMP   LLQAHY+N+ GV+T DFP  P  PFNYTG P  ANL T  GT+
Sbjct  387   LNNISFVMPQVGLLQAHYFNMKGVYTTDFPDNPPTPFNYTGAPLTANLGTSKGTR  441



>ref|XP_004232420.1| PREDICTED: laccase-11 [Solanum lycopersicum]
Length=559

 Score =   517 bits (1331),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 241/418 (58%), Positives = 309/418 (74%), Gaps = 3/418 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             IC  PVE+ ++ Y F V   N +R+C++K +V VNG FPGP++YARE D V + V N+VQ
Sbjct  19    IC-LPVEAALKKYQFDVKLSNVSRLCNAKQMVTVNGGFPGPTIYAREGDRVQINVTNYVQ  77

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHG++Q R GW+DGPAYITQCPIQTG +++Y+F +TGQRGTL WHAHI W RAT
Sbjct  78    YNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNVTGQRGTLWWHAHILWLRAT  137

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GAIVI+P++G P+PFP+PD+EEV+VLGEWW +DVEAV  Q    G+ PN+SDAHTING
Sbjct  138   VYGAIVIMPQKGTPFPFPQPDREEVLVLGEWWNADVEAVEKQGNALGIPPNMSDAHTING  197

Query  630   HPGPTPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PGP   CS K  + +EVE GKTYLLRIV+AA+N+ELFF +A H  TVVE+DA Y KPF 
Sbjct  198   KPGPLFPCSEKHTFAMEVEKGKTYLLRIVNAALNDELFFALANHTFTVVEIDAVYTKPFT  257

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             TD I I PGQTTN ++ A++  G+Y +A   FMD  ++ DN+TAT    YKG        
Sbjct  258   TDAILIAPGQTTNVLVRANRVPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPETVIPK  317

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
             L T+P +N +    ++   L+SLN+ K+PANVPL  D  LLF +G+GINPC TCLNG+R 
Sbjct  318   LPTLPAQNDSDFALSYNFKLKSLNTPKYPANVPLNVDRHLLFTVGLGINPCPTCLNGTRL  377

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
                +NNISF+MP TALLQ+HY+NI GV+T DFP +P  PFN+TG P  ANL+T  GT+
Sbjct  378   TASLNNISFIMPQTALLQSHYFNIKGVYTPDFPDKPPTPFNFTGAPLTANLRTNVGTR  435



>ref|XP_006425656.1| hypothetical protein CICLE_v10025287mg [Citrus clementina]
 gb|ESR38896.1| hypothetical protein CICLE_v10025287mg [Citrus clementina]
 gb|KDO70943.1| hypothetical protein CISIN_1g008484mg [Citrus sinensis]
Length=564

 Score =   517 bits (1332),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 302/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F V  KN +R+C +KPIV VNG+FPGP++Y RE D V+V V NH Q N+S
Sbjct  27    PAEAAIKKYQFDVQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVLVNVTNHAQYNMS  86

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  87    IHWHGLKQYRNGWADGPAYITQCPIKTGNSYTYDFNVTGQRGTLWWHAHIFWLRATVYGA  146

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK G P+PFP+P++EEVI+LGEWW +DVE V  Q  + G+ PN+SDAHTING PGP
Sbjct  147   IVIMPKPGSPFPFPQPNREEVILLGEWWHTDVEEVEKQGQKMGLPPNMSDAHTINGKPGP  206

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVESGKTYLLRI++AA+N+ELFF +AGHN TVVEVDA Y KPF T+ I
Sbjct  207   LFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNFTVVEVDAVYTKPFTTEAI  266

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PF D  +  DN+TATG L YKG        LA +
Sbjct  267   LIAPGQTTNVLVQANQKPGRYFMAARPFNDAPIPVDNKTATGILQYKGIPNSLLPTLAQL  326

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N +     + + LRSLNS KFPA+VP + D  L + IG G + C TC+NG+R +  +
Sbjct  327   PASNDSEFALNYNKKLRSLNSPKFPADVPQKVDRKLFYTIGFGKDSCPTCVNGTRLLATL  386

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNISFVMP TALLQAHY+N+ GVF  DFP +P  PFNYTG P  A+L T   T+
Sbjct  387   NNISFVMPQTALLQAHYFNLKGVFKADFPDKPPKPFNYTGAPLTASLGTSRATR  440



>ref|XP_009793780.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   517 bits (1331),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 303/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F V   N +R+C +KPIV VNG+FPGP++YARE D V + V N+ Q N+S
Sbjct  25    PAEAALKKYQFDVQVANVSRLCHAKPIVTVNGRFPGPTIYAREGDRVQINVTNYAQYNLS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPIQTG +++Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNITGQRGTLWWHAHILWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+P++G P+PFP+PD+EEV+VLGEWW +DVE V  Q    G+ PN+SDAHTING PGP
Sbjct  145   IVIMPQQGTPFPFPQPDREEVLVLGEWWNADVEEVEKQGNALGIPPNMSDAHTINGKPGP  204

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVE GKTYLLRIV+AA+N+ELFF +A H  TVVE+DA Y KPF T+ I
Sbjct  205   LFPCSEKHTFAMEVEKGKTYLLRIVNAALNDELFFALANHTFTVVEIDAVYTKPFSTEAI  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A   FMD  ++ DN+TAT    YKG        L T+
Sbjct  265   LIAPGQTTNVLVRANQVPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPQTLLPKLPTL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P +N T    T+   LRSLN+ K+PANVPL  D  LL  +G+GINPC TCLNG+R    +
Sbjct  325   PEQNDTNFALTYNSKLRSLNTPKYPANVPLNVDRHLLLTVGLGINPCPTCLNGTRFTASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+F MP TALLQAHY+NI GV+T DFP +P  PFN+TG P  ANL+T  GT+
Sbjct  385   NNITFSMPQTALLQAHYFNIKGVYTPDFPDKPPTPFNFTGAPLTANLRTNLGTR  438



>ref|XP_006466813.1| PREDICTED: laccase-11-like [Citrus sinensis]
Length=566

 Score =   517 bits (1332),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 302/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F V  KN +R+C +KPIV VNG+FPGP++Y RE D V+V V NH Q N+S
Sbjct  29    PAEAAIKKYQFDVQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVLVNVTNHAQYNMS  88

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  89    IHWHGLKQYRNGWADGPAYITQCPIKTGNSYTYDFNVTGQRGTLWWHAHIFWLRATVYGA  148

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK G P+PFP+P++EEVI+LGEWW +DVE V  Q  + G+ PN+SDAHTING PGP
Sbjct  149   IVIMPKPGSPFPFPQPNREEVILLGEWWHTDVEEVEKQGQKMGLPPNMSDAHTINGKPGP  208

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVESGKTYLLRI++AA+N+ELFF +AGHN TVVEVDA Y KPF T+ I
Sbjct  209   LFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNFTVVEVDAVYTKPFTTEAI  268

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PF D  +  DN+TATG L YKG        LA +
Sbjct  269   LIAPGQTTNVLVQANQKPGRYFMAARPFNDAPIPVDNKTATGILQYKGIPNSLLPTLAQL  328

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N +     + + LRSLNS KFPA+VP + D  L + IG G + C TC+NG+R +  +
Sbjct  329   PASNDSEFALNYNKKLRSLNSPKFPADVPQKVDRKLFYTIGFGKDSCPTCVNGTRLLATL  388

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNISFVMP TALLQAHY+N+ GVF  DFP +P  PFNYTG P  A+L T   T+
Sbjct  389   NNISFVMPQTALLQAHYFNLKGVFKADFPDKPPKPFNYTGAPLTASLGTSRATR  442



>ref|XP_004300985.1| PREDICTED: laccase-11-like [Fragaria vesca subsp. vesca]
Length=562

 Score =   516 bits (1330),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 241/414 (58%), Positives = 302/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P ++ V+ Y F +  KN +R+C SKPIV VNG FPGP++YARE DT++V V NH Q N+S
Sbjct  25    PAKAAVKSYQFNIQVKNVSRLCHSKPIVTVNGMFPGPTIYAREGDTLLVNVTNHAQYNMS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI TG T+ YN T+TGQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIMTGNTYTYNMTITGQRGTLWWHAHIFWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILPK+G  +PFP+P  E  ++LGEWW +DVE V+ Q  + G+ PN+SDAHTING PGP
Sbjct  145   IVILPKQGTGFPFPQPYSETNLILGEWWNNDVEEVVKQGNRLGLPPNMSDAHTINGKPGP  204

Query  642   TPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y +EVE GKTYLLRI++AA+N+ELFF +AGHNLTVVE+DA Y KPF +  I
Sbjct  205   LFPCSEKHTYAMEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAIYTKPFTSQAI  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q   +Y +A  PFMD  ++ DN+TAT  L YKG       VL+ +
Sbjct  265   LIAPGQTTNVLVQANQVPSRYFMAARPFMDAPLSIDNKTATAILQYKGIPNSVLPVLSQL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    ++   L+SLN+ K+PANVPL+ D  L + IG+GIN CSTCLNG++    +
Sbjct  325   PALNDTAFALSYNAKLKSLNTAKYPANVPLKVDRQLFYTIGLGINQCSTCLNGTQLTASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+FVMP   LLQAHY+N  GVFT DFP +P  PFNYTG P  ANL T+ GT+
Sbjct  385   NNITFVMPKIGLLQAHYFNTKGVFTTDFPDRPPTPFNYTGAPLTANLGTKLGTR  438



>ref|XP_007200216.1| hypothetical protein PRUPE_ppa015544mg [Prunus persica]
 gb|EMJ01415.1| hypothetical protein PRUPE_ppa015544mg [Prunus persica]
Length=563

 Score =   516 bits (1329),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 244/414 (59%), Positives = 304/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P ++ ++ Y F V  KN +R+C SKPIV VNG FPGP++YARE DT++V V NH + N+S
Sbjct  26    PAKAALKTYQFDVQVKNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLLVNVTNHAKYNMS  85

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ YN T+TGQRGTL WHAHI W RATV+GA
Sbjct  86    IHWHGLKQYRNGWADGPAYITQCPIKTGHSYTYNITITGQRGTLWWHAHIFWLRATVYGA  145

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILPK+G  +PF +P KE  IVLGEWW +DVE V+ Q  + G+ PN+SDAHTING PGP
Sbjct  146   IVILPKQGTGFPFLQPYKEANIVLGEWWNNDVEEVVKQGNKLGLPPNMSDAHTINGKPGP  205

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y LEVE GKTYLLRI++AA+N+ELFF +AGHNLTVVE+DA Y KPF +  +
Sbjct  206   LFPCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFISQAL  265

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PFMD  V+ DN+TATG L YKG       VL  +
Sbjct  266   LIAPGQTTNVLIQANQAPGRYFMASRPFMDAPVSIDNKTATGILQYKGIPNTVQPVLPQL  325

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T    +F   LRSLN+ +FPA+VPL+ D  L + IG+GIN C+TCLNG++    +
Sbjct  326   PALNDTAFALSFNAKLRSLNTAQFPASVPLKVDRHLFYTIGLGINQCTTCLNGTQLTASL  385

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+FVMP   LLQAHY+N  GVFT DFP +P  PFNYTG P  ANL T+ GT+
Sbjct  386   NNITFVMPQIGLLQAHYFNTKGVFTTDFPDRPPTPFNYTGAPLNANLGTKIGTR  439



>ref|XP_008452071.1| PREDICTED: laccase-11-like [Cucumis melo]
Length=563

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 241/413 (58%), Positives = 305/413 (74%), Gaps = 2/413 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE+ ++ Y F V  +N +R+C +KPIV VNGKFPGP++Y +E D V+V V NH Q N+SI
Sbjct  27    VEAAIKRYQFDVQVQNISRLCHAKPIVTVNGKFPGPTIYVQEGDRVLVNVTNHAQYNMSI  86

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG++Q R GW+DGPAYITQCPIQ G ++ Y+F +TGQRGTL WHAHI W RATV+GAI
Sbjct  87    HWHGLKQYRNGWADGPAYITQCPIQRGNSYTYDFNVTGQRGTLWWHAHILWLRATVYGAI  146

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK+G PYPFP+P+ E  I+LGEWW +DVEAV+NQ  + G+ PN+SDAHTING PGP 
Sbjct  147   VILPKQGTPYPFPQPNGEFEILLGEWWNNDVEAVVNQGSRMGVPPNMSDAHTINGKPGPL  206

Query  645   PNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
               CS K  + +EVE+GKTYLLRI++AA+N+ELFF +AGHN+TVVEVDA Y KPF T  I 
Sbjct  207   FPCSEKHTFAMEVEAGKTYLLRIINAALNDELFFAIAGHNMTVVEVDAVYTKPFTTQAIL  266

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
             I PGQTTN +L A+Q   +Y +A   FMD  +  DN+TATG L Y+G       +L  +P
Sbjct  267   IAPGQTTNVLLQANQAPNRYFMASRSFMDVPIPVDNKTATGILQYRGIPNTILPILPQLP  326

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
               N T    ++ + L+SLNS ++PANVPL+ D  L + IG+G N C TCLNG++ V  +N
Sbjct  327   ASNDTSFALSYNKKLKSLNSPQYPANVPLEVDRKLFYTIGLGQNDCPTCLNGTQLVASLN  386

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NISFVMP   LLQ+HY+NISGVF  DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  387   NISFVMPQIGLLQSHYFNISGVFRTDFPDRPPTPFNYTGAPLTANLRTAVGTR  439



>ref|XP_009772835.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 302/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F V   N +R+C +KPIV VNG+FPGP++YARE D V + V N  Q N+S
Sbjct  25    PAEAALKKYQFDVQVANVSRLCHAKPIVTVNGRFPGPTIYAREGDRVQINVTNFAQYNLS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPIQTG +++Y+F +TGQRGTL WHAHI W RATV+G 
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNITGQRGTLWWHAHILWLRATVYGP  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILP++G P+PFP+PD+EEV+VLGEWW +DVE V  Q    G+ PN+SDAHTING PGP
Sbjct  145   IVILPQQGTPFPFPQPDREEVLVLGEWWNADVEEVEKQGNALGIPPNMSDAHTINGKPGP  204

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVE GKTYLLRI++AA+N+ELFF +A H  TVVE+DA Y KPF T+ I
Sbjct  205   LFPCSEKHTFAMEVEKGKTYLLRIINAALNDELFFALANHTFTVVEIDAVYTKPFTTEAI  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A   FMD  ++ DN+TAT    YKG        L T+
Sbjct  265   LIAPGQTTNVLVRANQIPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPQTVLPKLPTL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P +N T    T+   L+SLN+ K+PANVPL  D  LLF IG+GINPC TCLNG+R    +
Sbjct  325   PEQNDTNFALTYNSKLKSLNTPKYPANVPLNVDRHLLFTIGLGINPCPTCLNGTRLTASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+F MP TALLQAHY+NI GV+T DFP +P  PFN+TG P  ANL+T  GT+
Sbjct  385   NNITFSMPQTALLQAHYFNIKGVYTPDFPDKPPTPFNFTGAPLTANLKTNLGTR  438



>emb|CDP09155.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   521 bits (1343),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 252/444 (57%), Positives = 323/444 (73%), Gaps = 24/444 (5%)
 Frame = +3

Query  18    RRVQRTRIMA-----SWVRGvvlvalaalICPEPVESVVRHYNFTVVSKNTTRMCSSKPI  182
             R  ++ R MA     SW+R + ++ L A + P  ++  +R Y F V++ NTTR+CS+KP 
Sbjct  171   RSTEKEREMAPSSSSSWLR-LRVLVLVACLLPSFIQCKIRIYKFNVMATNTTRLCSTKPA  229

Query  183   VVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIHWHGVRQLRTGWSDGPAYITQCPIQT  362
             V VNG FPGP+++A EDD ++V+VVN VQ N++IHWHG++QLR+GW+DGPA+ITQCPIQ 
Sbjct  230   VTVNGLFPGPTIFANEDDDLLVKVVNQVQYNLTIHWHGIKQLRSGWADGPAFITQCPIQP  289

Query  363   GQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIVILPKRGVPYPFPKPDKEEVIVL---  533
             GQT++YNFT+T QRGTL WHAHI W RATVHGA+VILPK G+PYPFP PD E VI+L   
Sbjct  290   GQTYVYNFTITDQRGTLWWHAHIGWLRATVHGALVILPKLGLPYPFPPPDSEVVIILDLA  349

Query  534   --------------GEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTPNCSSKG-Y  668
                              + SD+E +IN AM+ G+   VSDA+TING   P  NCSS+G +
Sbjct  350   ENKNLMDYLFYMVAAIVFYSDIETLINSAMKEGLPFQVSDAYTINGQSRPISNCSSEGGF  409

Query  669   TLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFIGPGQTTNA  848
             +  VE GK Y+LRI++AA+NEELFFK+AGH+LTVVEVDA+YVKPFKT TIFI PGQTTNA
Sbjct  410   SFPVEPGKKYMLRIINAALNEELFFKIAGHSLTVVEVDATYVKPFKTGTIFITPGQTTNA  469

Query  849   VLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPPRNATPVTS  1028
             +L AD   G YL+A SPFM   V  D   AT T+HY GTQ+  +T    +PPRNATP+ +
Sbjct  470   ILEADLGTGNYLMAASPFMAEPVPIDYTAATATVHYSGTQSSAATTFTDLPPRNATPLAT  529

Query  1029  TFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINNISFVMPTT  1208
              F++ L+SLNS+++PA VPL  DHSLLF +G+G NPC+TC+ GSR     NNISF+ P  
Sbjct  530   AFVDSLKSLNSQRYPARVPLTVDHSLLFTMGLGFNPCATCIRGSRIAAYFNNISFIRPAI  589

Query  1209  ALLQAHYYNISGVFTDDFPGQPAI  1280
             +LL AH++NISGVF DDFPG P I
Sbjct  590   SLLNAHFFNISGVFADDFPGNPPI  613



>emb|CDP02005.1| unnamed protein product [Coffea canephora]
Length=562

 Score =   515 bits (1326),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 240/414 (58%), Positives = 302/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F +  KN +R+C +KPIV VNG+FPGP++Y RE D V + V NH Q NVS
Sbjct  25    PAEAALKTYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTVYVREGDRVQINVTNHAQYNVS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPIQTG +++Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIQTGSSYVYDFNVTGQRGTLWWHAHILWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVILP++G P+PFPKP++EEVI+LGEWW +DVE ++N+A Q G  PN SDAHTING PGP
Sbjct  145   IVILPQQGTPFPFPKPEREEVILLGEWWHADVEKLVNKANQLGSPPNKSDAHTINGKPGP  204

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  + +EVE GKTYLLRI+++A+N+ELFF +AGH++TVVEVDA Y K F T  +
Sbjct  205   LFPCSEKHTFVMEVEQGKTYLLRIINSALNDELFFGIAGHSMTVVEVDAVYTKSFTTQAL  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A+Q  G+Y +A  PFMD  +  DN TATG L YKG        L  +
Sbjct  265   LIAPGQTTNVLVHANQIPGRYFMAARPFMDVQLPVDNNTATGILEYKGIPNTVLPTLPHL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N +     + + LRSLNS +FP NVPLQ D +L + IG+  N C  CLNG+R +  +
Sbjct  325   PKSNDSAFAFRYNKRLRSLNSPQFPTNVPLQVDRNLFYTIGLARNSCPACLNGTRLMASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNISF MP TALLQAHY+N+ GVF  DFP QP  PFNYTG P  ANL+T  GT+
Sbjct  385   NNISFTMPETALLQAHYFNVKGVFKTDFPDQPPKPFNYTGAPLTANLKTTIGTR  438



>ref|XP_006340638.1| PREDICTED: laccase-11-like [Solanum tuberosum]
Length=559

 Score =   514 bits (1324),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 239/418 (57%), Positives = 308/418 (74%), Gaps = 3/418 (1%)
 Frame = +3

Query  90    ICPEPVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQ  269
             IC  PVE+ ++ Y F V   N +R+C++K +V VNG FPGP++YARE D V + V N+VQ
Sbjct  19    IC-LPVEAALKKYQFDVKLSNVSRLCNAKQMVTVNGGFPGPTIYAREGDRVQINVTNYVQ  77

Query  270   ENVSIHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRAT  449
              N+SIHWHG++Q R GW+DGPAYITQCPIQTG +++Y+F +TGQRGTL WHAHI W RAT
Sbjct  78    YNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNVTGQRGTLWWHAHILWLRAT  137

Query  450   VHGAIVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTING  629
             V+GAIVI+P++G P+PFP+PD+EEV+VLGEWW +DVEAV  Q    G+ PN+SDAHTING
Sbjct  138   VYGAIVIMPQQGTPFPFPQPDREEVLVLGEWWNADVEAVEKQGNALGIPPNMSDAHTING  197

Query  630   HPGPTPNCSSK-GYTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFK  806
              PGP   CS K  + +EVE GKTYLLRI++AA+N+ELFF +A H  TVVE+DA Y KPF 
Sbjct  198   KPGPLFPCSEKYTFAMEVEKGKTYLLRIINAALNDELFFALANHTFTVVEIDAVYTKPFS  257

Query  807   TDTIFIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTV  986
             T+ I I PGQTTN ++ A+Q  G+Y +A   FMD  ++ DN+TAT    YKG        
Sbjct  258   TEAILIAPGQTTNVLVRANQVPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPETVLPK  317

Query  987   LATMPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRA  1166
               T+P +N +    ++   L+SLN+ K+PANVPL  D  LLF +G+GINPC TCLNG+R 
Sbjct  318   PPTLPAQNDSDFALSYNSKLKSLNTPKYPANVPLNVDRHLLFTVGLGINPCPTCLNGTRL  377

Query  1167  VGDINNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
                +NNISF+MP TALLQ+HY+NI GV+T DFP +P  PFN+TG P  ANL+T  GT+
Sbjct  378   TASLNNISFIMPQTALLQSHYFNIKGVYTPDFPDKPPTPFNFTGAPLTANLRTNVGTR  435



>ref|XP_003612035.1| Laccase-11 [Medicago truncatula]
 gb|AES94993.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=566

 Score =   514 bits (1324),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 238/415 (57%), Positives = 307/415 (74%), Gaps = 3/415 (1%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             PVE+ ++ Y F +  KN +R+C +KPIV VNG++PGP++YA E D V + V NHV+ N+S
Sbjct  28    PVEAAIKKYQFDIQMKNVSRLCHAKPIVTVNGRYPGPTIYATEGDRVQINVTNHVKYNIS  87

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPIQTG ++ Y+F +TGQRGTL WHAHI W RATV+GA
Sbjct  88    IHWHGLKQYRNGWADGPAYITQCPIQTGGSYTYDFNVTGQRGTLWWHAHILWLRATVYGA  147

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK G P+PFP+P +E  IVLGEWW  DVE ++NQ  Q G+ PN+SDAHTING PGP
Sbjct  148   IVIMPKPGTPFPFPQPAREFEIVLGEWWHKDVEEIVNQGNQMGLPPNMSDAHTINGKPGP  207

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y +EVE GKTYLLRI++AA+N+ELFF +AGHN+TVVEVDA Y KPF T +I
Sbjct  208   LFPCSEKHTYAMEVEKGKTYLLRIINAALNDELFFSLAGHNMTVVEVDAVYTKPFTTQSI  267

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGT-QALTSTVLAT  995
              IGPGQTTN ++ A++   +Y IA   FMD  ++ DN+TAT    YKG    +  +   T
Sbjct  268   LIGPGQTTNVLVKANKIPSRYFIATRTFMDAPLSVDNKTATAIFQYKGIPNTIIPSFPTT  327

Query  996   MPPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGD  1175
             +P  N T     + + +RSLNS K+PANVPL+ D +L + IG+G+N C TC+NG+R V  
Sbjct  328   LPNANDTNFALNYSKKIRSLNSAKYPANVPLKVDRNLFYTIGLGVNSCPTCINGTRLVAS  387

Query  1176  INNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             +NN++FVMP TALLQAH+++I GVF  DFP +P  PFNYTG P  ANL T+ GT+
Sbjct  388   LNNVTFVMPKTALLQAHHFDIKGVFRTDFPDKPLAPFNYTGAPLTANLGTKTGTR  442



>ref|XP_008357173.1| PREDICTED: laccase-11-like [Malus domestica]
Length=562

 Score =   512 bits (1319),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 241/414 (58%), Positives = 301/414 (73%), Gaps = 2/414 (0%)
 Frame = +3

Query  102   PVESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVS  281
             P E+ ++ Y F V   N +R+C SKPIV VNG FPGP++YARE DT++V V NH + N+S
Sbjct  25    PGEAALKTYQFDVKVTNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLVVNVTNHAKYNMS  84

Query  282   IHWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGA  461
             IHWHG++Q R GW+DGPAYITQCPI+TG ++ YN T+TGQRGTL WHAHI W RATV+GA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIKTGHSYTYNITITGQRGTLWWHAHIFWLRATVYGA  144

Query  462   IVILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGP  641
             IVI+PK+G  +PFP+P +E  IVLGEWW +DVE V+ Q  + G+ PN+SDAHTING PGP
Sbjct  145   IVIMPKQGEGFPFPQPYREANIVLGEWWNNDVEEVVKQGNKKGLPPNMSDAHTINGKPGP  204

Query  642   TPNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTI  818
                CS K  Y LEVE GKTYLLRI++AA+N+ELFF +AGHNLTVVE+DA Y KPF T  I
Sbjct  205   LFPCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTTQAI  264

Query  819   FIGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATM  998
              I PGQTTN ++ A Q  G+Y +A  PFMD  V+ DN+TAT  L YKG       VL  +
Sbjct  265   LIAPGQTTNVLVQATQAPGRYFMAARPFMDAPVSVDNKTATAILQYKGIPNSVQPVLPQL  324

Query  999   PPRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDI  1178
             P  N T     + + LRSLN+ +FPA+VPL+ D  L + IG+GINPC TCLNG++    +
Sbjct  325   PAPNNTAFALNYDDNLRSLNTAQFPAHVPLKVDRHLFYTIGLGINPCPTCLNGTQLTASL  384

Query  1179  NNISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NNI+FVMP   LLQAH++N  GVFT DFP +P   FN+TG P  ANL T+ GT+
Sbjct  385   NNITFVMPKIGLLQAHFFNTKGVFTTDFPDRPPTSFNFTGAPLTANLGTKQGTR  438



>gb|AES94995.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=561

 Score =   512 bits (1319),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 238/412 (58%), Positives = 297/412 (72%), Gaps = 2/412 (0%)
 Frame = +3

Query  108   ESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSIH  287
             E+ ++ Y F +  KN +R+C +KPIV VNG+FPGP++YARE D V V V NH Q N+SIH
Sbjct  26    EAAIKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGDQVFVNVTNHAQYNMSIH  85

Query  288   WHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAIV  467
             WHG++Q R GW+DGPAYITQCPIQTG ++ Y F +TGQRGTL WHAHI W RATV+GAIV
Sbjct  86    WHGLKQYRNGWADGPAYITQCPIQTGNSYTYEFNVTGQRGTLWWHAHIFWLRATVYGAIV  145

Query  468   ILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPTP  647
             I+PK G P+PFP+P +E  IVLGEWW +DVE +  Q  + G+ PN+SDAHTING PGP  
Sbjct  146   IMPKLGTPFPFPQPAREFEIVLGEWWNNDVEEIEKQGNKLGLPPNMSDAHTINGKPGPLF  205

Query  648   NCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIFI  824
              CS K  + +EVE GKTYL+RIV+AA+N+ELFF +AGHN+TVVEVDA Y KPF T  I I
Sbjct  206   PCSEKHTFAMEVEQGKTYLMRIVNAALNDELFFAIAGHNMTVVEVDAVYTKPFTTQAILI  265

Query  825   GPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMPP  1004
              PGQTTN ++ A+Q  G+Y +A   FMD  +  DN+TAT  L YK        +L  +P 
Sbjct  266   APGQTTNVLVHANQVAGRYFVATKAFMDAPIQVDNKTATAILQYKDIPNTVQPILPQLPA  325

Query  1005  RNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDINN  1184
              N T    ++ + LRSLNS K+PANVPL+ D +L + IG+G N C TCLNG+R +  INN
Sbjct  326   SNDTGFALSYNKKLRSLNSAKYPANVPLKVDRNLFYTIGLGKNSCPTCLNGTRFLASINN  385

Query  1185  ISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             +SFVMP  ALLQAHY+NI GVF  DFP +P  PFNYTG P  ANL +   T+
Sbjct  386   VSFVMPQIALLQAHYFNIKGVFRADFPDRPPTPFNYTGAPLTANLASLTDTR  437



>ref|XP_004160985.1| PREDICTED: laccase-11-like [Cucumis sativus]
Length=563

 Score =   512 bits (1319),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 239/413 (58%), Positives = 303/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE+ ++ Y F V  +N +R+C +KPIV VNGKFPGP++Y +E D V+V V NH Q N+SI
Sbjct  27    VEAAIKRYQFDVQVQNISRLCHAKPIVTVNGKFPGPTIYVQEGDRVLVNVTNHAQYNMSI  86

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG++Q R GW+DGPAYITQCPIQ G ++ Y+F +TGQRGTL WHAHI W RATV+GAI
Sbjct  87    HWHGLKQYRNGWADGPAYITQCPIQRGNSYTYDFNVTGQRGTLWWHAHILWLRATVYGAI  146

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK+G PYPFP+P+ E  I+LGEWW +DVEAV+NQ  + G+ PN+SDAHTING PGP 
Sbjct  147   VILPKQGTPYPFPQPNGEFEILLGEWWNNDVEAVVNQGSRMGLPPNMSDAHTINGKPGPL  206

Query  645   PNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
               CS K  + +EVE+GKTYLLRI++AA+N+ELFF +AGH++TVVEVDA Y KPF T  I 
Sbjct  207   FPCSEKHTFAMEVEAGKTYLLRIINAALNDELFFAIAGHSMTVVEVDAVYTKPFTTQAIL  266

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
             I PGQTTN +L A+Q   +Y +A   FMD  +  DN+TATG L Y+G        L  +P
Sbjct  267   IAPGQTTNVLLQANQAPNRYFMASRSFMDVPIPVDNKTATGILQYRGIPNTVLPALPQLP  326

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
               N T    ++ + L+SLNS ++PANVPL+ D  L + IG+G N C TCLNG++ V  +N
Sbjct  327   ASNDTSFALSYNKKLKSLNSPQYPANVPLKVDRKLFYTIGLGQNECPTCLNGTQLVASLN  386

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NISFVMP   LLQ+HY+NI GVF  DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  387   NISFVMPQIGLLQSHYFNIGGVFRTDFPDRPPTPFNYTGAPLTANLRTAVGTR  439



>ref|XP_004146556.1| PREDICTED: laccase-11-like [Cucumis sativus]
 gb|KGN53314.1| hypothetical protein Csa_4G046770 [Cucumis sativus]
Length=563

 Score =   512 bits (1319),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 239/413 (58%), Positives = 303/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  105   VESVVRHYNFTVVSKNTTRMCSSKPIVVVNGKFPGPSLYAREDDTVIVRVVNHVQENVSI  284
             VE+ ++ Y F V  +N +R+C +KPIV VNGKFPGP++Y +E D V+V V NH Q N+SI
Sbjct  27    VEAAIKRYQFDVQVQNISRLCHAKPIVTVNGKFPGPTIYVQEGDRVLVNVTNHAQYNMSI  86

Query  285   HWHGVRQLRTGWSDGPAYITQCPIQTGQTFIYNFTLTGQRGTLLWHAHINWQRATVHGAI  464
             HWHG++Q R GW+DGPAYITQCPIQ G ++ Y+F +TGQRGTL WHAHI W RATV+GAI
Sbjct  87    HWHGLKQYRNGWADGPAYITQCPIQRGNSYTYDFNVTGQRGTLWWHAHILWLRATVYGAI  146

Query  465   VILPKRGVPYPFPKPDKEEVIVLGEWWKSDVEAVINQAMQSGMAPNVSDAHTINGHPGPT  644
             VILPK+G PYPFP+P+ E  I+LGEWW +DVEAV+NQ  + G+ PN+SDAHTING PGP 
Sbjct  147   VILPKQGTPYPFPQPNGEFEILLGEWWNNDVEAVVNQGSRMGLPPNMSDAHTINGKPGPL  206

Query  645   PNCSSKG-YTLEVESGKTYLLRIVSAAVNEELFFKVAGHNLTVVEVDASYVKPFKTDTIF  821
               CS K  + +EVE+GKTYLLRI++AA+N+ELFF +AGH++TVVEVDA Y KPF T  I 
Sbjct  207   FPCSEKHTFAMEVEAGKTYLLRIINAALNDELFFAIAGHSMTVVEVDAVYTKPFTTQAIL  266

Query  822   IGPGQTTNAVLTADQNGGKYLIAVSPFMDTIVATDNQTATGTLHYKGTQALTSTVLATMP  1001
             I PGQTTN +L A+Q   +Y +A   FMD  +  DN+TATG L Y+G        L  +P
Sbjct  267   IAPGQTTNVLLQANQAPNRYFMASRSFMDVPIPVDNKTATGILQYRGIPNTVLPTLPQLP  326

Query  1002  PRNATPVTSTFMEGLRSLNSKKFPANVPLQTDHSLLFAIGIGINPCSTCLNGSRAVGDIN  1181
               N T    ++ + L+SLNS ++PANVPL+ D  L + IG+G N C TCLNG++ V  +N
Sbjct  327   ASNDTSFALSYNKKLKSLNSPQYPANVPLKVDRKLFYTIGLGQNECPTCLNGTQLVASLN  386

Query  1182  NISFVMPTTALLQAHYYNISGVFTDDFPGQPAIPFNYTGTP-PANLQTQNGTK  1337
             NISFVMP   LLQ+HY+NI GVF  DFP +P  PFNYTG P  ANL+T  GT+
Sbjct  387   NISFVMPQIGLLQSHYFNIGGVFRTDFPDRPPTPFNYTGAPLTANLRTAVGTR  439



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3594897880140