BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c35114_g1_i1 len=1625 path=[1603:0-1624]

Length=1625
                                                                      Score     E

emb|CDO99097.1|  unnamed protein product                                518   2e-176   
ref|XP_009622388.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    508   2e-173   
ref|XP_009773829.1|  PREDICTED: leucine-rich repeat extensin-like...    507   4e-173   
ref|XP_006360809.1|  PREDICTED: leucine-rich repeat extensin-like...    500   9e-171   
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...    492   1e-167   
ref|XP_004247590.1|  PREDICTED: leucine-rich repeat extensin-like...    490   1e-166   
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...    486   5e-165   
ref|XP_004134434.1|  PREDICTED: leucine-rich repeat extensin-like...    476   2e-161   
ref|XP_002279192.1|  PREDICTED: leucine-rich repeat extensin-like...    476   5e-161   Vitis vinifera
gb|KGN56949.1|  hypothetical protein Csa_3G146350                       475   7e-161   
ref|XP_006420005.1|  hypothetical protein CICLE_v10004988mg             476   3e-160   
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...    473   4e-160   
ref|XP_006489442.1|  PREDICTED: leucine-rich repeat extensin-like...    474   4e-160   
gb|KDP40221.1|  hypothetical protein JCGZ_02219                         474   9e-160   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...    471   1e-158   
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                   470   1e-158   
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g             465   4e-157   Populus trichocarpa [western balsam poplar]
ref|XP_010938335.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    465   7e-157   
ref|XP_007143301.1|  hypothetical protein PHAVU_007G060800g             466   7e-157   
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg             466   2e-156   
ref|XP_002517082.1|  serine-threonine protein kinase, plant-type,...    462   4e-156   Ricinus communis
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...    461   2e-155   
ref|XP_003556064.1|  PREDICTED: leucine-rich repeat extensin-like...    461   5e-155   
ref|XP_008798454.1|  PREDICTED: leucine-rich repeat extensin-like...    460   6e-155   
ref|XP_010092426.1|  Leucine-rich repeat extensin-like protein 6        461   1e-154   
ref|XP_011091034.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    458   2e-154   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...    455   1e-152   
ref|XP_009408506.1|  PREDICTED: leucine-rich repeat extensin-like...    454   3e-152   
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...    451   6e-151   
ref|XP_008224262.1|  PREDICTED: leucine-rich repeat extensin-like...    449   8e-151   
ref|XP_009389012.1|  PREDICTED: leucine-rich repeat extensin-like...    448   2e-150   
ref|XP_011030645.1|  PREDICTED: leucine-rich repeat extensin-like...    447   7e-150   
gb|EYU41449.1|  hypothetical protein MIMGU_mgv1a007525mg                447   2e-149   
ref|XP_010024229.1|  PREDICTED: leucine-rich repeat extensin-like...    446   3e-149   
ref|XP_010694037.1|  PREDICTED: leucine-rich repeat extensin-like...    446   6e-149   
ref|XP_010488313.1|  PREDICTED: leucine-rich repeat extensin-like...    446   2e-148   
gb|KEH43816.1|  LRR/extensin 2                                          443   3e-148   
gb|ACU18125.1|  unknown                                                 443   5e-148   Glycine max [soybeans]
ref|XP_002517083.1|  serine-threonine protein kinase, plant-type,...    442   6e-148   Ricinus communis
gb|KCW60691.1|  hypothetical protein EUGRSUZ_H03422                     439   2e-147   
ref|XP_010466571.1|  PREDICTED: leucine-rich repeat extensin-like...    446   3e-147   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                         440   3e-147   
ref|XP_002314670.2|  hypothetical protein POPTR_0010s09320g             439   4e-147   Populus trichocarpa [western balsam poplar]
ref|XP_009371969.1|  PREDICTED: leucine-rich repeat extensin-like...    439   9e-147   
ref|XP_010511710.1|  PREDICTED: leucine-rich repeat extensin-like...    439   4e-146   
ref|XP_009413897.1|  PREDICTED: leucine-rich repeat extensin-like...    436   9e-146   
ref|XP_008391000.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    437   1e-145   
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610          439   3e-145   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg            434   1e-144   
ref|NP_188919.1|  leucine-rich repeat extensin-like protein 6           437   2e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885524.1|  hypothetical protein ARALYDRAFT_898761             432   2e-143   
ref|XP_009110797.1|  PREDICTED: leucine-rich repeat extensin-like...    431   7e-143   
emb|CDX93014.1|  BnaA03g37360D                                          432   9e-143   
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg            432   2e-142   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                         439   3e-142   
emb|CDY10673.1|  BnaA05g16890D                                          431   5e-142   
ref|XP_009145262.1|  PREDICTED: leucine-rich repeat extensin-like...    431   5e-142   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g             431   8e-142   
ref|XP_007013226.1|  Leucine-rich repeat family protein                 438   1e-141   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g             431   2e-141   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    440   2e-141   
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...    428   2e-141   
ref|XP_006299744.1|  hypothetical protein CARUB_v10015937mg             428   2e-141   
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g             431   5e-141   
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             433   6e-141   
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4           428   6e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...    435   9e-141   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051             430   1e-140   
emb|CDX94809.1|  BnaC03g43790D                                          429   1e-140   
ref|XP_002885650.1|  predicted protein                                  427   2e-140   
ref|XP_006406127.1|  hypothetical protein EUTSA_v10022219mg             425   2e-140   
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...    435   3e-140   
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    434   3e-140   
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...    425   3e-140   
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...    434   3e-140   
ref|XP_010695983.1|  PREDICTED: leucine-rich repeat extensin-like...    422   3e-140   
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...    434   5e-140   
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...    434   6e-140   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    427   7e-140   
emb|CDX83065.1|  BnaA01g20650D                                          426   8e-140   
ref|XP_010532845.1|  PREDICTED: leucine-rich repeat extensin-like...    431   8e-140   
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg            424   8e-140   
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...    427   1e-139   
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    431   1e-139   
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3           434   2e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...    428   3e-139   
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...    431   3e-139   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...    426   3e-139   
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg             432   5e-139   
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg                419   9e-139   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...    427   1e-138   
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...    431   1e-138   
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...    431   2e-138   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...    430   5e-138   Vitis vinifera
ref|XP_002862780.1|  hypothetical protein ARALYDRAFT_920276             416   6e-138   
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...    426   1e-137   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                    431   1e-137   
ref|XP_009132101.1|  PREDICTED: leucine-rich repeat extensin-like...    429   1e-137   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...    426   1e-137   
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...    421   2e-137   
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...    421   2e-137   
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...    427   2e-137   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...    428   2e-137   
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...    425   2e-137   
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...    426   5e-137   
ref|XP_010559035.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    414   6e-137   
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...    420   6e-137   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...    423   7e-137   
ref|XP_002867981.1|  hypothetical protein ARALYDRAFT_492992             426   1e-136   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    423   2e-136   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                       426   2e-136   
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...    424   3e-136   
ref|XP_007013716.1|  Leucine-rich repeat family protein                 421   3e-136   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...    423   4e-136   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg             416   4e-136   
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...    416   4e-136   
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...    429   5e-136   
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                    424   6e-136   
ref|XP_010925096.1|  PREDICTED: leucine-rich repeat extensin-like...    414   6e-136   
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...    426   1e-135   
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                   415   1e-135   
ref|NP_193602.4|  leucine-rich repeat extensin-like protein 5           426   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296668.1|  PREDICTED: leucine-rich repeat extensin-like...    410   2e-135   
emb|CAB37452.1|  extensin-like protein                                  425   3e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...    414   4e-135   
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...    421   6e-135   
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...    425   7e-135   
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...    421   2e-134   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4        421   2e-134   
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg             420   2e-134   
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g           409   3e-134   
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...    421   3e-134   
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                416   4e-134   
gb|EPS61338.1|  hypothetical protein M569_13456                         406   7e-134   
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...    415   8e-134   
gb|EAY91133.1|  hypothetical protein OsI_12740                          406   9e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...    418   9e-134   
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...    408   2e-133   
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...    417   3e-133   
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...    408   3e-133   
ref|NP_001050725.1|  Os03g0637600                                       405   3e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...    408   4e-133   
ref|XP_010688564.1|  PREDICTED: leucine-rich repeat extensin-like...    412   7e-133   
gb|KDP27758.1|  hypothetical protein JCGZ_19787                         415   1e-132   
gb|EPS67208.1|  hypothetical protein M569_07569                         400   3e-132   
ref|XP_010525315.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    403   3e-132   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...    410   7e-132   
ref|XP_010050506.1|  PREDICTED: leucine-rich repeat extensin-like...    401   2e-131   
gb|KHN21547.1|  Leucine-rich repeat extensin-like protein 5             407   2e-131   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g             404   3e-131   Populus trichocarpa [western balsam poplar]
ref|XP_010655031.1|  PREDICTED: leucine-rich repeat extensin-like...    411   4e-131   
emb|CDY10310.1|  BnaC05g29690D                                          403   4e-131   
ref|XP_011019927.1|  PREDICTED: leucine-rich repeat extensin-like...    412   6e-131   
ref|XP_008357497.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    405   7e-131   
ref|XP_003524389.2|  PREDICTED: leucine-rich repeat extensin-like...    406   8e-131   
ref|XP_008337109.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    402   8e-131   
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...    404   2e-130   
ref|XP_008378297.1|  PREDICTED: leucine-rich repeat extensin-like...    404   2e-130   
ref|XP_006372265.1|  hypothetical protein POPTR_0018s14790g             400   3e-130   
emb|CBI26296.3|  unnamed protein product                                398   5e-130   
gb|EPS58069.1|  hypothetical protein M569_16746                         394   7e-130   
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...    401   7e-130   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...    409   7e-130   
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             407   7e-130   
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...    407   7e-130   
gb|EPS66877.1|  hypothetical protein M569_07899                         395   9e-130   
ref|XP_006351117.1|  PREDICTED: leucine-rich repeat extensin-like...    407   1e-129   
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...    408   1e-129   
ref|XP_008365636.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    399   2e-129   
ref|XP_009377376.1|  PREDICTED: leucine-rich repeat extensin-like...    405   2e-129   
ref|XP_002324259.1|  hypothetical protein POPTR_0018s01010g             399   3e-129   Populus trichocarpa [western balsam poplar]
ref|XP_009348443.1|  PREDICTED: leucine-rich repeat extensin-like...    407   3e-129   
ref|XP_007014601.1|  Leucine-rich repeat/extensin 2                     406   4e-129   
ref|XP_003630813.1|  Extensin-like protein                              405   5e-129   
ref|XP_008342893.1|  PREDICTED: leucine-rich repeat extensin-like...    395   7e-129   
ref|XP_004148723.1|  PREDICTED: leucine-rich repeat extensin-like...    405   1e-128   
ref|XP_002514492.1|  LRX2, putative                                     405   1e-128   Ricinus communis
gb|KGN65364.1|  hypothetical protein Csa_1G383520                       406   1e-128   
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...    394   1e-128   
ref|XP_004170319.1|  PREDICTED: leucine-rich repeat extensin-like...    406   2e-128   
ref|XP_009336235.1|  PREDICTED: leucine-rich repeat extensin-like...    394   2e-128   
ref|XP_007160348.1|  hypothetical protein PHAVU_002G314200g             404   2e-128   
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...    392   4e-128   
emb|CDP14269.1|  unnamed protein product                                403   5e-128   
ref|XP_004249854.1|  PREDICTED: leucine-rich repeat extensin-like...    401   6e-128   
ref|XP_006651620.1|  PREDICTED: leucine-rich repeat extensin-like...    391   6e-128   
ref|XP_011081863.1|  PREDICTED: leucine-rich repeat extensin-like...    395   1e-127   
gb|KEH30699.1|  LRR/extensin                                            392   1e-127   
gb|KEH27082.1|  LRR extensin-like protein                               405   1e-127   
ref|XP_003620502.1|  Extensin-like protein                              405   2e-127   
ref|XP_003566833.2|  PREDICTED: leucine-rich repeat extensin-like...    395   2e-127   
emb|CDP03355.1|  unnamed protein product                                402   3e-127   
ref|XP_010107567.1|  Leucine-rich repeat extensin-like protein 2        402   4e-127   
ref|XP_010040127.1|  PREDICTED: leucine-rich repeat extensin-like...    391   4e-127   
ref|XP_008665106.1|  PREDICTED: leucine-rich repeat extensin-like...    389   4e-127   
ref|XP_010520859.1|  PREDICTED: leucine-rich repeat extensin-like...    391   5e-127   
emb|CDP14813.1|  unnamed protein product                                389   7e-127   
ref|XP_002464196.1|  hypothetical protein SORBIDRAFT_01g013940          388   1e-126   Sorghum bicolor [broomcorn]
ref|XP_002872172.1|  leucine-rich repeat family protein                 389   3e-126   
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg             389   5e-126   
ref|NP_001130107.1|  uncharacterized protein LOC100191200 precursor     386   6e-126   Zea mays [maize]
ref|XP_006453735.1|  hypothetical protein CICLE_v10010678mg             396   7e-126   
ref|XP_010035772.1|  PREDICTED: leucine-rich repeat extensin-like...    387   8e-126   
ref|XP_010091486.1|  hypothetical protein L484_010328                   386   9e-126   
ref|XP_006473926.1|  PREDICTED: leucine-rich repeat extensin-like...    396   9e-126   
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein          391   1e-125   
ref|XP_006842252.1|  hypothetical protein AMTR_s00078p00197410          400   1e-125   
ref|XP_002463746.1|  hypothetical protein SORBIDRAFT_01g005300          385   1e-125   Sorghum bicolor [broomcorn]
ref|XP_010493816.1|  PREDICTED: leucine-rich repeat extensin-like...    387   1e-125   
ref|XP_010454895.1|  PREDICTED: leucine-rich repeat extensin-like...    387   2e-125   
ref|XP_004292960.1|  PREDICTED: leucine-rich repeat extensin-like...    390   2e-125   
ref|XP_010424321.1|  PREDICTED: leucine-rich repeat extensin-like...    386   2e-125   
ref|XP_010252148.1|  PREDICTED: leucine-rich repeat extensin-like...    397   3e-125   
ref|XP_010228296.1|  PREDICTED: leucine-rich repeat extensin-like...    384   3e-125   
ref|NP_197937.1|  leucine-rich repeat extensin-like protein 7           385   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225572.1|  hypothetical protein PRUPE_ppa019759m1g            388   6e-125   
ref|XP_004982365.1|  PREDICTED: leucine-rich repeat extensin-like...    384   6e-125   
gb|KFK39565.1|  hypothetical protein AALP_AA3G260700                    382   7e-125   
emb|CDX88190.1|  BnaA06g27810D                                          384   7e-125   
dbj|BAJ86997.1|  predicted protein                                      383   7e-125   
ref|XP_007043626.1|  Leucine-rich repeat family protein                 384   1e-124   
ref|XP_004981448.1|  PREDICTED: leucine-rich repeat extensin-like...    383   1e-124   
ref|XP_011026539.1|  PREDICTED: leucine-rich repeat extensin-like...    387   1e-124   
ref|XP_011018198.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    389   2e-124   
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg             384   2e-124   
ref|XP_009151086.1|  PREDICTED: leucine-rich repeat extensin-like...    383   2e-124   
ref|NP_001051547.1|  Os03g0795300                                       382   3e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002516600.1|  serine-threonine protein kinase, plant-type,...    386   3e-124   Ricinus communis
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...    393   3e-124   
gb|EAY92168.1|  hypothetical protein OsI_13881                          382   4e-124   Oryza sativa Indica Group [Indian rice]
dbj|BAF48663.1|  leucine-rich repeat/extensin                           392   5e-124   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_003526272.1|  PREDICTED: leucine-rich repeat extensin-like...    382   6e-124   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...    392   6e-124   
gb|KHN01115.1|  Pollen-specific leucine-rich repeat extensin-like...    382   7e-124   
ref|XP_003557501.1|  PREDICTED: leucine-rich repeat extensin-like...    381   8e-124   
gb|KFK27830.1|  hypothetical protein AALP_AA8G435400                    382   2e-123   
gb|EMT04692.1|  hypothetical protein F775_21578                         379   3e-123   
ref|XP_003540926.1|  PREDICTED: leucine-rich repeat extensin-like...    380   3e-123   
ref|XP_004955608.1|  PREDICTED: leucine-rich repeat extensin-like...    381   3e-123   
ref|XP_009758506.1|  PREDICTED: leucine-rich repeat extensin-like...    390   3e-123   
gb|EMS66895.1|  Leucine-rich repeat extensin-like protein 6             379   3e-123   
ref|XP_011026538.1|  PREDICTED: leucine-rich repeat extensin-like...    387   4e-123   
tpg|DAA51888.1|  TPA: leucine-rich repeat (LRR) family protein          379   7e-123   
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...    389   1e-122   
dbj|BAF48665.1|  leucine-rich repeat/extensin 1                         389   1e-122   Nicotiana tabacum [American tobacco]
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...    389   2e-122   
ref|XP_009415697.1|  PREDICTED: leucine-rich repeat extensin-like...    385   2e-122   
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...    386   2e-122   
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...    388   2e-122   
ref|XP_003562088.1|  PREDICTED: leucine-rich repeat extensin-like...    376   5e-122   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                   376   7e-122   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...    387   8e-122   
emb|CDX80525.1|  BnaC07g29190D                                          376   1e-121   
ref|NP_001152233.1|  systemin receptor SR160 precursor                  375   1e-121   Zea mays [maize]
ref|XP_008455274.1|  PREDICTED: leucine-rich repeat extensin-like...    376   1e-121   
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...    386   1e-121   
emb|CDY19550.1|  BnaC09g13530D                                          387   1e-121   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...    387   1e-121   
emb|CDY12948.1|  BnaA09g13260D                                          385   1e-121   
ref|XP_009385615.1|  PREDICTED: leucine-rich repeat extensin-like...    382   2e-121   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099             385   2e-121   
ref|XP_007198810.1|  hypothetical protein PRUPE_ppa026805mg             375   2e-121   
ref|XP_009613983.1|  PREDICTED: leucine-rich repeat extensin-like...    379   3e-121   
dbj|BAJ98253.1|  predicted protein                                      374   3e-121   
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg             374   7e-121   
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...    374   9e-121   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...    385   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137033.1|  PREDICTED: leucine-rich repeat extensin-like...    372   2e-120   
ref|XP_006654107.1|  PREDICTED: leucine-rich repeat extensin-like...    371   2e-120   
ref|XP_004170132.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    372   3e-120   
ref|XP_009798822.1|  PREDICTED: leucine-rich repeat extensin-like...    377   3e-120   
ref|XP_004505561.1|  PREDICTED: leucine-rich repeat extensin-like...    372   3e-120   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1           383   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2           385   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg             384   4e-120   
dbj|BAJ85515.1|  predicted protein                                      372   5e-120   
ref|XP_006849391.1|  hypothetical protein AMTR_s00160p00027170          371   6e-120   
ref|XP_002455880.1|  hypothetical protein SORBIDRAFT_03g026730          378   7e-120   Sorghum bicolor [broomcorn]
ref|XP_008224557.1|  PREDICTED: leucine-rich repeat extensin-like...    382   1e-119   
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...    384   1e-119   
emb|CDY15964.1|  BnaC08g41590D                                          377   1e-119   
gb|EMT22007.1|  hypothetical protein F775_31106                         369   2e-119   
ref|XP_010664614.1|  PREDICTED: pollen-specific leucine-rich repe...    374   2e-119   
ref|XP_004297998.1|  PREDICTED: uncharacterized protein LOC101315333    381   2e-119   
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...    384   2e-119   
ref|XP_002310403.2|  hypothetical protein POPTR_0007s01000g             367   6e-119   
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg             379   7e-119   
dbj|BAO45886.1|  leucine-rich repeat extensin-like protein              369   1e-118   
ref|XP_009118117.1|  PREDICTED: leucine-rich repeat extensin-like...    374   1e-118   
ref|XP_006582471.1|  PREDICTED: pollen-specific leucine-rich repe...    371   1e-118   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...    379   2e-118   
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g             370   2e-118   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...    377   2e-118   
ref|XP_003523588.1|  PREDICTED: pollen-specific leucine-rich repe...    372   2e-118   
ref|NP_001150408.1|  receptor-like protein kinase precursor             367   2e-118   
gb|ACL53978.1|  unknown                                                 367   3e-118   
ref|XP_010656991.1|  PREDICTED: leucine-rich repeat extensin-like...    367   3e-118   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg             367   3e-118   
ref|XP_006417273.1|  hypothetical protein EUTSA_v10006975mg             376   4e-118   
ref|XP_010260256.1|  PREDICTED: leucine-rich repeat extensin-like...    366   5e-118   
emb|CDY31235.1|  BnaC08g15300D                                          377   6e-118   
ref|XP_010669462.1|  PREDICTED: leucine-rich repeat extensin-like...    379   1e-117   
emb|CDY26536.1|  BnaA09g47410D                                          374   2e-117   
gb|EAZ02952.1|  hypothetical protein OsI_25092                          363   3e-117   
ref|XP_004242113.1|  PREDICTED: leucine-rich repeat extensin-like...    367   7e-117   
emb|CDY21028.1|  BnaA08g24970D                                          375   7e-117   
ref|XP_010447991.1|  PREDICTED: pollen-specific leucine-rich repe...    363   9e-117   
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...    370   1e-116   
ref|XP_010438472.1|  PREDICTED: pollen-specific leucine-rich repe...    363   1e-116   
ref|XP_010689048.1|  PREDICTED: leucine-rich repeat extensin-like...    363   1e-116   
ref|XP_008380620.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    375   1e-116   
ref|XP_006361150.1|  PREDICTED: leucine-rich repeat extensin-like...    366   1e-116   
ref|XP_008371522.1|  PREDICTED: pollen-specific leucine-rich repe...    365   2e-116   
ref|XP_009376329.1|  PREDICTED: leucine-rich repeat extensin-like...    375   3e-116   
emb|CDY72552.1|  BnaCnng78240D                                          361   3e-116   
emb|CDY18974.1|  BnaC01g20940D                                          361   3e-116   
ref|XP_006367488.1|  PREDICTED: leucine-rich repeat extensin-like...    360   4e-116   
ref|XP_003629650.1|  Receptor-like protein kinase                       370   5e-116   
emb|CDY49661.1|  BnaC09g41390D                                          361   6e-116   
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein              360   6e-116   
ref|XP_010433232.1|  PREDICTED: pollen-specific leucine-rich repe...    360   7e-116   
ref|XP_004243365.1|  PREDICTED: leucine-rich repeat extensin-like...    359   9e-116   
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...    360   1e-115   
ref|NP_001147644.1|  receptor protein kinase CLAVATA1 precursor         358   3e-115   
ref|XP_003602966.1|  Serine/threonine protein kinase BRI1-like pr...    368   4e-115   
ref|XP_009110677.1|  PREDICTED: leucine-rich repeat extensin-like...    370   5e-115   
ref|XP_007214112.1|  hypothetical protein PRUPE_ppa017121mg             370   5e-115   
gb|KHN22289.1|  Pollen-specific leucine-rich repeat extensin-like...    370   6e-115   
gb|KHN04530.1|  Pollen-specific leucine-rich repeat extensin-like...    370   7e-115   
ref|XP_004501605.1|  PREDICTED: pollen-specific leucine-rich repe...    373   7e-115   
ref|XP_002972291.1|  hypothetical protein SELMODRAFT_412903             358   7e-115   
ref|XP_011100435.1|  PREDICTED: leucine-rich repeat extensin-like...    358   8e-115   
ref|XP_007132678.1|  hypothetical protein PHAVU_011G115300g             358   8e-115   
ref|XP_002984203.1|  hypothetical protein SELMODRAFT_423462             358   8e-115   
ref|XP_003565428.1|  PREDICTED: leucine-rich repeat extensin-like...    363   1e-114   
ref|XP_009405471.1|  PREDICTED: pollen-specific leucine-rich repe...    361   1e-114   
ref|XP_009801066.1|  PREDICTED: pollen-specific leucine-rich repe...    361   1e-114   
ref|XP_002517887.1|  serine-threonine protein kinase, plant-type,...    358   2e-114   
gb|EPS72402.1|  hypothetical protein M569_02357                         357   2e-114   
gb|KDP24107.1|  hypothetical protein JCGZ_25764                         357   2e-114   
ref|XP_002461531.1|  hypothetical protein SORBIDRAFT_02g004260          356   2e-114   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg                358   3e-114   
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                    367   7e-114   
ref|XP_008225416.1|  PREDICTED: pollen-specific leucine-rich repe...    367   7e-114   
ref|XP_007136648.1|  hypothetical protein PHAVU_009G062000g             363   8e-114   
ref|NP_001054807.1|  Os05g0180300                                       356   8e-114   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...    361   1e-113   
ref|XP_002889910.1|  hypothetical protein ARALYDRAFT_312231             361   1e-113   
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...    362   1e-113   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg             354   1e-113   
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg                355   2e-113   
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g            359   2e-113   
gb|KDP43798.1|  hypothetical protein JCGZ_23006                         367   4e-113   
ref|XP_009419628.1|  PREDICTED: pollen-specific leucine-rich repe...    362   6e-113   
gb|EMS46551.1|  Leucine-rich repeat extensin-like protein 3             356   6e-113   
ref|XP_009626397.1|  PREDICTED: leucine-rich repeat extensin-like...    352   8e-113   
ref|XP_009781630.1|  PREDICTED: leucine-rich repeat extensin-like...    352   1e-112   
gb|KFK29358.1|  hypothetical protein AALP_AA7G123800                    352   1e-112   
gb|ACF82634.1|  unknown                                                 350   2e-112   
dbj|BAJ98482.1|  predicted protein                                      352   2e-112   
ref|XP_002867451.1|  leucine-rich repeat family protein                 351   2e-112   
ref|XP_010064140.1|  PREDICTED: pollen-specific leucine-rich repe...    357   3e-112   
emb|CDM81891.1|  unnamed protein product                                357   4e-112   
ref|NP_001131493.1|  leucine-rich repeat (LRR) family protein pre...    352   4e-112   
ref|XP_002440709.1|  hypothetical protein SORBIDRAFT_09g005520          351   5e-112   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...    361   5e-112   
ref|XP_004303132.1|  PREDICTED: pollen-specific leucine-rich repe...    351   5e-112   
ref|XP_009781465.1|  PREDICTED: leucine-rich repeat extensin-like...    350   7e-112   
ref|XP_010104364.1|  Pollen-specific leucine-rich repeat extensin...    366   7e-112   
gb|EEC76325.1|  hypothetical protein OsI_13883                          348   1e-111   
ref|NP_001043463.1|  Os01g0594300                                       354   2e-111   
ref|XP_010647882.1|  PREDICTED: pollen-specific leucine-rich repe...    359   2e-111   
ref|XP_006300262.1|  hypothetical protein CARUB_v100151920mg            357   2e-111   
ref|XP_009108764.1|  PREDICTED: pollen-specific leucine-rich repe...    358   3e-111   
dbj|BAB91812.1|  extensin precursor-like                                354   4e-111   
ref|XP_009390486.1|  PREDICTED: leucine-rich repeat extensin-like...    356   4e-111   
emb|CBI32495.3|  unnamed protein product                                360   5e-111   
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...    360   5e-111   
ref|XP_008366033.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    363   6e-111   
ref|XP_003568808.1|  PREDICTED: leucine-rich repeat extensin-like...    348   8e-111   
ref|XP_004960846.1|  PREDICTED: leucine-rich repeat extensin-like...    348   9e-111   
dbj|BAJ89804.1|  predicted protein                                      358   1e-110   
ref|XP_010437693.1|  PREDICTED: pollen-specific leucine-rich repe...    357   1e-110   
ref|XP_009606354.1|  PREDICTED: pollen-specific leucine-rich repe...    355   1e-110   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...    358   1e-110   
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...    360   1e-110   
ref|XP_008225431.1|  PREDICTED: pollen-specific leucine-rich repe...    363   1e-110   
ref|XP_010437692.1|  PREDICTED: pollen-specific leucine-rich repe...    357   2e-110   
ref|XP_009351868.1|  PREDICTED: pollen-specific leucine-rich repe...    360   2e-110   
emb|CDY51859.1|  BnaC03g77110D                                          355   2e-110   
ref|XP_009385321.1|  PREDICTED: pollen-specific leucine-rich repe...    352   2e-110   
emb|CDY51948.1|  BnaA08g11700D                                          355   3e-110   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    356   3e-110   
ref|XP_010447169.1|  PREDICTED: pollen-specific leucine-rich repe...    357   3e-110   
gb|KFK30023.1|  hypothetical protein AALP_AA7G207900                    354   3e-110   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...    357   5e-110   
ref|XP_006285576.1|  hypothetical protein CARUB_v10007020mg             355   5e-110   
ref|XP_007042323.1|  Leucine-rich repeat family protein                 356   6e-110   
ref|XP_010437689.1|  PREDICTED: pollen-specific leucine-rich repe...    357   6e-110   
dbj|BAD53794.1|  putative extensin                                      350   6e-110   
ref|XP_002867142.1|  hypothetical protein ARALYDRAFT_491276             354   6e-110   
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...    356   6e-110   
gb|EAY96763.1|  hypothetical protein OsI_18683                          345   8e-110   
ref|XP_010437688.1|  PREDICTED: pollen-specific leucine-rich repe...    357   9e-110   
ref|XP_007017392.1|  Leucine-rich repeat family protein                 359   2e-109   
dbj|BAJ91841.1|  predicted protein                                      351   3e-109   
ref|XP_006412291.1|  hypothetical protein EUTSA_v100245901mg            352   4e-109   
ref|NP_179188.1|  pollen-specific leucine-rich repeat extensin-li...    353   8e-109   
ref|XP_009775306.1|  PREDICTED: pollen-specific leucine-rich repe...    355   1e-108   
ref|XP_010507385.1|  PREDICTED: pollen-specific leucine-rich repe...    357   1e-108   
ref|XP_009606917.1|  PREDICTED: leucine-rich repeat extensin-like...    342   1e-108   
ref|XP_010507380.1|  PREDICTED: pollen-specific leucine-rich repe...    357   1e-108   
emb|CDY49265.1|  BnaA03g50780D                                          348   1e-108   
emb|CDY54073.1|  BnaA07g36350D                                          350   2e-108   
ref|NP_195123.1|  pollen-specific leucine-rich repeat extensin-li...    351   2e-108   
ref|XP_009402787.1|  PREDICTED: pollen-specific leucine-rich repe...    353   3e-108   
ref|XP_010530870.1|  PREDICTED: pollen-specific leucine-rich repe...    348   5e-108   
ref|XP_006300291.1|  hypothetical protein CARUB_v100136950mg            340   6e-108   
ref|XP_002885986.1|  predicted protein                                  351   7e-108   
emb|CDY49264.1|  BnaA03g50770D                                          347   8e-108   
ref|XP_010487832.1|  PREDICTED: pollen-specific leucine-rich repe...    355   8e-108   
emb|CDO97126.1|  unnamed protein product                                347   9e-108   
emb|CDY02276.1|  BnaA03g38910D                                          346   1e-107   
emb|CDY46593.1|  BnaCnng14150D                                          338   1e-107   
gb|AFW70087.1|  leucine-rich repeat (LRR) family protein                347   1e-107   
ref|XP_004248904.1|  PREDICTED: pollen-specific leucine-rich repe...    349   1e-107   
ref|XP_010466040.1|  PREDICTED: pollen-specific leucine-rich repe...    354   2e-107   
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g             358   2e-107   
ref|XP_009119384.1|  PREDICTED: pollen-specific leucine-rich repe...    352   2e-107   
ref|XP_002875655.1|  hypothetical protein ARALYDRAFT_347509             342   3e-107   
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...    355   3e-107   
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg             342   4e-107   
gb|AAM13864.1|  unknown protein                                         348   5e-107   
ref|XP_010467332.1|  PREDICTED: pollen-specific leucine-rich repe...    348   6e-107   
gb|EYU17639.1|  hypothetical protein MIMGU_mgv1a024686mg                335   6e-107   
gb|EEC70051.1|  hypothetical protein OsI_00647                          341   9e-107   
ref|XP_006342607.1|  PREDICTED: pollen-specific leucine-rich repe...    347   1e-106   
ref|XP_010251729.1|  PREDICTED: pollen-specific leucine-rich repe...    346   2e-106   
ref|XP_010432489.1|  PREDICTED: pollen-specific leucine-rich repe...    347   2e-106   
ref|XP_009138254.1|  PREDICTED: pollen-specific leucine-rich repe...    348   2e-106   
ref|XP_009383792.1|  PREDICTED: pollen-specific leucine-rich repe...    351   2e-106   
emb|CDX69018.1|  BnaC01g04350D                                          344   3e-106   
ref|XP_008645230.1|  PREDICTED: leucine-rich repeat extensin-like...    345   3e-106   
emb|CDX89681.1|  BnaC03g45950D                                          347   5e-106   
gb|EPS66537.1|  extensin-like protein                                   335   5e-106   
ref|XP_010489184.1|  PREDICTED: pollen-specific leucine-rich repe...    347   5e-106   
ref|NP_001042204.1|  Os01g0180000                                       339   6e-106   
ref|XP_003581687.1|  PREDICTED: leucine-rich repeat extensin-like...    340   2e-105   
ref|XP_006406541.1|  hypothetical protein EUTSA_v10022433mg             332   2e-105   
emb|CDY34233.1|  BnaA01g24500D                                          333   2e-105   
ref|XP_004173261.1|  PREDICTED: pollen-specific leucine-rich repe...    337   2e-105   
ref|XP_004951943.1|  PREDICTED: leucine-rich repeat extensin-like...    345   3e-105   
ref|XP_002885290.1|  hypothetical protein ARALYDRAFT_479420             348   4e-105   
emb|CDP07600.1|  unnamed protein product                                338   4e-105   
ref|NP_188532.2|  pollen-specific leucine-rich repeat extensin-li...    348   4e-105   
ref|XP_008796915.1|  PREDICTED: leucine-rich repeat extensin-like...    342   4e-105   
ref|XP_010927122.1|  PREDICTED: leucine-rich repeat extensin-like...    342   8e-105   
gb|EPS67596.1|  hypothetical protein M569_07180                         332   1e-104   
ref|XP_004498175.1|  PREDICTED: pollen-specific leucine-rich repe...    344   1e-104   
ref|NP_001045834.1|  Os02g0138000                                       341   1e-104   
ref|XP_006356596.1|  PREDICTED: pollen-specific leucine-rich repe...    341   2e-104   
ref|XP_008458676.1|  PREDICTED: pollen-specific leucine-rich repe...    337   2e-104   
ref|XP_009136284.1|  PREDICTED: pollen-specific leucine-rich repe...    345   2e-104   
ref|XP_002455064.1|  hypothetical protein SORBIDRAFT_03g003730          336   3e-104   
gb|AID60115.1|  leucine-rich repeat (LRR) family protein                338   5e-104   
gb|EMT18385.1|  hypothetical protein F775_11275                         329   5e-104   
gb|KFK40046.1|  hypothetical protein AALP_AA3G322800                    345   5e-104   
ref|XP_010096273.1|  Pollen-specific leucine-rich repeat extensin...    343   6e-104   
ref|XP_009118084.1|  PREDICTED: pollen-specific leucine-rich repe...    339   7e-104   
ref|XP_004138582.1|  PREDICTED: pollen-specific leucine-rich repe...    337   7e-104   
ref|XP_010525682.1|  PREDICTED: pollen-specific leucine-rich repe...    344   8e-104   
ref|XP_010461787.1|  PREDICTED: pollen-specific leucine-rich repe...    344   8e-104   
ref|NP_175372.1|  Leucine-rich repeat family protein                    343   8e-104   
ref|XP_008458201.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    337   9e-104   
ref|XP_010479383.1|  PREDICTED: pollen-specific leucine-rich repe...    343   9e-104   
ref|XP_010690992.1|  PREDICTED: pollen-specific leucine-rich repe...    337   1e-103   
gb|KGN45680.1|  hypothetical protein Csa_6G006180                       336   1e-103   
ref|XP_004138583.1|  PREDICTED: pollen-specific leucine-rich repe...    332   3e-103   
ref|XP_009350755.1|  PREDICTED: pollen-specific leucine-rich repe...    337   4e-103   
ref|NP_001175075.1|  Os07g0176400                                       325   4e-103   
ref|XP_006646058.1|  PREDICTED: leucine-rich repeat extensin-like...    331   4e-103   
ref|XP_010527734.1|  PREDICTED: pollen-specific leucine-rich repe...    344   4e-103   
emb|CDY53352.1|  BnaA06g38270D                                          335   4e-103   
gb|AAD55979.1|AF159296_1  extensin-like protein                         337   4e-103   
ref|XP_009345516.1|  PREDICTED: pollen-specific leucine-rich repe...    337   5e-103   
ref|XP_004230831.1|  PREDICTED: pollen-specific leucine-rich repe...    337   8e-103   
gb|KFK39231.1|  hypothetical protein AALP_AA3G216900                    341   1e-102   
ref|XP_007200697.1|  hypothetical protein PRUPE_ppa000722m2g            333   1e-102   
ref|XP_002982230.1|  hypothetical protein SELMODRAFT_54019              327   1e-102   
gb|AGT16949.1|  hypothetical protein SHCRBa_028_D11_F_270               336   1e-102   
ref|XP_011092901.1|  PREDICTED: pollen-specific leucine-rich repe...    341   2e-102   
gb|AGT17203.1|  hypothetical protein SHCRBa_102_P01_R_230               335   2e-102   
gb|AGT16787.1|  Leucine rich repeat protein                             334   2e-102   
ref|XP_009616761.1|  PREDICTED: pollen-specific leucine-rich repe...    333   2e-102   
ref|XP_010500490.1|  PREDICTED: pollen-specific leucine-rich repe...    340   2e-102   
gb|AGT17110.1|  hypothetical protein SHCRBa_170_G03_R_510               335   2e-102   
emb|CBI38962.3|  unnamed protein product                                343   2e-102   
gb|KFK36007.1|  hypothetical protein AALP_AA4G065700                    338   3e-102   
emb|CDY64248.1|  BnaCnng43540D                                          336   3e-102   
ref|XP_002453278.1|  hypothetical protein SORBIDRAFT_04g003090          327   3e-102   



>emb|CDO99097.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   518 bits (1333),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/344 (72%), Positives = 284/344 (83%), Gaps = 2/344 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPSHQ Y+  PP  PF NPRL NA+IALQAWKH IT+DPK FT +WYGP VC+Y GVYC
Sbjct  26    SKPSHQQYNASPP--PFPNPRLSNAYIALQAWKHAITSDPKGFTSNWYGPNVCSYNGVYC  83

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             A A DD  I TVAGIDLNHA+++G LPE+LGLLTDLALFHINSNRF G +P+SF HL LL
Sbjct  84    AQALDDPHIITVAGIDLNHADLAGYLPEELGLLTDLALFHINSNRFCGAVPKSFIHLHLL  143

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELD+SNNL  G+FP+VVL LP LKFLDIRYNQFQG IP  ++DLKLDALF+N+NNF  T
Sbjct  144   YELDISNNLFSGEFPSVVLCLPSLKFLDIRYNQFQGSIPSALFDLKLDALFINNNNFQST  203

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LPRN GNS VSVLV ANNNL+GCLP SI  M  TL+EIIL+NV LG CLP E+GLLK + 
Sbjct  204   LPRNIGNSTVSVLVLANNNLQGCLPSSIGNMANTLNEIILLNVGLGGCLPQELGLLKGVT  263

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFNNLVG+LP+S+G +  LEQLNVAHNKLSGEIPASIC LPRL+NFTYSYNYFC+ 
Sbjct  264   VFDVSFNNLVGTLPDSIGNMVSLEQLNVAHNKLSGEIPASICSLPRLQNFTYSYNYFCTE  323

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P +C K+  K+D++NCIP  P QRSP+ C+AFYS PVDCS  GC
Sbjct  324   PSLCLKLPDKDDEQNCIPGRPAQRSPQECQAFYSHPVDCSAFGC  367



>ref|XP_009622388.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Nicotiana tomentosiformis]
Length=403

 Score =   508 bits (1308),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 255/345 (74%), Positives = 292/345 (85%), Gaps = 1/345 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPS QA    PP+   +NPRL+NA+IALQAWKHV+T+DP+NFTK+WYG  VCNYTGVYC
Sbjct  19    SKPSFQASPPPPPIKYDQNPRLFNAYIALQAWKHVMTSDPRNFTKNWYGYKVCNYTGVYC  78

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPD+ +I TVAGIDLNHANISG LPEDLGLLTDLA+FHINSNRF+GT+P+SFS L+LL
Sbjct  79    APAPDNPKITTVAGIDLNHANISGYLPEDLGLLTDLAVFHINSNRFSGTVPKSFSKLQLL  138

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELDVSNNLLCG+FP+VVLSL  LKFLDIRYNQF+G +P  ++D KLDALF+N+NNF  T
Sbjct  139   YELDVSNNLLCGEFPSVVLSLSSLKFLDIRYNQFEGNVPSRLWDRKLDALFINNNNFQFT  198

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
              P+N GNSPVS LV AN N+ GC+PPSIAKM KTL++IILMN SL  CLP E+GLLK + 
Sbjct  199   WPKNLGNSPVSALVMANINVTGCIPPSIAKMGKTLNQIILMNASLNGCLPQELGLLKNVT  258

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFNNLVG LPE++  +KKLE LNVAHNKLSGEIPASIC LPRLKNFTYSYNYFC  
Sbjct  259   VFDVSFNNLVGKLPETIAGMKKLEHLNVAHNKLSGEIPASICSLPRLKNFTYSYNYFCDE  318

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             P+IC K+K KNDKKNCIPY P QRS   CKAFYS+ PVDC   GC
Sbjct  319   PKICLKLKDKNDKKNCIPYRPSQRSVNECKAFYSRGPVDCRSFGC  363



>ref|XP_009773829.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Nicotiana 
sylvestris]
Length=392

 Score =   507 bits (1305),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 254/345 (74%), Positives = 290/345 (84%), Gaps = 1/345 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPS QA    PP+   +NPRL+NA+IALQAWKHV+T+DP+NFTK+WYG  VCNYTGVYC
Sbjct  19    SKPSFQASPPPPPIKYDQNPRLFNAYIALQAWKHVMTSDPRNFTKNWYGYKVCNYTGVYC  78

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             AP PD+ +I TVAGIDLNHANISG LPEDLGLLTDLA+FHINSNRF+GT+P+SFS L+LL
Sbjct  79    APVPDNPKITTVAGIDLNHANISGYLPEDLGLLTDLAVFHINSNRFSGTIPKSFSKLQLL  138

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELDVSNNLLCG+FP+VVLSL  LKFLDIRYNQF+G +P  ++D KLDALF+N+NNF  T
Sbjct  139   YELDVSNNLLCGEFPSVVLSLSSLKFLDIRYNQFEGNVPSRLWDRKLDALFINNNNFQFT  198

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
              P+N GNSPVS LV AN N+ GC+PPSIAKM KTL++IILMN SL  CLP E+G LK + 
Sbjct  199   WPKNLGNSPVSALVMANINITGCIPPSIAKMGKTLNQIILMNASLNGCLPQELGFLKNVT  258

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFNNLVG LPE+M  +KKLE LNVAHNKLSGEIPASIC LPRLKNFTYSYNYFC  
Sbjct  259   VFDVSFNNLVGKLPETMAGMKKLEHLNVAHNKLSGEIPASICSLPRLKNFTYSYNYFCDE  318

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             P+IC K+K KNDKKNCIPY P QRS   CKAFYS+ PVDC   GC
Sbjct  319   PKICLKLKDKNDKKNCIPYRPSQRSVNECKAFYSRGPVDCRSFGC  363



>ref|XP_006360809.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Solanum 
tuberosum]
Length=377

 Score =   500 bits (1288),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 243/345 (70%), Positives = 279/345 (81%), Gaps = 6/345 (2%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPS QA     P     NPRL++A+IALQAWKHV+T+DP+NFTKDWY   VCNYTGVYC
Sbjct  19    SKPSFQASIKYEP-----NPRLFDAYIALQAWKHVMTSDPRNFTKDWYDYNVCNYTGVYC  73

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPD+  I TVAGIDLNHANISG LPE LGLLTDLA+FHINSNRF G++P+SFS LR+L
Sbjct  74    APAPDNPNITTVAGIDLNHANISGYLPEKLGLLTDLAVFHINSNRFEGSIPKSFSKLRIL  133

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             FELDVSNNL CG+FP+VVLSLP LKFLDIRYNQF+GK+P  ++D  LDALF+N+N F  +
Sbjct  134   FELDVSNNLFCGEFPSVVLSLPSLKFLDIRYNQFEGKVPSTLWDRTLDALFINNNKFQFS  193

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
              P+N G SPVS LV AN N+ GC+P SIAKM KTL+EIIL N SL  CLP E+GLLK ++
Sbjct  194   WPKNLGKSPVSALVMANINVTGCIPSSIAKMSKTLNEIILSNSSLSGCLPQELGLLKNVR  253

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             V DVSFN LVG LPES+G +KKLE LNVAHNK SGEIP SIC LP+L+NFTYSYNYFC  
Sbjct  254   VLDVSFNKLVGELPESIGGMKKLEHLNVAHNKFSGEIPMSICSLPKLENFTYSYNYFCGE  313

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             P+IC K+K +NDKKNCIPY P QRS   CK FYS+ PVDCS  GC
Sbjct  314   PKICLKLKDRNDKKNCIPYRPSQRSESECKTFYSRGPVDCSSFGC  358



>ref|XP_008438627.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Cucumis 
melo]
Length=373

 Score =   492 bits (1267),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 238/343 (69%), Positives = 277/343 (81%), Gaps = 4/343 (1%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             +PSHQ      P  P  NPRL  A+IALQAWKH ITADP NFT +WYGP VCNYTGV+CA
Sbjct  23    QPSHQQTPS--PFLP--NPRLLKAYIALQAWKHAITADPANFTANWYGPNVCNYTGVFCA  78

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
             PA DD +IRTVAGIDLNHANISGTLP+DLGLLTDLALFHINSNRF GT+P SF  L LLF
Sbjct  79    PALDDSDIRTVAGIDLNHANISGTLPDDLGLLTDLALFHINSNRFCGTIPDSFRCLTLLF  138

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             ELD+SNN   G+FP+V+LSLP LKFLD+R+N+F G +P  ++DLKLDALF+N+N+F  +L
Sbjct  139   ELDISNNDFSGEFPSVILSLPALKFLDVRFNKFSGDLPSSLFDLKLDALFINNNDFKFSL  198

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P N GNSPVSVLVFANNN+ GCLP SI+ M  TL+EII+ +  L  CLP EIG L+ L V
Sbjct  199   PENIGNSPVSVLVFANNNINGCLPSSISNMNTTLNEIIITSSGLIGCLPPEIGSLRNLTV  258

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
             FDVS NNLVG LPE+M  +KKLEQLNVAHN+LSGEIPASIC LP+L+NFTYSYN+FCS P
Sbjct  259   FDVSDNNLVGPLPETMAGMKKLEQLNVAHNQLSGEIPASICSLPKLQNFTYSYNFFCSEP  318

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              +C K++  +D+KNC+P  P QRSPE CKAFYS PVDC V GC
Sbjct  319   PVCLKLQASDDQKNCLPDRPFQRSPEECKAFYSYPVDCGVFGC  361



>ref|XP_004247590.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Solanum 
lycopersicum]
Length=393

 Score =   490 bits (1262),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 240/345 (70%), Positives = 279/345 (81%), Gaps = 6/345 (2%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPS QA     P     NPRL++A+IALQAWKHV+T+DP+NFTKDWY   VCNYTGVYC
Sbjct  19    SKPSFQASIKYEP-----NPRLFDAYIALQAWKHVMTSDPRNFTKDWYDYNVCNYTGVYC  73

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPD+  I TVAGIDLNHANISG L E LGLLTDLA+FHINSNRF G++P+SFS LR+L
Sbjct  74    APAPDNPNITTVAGIDLNHANISGYLHEKLGLLTDLAVFHINSNRFQGSIPKSFSKLRIL  133

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             FELDVSNNL CG+FP+VVLSLP LKFLD+RYNQF+GKIP +++D  LDALF+N+N F  +
Sbjct  134   FELDVSNNLFCGEFPSVVLSLPSLKFLDVRYNQFEGKIPTKLWDRTLDALFINNNKFQFS  193

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
              P+N G SPVS LV AN N+ GC+P SIAKM KTL+EIIL N SL  CLP E+GLLK ++
Sbjct  194   WPKNLGKSPVSALVMANINVTGCIPSSIAKMSKTLNEIILSNSSLSGCLPQELGLLKNVR  253

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             V DVSFN LVG LPES+G++KKLE LNVA NK SG+IP SIC LP+L+NFTYSYNYFC  
Sbjct  254   VLDVSFNKLVGELPESIGEMKKLEHLNVAQNKFSGKIPMSICLLPKLENFTYSYNYFCGE  313

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             P+IC K+K  NDKKNCIPY P QRS   CKAFYS+ PV+CS  GC
Sbjct  314   PKICLKLKDINDKKNCIPYRPSQRSENECKAFYSRGPVNCSSFGC  358



>ref|XP_010256147.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Nelumbo 
nucifera]
Length=378

 Score =   486 bits (1250),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 234/342 (68%), Positives = 273/342 (80%), Gaps = 5/342 (1%)
 Frame = -3

Query  1491  PSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAP  1312
             PSHQ    G P  PF NPRL NA+ ALQAWKHVI +DPKN T +WYGP+VCNYTGV+CAP
Sbjct  23    PSHQ---QGLP--PFPNPRLLNAYTALQAWKHVILSDPKNSTANWYGPHVCNYTGVFCAP  77

Query  1311  APDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFE  1132
             APDD  I+TVAGIDLNHA+I+G+LPE+LGLLTDLALFHINSNRF GT+P SF ++ LL+E
Sbjct  78    APDDPYIKTVAGIDLNHADIAGSLPEELGLLTDLALFHINSNRFCGTIPESFKNMHLLYE  137

Query  1131  LDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLP  952
             LDVSNN   G FP+VVL LP LK+LDIRYNQF+G++P  ++DL LDA+F+N+N F  TLP
Sbjct  138   LDVSNNWFTGPFPSVVLCLPSLKYLDIRYNQFEGEVPTRLFDLNLDAIFINNNRFKFTLP  197

Query  951   RNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVF  772
             +N GNSP SVLV AN  + GCLP S+  M  TL +IILMN+ L +C+P EIG LK + VF
Sbjct  198   KNIGNSPASVLVMANIQVSGCLPSSLGNMTGTLDQIILMNMGLRSCIPPEIGYLKNITVF  257

Query  771   DVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPE  592
             DVSFNNL G LPE++G++KKLE LNVAHNKL GEIP SIC LPRLKNFT+S NYFCS P 
Sbjct  258   DVSFNNLTGPLPETIGEMKKLEHLNVAHNKLIGEIPESICALPRLKNFTFSDNYFCSEPH  317

Query  591   ICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +C K+KHKNDKKNCIPY P QRSPE CKAF   PV C   GC
Sbjct  318   LCLKLKHKNDKKNCIPYQPKQRSPEECKAFLDHPVHCDSFGC  359



>ref|XP_004134434.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Cucumis 
sativus]
 ref|XP_004166385.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Cucumis 
sativus]
Length=376

 Score =   476 bits (1225),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 224/320 (70%), Positives = 262/320 (82%), Gaps = 0/320 (0%)
 Frame = -3

Query  1425  AFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLNHANISG  1246
             A+ ALQAWKH IT DP NFT +WYGP VCNY+GV+CAPA DD +IRTVAGIDLNH NISG
Sbjct  45    AYTALQAWKHAITEDPSNFTANWYGPDVCNYSGVFCAPALDDPDIRTVAGIDLNHGNISG  104

Query  1245  TLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVVLSLPKL  1066
             TLP+DLGLLTDLALFHINSNRF GT+P SF  L LLFELD+SNN   G+FP+V+LSLP L
Sbjct  105   TLPDDLGLLTDLALFHINSNRFCGTIPNSFRCLTLLFELDISNNDFSGEFPSVILSLPAL  164

Query  1065  KFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANNNLRGCL  886
             KFLDIR+N+F G +P  +++LKLDALF+N+N+F  +LP N GNSPVSVLVFANNN+ GCL
Sbjct  165   KFLDIRFNKFSGDVPSSLFELKLDALFINNNDFNFSLPENIGNSPVSVLVFANNNINGCL  224

Query  885   PPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMGKLKKLE  706
             P SI+ M  TL+EII+    L  CLP EIG L  L VFDVS NNLVG LPE+M  +KKLE
Sbjct  225   PSSISNMNTTLNEIIITGSGLIGCLPSEIGSLSNLTVFDVSDNNLVGPLPETMAGMKKLE  284

Query  705   QLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIPYWPHQR  526
             QLNVAHN+LSGEIPASIC LP+L+NFT+SYN+FCS P +C K++  +D+KNC+P  P QR
Sbjct  285   QLNVAHNQLSGEIPASICSLPKLQNFTFSYNFFCSEPPVCLKLQASDDQKNCLPDRPFQR  344

Query  525   SPETCKAFYSKPVDCSVLGC  466
             SPE CKAFYS PVDCSV GC
Sbjct  345   SPEECKAFYSNPVDCSVFGC  364



>ref|XP_002279192.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Vitis 
vinifera]
Length=394

 Score =   476 bits (1225),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 233/344 (68%), Positives = 270/344 (78%), Gaps = 3/344 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             S PSHQ     PP+    NPR+ NA+ ALQAWKHVI +DPKNFT +W G  VCNY GVYC
Sbjct  25    SAPSHQDSYSPPPL---PNPRILNAYTALQAWKHVILSDPKNFTSNWCGFDVCNYKGVYC  81

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPDD  I TVAGIDLNHA+I+G+LPE+LGLLTDLALFHINSNRF GTLP SF HLRLL
Sbjct  82    APAPDDPHITTVAGIDLNHADIAGSLPEELGLLTDLALFHINSNRFCGTLPDSFRHLRLL  141

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELD+SNN   G FP+VVL LP LKFLDIRYN+F+G IP  ++DLKLDA+FVN+N F  +
Sbjct  142   YELDISNNRFKGQFPSVVLCLPSLKFLDIRYNEFEGDIPTGLFDLKLDAIFVNNNKFKSS  201

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP N GNSPVSV+VFANNNL GCLP S++KM KTL+E+I+ N  L  CL  EIGLLK + 
Sbjct  202   LPGNIGNSPVSVIVFANNNLNGCLPSSLSKMAKTLNELIITNAGLKGCLSPEIGLLKNVT  261

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVS N LVG LPE++G++K LEQLNVAHNKLSGEIP +IC LP L+NFTYSYNYFC  
Sbjct  262   VFDVSSNELVGPLPETIGEMKSLEQLNVAHNKLSGEIPETICSLPNLENFTYSYNYFCGE  321

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P  C K+   +D+KNCIP  P QRSPE C AF ++PVDC   GC
Sbjct  322   PPTCLKLPANDDQKNCIPDRPMQRSPEECAAFLAQPVDCGAFGC  365



>gb|KGN56949.1| hypothetical protein Csa_3G146350 [Cucumis sativus]
Length=386

 Score =   475 bits (1223),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 224/320 (70%), Positives = 262/320 (82%), Gaps = 0/320 (0%)
 Frame = -3

Query  1425  AFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLNHANISG  1246
             A+ ALQAWKH IT DP NFT +WYGP VCNY+GV+CAPA DD +IRTVAGIDLNH NISG
Sbjct  55    AYTALQAWKHAITEDPSNFTANWYGPDVCNYSGVFCAPALDDPDIRTVAGIDLNHGNISG  114

Query  1245  TLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVVLSLPKL  1066
             TLP+DLGLLTDLALFHINSNRF GT+P SF  L LLFELD+SNN   G+FP+V+LSLP L
Sbjct  115   TLPDDLGLLTDLALFHINSNRFCGTIPNSFRCLTLLFELDISNNDFSGEFPSVILSLPAL  174

Query  1065  KFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANNNLRGCL  886
             KFLDIR+N+F G +P  +++LKLDALF+N+N+F  +LP N GNSPVSVLVFANNN+ GCL
Sbjct  175   KFLDIRFNKFSGDVPSSLFELKLDALFINNNDFNFSLPENIGNSPVSVLVFANNNINGCL  234

Query  885   PPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMGKLKKLE  706
             P SI+ M  TL+EII+    L  CLP EIG L  L VFDVS NNLVG LPE+M  +KKLE
Sbjct  235   PSSISNMNTTLNEIIITGSGLIGCLPSEIGSLSNLTVFDVSDNNLVGPLPETMAGMKKLE  294

Query  705   QLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIPYWPHQR  526
             QLNVAHN+LSGEIPASIC LP+L+NFT+SYN+FCS P +C K++  +D+KNC+P  P QR
Sbjct  295   QLNVAHNQLSGEIPASICSLPKLQNFTFSYNFFCSEPPVCLKLQASDDQKNCLPDRPFQR  354

Query  525   SPETCKAFYSKPVDCSVLGC  466
             SPE CKAFYS PVDCSV GC
Sbjct  355   SPEECKAFYSNPVDCSVFGC  374



>ref|XP_006420005.1| hypothetical protein CICLE_v10004988mg [Citrus clementina]
 gb|ESR33245.1| hypothetical protein CICLE_v10004988mg [Citrus clementina]
Length=438

 Score =   476 bits (1225),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 236/343 (69%), Positives = 267/343 (78%), Gaps = 0/343 (0%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             KPSHQA DD    F   NPRL  A+IALQ WK  IT+DP  FT +W GP VCNYTGVYCA
Sbjct  59    KPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCA  118

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
             PAPDD +  TVAGIDLN ANI+GTLPE LGLL DLALFHINSNRF GT+P SF +++LLF
Sbjct  119   PAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLF  178

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             ELDVSNN   G FP+VVL LP LKFLDIR+NQF+G+IP  V+DLKLDALF+N+N FT +L
Sbjct  179   ELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSL  238

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P N GNSPVSVLV ANNN   CLPPS+ KM  TL+EIIL N  L  CL  +IGLL ++ V
Sbjct  239   PNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTV  298

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
             FDVSFNNLVGSLPESMG +K LEQLNVAHN LSG IP SIC LP+L+NFTYSYN+FC+ P
Sbjct  299   FDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEP  358

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               C K+K K+D++NCIP  P QRSP  CKAFYS PVDC    C
Sbjct  359   LACLKLKVKDDRQNCIPNRPFQRSPMECKAFYSHPVDCGASCC  401



>ref|XP_010259122.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Nelumbo 
nucifera]
Length=376

 Score =   473 bits (1218),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 227/320 (71%), Positives = 259/320 (81%), Gaps = 1/320 (0%)
 Frame = -3

Query  1425  AFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLNHANISG  1246
              + ALQAWKH I +DPKNF  +W GP+VCNYTGVYCAPAPDD  I TVAGIDLNHA+ISG
Sbjct  40    TYAALQAWKHAILSDPKNFXANWCGPHVCNYTGVYCAPAPDDPHITTVAGIDLNHADISG  99

Query  1245  TLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVVLSLPKL  1066
             +LPE+LGLLTDLA+FHINSNRF GT+P SF +L LL+ELDVSNN   G FP+VVL LP L
Sbjct  100   SLPEELGLLTDLAVFHINSNRFCGTIPESFRNLHLLYELDVSNNRFTGPFPSVVLCLPSL  159

Query  1065  KFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANNNLRGCL  886
             K+LDIRYNQF+G +P  ++DLKLDALF+N+N F  +LPRN GNSPVSVLV ANN L GCL
Sbjct  160   KYLDIRYNQFEGDVPTRLFDLKLDALFINNNRFKFSLPRNIGNSPVSVLVLANNKLGGCL  219

Query  885   PPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMGKLKKLE  706
             P S+A M   L+EIILMN  L +C+P EIGLLK + VFDVSFNNL G LP++MG +K LE
Sbjct  220   PSSLANMVG-LNEIILMNAGLTSCVPPEIGLLKNVTVFDVSFNNLTGPLPDTMGGMKSLE  278

Query  705   QLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIPYWPHQR  526
             QLNVAHNKL+GEIP SIC LPRLKNFTYSYNYFC  P IC K+KHKND+KNCIPY P QR
Sbjct  279   QLNVAHNKLTGEIPESICHLPRLKNFTYSYNYFCGEPPICLKLKHKNDRKNCIPYRPSQR  338

Query  525   SPETCKAFYSKPVDCSVLGC  466
             SPE C AF S P+ C   GC
Sbjct  339   SPEECVAFLSHPIHCDAFGC  358



>ref|XP_006489442.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Citrus 
sinensis]
 gb|KDO74486.1| hypothetical protein CISIN_1g015481mg [Citrus sinensis]
Length=406

 Score =   474 bits (1220),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 235/343 (69%), Positives = 266/343 (78%), Gaps = 0/343 (0%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             KPSHQA DD    F   NPRL  A+IALQ WK  IT+DP  FT +W GP VCNYTGVYCA
Sbjct  27    KPSHQALDDNDIGFIIPNPRLLKAYIALQFWKLSITSDPNGFTSNWCGPNVCNYTGVYCA  86

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
             PAPDD +  TVAGIDLN ANI+GTLPE LGLL DLALFHINSNRF GT+P SF +++LLF
Sbjct  87    PAPDDPDCLTVAGIDLNQANIAGTLPEKLGLLQDLALFHINSNRFCGTIPDSFRNMQLLF  146

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             ELDVSNN   G FP+VVL LP LKFLDIR+NQF+G+IP  V+DLKLDALF+N+N FT +L
Sbjct  147   ELDVSNNQFSGCFPSVVLCLPSLKFLDIRFNQFEGEIPSAVFDLKLDALFLNNNKFTSSL  206

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P N GNSPVSVLV ANNN   CLPPS+ KM  TL+EIIL N  L  CL  +IGLL ++ V
Sbjct  207   PNNIGNSPVSVLVLANNNFDSCLPPSLTKMAGTLNEIILANAKLKGCLLKDIGLLNQVTV  266

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
             FDVSFNNLVGSLPESMG +K LEQLNVAHN LSG IP SIC LP+L+NFTYSYN+FC+ P
Sbjct  267   FDVSFNNLVGSLPESMGNMKSLEQLNVAHNNLSGAIPNSICCLPKLENFTYSYNFFCTEP  326

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               C K+K K+D++NCIP  P QRSP  CK FYS PVDC    C
Sbjct  327   LACLKLKVKDDRQNCIPNRPFQRSPMECKTFYSHPVDCGASCC  369



>gb|KDP40221.1| hypothetical protein JCGZ_02219 [Jatropha curcas]
Length=422

 Score =   474 bits (1220),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 236/344 (69%), Positives = 282/344 (82%), Gaps = 1/344 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPS QA D  PP    +NPRL NA+ ALQA KH IT+DPKNFT +W GP VCNYTGVYC
Sbjct  22    SKPSLQASDYDPPPL-IQNPRLLNAYTALQALKHSITSDPKNFTSNWCGPNVCNYTGVYC  80

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPDD E  TVAGIDLNHA+ISG LPE+LGLLTDLALFH+N+NRF GT+P SF HLRLL
Sbjct  81    APAPDDHETITVAGIDLNHADISGLLPEELGLLTDLALFHLNTNRFCGTIPDSFRHLRLL  140

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELDVSNN   G+FP+V+LSLP LKFLDIR+N+F+G IP E++DLKLDALF+N+N F  +
Sbjct  141   YELDVSNNKFSGEFPSVLLSLPSLKFLDIRFNEFRGNIPSELFDLKLDALFINNNKFNSS  200

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP NFGNS VSV+V ANN++ GCLP S+ KM KTL++IIL N+ L  CL  +IGL  ++ 
Sbjct  201   LPENFGNSSVSVIVLANNDISGCLPSSLTKMSKTLNQIILSNMGLHGCLQSDIGLFNQVT  260

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFN LVGSLP+SMGK+KKLEQLNVAHNKLSGEIP SIC LP+L++FTYSYNYFC+ 
Sbjct  261   VFDVSFNKLVGSLPDSMGKMKKLEQLNVAHNKLSGEIPESICLLPKLESFTYSYNYFCTE  320

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P +C K+  ++D+KNC+P+ P QRSPE CK FYS PV+C+  GC
Sbjct  321   PSVCLKISARDDRKNCLPHRPLQRSPEECKVFYSYPVNCNAFGC  364



>ref|XP_011030644.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Populus 
euphratica]
Length=404

 Score =   471 bits (1211),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 228/344 (66%), Positives = 270/344 (78%), Gaps = 3/344 (1%)
 Frame = -3

Query  1494  KPSHQ-AYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             KPS+Q + D   P+ P  NPRL  A+IALQAWKH IT+DPKNFT +W GP VCNYTGVYC
Sbjct  22    KPSYQLSVDLDLPLIP--NPRLLKAYIALQAWKHAITSDPKNFTSNWCGPNVCNYTGVYC  79

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPDD+   TVAGIDLNHANI+G LPEDLGLLTDLALFHINSNRF G++P SF  L LL
Sbjct  80    APAPDDRNTLTVAGIDLNHANITGYLPEDLGLLTDLALFHINSNRFFGSIPGSFCKLNLL  139

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELDVSNN   G+FP+VVLSLP LKFLDIR+N+FQGKIP +++D+ LDALF+N+N F  +
Sbjct  140   YELDVSNNQFSGEFPSVVLSLPSLKFLDIRFNEFQGKIPSKLFDINLDALFINNNKFQSS  199

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             +P NFG SP SV+V ANNN   C P S+ +M  TL EIIL N+ L  CLP +IGL+ +L 
Sbjct  200   IPTNFGKSPASVIVLANNNFNSCFPSSLTEMAGTLDEIILTNMGLTGCLPSDIGLMNQLT  259

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVS N LVGSLPES+G +K+LEQLNVAHN L G+IP SIC LPRL+NFTYSYNYFC  
Sbjct  260   VFDVSSNKLVGSLPESIGDMKRLEQLNVAHNMLYGDIPRSICLLPRLENFTYSYNYFCGE  319

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P  C K++ K+D +NCIPY P QRSP+ CK+FY+ P  CS  GC
Sbjct  320   PPACLKLQAKDDTENCIPYRPLQRSPQECKSFYAFPPSCSASGC  363



>gb|KDO74484.1| hypothetical protein CISIN_1g045950mg [Citrus sinensis]
Length=405

 Score =   470 bits (1210),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 228/344 (66%), Positives = 265/344 (77%), Gaps = 2/344 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             S+PS     D     P  NPRL  A+ ALQAWK+ IT+DP  FT +WYGP VCNYTGVYC
Sbjct  21    SEPSQSIDIDIGLTIP--NPRLSKAYTALQAWKYAITSDPNGFTSNWYGPDVCNYTGVYC  78

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPDD    TVAGIDLNHANI+GTLPE+LGLL DLALFH+NSNRF GT+P SF ++RLL
Sbjct  79    APAPDDPHSLTVAGIDLNHANIAGTLPEELGLLEDLALFHLNSNRFCGTIPDSFRNMRLL  138

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             FELDVS N   G FP+VVL LP LKFLDIR+NQF+G IP  V+DLKLDALF+N+N F+ +
Sbjct  139   FELDVSTNQFSGCFPSVVLCLPSLKFLDIRFNQFEGDIPSAVFDLKLDALFINNNKFSSS  198

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP+N GNSPVSVLV ANNNL  C+P S+ KM  TL+EIIL+N  L  C P +IGLL ++ 
Sbjct  199   LPKNIGNSPVSVLVLANNNLNSCIPSSLTKMAGTLNEIILLNTGLTGCFPQDIGLLNQVT  258

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDV FNNLVG LPESMG +K LEQLNVAHNKLSG IP SIC LP+L+NFTYSYN+FCS 
Sbjct  259   VFDVGFNNLVGPLPESMGNMKSLEQLNVAHNKLSGAIPESICRLPKLENFTYSYNFFCSE  318

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P  C  +K K+D++NCIP  P QRS   CK+FY+ PVDC   GC
Sbjct  319   PLTCLNLKDKDDRQNCIPNRPLQRSAMECKSFYAHPVDCGAFGC  362



>ref|XP_002314669.2| hypothetical protein POPTR_0010s09310g, partial [Populus trichocarpa]
 gb|EEF00840.2| hypothetical protein POPTR_0010s09310g, partial [Populus trichocarpa]
Length=361

 Score =   465 bits (1196),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 228/342 (67%), Positives = 269/342 (79%), Gaps = 5/342 (1%)
 Frame = -3

Query  1494  KPSHQ-AYD-DGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVY  1321
             KPS+Q + D D PP+    NPRL  A+IALQAWKH IT+DPKNFT +W GP VCNYTGVY
Sbjct  22    KPSYQLSVDLDLPPI---PNPRLLKAYIALQAWKHAITSDPKNFTSNWCGPNVCNYTGVY  78

Query  1320  CAPAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRL  1141
             CAPAPDD++  TVAGIDLNHA I+G+LPEDLGLLTDLALFHINSNRF G++P SF  L L
Sbjct  79    CAPAPDDRDTLTVAGIDLNHAKIAGSLPEDLGLLTDLALFHINSNRFFGSIPGSFCELNL  138

Query  1140  LFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTV  961
             L+ELDVSNN   G FP+VVLSLP LKFLDIRYN+F+GKIP +++D  LDALF+N+N F  
Sbjct  139   LYELDVSNNQFSGKFPSVVLSLPSLKFLDIRYNEFRGKIPSKLFDKNLDALFINNNKFQS  198

Query  960   TLPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKEL  781
             ++P+N G SPVSV+V ANNN   C P S+ KM  TL EIIL N+ L  CLP +IGL+ +L
Sbjct  199   SVPKNLGKSPVSVIVLANNNFNSCFPSSLTKMAGTLDEIILTNMGLTGCLPSDIGLMNQL  258

Query  780   KVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCS  601
              VFDVS N LVGSLPES+G +KKLEQLNVAHN L G+IP SIC LPRL+NFTYSYNYFC 
Sbjct  259   TVFDVSSNKLVGSLPESIGDMKKLEQLNVAHNMLYGDIPRSICLLPRLENFTYSYNYFCG  318

Query  600   APEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSV  475
              P  C K++ K+D +NCIPY P QRSP+ CK+FY+ P  CS 
Sbjct  319   EPPACLKLQAKDDTENCIPYRPLQRSPQECKSFYAFPPSCSA  360



>ref|XP_010938335.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Elaeis guineensis]
Length=381

 Score =   465 bits (1197),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 238/333 (71%), Positives = 266/333 (80%), Gaps = 1/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP+ P  NPRL  A+IALQAWKH IT+DPKNFT DW GPYVCNYTGVYCAPAPDD  + T
Sbjct  28    PPLPPI-NPRLEKAYIALQAWKHAITSDPKNFTLDWCGPYVCNYTGVYCAPAPDDPHVLT  86

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHA I+GTLPEDLGLLTDL LFHINSNRF GTLP SF  L+ L+ELDVSNNLL 
Sbjct  87    VAGIDLNHARIAGTLPEDLGLLTDLGLFHINSNRFEGTLPSSFDQLKRLYELDVSNNLLE  146

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP+V L LP LK+LDIRYN F G++P EV+DL LDA F+N N F  TLP N GNS VS
Sbjct  147   GPFPSVALRLPTLKYLDIRYNNFHGEVPSEVFDLTLDAFFINSNQFRFTLPDNIGNSTVS  206

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV ANN L GCLP ++A M KTL++IILMN S+ +C+P EIG L +L VFDVSFNNLVG
Sbjct  207   VLVAANNPLTGCLPKTLANMAKTLNQIILMNSSITSCIPPEIGKLDKLTVFDVSFNNLVG  266

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPES+G +KKLEQL+VAHNKLSG IP +IC LPRLKNFTYSYNYFC  PE C K+K ++
Sbjct  267   PLPESIGDMKKLEQLDVAHNKLSGFIPETICALPRLKNFTYSYNYFCGVPEQCTKIKRRD  326

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             DKKNCIP WP QRS E C AF SKPV C   GC
Sbjct  327   DKKNCIPDWPKQRSEEECHAFLSKPVYCDANGC  359



>ref|XP_007143301.1| hypothetical protein PHAVU_007G060800g [Phaseolus vulgaris]
 gb|ESW15295.1| hypothetical protein PHAVU_007G060800g [Phaseolus vulgaris]
Length=401

 Score =   466 bits (1199),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 264/342 (77%), Gaps = 2/342 (1%)
 Frame = -3

Query  1491  PSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAP  1312
             PS   +   P   P  NPRL  A+ ALQAWKH IT+DPKNFT +W GP VCNYTG+YCAP
Sbjct  31    PSQAQHSSSP--LPPLNPRLSKAYTALQAWKHKITSDPKNFTLNWCGPNVCNYTGIYCAP  88

Query  1311  APDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFE  1132
             APDD  I TVAG+DLNHA ISG+LPE+LGLLTDLALFHINSNRF G+LP +F  L LL E
Sbjct  89    APDDPHIYTVAGVDLNHATISGSLPEELGLLTDLALFHINSNRFCGSLPSTFDQLNLLHE  148

Query  1131  LDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLP  952
             LD+SNN   G FP V+L +  LK+LDIR+N F G IP  ++DLKLDALF+N+NNF  +LP
Sbjct  149   LDISNNQFSGPFPEVLLCISSLKYLDIRFNNFYGSIPSRLFDLKLDALFINNNNFKFSLP  208

Query  951   RNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVF  772
              NF N+ VSVLVFANN+L+GCLP S+AKM+ TL+EII+ N  L  CLP EIG L +L VF
Sbjct  209   DNFANTSVSVLVFANNDLKGCLPSSLAKMKGTLNEIIITNSGLTGCLPSEIGDLDKLTVF  268

Query  771   DVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPE  592
             DVSFN LVG LPES+GK+KKLEQLNVAHN LSG IP S+C LP+L+NFTYSYNYFCS   
Sbjct  269   DVSFNKLVGDLPESLGKMKKLEQLNVAHNMLSGTIPESVCMLPKLENFTYSYNYFCSESP  328

Query  591   ICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +C K+K  +D KNCIPY P QRSP+ C+AFY  PV CS  GC
Sbjct  329   LCLKLKDTDDTKNCIPYRPLQRSPDECEAFYKYPVHCSAFGC  370



>ref|XP_006420010.1| hypothetical protein CICLE_v10005037mg [Citrus clementina]
 gb|ESR33250.1| hypothetical protein CICLE_v10005037mg [Citrus clementina]
Length=422

 Score =   466 bits (1198),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 222/326 (68%), Positives = 258/326 (79%), Gaps = 0/326 (0%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             NPRL  A+ ALQAWK+ IT+DP  FT +WYGP VCNYTGVYCAPAPDD    TVAGIDLN
Sbjct  39    NPRLSKAYTALQAWKYAITSDPNGFTSNWYGPDVCNYTGVYCAPAPDDPRSLTVAGIDLN  98

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             HANI+GTLPE+LGLL DLALFH+NSNRF GT+P SF ++RLLFELDVS N   G FP+VV
Sbjct  99    HANIAGTLPEELGLLEDLALFHLNSNRFCGTIPDSFRNMRLLFELDVSTNQFSGCFPSVV  158

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
             L LP LKFLDIR+NQF+G IP  V+DLKLDALF+N+N F+ +LP+N GNSPVSVLV ANN
Sbjct  159   LCLPSLKFLDIRFNQFEGAIPSAVFDLKLDALFINNNKFSSSLPKNIGNSPVSVLVLANN  218

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
             NL  C+P S+ KM  TL+EIIL+N  L  C P +IGLL ++ VFDV FNNL G LPESMG
Sbjct  219   NLNSCIPSSLTKMAGTLNEIILLNTGLTGCFPQDIGLLNQVTVFDVGFNNLGGPLPESMG  278

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIP  544
              +K LEQLNVAHNKLSG IP SIC LP+L+NFTYSYN+FCS P  C  +K K+D++NCIP
Sbjct  279   NMKSLEQLNVAHNKLSGAIPESICRLPKLENFTYSYNFFCSEPLTCLNLKDKDDRQNCIP  338

Query  543   YWPHQRSPETCKAFYSKPVDCSVLGC  466
               P QRS   CK+FY+ PVDC   GC
Sbjct  339   NRPLQRSAMECKSFYAHPVDCGAFGC  364



>ref|XP_002517082.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45245.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=356

 Score =   462 bits (1189),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 222/336 (66%), Positives = 269/336 (80%), Gaps = 0/336 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPS+QA     P  P  +PRL  A+IALQAWKH IT+DPKNFT +WYGP VC+YTGVYC
Sbjct  19    SKPSYQASYSSSPPPPIPSPRLLKAYIALQAWKHAITSDPKNFTSNWYGPDVCSYTGVYC  78

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA DD    TVAGIDLNHANI+G+LPEDLGLLTDLALFH+NSNRF GT+P SF HLRLL
Sbjct  79    APALDDPHTITVAGIDLNHANIAGSLPEDLGLLTDLALFHLNSNRFCGTIPDSFRHLRLL  138

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +E D+SNN   G+ P V+L L  LKFLD+RYN+F G +P +++DLKLDALF+N+N F  +
Sbjct  139   YEFDISNNQFSGELPPVLLCLTSLKFLDVRYNEFYGNVPSKLFDLKLDALFINNNKFKSS  198

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP NFGNSPVSV+V ANN++ GC+P S+ KM +TL +IIL N+ L  C+  +IGLL ++ 
Sbjct  199   LPENFGNSPVSVIVLANNDISGCIPSSLTKMGRTLKQIILTNMGLNGCIQSDIGLLNQVT  258

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFN LVGSLP+SMG++K LEQLNVAHNKLSG IP SIC LPRL+NFTYS NYFC  
Sbjct  259   VFDVSFNKLVGSLPDSMGEMKSLEQLNVAHNKLSGNIPESICLLPRLENFTYSDNYFCGE  318

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKP  490
             P +C K++ K+D++NCIP+ P QRSPE CKAFY+ P
Sbjct  319   PPVCLKLQAKDDRRNCIPHRPLQRSPEECKAFYAYP  354



>ref|XP_007034837.1| Leucine-rich repeat (LRR) family protein, putative [Theobroma 
cacao]
 gb|EOY05763.1| Leucine-rich repeat (LRR) family protein, putative [Theobroma 
cacao]
Length=384

 Score =   461 bits (1187),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 231/347 (67%), Positives = 266/347 (77%), Gaps = 5/347 (1%)
 Frame = -3

Query  1497  SKPSHQAYDD--GPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGV  1324
             SKPSH   D    PP+ P  NPRL  A+ ALQAWKH +T+DP  FT +WYGP VCNYTGV
Sbjct  22    SKPSHGLIDTDINPPLIP--NPRLLKAYTALQAWKHAMTSDPNRFTSNWYGPKVCNYTGV  79

Query  1323  YCAPAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLR  1144
             YCAPAPDD  I TVAGIDLNHANI+GTLPEDLGLLTDLALFHINSNRF G +P SF +L 
Sbjct  80    YCAPAPDDPYITTVAGIDLNHANIAGTLPEDLGLLTDLALFHINSNRFCGQVPESFRNLN  139

Query  1143  LLFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFT  964
              L ELD+SNN   G FP VVL LP LKFLDIRYNQF G IP +++DLKLDALFVN+N F 
Sbjct  140   FLHELDISNNRFSGRFPYVVLYLPSLKFLDIRYNQFSGTIPSQLFDLKLDALFVNNNKFQ  199

Query  963   VTLPRNFGNSPVSVLVFANNNLRGCLP-PSIAKMRKTLSEIILMNVSLGACLPDEIGLLK  787
              +LP+NFGNSPVSV+V AN+ L GC P  S+A+M  TL EIILMN     CL  EIG LK
Sbjct  200   SSLPKNFGNSPVSVIVMANSGLTGCFPSSSLAQMAGTLQEIILMNNGFTGCLKPEIGNLK  259

Query  786   ELKVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYF  607
              + VFDVS N LVG LP+++G++K LEQLNVA+NKLSG IP SIC LP+L+NFTYS N+F
Sbjct  260   GVTVFDVSSNKLVGPLPDAIGQMKSLEQLNVANNKLSGYIPESICSLPKLENFTYSNNFF  319

Query  606   CSAPEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              S P  C K+  K+D+KNCIPY P QRSP  CK+FY+ PVDCS+ GC
Sbjct  320   ASEPPKCLKLPDKDDRKNCIPYRPLQRSPMECKSFYAHPVDCSISGC  366



>ref|XP_003556064.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Glycine 
max]
 gb|KHN15735.1| Leucine-rich repeat extensin-like protein 6 [Glycine soja]
Length=399

 Score =   461 bits (1186),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 218/324 (67%), Positives = 260/324 (80%), Gaps = 0/324 (0%)
 Frame = -3

Query  1437  RLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLNHA  1258
             RL  A+ ALQAWK+ IT+DPKNFT +W GP VCNYTG+YCAPA DD  I TVAG+DLNHA
Sbjct  43    RLTKAYTALQAWKYKITSDPKNFTLNWCGPNVCNYTGIYCAPALDDPHIYTVAGVDLNHA  102

Query  1257  NISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVVLS  1078
              ISG+LPE+LGLLTDL+LFHINSNRF G+LP SF  L LL ELD+SNN   G FP VVL 
Sbjct  103   TISGSLPEELGLLTDLSLFHINSNRFCGSLPNSFDKLHLLHELDISNNQFSGPFPEVVLC  162

Query  1077  LPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANNNL  898
             +P LK+LDIR+N F G +P  ++D+KLDALF+N+NNF  +LP N GNSPVSV+VFANN+L
Sbjct  163   IPNLKYLDIRFNNFHGNVPSRLFDVKLDALFINNNNFQFSLPENLGNSPVSVVVFANNDL  222

Query  897   RGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMGKL  718
             +GCLP S+ KM+ TL+EII+ N  L  CLP EIG L ++ VFDVSFN LVG LPES+G++
Sbjct  223   KGCLPLSLVKMKGTLNEIIITNSGLTGCLPSEIGDLDKVTVFDVSFNKLVGELPESLGRM  282

Query  717   KKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIPYW  538
             K+LEQLNVAHN LSGEIP S+C LPRL+NFTYSYNYFCS   +C K+K K+D KNCIPY 
Sbjct  283   KRLEQLNVAHNMLSGEIPESVCMLPRLENFTYSYNYFCSESPVCLKLKEKDDTKNCIPYR  342

Query  537   PHQRSPETCKAFYSKPVDCSVLGC  466
             P Q+SP+ CKAFY+ PV CS  GC
Sbjct  343   PLQKSPDECKAFYAHPVHCSAFGC  366



>ref|XP_008798454.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Phoenix 
dactylifera]
Length=380

 Score =   460 bits (1184),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 232/326 (71%), Positives = 264/326 (81%), Gaps = 0/326 (0%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             NPRL  A++ALQA KH IT+DPKNFT +W GP+VCNYTGVYCAPAPDD  + TVAG+DLN
Sbjct  35    NPRLEKAYVALQALKHSITSDPKNFTLNWCGPHVCNYTGVYCAPAPDDPHVLTVAGVDLN  94

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             HA I+GTLPEDLGLLTDLALFHINSNRF GTLP SF+ L  L+ELDVSNNLL G FP+VV
Sbjct  95    HARIAGTLPEDLGLLTDLALFHINSNRFEGTLPTSFNQLERLYELDVSNNLLEGPFPSVV  154

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
             L LP LKFLDIRYN+F G +P +V+DL LDA F+N N F  +LP N GNSPVSVLV A+N
Sbjct  155   LHLPSLKFLDIRYNKFHGDVPSDVFDLTLDAFFINSNQFRFSLPENIGNSPVSVLVAADN  214

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
              L GCLP S+  M KTL++IIL+N S+ +C+P EIG L+ L VFDVSFNNLVG LPES+G
Sbjct  215   QLNGCLPKSLGNMAKTLNQIILINSSISSCIPPEIGKLENLTVFDVSFNNLVGPLPESIG  274

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIP  544
              +KKLEQL+VAHNKLSG IP SICELPRLKNFTYSYNYFC APE C ++K  +DKKNCIP
Sbjct  275   NMKKLEQLDVAHNKLSGFIPESICELPRLKNFTYSYNYFCGAPEQCLRIKRTDDKKNCIP  334

Query  543   YWPHQRSPETCKAFYSKPVDCSVLGC  466
              WP QRS E C AF SKPV C   GC
Sbjct  335   DWPKQRSEEECHAFLSKPVYCDSNGC  360



>ref|XP_010092426.1| Leucine-rich repeat extensin-like protein 6 [Morus notabilis]
 gb|EXB51144.1| Leucine-rich repeat extensin-like protein 6 [Morus notabilis]
Length=427

 Score =   461 bits (1186),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 229/346 (66%), Positives = 266/346 (77%), Gaps = 5/346 (1%)
 Frame = -3

Query  1497  SKPSHQAY--DDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGV  1324
             SKPS      D   P+ P  NPRL  AF ALQAWKH IT+DPKNFT +W+GP+VCNYTGV
Sbjct  23    SKPSQGQLVPDIHDPLIP--NPRLLKAFKALQAWKHAITSDPKNFTSNWWGPHVCNYTGV  80

Query  1323  YCAPAPDD-KEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHL  1147
             YCAPAPDD     TVAGID+NHA I+G+LPE+LGLLTDL+LFHINSNRF GT+P+SFS L
Sbjct  81    YCAPAPDDPHNTTTVAGIDINHAKIAGSLPEELGLLTDLSLFHINSNRFKGTIPKSFSCL  140

Query  1146  RLLFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNF  967
             +LL+ELD+SNN   G FP VVL LP LK+LDIR+N+F+G IP  ++D+KLDA+FVN+N F
Sbjct  141   KLLYELDISNNQFSGKFPTVVLFLPSLKYLDIRFNKFKGDIPSRLFDVKLDAVFVNNNGF  200

Query  966   TVTLPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLK  787
               +LP N GNS  SV+V ANNNL  CLP S+ KM+ TL+EII+ N  L  CLP E+G L 
Sbjct  201   RSSLPENIGNSTASVIVLANNNLNSCLPSSLGKMKDTLNEIIITNSGLKGCLPSELGFLD  260

Query  786   ELKVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYF  607
             +L VFDVS N LVGSLPESMGKL+ LE LNVAHNKLSG IP SIC LPRL+NFTYS NYF
Sbjct  261   KLTVFDVSSNELVGSLPESMGKLRSLELLNVAHNKLSGVIPPSICALPRLENFTYSDNYF  320

Query  606   CSAPEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLG  469
             C  P  C K+K K+D+KNCIPY P QRSP  C AFY  PVDCS  G
Sbjct  321   CGEPLTCLKLKDKDDRKNCIPYRPWQRSPVECTAFYKYPVDCSAFG  366



>ref|XP_011091034.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Sesamum indicum]
Length=365

 Score =   458 bits (1178),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 260/321 (81%), Gaps = 3/321 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             ++PS Q   + P + P  NPRL NAFIALQAWKH+IT DPK FT +WYG  VCNYTGVYC
Sbjct  19    TEPSLQE-SNSPTLLP--NPRLLNAFIALQAWKHLITDDPKGFTSNWYGHGVCNYTGVYC  75

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPDD  I TVAGIDLNHA ISG+LP++LGLLTDLALFH+NSNRF G+LP +F HLRLL
Sbjct  76    APAPDDPHITTVAGIDLNHARISGSLPQELGLLTDLALFHLNSNRFKGSLPDAFRHLRLL  135

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELD+SNNL  G+FP  +L LP LKFLDIRYN+F+GK+P ++++LKLDALF+N+NNF  T
Sbjct  136   YELDISNNLFSGEFPPALLCLPSLKFLDIRYNKFKGKVPSDLFNLKLDALFINNNNFDFT  195

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP+N GNS VSVLV ANNNLRGCLP  I KM KTL+EIIL N  L  CLP+EIG L +L 
Sbjct  196   LPKNIGNSTVSVLVLANNNLRGCLPTGIGKMAKTLNEIILSNAGLSGCLPEEIGSLTKLT  255

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFN+LVGSLP+SMG +K LEQLNVAHNKLSG IP SIC LPRL+NFTYS NY C  
Sbjct  256   VFDVSFNSLVGSLPKSMGNMKSLEQLNVAHNKLSGAIPDSICSLPRLENFTYSDNYICVE  315

Query  597   PEICRKVKHKNDKKNCIPYWP  535
             P  C K++ K+D KNCIPY P
Sbjct  316   PSSCLKLEDKDDAKNCIPYRP  336



>ref|XP_004496690.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Cicer 
arietinum]
Length=404

 Score =   455 bits (1170),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 217/342 (63%), Positives = 263/342 (77%), Gaps = 7/342 (2%)
 Frame = -3

Query  1491  PSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAP  1312
             PSHQ+    PP+    NPRL  A+ ALQAWK   T+DPKNFT +WYGP VCNYTG+YCAP
Sbjct  24    PSHQSL---PPL----NPRLSKAYTALQAWKQTFTSDPKNFTSNWYGPNVCNYTGIYCAP  76

Query  1311  APDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFE  1132
             APDD  I TVAGID+NHANI+G+LPE LGLLTDLALFHINSNRF G+LP +F++L+LL E
Sbjct  77    APDDSYIYTVAGIDINHANIAGSLPEQLGLLTDLALFHINSNRFCGSLPYNFTYLQLLHE  136

Query  1131  LDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLP  952
             LD+SNN   G FP VVL +  LK+LDIR+N FQG IP  ++DLKLDALF+N+N F  +LP
Sbjct  137   LDISNNKFSGKFPEVVLCISSLKYLDIRFNDFQGDIPDRLFDLKLDALFINNNKFQFSLP  196

Query  951   RNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVF  772
              NFGN   SV+VFANN ++GC+P S+ KM+ T++EII+ N  L  CLP+EIG L ++ VF
Sbjct  197   ENFGNISASVVVFANNEIKGCVPSSVVKMKDTINEIIIRNSGLKGCLPNEIGKLDKVTVF  256

Query  771   DVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPE  592
             DVSFN LVG LPES+G +K LEQLNVA+N+ SG IP SIC LPRL+NFTYSYNYFC   E
Sbjct  257   DVSFNELVGELPESIGDMKSLEQLNVANNRFSGVIPESICRLPRLENFTYSYNYFCEESE  316

Query  591   ICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              C K+K K+D+KNCIPY P QRS   C+ FY  P+ C+  GC
Sbjct  317   TCVKLKVKDDRKNCIPYRPLQRSIYECETFYKHPLHCTGFGC  358



>ref|XP_009408506.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Musa 
acuminata subsp. malaccensis]
Length=405

 Score =   454 bits (1168),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 217/330 (66%), Positives = 262/330 (79%), Gaps = 0/330 (0%)
 Frame = -3

Query  1455  FPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAG  1276
             +P  NPRL  A++ALQAWKH ITADPKN T DW GP+VCNYTGVYCAPA D+    TVAG
Sbjct  53    YPPPNPRLEKAYVALQAWKHAITADPKNLTHDWCGPHVCNYTGVYCAPALDNPHEFTVAG  112

Query  1275  IDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDF  1096
             IDLNH  + GTLPE+LGLL+DLALFH+NSN+F G LP SF  L+LL+ELDVSNN L G F
Sbjct  113   IDLNHGTLEGTLPEELGLLSDLALFHLNSNKFRGALPSSFKCLKLLYELDVSNNQLEGSF  172

Query  1095  PAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLV  916
             P+VVL LP LK+LDIRYN+F G +P  VY+LKLDALF+N+N+FT ++P N GNSPVSVLV
Sbjct  173   PSVVLELPSLKYLDIRYNRFCGDVPSCVYNLKLDALFINNNDFTFSIPDNIGNSPVSVLV  232

Query  915   FANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
             FANN + GC P SI  M +TL E+I++N  L AC+P EIG+L++L+V D+S+N+LVG LP
Sbjct  233   FANNQISGCFPKSIGNMHETLRELIILNTGLRACIPPEIGMLRKLRVLDLSYNHLVGPLP  292

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             ES+G++KKLEQL+VAHNKLSG+IP SIC+LPRLKNFTYSYNYFC  P  C K+K  +D+K
Sbjct  293   ESIGEMKKLEQLDVAHNKLSGKIPCSICDLPRLKNFTYSYNYFCEEPPSCLKIKTHDDRK  352

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC P+ P QR  E C AF SKP  C   GC
Sbjct  353   NCFPFRPDQRPEEQCMAFLSKPRYCDSNGC  382



>ref|XP_006489595.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Citrus 
sinensis]
Length=397

 Score =   451 bits (1159),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 258/334 (77%), Gaps = 2/334 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             S+PS     D     P  NPRL  A+ ALQAWK+ IT+DP  FT +WYGP VCNYTGVYC
Sbjct  23    SEPSQSIDIDIGLTIP--NPRLSKAYTALQAWKYAITSDPNGFTSNWYGPDVCNYTGVYC  80

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPDD    TVAGIDLNHANI+GTLPE+LGLL DLALFH+NSNRF GT+P SF ++RLL
Sbjct  81    APAPDDPRSLTVAGIDLNHANIAGTLPEELGLLEDLALFHLNSNRFCGTIPDSFRNMRLL  140

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             FELDVS N   G FP+VVL LP LKFLDIR+NQF+G IP  V+DLKLDALF+N+N F+ +
Sbjct  141   FELDVSTNQFSGCFPSVVLCLPSLKFLDIRFNQFEGAIPSAVFDLKLDALFINNNKFSSS  200

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP+N GNSPVSVLV ANNNL  C+P S+ KM  TL+EIIL+N  L  C P +IGLL ++ 
Sbjct  201   LPKNIGNSPVSVLVLANNNLNSCIPSSLTKMAGTLNEIILLNTGLTGCFPQDIGLLNQVT  260

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDV FNNL G LPESMG +K LEQLNVAHNKLSG IP SIC LP+L+NFTYSYN+FCS 
Sbjct  261   VFDVGFNNLGGPLPESMGNMKSLEQLNVAHNKLSGAIPESICRLPKLENFTYSYNFFCSE  320

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYS  496
             P  C  +K K+D++NCIP  P QRS   CK+FY+
Sbjct  321   PLTCLNLKDKDDRQNCIPNRPLQRSAMECKSFYA  354



>ref|XP_008224262.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Prunus 
mume]
Length=379

 Score =   449 bits (1156),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 212/343 (62%), Positives = 264/343 (77%), Gaps = 10/343 (3%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             KPSHQ            NPRL  A+ ALQAWKHVIT+DP NFT +W G  VCNYTGVYCA
Sbjct  25    KPSHQV----------SNPRLLQAYTALQAWKHVITSDPNNFTANWCGLQVCNYTGVYCA  74

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
             PA DD    TVAGIDLNHANI+G++PE+LGLLTDLA+FHINSNRF GT+P SF +LRLL 
Sbjct  75    PALDDPHTITVAGIDLNHANIAGSMPEELGLLTDLAIFHINSNRFCGTIPYSFRYLRLLH  134

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             ELD+SNN   G FP+ VL +  LK+LDIRYN F G++P  +++LKLDALF+N+N F  +L
Sbjct  135   ELDISNNQFSGQFPSFVLYINSLKYLDIRYNNFHGEVPSALFNLKLDALFLNNNRFQFSL  194

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P+N GNS +SV+V ANN+L+GC+P S+A ++ TL+E+IL+N  L  CLP  +GLL +++V
Sbjct  195   PQNIGNSSLSVIVLANNDLKGCIPSSLANLKDTLNEVILINSGLKGCLPSNLGLLDKVRV  254

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
             FD+S N LVG+LPESMG +K LEQLNVAHNKLSGE+PASIC LP+L+NFT+SYNYFC  P
Sbjct  255   FDISQNKLVGALPESMGGMKNLEQLNVAHNKLSGEVPASICLLPKLENFTHSYNYFCGEP  314

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              IC K+  ++D+KNCI Y P QRSP+ C  FY+  V+C   GC
Sbjct  315   PICIKLPEQDDRKNCIAYRPLQRSPQECATFYAHLVNCDAFGC  357



>ref|XP_009389012.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Musa 
acuminata subsp. malaccensis]
Length=378

 Score =   448 bits (1153),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 213/326 (65%), Positives = 255/326 (78%), Gaps = 0/326 (0%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             NPRL  A++ALQAWKH IT+DPK FT++W GP+VCNYTGVYCAPAPD+    TVAG+DLN
Sbjct  32    NPRLEKAYVALQAWKHSITSDPKGFTENWCGPHVCNYTGVYCAPAPDNPHEFTVAGVDLN  91

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H  I GTLPE+LGLL DLA+FH+NSN+F G LP S   L+LL+ELDVSNN   G FP+VV
Sbjct  92    HGAIEGTLPEELGLLADLAVFHLNSNKFHGALPSSLECLKLLYELDVSNNQFEGSFPSVV  151

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
               LP LKFLDIRYN+F G +P  V+DLKLDALF+N+N  T ++P N GNSPVSVLV ANN
Sbjct  152   FQLPSLKFLDIRYNRFCGDVPSCVFDLKLDALFINNNQLTFSIPDNIGNSPVSVLVLANN  211

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
              + GC P SIA M +TL E++++N  L AC+P EIG L +L+V DVS+N+LVG LPES+G
Sbjct  212   QITGCFPKSIANMHETLRELVILNTGLRACIPPEIGRLDKLRVLDVSYNHLVGPLPESIG  271

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIP  544
              ++KLEQL+VAHNKLSGEIP SIC+LPRLKNFTYSYNYFC  P  C K++  +D+KNCIP
Sbjct  272   GMRKLEQLDVAHNKLSGEIPCSICDLPRLKNFTYSYNYFCGEPPQCLKIRSHDDRKNCIP  331

Query  543   YWPHQRSPETCKAFYSKPVDCSVLGC  466
             Y P QR PE C AF SKP  C   GC
Sbjct  332   YRPDQRPPEQCMAFLSKPKYCDSNGC  357



>ref|XP_011030645.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Populus 
euphratica]
Length=366

 Score =   447 bits (1149),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 258/333 (77%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP FP  +P+L  A+IALQAWK VIT+DP  FT +W GP+VCNYTGVYCAPAP D  I T
Sbjct  31    PPDFPIISPQLMEAYIALQAWKQVITSDPNQFTANWQGPHVCNYTGVYCAPAPYDPFILT  90

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHANI+G LPE+LGLL DLALFHINSNRF G +P SF HL+ LFELD+SNN   
Sbjct  91    VAGIDLNHANIAGFLPEELGLLKDLALFHINSNRFFGVIPDSFVHLKFLFELDISNNRFS  150

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP+VV  L  LK+LD+R+N+F GKIP ++++LKLDALF+N+N F   LP N GNSPVS
Sbjct  151   GPFPSVVFFLHSLKYLDVRFNEFDGKIPPQLFELKLDALFINNNRFHSALPANLGNSPVS  210

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V V ANN++RGC+PPS+A M +TL EIIL N++L  CL  +IGLL+ L V DVSFNNL G
Sbjct  211   VFVVANNDIRGCIPPSLANMAETLDEIILSNMALTGCLRQDIGLLRGLTVLDVSFNNLAG  270

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPES+G ++ LEQLNVAHNK SG++P+SIC LP+L+NFTYS+NYF   P +C ++   +
Sbjct  271   PLPESIGAMRNLEQLNVAHNKFSGQVPSSICSLPKLENFTYSFNYFSGEPLVCLRLPGND  330

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D++NCIP  P QR+PE C  FY +P+ C  + C
Sbjct  331   DRRNCIPNRPFQRTPEECSNFYVQPISCGSIQC  363



>gb|EYU41449.1| hypothetical protein MIMGU_mgv1a007525mg [Erythranthe guttata]
Length=404

 Score =   447 bits (1149),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/344 (67%), Positives = 260/344 (76%), Gaps = 1/344 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             +KPS Q  +  PP  P  NPRL NAFIALQAWKH IT DPKN T +W GP    +   YC
Sbjct  20    TKPSLQESNPPPPPLPPTNPRLSNAFIALQAWKHAITGDPKNLTANWCGPTYALHRS-YC  78

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APAPDD    TVAGIDLNH  ISG+LPE+LGLLTDLALFHINSNRF  TLP SF  L LL
Sbjct  79    APAPDDPHTITVAGIDLNHGRISGSLPEELGLLTDLALFHINSNRFKKTLPESFRDLHLL  138

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELD+SNN   G FP+VVL LP LKFLDIRYN+F G++P E++D KLDA+F+N+N+F   
Sbjct  139   YELDISNNRFAGVFPSVVLCLPTLKFLDIRYNKFHGEVPSELFDRKLDAIFINNNDFEFR  198

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP+N  NS VSVLV ANN+LRGCLPP I +M KTL+EIIL N  L  CL DEIGLLK+L 
Sbjct  199   LPKNIWNSTVSVLVLANNDLRGCLPPGIGRMAKTLNEIILTNSGLSGCLTDEIGLLKKLT  258

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVS N LVGSLPE MG ++ LEQLNVA NK SG+IPASIC LPRL+NFTYS NYFC  
Sbjct  259   VFDVSNNKLVGSLPEKMGNMESLEQLNVAGNKFSGQIPASICSLPRLENFTYSDNYFCGE  318

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P+ C K+K K+D+KNCIPY P QRS E C  FYS PVDC   GC
Sbjct  319   PKSCLKLKDKDDRKNCIPYRPKQRSAEECHVFYSHPVDCGAPGC  362



>ref|XP_010024229.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Eucalyptus 
grandis]
Length=395

 Score =   446 bits (1147),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 224/327 (69%), Positives = 264/327 (81%), Gaps = 1/327 (0%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDD-KEIRTVAGIDL  1267
             NPRL+NA+IALQAWKH IT+DPKN T +W GP VCNYT V+CAPAP D   + TVAGIDL
Sbjct  43    NPRLFNAYIALQAWKHAITSDPKNITGNWCGPEVCNYTRVFCAPAPGDPHNLTTVAGIDL  102

Query  1266  NHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAV  1087
             NH NISG+LPEDLGLL DLALFHINSNRF GTLP SF  LRLLFELDVSNNLL G FP V
Sbjct  103   NHGNISGSLPEDLGLLADLALFHINSNRFHGTLPESFRKLRLLFELDVSNNLLSGKFPTV  162

Query  1086  VLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN  907
             V  LP LKFLDIR+N+++GK+P  V+DLKLDALF+N+NNF+ +LP N GNSPVSV+V AN
Sbjct  163   VFDLPSLKFLDIRFNRYRGKVPARVFDLKLDALFINNNNFSFSLPPNIGNSPVSVIVIAN  222

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
             NNL  CLP SI+ M KTL++II+ N  L  CLP +IG LK + VFDVS N+LVG LP+++
Sbjct  223   NNLNSCLPSSISNMSKTLNQIIITNSGLTGCLPPDIGALKNVTVFDVSGNDLVGKLPDTI  282

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             G ++ LEQLNVAHNKLSG+IP SIC LP+L+NFTYS NYFC  PEIC K+++++D++NCI
Sbjct  283   GHMRALEQLNVAHNKLSGDIPKSICSLPKLQNFTYSDNYFCGEPEICLKLQNEDDRENCI  342

Query  546   PYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P  P QRS E C AFYS PVDC   GC
Sbjct  343   PDRPLQRSAEECDAFYSHPVDCGAYGC  369



>ref|XP_010694037.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Beta 
vulgaris subsp. vulgaris]
Length=427

 Score =   446 bits (1148),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 211/327 (65%), Positives = 254/327 (78%), Gaps = 0/327 (0%)
 Frame = -3

Query  1446  ENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDL  1267
              N RL+NAFIALQAWK  IT+DP  FT +W G  VC Y G+YCAPAPDD  ++TVAGIDL
Sbjct  40    SNIRLHNAFIALQAWKKAITSDPNGFTSNWKGHDVCTYKGIYCAPAPDDAHVKTVAGIDL  99

Query  1266  NHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAV  1087
             NHANISGTLP +LGLLTDLA+ H+NSNRF GT+P SFSHL+LL+ELD+SNNL CG FP+V
Sbjct  100   NHANISGTLPNELGLLTDLAVLHLNSNRFFGTIPTSFSHLKLLYELDISNNLFCGKFPSV  159

Query  1086  VLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN  907
             +L L  LKFLDIRYN F+G IP +V+DL+LDALF+N+NNF+ T+P+N G+S VSVLV AN
Sbjct  160   ILCLTSLKFLDIRYNHFEGSIPDKVFDLRLDALFLNNNNFSSTIPKNIGSSTVSVLVLAN  219

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
             NNL GC P  I  M +TL EIIL N  L  CLP  +G LK+  VFDVSFN+L G+LP+S+
Sbjct  220   NNLNGCFPHEITNMGRTLHEIILTNAGLKGCLPSSVGELKQATVFDVSFNDLTGTLPDSI  279

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             GK++ LEQLNVAHNK  GEIPASIC LP L+NFTYS+NYFC  P  C ++  K+D  NC+
Sbjct  280   GKMESLEQLNVAHNKFYGEIPASICCLPSLENFTYSHNYFCGEPIQCLRLPDKDDSFNCL  339

Query  546   PYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P+   QRS E CKAF S P +C+  GC
Sbjct  340   PFRQGQRSLEECKAFISYPPNCNTFGC  366



>ref|XP_010488313.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Camelina 
sativa]
Length=462

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/342 (63%), Positives = 261/342 (76%), Gaps = 1/342 (0%)
 Frame = -3

Query  1488  SHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPA  1309
             +H  +   P + P  NPRL  AF ALQAWK  IT+DP  FT +W GP+VCNYTGV+CAPA
Sbjct  31    THPCFPHAPFLPPIANPRLLKAFAALQAWKFTITSDPNGFTSNWCGPHVCNYTGVFCAPA  90

Query  1308  PDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFEL  1129
              D+  + TVAGIDLNHANI+G LP +LGLLTDLALFHINSNRF G LP++   L+LL EL
Sbjct  91    LDNPYVLTVAGIDLNHANIAGYLPIELGLLTDLALFHINSNRFEGQLPKTLKCLQLLHEL  150

Query  1128  DVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPR  949
             DVSNN LCG+FP+V+ SLP LKFLDIR+N+F+G +P +++DL LDALF+N N F   LPR
Sbjct  151   DVSNNKLCGEFPSVIFSLPSLKFLDIRFNEFEGDVPSQLFDLNLDALFINDNKFRFRLPR  210

Query  948   NFGNSPVSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVF  772
             N GNSPVSVLV ANN+L+G C+PPS   M KTL E+IL N  L  CL  EIGLL +L VF
Sbjct  211   NIGNSPVSVLVLANNDLQGSCVPPSFYNMGKTLHEVILSNSQLTGCLNREIGLLNQLTVF  270

Query  771   DVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPE  592
             DVS+NNLVGSLPE++G +K LEQLN+AHNK SG IP SIC LPRL+NFTYSYN+F   P 
Sbjct  271   DVSYNNLVGSLPETIGDMKSLEQLNIAHNKFSGYIPESICRLPRLENFTYSYNFFSGEPP  330

Query  591   ICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +C +++  +D++NC+P  P QRSP  CK+F S P+DC   GC
Sbjct  331   VCLRLQEFDDRQNCLPSRPMQRSPTECKSFASHPIDCGSFGC  372



>gb|KEH43816.1| LRR/extensin 2 [Medicago truncatula]
Length=382

 Score =   443 bits (1139),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 257/341 (75%), Gaps = 7/341 (2%)
 Frame = -3

Query  1488  SHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPA  1309
             SHQ+    PP+    NPRL  A+IALQAWK   T+DPKN T +WYGP VCNYTG+ CAP+
Sbjct  24    SHQSL---PPL----NPRLTKAYIALQAWKQTFTSDPKNTTLNWYGPNVCNYTGIICAPS  76

Query  1308  PDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFEL  1129
              DD  I TVAGID+NHANI+G+LPE+LGLLTD+ALFHINSNRF G+LP SF+HL LL EL
Sbjct  77    LDDPYINTVAGIDINHANIAGSLPEELGLLTDIALFHINSNRFYGSLPNSFNHLHLLHEL  136

Query  1128  DVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPR  949
             D+SNN   G FP VVL +P LK+LDIRYN FQG +PK ++DLKLDALF+N+N F  +LP 
Sbjct  137   DISNNQFSGTFPEVVLCIPSLKYLDIRYNNFQGNVPKGLFDLKLDALFINNNKFKFSLPE  196

Query  948   NFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFD  769
             NFG  P SV+VFANN+++GC+P S+A M+ T++EII+ N  +  CLP++IG L ++ VFD
Sbjct  197   NFGKMPASVVVFANNDIQGCIPSSVANMKDTINEIIMTNSRMKGCLPNDIGKLDKVTVFD  256

Query  768   VSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEI  589
             VSFN  VG LPES+  +K LEQLNVAHNK SG IP SIC LPRLKN TYSYNY     EI
Sbjct  257   VSFNEFVGELPESISGMKSLEQLNVAHNKFSGVIPESICRLPRLKNLTYSYNYLSGESEI  316

Query  588   CRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             C K+  K+D KNCIP+   QRS   C AFY  PV C+ +GC
Sbjct  317   CVKLDDKDDTKNCIPHMHFQRSSHGCDAFYEHPVHCTGVGC  357



>gb|ACU18125.1| unknown [Glycine max]
Length=390

 Score =   443 bits (1139),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 266/342 (78%), Gaps = 3/342 (1%)
 Frame = -3

Query  1491  PSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAP  1312
             PSHQ  D   P+ P  NPRL  A+ ALQAWKH IT+DPKNFT +W GP VCNYTG+YCAP
Sbjct  29    PSHQ--DPSSPLPPI-NPRLTKAYTALQAWKHKITSDPKNFTLNWCGPNVCNYTGIYCAP  85

Query  1311  APDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFE  1132
             A DD  I TVAG+DLNHA ISG+LPE+LGLLTDL+L HINSNRF G+LP SF  L LL E
Sbjct  86    ALDDPHIYTVAGVDLNHATISGSLPEELGLLTDLSLLHINSNRFCGSLPTSFDKLHLLHE  145

Query  1131  LDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLP  952
             LD+SNN   G FP VVL +P LK+LDIR+N F G +P  ++D+KLDALF+N+NNF  +LP
Sbjct  146   LDISNNQFSGPFPEVVLCIPNLKYLDIRFNNFHGNVPSRLFDVKLDALFINNNNFQFSLP  205

Query  951   RNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVF  772
              NFGNS  SV+VFANN+L+GCLP S+ KM+ TL+EII+ N  L  CLP EIG L  + VF
Sbjct  206   NNFGNSTASVVVFANNDLKGCLPSSLVKMKGTLNEIIITNSGLTGCLPSEIGDLDMVTVF  265

Query  771   DVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPE  592
             DVSFN LVG LPES+G++KKLEQLNVA+N+LSGEIP S+C LPRL+NFTYSYNYFCS   
Sbjct  266   DVSFNKLVGELPESLGRMKKLEQLNVANNELSGEIPESVCMLPRLENFTYSYNYFCSESP  325

Query  591   ICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              C K+K K+D KNCIPY P QRS + CKAFY+ PV CS  GC
Sbjct  326   TCLKLKDKDDTKNCIPYRPLQRSLDECKAFYAHPVHCSAFGC  367



>ref|XP_002517083.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45246.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=364

 Score =   442 bits (1136),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 217/345 (63%), Positives = 258/345 (75%), Gaps = 2/345 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPSHQ     P + P  NPRL  A+IALQ WK  IT+DP  FT +WYG  VCNYTGVYC
Sbjct  18    SKPSHQNIFPFPSL-PILNPRLLQAYIALQTWKFAITSDPNQFTANWYGHNVCNYTGVYC  76

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA DD    TVAGIDLNHANI+G LPE+LGLL DLALFH+NSNRF GT+P SF  L LL
Sbjct  77    APALDDPHTLTVAGIDLNHANIAGFLPEELGLLKDLALFHLNSNRFCGTIPASFIKLHLL  136

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELD+SNN   G FP V+L LP LKFLDIR+N F G+IP++++DL LDALF+N N F   
Sbjct  137   YELDISNNQFSGPFPCVILYLPSLKFLDIRFNDFSGEIPEQLFDLNLDALFLNDNKFVSG  196

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP N GNSP+SV V ANNN+ GC+PPS+A+M +TL EIIL N+ L  CL  +IG+L ELK
Sbjct  197   LPENLGNSPISVFVLANNNIGGCIPPSLARMAETLEEIILSNLGLKGCLRQDIGMLTELK  256

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             V DVS N L GSLPES+G++K LEQLNVA NK SG IP SIC LP L+NFTYS+NYF S 
Sbjct  257   VLDVSCNKLSGSLPESIGEMKNLEQLNVARNKFSGHIPESICSLPNLENFTYSFNYFSSE  316

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPV-DCSVLGC  466
             P +C ++   +D+KNCIPY P QRS E C++FYS PV +C+   C
Sbjct  317   PSVCLRLPANDDRKNCIPYRPLQRSLEECRSFYSHPVSNCAATAC  361



>gb|KCW60691.1| hypothetical protein EUGRSUZ_H03422, partial [Eucalyptus grandis]
Length=328

 Score =   439 bits (1128),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 261/324 (81%), Gaps = 1/324 (0%)
 Frame = -3

Query  1434  LYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDD-KEIRTVAGIDLNHA  1258
             L+NA+IALQAWKH IT+DPKN T +W GP VCNYT V+CAPAP D   + TVAGIDLNH 
Sbjct  1     LFNAYIALQAWKHAITSDPKNITGNWCGPEVCNYTRVFCAPAPGDPHNLTTVAGIDLNHG  60

Query  1257  NISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVVLS  1078
             NISG+LPEDLGLL DLALFHINSNRF GTLP SF  LRLLFELDVSNNLL G FP VV  
Sbjct  61    NISGSLPEDLGLLADLALFHINSNRFHGTLPESFRKLRLLFELDVSNNLLSGKFPTVVFD  120

Query  1077  LPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANNNL  898
             LP LKFLDIR+N+++GK+P  V+DLKLDALF+N+NNF+ +LP N GNSPVSV+V ANNNL
Sbjct  121   LPSLKFLDIRFNRYRGKVPARVFDLKLDALFINNNNFSFSLPPNIGNSPVSVIVIANNNL  180

Query  897   RGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMGKL  718
               CLP SI+ M KTL++II+ N  L  CLP +IG LK + VFDVS N+LVG LP+++G +
Sbjct  181   NSCLPSSISNMSKTLNQIIITNSGLTGCLPPDIGALKNVTVFDVSGNDLVGKLPDTIGHM  240

Query  717   KKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIPYW  538
             + LEQLNVAHNKLSG+IP SIC LP+L+NFTYS NYFC  PEIC K+++++D++NCIP  
Sbjct  241   RALEQLNVAHNKLSGDIPKSICSLPKLQNFTYSDNYFCGEPEICLKLQNEDDRENCIPDR  300

Query  537   PHQRSPETCKAFYSKPVDCSVLGC  466
             P QRS E C AFYS PVDC   GC
Sbjct  301   PLQRSAEECDAFYSHPVDCGAYGC  324



>ref|XP_010466571.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Camelina 
sativa]
Length=516

 Score =   446 bits (1146),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 214/345 (62%), Positives = 262/345 (76%), Gaps = 1/345 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             + P +  +   P + P  NPRL  AF ALQAWK  IT+DP  FT +W GP+VCNYTGV+C
Sbjct  86    THPIYPCFPHAPFLPPIGNPRLLKAFAALQAWKFTITSDPNGFTSNWCGPHVCNYTGVFC  145

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA D+  + TVAGIDLNHANI+G LP +LGLLTDLALFHINSNRF G LP++   L+LL
Sbjct  146   APALDNPYVLTVAGIDLNHANIAGYLPIELGLLTDLALFHINSNRFEGQLPKTLKCLQLL  205

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
              ELDVSNN LCG+FP+V+ SLP LKFLDIR+N+F+G +P +++DL LDALF+N N F   
Sbjct  206   HELDVSNNKLCGEFPSVIFSLPSLKFLDIRFNEFEGDVPSQLFDLNLDALFINDNKFRFR  265

Query  957   LPRNFGNSPVSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKEL  781
             LPRN GNSPVSVLV ANN+L+G C+PPS   M KTL E+IL N  L  CL  EIGLL +L
Sbjct  266   LPRNIGNSPVSVLVLANNDLQGSCVPPSFYNMGKTLHEVILSNSQLTGCLNREIGLLNQL  325

Query  780   KVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCS  601
              VFDVS+NNLVGSLPE++G +K LEQLN+AHNK SG IP SIC LPRL+NFTYSYN+F  
Sbjct  326   TVFDVSYNNLVGSLPETIGNMKSLEQLNIAHNKFSGYIPESICRLPRLENFTYSYNFFSG  385

Query  600   APEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              P +C +++  +D++NC+P  P QRSP  CK+F S P+DC   GC
Sbjct  386   EPPVCLRLQEFDDRQNCLPSRPMQRSPAECKSFASHPIDCGSFGC  430



>gb|KDP40220.1| hypothetical protein JCGZ_02218 [Jatropha curcas]
Length=370

 Score =   440 bits (1132),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 217/345 (63%), Positives = 260/345 (75%), Gaps = 1/345 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPS+Q      P FP  NPRL  A+IALQAWK  IT+DP NFT +WYG  VCNYTGVYC
Sbjct  23    SKPSYQDDIFPFPSFPILNPRLMKAYIALQAWKLAITSDPNNFTANWYGHNVCNYTGVYC  82

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA DD  I TVAGIDLNHANI+G LPE+LGLL DLALFH+NSNRF GT+P SF HL LL
Sbjct  83    APALDDPHILTVAGIDLNHANIAGYLPEELGLLKDLALFHLNSNRFCGTIPASFIHLHLL  142

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELDVSNN   G FP VVL LP LK+LDIR+NQF G+IP+EV+DL LDALF+N N F  +
Sbjct  143   YELDVSNNQFSGPFPYVVLYLPSLKYLDIRFNQFDGEIPEEVFDLPLDALFLNDNKFESS  202

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP N GNSPVSV V AN+N+RGC+PPS+A+M  TL EI+L N+ L  CL  +IG+LK LK
Sbjct  203   LPENLGNSPVSVFVLANSNVRGCIPPSLARMAATLEEIVLSNLGLTGCLRQDIGVLKGLK  262

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             V D+SFN L G LP S+G+++ LEQLNVAHNK  G++P SIC LP LKNFTYS+NYF   
Sbjct  263   VLDLSFNKLSGYLPASIGEMRNLEQLNVAHNKFYGQVPQSICSLPNLKNFTYSFNYFSGE  322

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
               +C ++   +D++NCIP  P QRSPE C++FY+ + V C    C
Sbjct  323   SPVCLRLPAIDDQRNCIPSRPFQRSPEECRSFYAHQRVICGANKC  367



>ref|XP_002314670.2| hypothetical protein POPTR_0010s09320g, partial [Populus trichocarpa]
 gb|EEF00841.2| hypothetical protein POPTR_0010s09320g, partial [Populus trichocarpa]
Length=358

 Score =   439 bits (1130),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 204/328 (62%), Positives = 256/328 (78%), Gaps = 0/328 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP FP  +P+L  A+IALQAWK  IT+DP +FT +W+GP+VCNYTGVYCAPAP D  I T
Sbjct  31    PPDFPIVSPQLMEAYIALQAWKQAITSDPNHFTANWHGPHVCNYTGVYCAPAPYDPFILT  90

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHANI+G LPE+LGLL DLALFHINSNRF G +P SF HL+ LFELD+SNN   
Sbjct  91    VAGIDLNHANIAGFLPEELGLLKDLALFHINSNRFFGVIPDSFIHLKFLFELDISNNRFS  150

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP+VV  L  LK+LD+R+N+F GKIP ++++LKLDALF+N+N F   LP N GNSPVS
Sbjct  151   GPFPSVVFFLHSLKYLDVRFNEFDGKIPPQLFELKLDALFINNNRFHSALPANLGNSPVS  210

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V V ANN++RGC+PPS+A M +TL EI+L N++L  CL  +IGLL+ L V DVSFNNL G
Sbjct  211   VFVAANNDIRGCIPPSLANMAETLDEIVLSNMALTGCLRQDIGLLRGLTVLDVSFNNLAG  270

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPES+G ++ LEQLNVAHNK SG++P+SIC LP+L+NFTYS+NYF     +C ++   +
Sbjct  271   PLPESVGAMRNLEQLNVAHNKFSGQVPSSICSLPKLENFTYSFNYFSGESLVCLRLPGND  330

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDC  481
             D++NCIP  P QR+PE C  FY+ P+ C
Sbjct  331   DRRNCIPNRPFQRTPEECSNFYAHPISC  358



>ref|XP_009371969.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Pyrus 
x bretschneideri]
Length=386

 Score =   439 bits (1130),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 214/342 (63%), Positives = 263/342 (77%), Gaps = 3/342 (1%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             KPSHQA +  PP+      +   A+ ALQAWKHVIT+DP NFT +W G  VCNYTGVYCA
Sbjct  21    KPSHQASNPPPPLPNPRLLK---AYTALQAWKHVITSDPNNFTANWCGLNVCNYTGVYCA  77

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
             PAPDD    TV+GIDLNHANI G+LPE+LGLLTDLALFH+NSNRF GT+P SF +L LL 
Sbjct  78    PAPDDPHTITVSGIDLNHANIVGSLPEELGLLTDLALFHVNSNRFYGTVPYSFRYLHLLH  137

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             ELD+SNN   G FP  VL L  LKFLD+RYN F G+IP  ++DLKLDALFVN+N F  +L
Sbjct  138   ELDISNNQFSGQFPLSVLYLLSLKFLDVRYNNFLGEIPSTLFDLKLDALFVNNNKFQFSL  197

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P+N GNS +SV+V ANN+L+GC+P S A ++ TL E+ILMN  L  CLP  +GLL ++KV
Sbjct  198   PQNIGNSSLSVIVLANNDLKGCIPSSFANLKDTLDEVILMNSGLRGCLPSNLGLLDKVKV  257

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
             FD+S N+L+G+LPESMG +K LEQLNVA+NK SG++PASIC LP+L+NFTYSYNYFC+ P
Sbjct  258   FDISNNDLLGALPESMGGMKSLEQLNVANNKFSGKVPASICSLPKLENFTYSYNYFCTQP  317

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLG  469
               C K++ +ND+KNCIPY   QRSP+ C  FY+  V+C  LG
Sbjct  318   PTCMKLQEQNDRKNCIPYRQLQRSPKECATFYANLVNCDALG  359



>ref|XP_010511710.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Camelina 
sativa]
Length=430

 Score =   439 bits (1130),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 260/345 (75%), Gaps = 1/345 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             + P +  +   P + P  NPRL  AF ALQAWK  IT+DP  FT +W GP+VCNYTGV+C
Sbjct  31    TYPIYPCFPHAPFLPPIANPRLLKAFAALQAWKFTITSDPNGFTSNWCGPHVCNYTGVFC  90

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA D+  + TVAGIDLN ANI+G LP +LGLLTDLALFHINSNRF G LP +   L+LL
Sbjct  91    APALDNPYVLTVAGIDLNQANIAGYLPIELGLLTDLALFHINSNRFEGQLPETLKCLQLL  150

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
              ELDVSNN LCG+FP+++ SLP LKFLDIR+N+F+G +P +++DL LDALF+N N F   
Sbjct  151   HELDVSNNKLCGEFPSLIFSLPSLKFLDIRFNEFEGDVPSQLFDLNLDALFINDNKFRFR  210

Query  957   LPRNFGNSPVSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKEL  781
             LPRN GNSPVSVLV ANN+L+G C+PPS   M KTL E+IL N  L  CL  EIGLL +L
Sbjct  211   LPRNIGNSPVSVLVLANNDLQGSCVPPSFYNMGKTLHEVILSNSQLTGCLNREIGLLNQL  270

Query  780   KVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCS  601
              VFDVS+NNLVGSLPE++G +K LEQLN+AHNK SG IP SIC LPRL+NFTYSYN+F  
Sbjct  271   TVFDVSYNNLVGSLPETIGDMKSLEQLNIAHNKFSGYIPESICWLPRLENFTYSYNFFSG  330

Query  600   APEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              P +C +++  +D++NC+P  P QRSP  CK+F S P+DC   GC
Sbjct  331   EPPVCLRLQEFDDRQNCLPSRPMQRSPAECKSFASHPIDCGSFGC  375



>ref|XP_009413897.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Musa 
acuminata subsp. malaccensis]
Length=368

 Score =   436 bits (1122),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 214/326 (66%), Positives = 263/326 (81%), Gaps = 0/326 (0%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             NPRL  A++ALQAWKH ITADPKN T DW GP+VCNYTGV+CAPAP+D+   TVAG+DLN
Sbjct  33    NPRLEKAYVALQAWKHAITADPKNLTLDWCGPHVCNYTGVFCAPAPEDRHELTVAGVDLN  92

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H  I+GTLPE+LGLL+DLAL H+NSNRF G LP +F  L+LL+ELDVSNN   G FPAVV
Sbjct  93    HGRIAGTLPEELGLLSDLALLHLNSNRFHGGLPEAFERLQLLYELDVSNNRFQGPFPAVV  152

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
             L LP LK+LDIR+N+F+G++P+ V+DL+LDALF+N N F  +LP + GNS +SVLV ANN
Sbjct  153   LHLPSLKYLDIRFNRFRGEVPRRVFDLRLDALFLNDNQFAFSLPDSIGNSSLSVLVVANN  212

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
              + GC P SI  +  TL+E+IL+N S+ +C+P+++G LK L VFDVSFNNLVG LP+S+G
Sbjct  213   RISGCFPRSITDLADTLNELILLNASITSCIPEDVGKLKNLTVFDVSFNNLVGPLPDSIG  272

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIP  544
             +++KLEQLNVAHN LSG+IP SICELPRLKNFTYSYNYFC  PE C KV+ ++D++NCIP
Sbjct  273   EMRKLEQLNVAHNNLSGDIPESICELPRLKNFTYSYNYFCGEPERCLKVRSRDDRENCIP  332

Query  543   YWPHQRSPETCKAFYSKPVDCSVLGC  466
               PHQRS E C AF SKPV C   GC
Sbjct  333   ERPHQRSEEECIAFSSKPVHCDANGC  358



>ref|XP_008391000.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Malus domestica]
 ref|XP_008360359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Malus domestica]
Length=387

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 212/343 (62%), Positives = 262/343 (76%), Gaps = 3/343 (1%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             KPSHQA +  PP+      +   A+ ALQAWKHVIT+DP NFT +W G  VCNYTGVYCA
Sbjct  21    KPSHQASNPPPPLPNPRLLK---AYTALQAWKHVITSDPNNFTANWCGLNVCNYTGVYCA  77

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
              APDD    TV+GIDLNHANI G+LPE+LGLLTDLALFH+NSNRF GT+P SF +L LL 
Sbjct  78    QAPDDPHTVTVSGIDLNHANIVGSLPEELGLLTDLALFHVNSNRFYGTVPYSFRYLHLLH  137

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             ELD+SNN   G FP  VL L  LKFLD+RYN F+G+IP  ++DLKLDALFVN+N F  +L
Sbjct  138   ELDISNNQFSGQFPLSVLYLLSLKFLDVRYNNFRGEIPSXLFDLKLDALFVNNNKFQFSL  197

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P+N GNS +SV+V ANN+L+GC+P S A ++ TL E+ILMN  L  CLP  +GLL ++KV
Sbjct  198   PQNIGNSSLSVIVLANNDLKGCIPSSFANLKDTLDEVILMNSGLRGCLPSNLGLLDKVKV  257

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
             FD+S N+LVG+LPES G +K LEQLNVA+NK SG++PASIC LP+L+NFTYSYNYFC+ P
Sbjct  258   FDISNNDLVGALPESTGGMKSLEQLNVANNKFSGKVPASICSLPKLENFTYSYNYFCTQP  317

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               C K++ ++D+KNCIPY   QRSP+ C  FY+  V+C   GC
Sbjct  318   PTCMKLQEQDDRKNCIPYRQLQRSPKECATFYANLVNCDAFGC  360



>ref|XP_006838987.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
 gb|ERN01556.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
Length=487

 Score =   439 bits (1129),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 214/338 (63%), Positives = 254/338 (75%), Gaps = 8/338 (2%)
 Frame = -3

Query  1470  DGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEI  1291
             D  P   F NPRL NA+IALQAWKH I +DPKN T++W GP VCNYTGVYCA A DD  I
Sbjct  30    DEQPSLLFPNPRLQNAYIALQAWKHAIVSDPKNITRNWVGPNVCNYTGVYCARALDDPHI  89

Query  1290  RTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNL  1111
               VAGID+NH +I+G LPEDLGLLTDLALFHINSNRF GT+P SF  L+LLFELDVSNN 
Sbjct  90    TVVAGIDVNHDDIAGYLPEDLGLLTDLALFHINSNRFCGTIPMSFKDLKLLFELDVSNNR  149

Query  1110  LCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSP  931
               G FP VVLSL  LK+LD+R+N+F+GK+PKE++D+ LDA+FVNHN F   +P NFGNSP
Sbjct  150   FAGAFPYVVLSLKSLKYLDLRFNEFEGKVPKELFDMDLDAIFVNHNRFRFQIPENFGNSP  209

Query  930   VSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNL  751
             VSV+VFANN LRGCLP SI+KM  TL+EIIL +  L +CLP EIG LK L VFDVSFNN 
Sbjct  210   VSVVVFANNGLRGCLPKSISKMAPTLNEIILSSNGLSSCLPQEIGELKNLTVFDVSFNNF  269

Query  750   VGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKH  571
              G LPES+G++  LEQLN+ HNK  GEIP SIC LP L+NFT+S N+F   P+ C+  ++
Sbjct  270   TGELPESIGEMVSLEQLNIEHNKFYGEIPESICLLPNLENFTFSDNFFVGEPKECKAGRN  329

Query  570   KN--------DKKNCIPYWPHQRSPETCKAFYSKPVDC  481
              N        D+KNCIPY   QRS + C++FY KP  C
Sbjct  330   TNSSARITVSDRKNCIPYAKSQRSEKECESFYKKPPQC  367



>ref|XP_006414930.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
 gb|ESQ56383.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
Length=400

 Score =   434 bits (1117),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 259/333 (78%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+PA D++ IRTV
Sbjct  56    PSLSFENPRLRNAYIALQAWKQAILSDPFNFTANWIGSNVCNYTGVFCSPALDNRRIRTV  115

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  116   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  175

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  176   KFPAVVLRLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENFGDSPVSV  235

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  236   IVLANNRFHGCIPSSMVEM-KNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGP  294

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G++  +EQL+VAHNKLSG+IPASIC+LP+L+NFT+SYN+F     +C ++   +D
Sbjct  295   LPESVGEMVSVEQLDVAHNKLSGKIPASICQLPKLENFTFSYNFFTGEAPVCLRLPEFDD  354

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C    C
Sbjct  355   RRNCLPGRPAQRSPGQCKAFLSQPPVNCGSFSC  387



>ref|NP_188919.1| leucine-rich repeat extensin-like protein 6 [Arabidopsis thaliana]
 sp|Q9LUI1.1|LRX6_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 6; Short=AtLRX6; 
Short=LRR/EXTENSIN6; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01255.1| extensin protein-like [Arabidopsis thaliana]
 gb|ACL13984.1| At3g22800 [Arabidopsis thaliana]
 gb|AEE76678.1| leucine-rich repeat extensin-like protein 6 [Arabidopsis thaliana]
Length=470

 Score =   437 bits (1123),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/330 (64%), Positives = 253/330 (77%), Gaps = 1/330 (0%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  NPRL  AF ALQAWK  IT+DP  FT +W GP VCNYTGV+CAPA D+  + TVAGI
Sbjct  45    PITNPRLLKAFTALQAWKFTITSDPNGFTSNWCGPNVCNYTGVFCAPALDNPYVLTVAGI  104

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNHANI+G LP +LGLLTDLALFHINSNRF G LP++   L LL ELDVSNN L G+FP
Sbjct  105   DLNHANIAGYLPLELGLLTDLALFHINSNRFQGQLPKTLKCLHLLHELDVSNNKLSGEFP  164

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
             +V+ SLP LKFLDIR+N+FQG +P +++DL LDALF+N N F   LPRN GNSPVSVLV 
Sbjct  165   SVIFSLPSLKFLDIRFNEFQGDVPSQLFDLNLDALFINDNKFQFRLPRNIGNSPVSVLVL  224

Query  912   ANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
             ANN+L+G C+PPS  KM KTL EII+ N  L  CL  EIGLL +L VFDVS+NNLVGSLP
Sbjct  225   ANNDLQGSCVPPSFYKMGKTLHEIIITNSQLTGCLNREIGLLNQLTVFDVSYNNLVGSLP  284

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             E++G +K LEQLN+AHNK SG IP SIC LPRL+NFTYSYN+F   P  C +++  +D++
Sbjct  285   ETIGDMKSLEQLNIAHNKFSGYIPESICRLPRLENFTYSYNFFSGEPPACLRLQEFDDRR  344

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC+P  P QRS   CK+F S P+DC+  GC
Sbjct  345   NCLPSRPMQRSLAECKSFSSYPIDCASFGC  374



>ref|XP_002885524.1| hypothetical protein ARALYDRAFT_898761 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61783.1| hypothetical protein ARALYDRAFT_898761 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   432 bits (1112),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 258/345 (75%), Gaps = 1/345 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             + P +  Y   P + P  NPRL  A+ ALQAWK  IT+DP  FT +W GP+VCNYTGVYC
Sbjct  82    TPPINPCYAHAPFLPPIANPRLLKAYAALQAWKFTITSDPNGFTSNWCGPHVCNYTGVYC  141

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA D+  + TVAGIDLNHANI+G LP +LGLLTDLALFHINSNRF G LP++   L LL
Sbjct  142   APALDNPYVLTVAGIDLNHANIAGYLPIELGLLTDLALFHINSNRFQGQLPKTLKCLELL  201

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
              ELDVSNN L G+FP+V+ SLP LKFLDIR+N+FQG +P +++DL LDALF+N N F   
Sbjct  202   HELDVSNNKLSGEFPSVIFSLPSLKFLDIRFNEFQGDVPDQLFDLNLDALFINDNKFQFR  261

Query  957   LPRNFGNSPVSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKEL  781
             LP+N GNSPVSVLV AN +L+G C+PPS  KM KTL E+I+ N  +  CL  EIG+L +L
Sbjct  262   LPKNIGNSPVSVLVLANIDLQGSCVPPSFYKMGKTLHELIISNSQITGCLNREIGMLNQL  321

Query  780   KVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCS  601
              VFDVS+NNLVGSLPE++G +K LEQLN+AHNK SG IP SIC LP L+NFTYSYN+F  
Sbjct  322   TVFDVSYNNLVGSLPETIGDMKSLEQLNIAHNKFSGYIPESICRLPSLENFTYSYNFFSG  381

Query  600   APEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              P  C +++  +D++NC+P  P QRS   CK+F S P+DC+  GC
Sbjct  382   EPPACLRLQEFDDRRNCLPSRPMQRSLAECKSFSSYPIDCASFGC  426



>ref|XP_009110797.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brassica 
rapa]
Length=413

 Score =   431 bits (1107),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 210/336 (63%), Positives = 256/336 (76%), Gaps = 2/336 (1%)
 Frame = -3

Query  1467  GPPVFP-FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEI  1291
             GP  FP   NPRL  A+ ALQAWKH +T+DP  FT +W  P VCNYTGV+CA A D+  +
Sbjct  35    GPYGFPPIVNPRLLKAYTALQAWKHTMTSDPNGFTSNWCSPNVCNYTGVFCAQALDNSYV  94

Query  1290  RTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNL  1111
              TVAGIDLN ANI+G LP +LGLLTDLALFHINSNRF G LP+S + L+LL ELDVSNN 
Sbjct  95    LTVAGIDLNRANIAGYLPLELGLLTDLALFHINSNRFEGQLPKSLNCLKLLHELDVSNNK  154

Query  1110  LCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSP  931
             L G+FP+VV SLP LKFLDIR+N+  G +P +++DL LDALF+N+N F   LP+N GNS 
Sbjct  155   LSGEFPSVVFSLPSLKFLDIRFNELYGDVPSQLFDLNLDALFINNNKFRFRLPKNIGNSQ  214

Query  930   VSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNN  754
             VSVLV ANN+L+G CLPPS  KM KTL E+IL N  +G CL  E+GLL +L VFDVSFNN
Sbjct  215   VSVLVLANNDLQGSCLPPSFYKMGKTLHEVILTNSQIGGCLNREVGLLNQLTVFDVSFNN  274

Query  753   LVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVK  574
             LVGSLPE+MG +K LEQLN+A+NK SG IP SIC LP L+NFTYSYN+F   P +C +++
Sbjct  275   LVGSLPETMGDMKSLEQLNIANNKFSGHIPESICRLPNLENFTYSYNFFSGEPPVCLRLQ  334

Query  573   HKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               +D+KNC+P  P QRSP  CK+F S P++C+  GC
Sbjct  335   EFDDRKNCLPLRPMQRSPAECKSFSSYPINCASFGC  370



>emb|CDX93014.1| BnaA03g37360D [Brassica napus]
Length=456

 Score =   432 bits (1110),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 254/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T +W G  VC YTGV+C+ APD++ IRTV
Sbjct  64    PSLVFENPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVCTYTGVFCSRAPDNRRIRTV  123

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFH+N+NRF GT+P  F HL+LLFELD+SNN   G
Sbjct  124   AGIDLNHADIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFKHLKLLFELDLSNNRFAG  183

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  184   KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPVSV  243

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S  +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  244   VVLANNRFHGCIPSSFVEM-KNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGP  302

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHN+LSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  303   LPESVGGMVSVEQLNVAHNRLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDD  362

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRS E C AF S+ PVDC    C
Sbjct  363   RRNCLPSRPAQRSSEQCAAFLSRPPVDCESFKC  395



>ref|XP_006282938.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
 gb|EOA15836.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
Length=488

 Score =   432 bits (1111),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 257/333 (77%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP  FT +W G  VCNYTGV+C+PA D+++IRTV
Sbjct  52    PSLVFENPRLRNAYIALQAWKQAILSDPNKFTSNWIGSNVCNYTGVFCSPALDNRKIRTV  111

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFH+NSNRF G +P  F+ L+LLFELD+SNN   G
Sbjct  112   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGMVPHRFNRLKLLFELDLSNNRFAG  171

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  172   KFPTVVLRLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPDNFGDSPVSV  231

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EIIL+N  L +CLP +IG LK + VFDVS+N LVG 
Sbjct  232   IVLANNRFHGCVPSSLVEM-KNLNEIILINNGLSSCLPSDIGRLKNVTVFDVSYNELVGP  290

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHNKLSG IPASIC+LP+L+NFT+SYN+F     +C ++   +D
Sbjct  291   LPESVGGMVSVEQLNVAHNKLSGNIPASICQLPKLENFTFSYNFFTGEAPMCLRLPEFDD  350

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C   GC
Sbjct  351   RRNCLPGRPSQRSPGQCKAFLSRPPVNCGSFGC  383



>gb|KDP32304.1| hypothetical protein JCGZ_13229 [Jatropha curcas]
Length=713

 Score =   439 bits (1130),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/332 (63%), Positives = 253/332 (76%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP+N T DW GP VC+YTGV+CAPAPD+K IRTV
Sbjct  68    PSLVFENPRLKNAYIALQAWKQAILSDPQNLTSDWVGPNVCDYTGVFCAPAPDNKTIRTV  127

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F  + LLFELD+SNN   G
Sbjct  128   AGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPHKFKEMTLLFELDLSNNRFAG  187

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   +P NFGNSPVSV
Sbjct  188   KFPQVVLKLPKLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDIPDNFGNSPVSV  247

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN +L +CLP EIG+LK L VFDVSFN L+G 
Sbjct  248   IVLANNRFHGCVPSSLGNM-SNLNEIILMNNNLKSCLPPEIGMLKNLTVFDVSFNQLLGP  306

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S G L  LEQLNVAHN LSG IPASIC+LP L+NFT+SYN+F   P  C  ++   D
Sbjct  307   LPDSFGGLVSLEQLNVAHNLLSGNIPASICQLPNLENFTFSYNFFTGEPPACLSLQGFED  366

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   C+AF SKPV+C+   C
Sbjct  367   RRNCLPGRPVQRSTAQCQAFLSKPVNCNSFRC  398



>emb|CDY10673.1| BnaA05g16890D [Brassica napus]
Length=490

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 207/330 (63%), Positives = 253/330 (77%), Gaps = 1/330 (0%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  NPRL  A+ ALQAWK  +T+DP  FT +W GP+VCNYTGV+CAP  D+  + TVAGI
Sbjct  47    PIANPRLLKAYTALQAWKFTMTSDPNGFTSNWCGPHVCNYTGVFCAPTLDNPYLLTVAGI  106

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNHANI+G LPE+LGLLTDLALFHINSNRF G LP S + L+LL ELDVSNN L G+FP
Sbjct  107   DLNHANIAGYLPEELGLLTDLALFHINSNRFKGQLPMSLNCLKLLHELDVSNNKLSGEFP  166

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
             +VV +LP LKFLDIR+N F G IP +++DL LDALF+N+NNF   LP N GNS VSVLV 
Sbjct  167   SVVFTLPSLKFLDIRFNGFYGDIPSQLFDLNLDALFINNNNFRFRLPGNIGNSTVSVLVL  226

Query  912   ANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
             ANN+L+G C+PPS   M KTL E+IL N  +  CL  EIGLL +L VFDVSFNNLVGSLP
Sbjct  227   ANNDLQGSCVPPSFYNMGKTLHEVILTNSQISGCLNREIGLLTQLTVFDVSFNNLVGSLP  286

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             E+MG +K LEQLN+AHNK SG IP  IC LP L+NFTYSYN+F + P +C +++  +D++
Sbjct  287   ETMGDMKSLEQLNIAHNKFSGYIPEGICRLPNLENFTYSYNFFSAEPPVCLRLQEFDDRR  346

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC+P  P QRSP  C++F S P++C+  GC
Sbjct  347   NCLPMRPIQRSPAECRSFSSYPINCASFGC  376



>ref|XP_009145262.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brassica 
rapa]
Length=486

 Score =   431 bits (1108),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 207/330 (63%), Positives = 253/330 (77%), Gaps = 1/330 (0%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  NPRL  A+ ALQAWK  +T+DP  FT +W GP+VCNYTGV+CAP  D+  + TVAGI
Sbjct  47    PIANPRLLKAYAALQAWKFTMTSDPNGFTSNWCGPHVCNYTGVFCAPTLDNPYLLTVAGI  106

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNHANI+G LPE+LGLLTDLALFHINSNRF G LP S + L+LL ELDVSNN L G+FP
Sbjct  107   DLNHANIAGYLPEELGLLTDLALFHINSNRFKGQLPMSLNCLKLLHELDVSNNKLSGEFP  166

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
             +VV +LP LKFLDIR+N F G IP +++DL LDALF+N+NNF   LP N GNS VSVLV 
Sbjct  167   SVVFTLPSLKFLDIRFNGFYGDIPSQLFDLNLDALFINNNNFRFRLPGNIGNSTVSVLVL  226

Query  912   ANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
             ANN+L+G C+PPS   M KTL E+IL N  +  CL  EIGLL +L VFDVSFNNLVGSLP
Sbjct  227   ANNDLQGSCVPPSFYNMGKTLHEVILTNSQISGCLNREIGLLTQLTVFDVSFNNLVGSLP  286

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             E+MG +K LEQLN+AHNK SG IP  IC LP L+NFTYSYN+F + P +C +++  +D++
Sbjct  287   ETMGDMKSLEQLNIAHNKFSGYIPEGICRLPNLENFTYSYNFFSAEPPVCLRLQEFDDRR  346

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC+P  P QRSP  C++F S P++C+  GC
Sbjct  347   NCLPMRPIQRSPAECRSFSSYPINCASFGC  376



>ref|XP_006389336.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
 gb|ERP48250.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
Length=500

 Score =   431 bits (1108),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 248/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP N T +W G  VCNY GV+C+ APD+K IRTV
Sbjct  26    PSLVFENPRLKNAYMALQAWKQAIFSDPLNLTANWVGSQVCNYEGVFCSRAPDNKTIRTV  85

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LG L DLALFHINSNRF GT+P  F  LRLLFELD+SNN   G
Sbjct  86    AGIDLNHGDIAGYLPEELGFLVDLALFHINSNRFCGTIPHKFKKLRLLFELDLSNNRFAG  145

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  146   KFPQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPVNFGNSPVSV  205

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN    +CLP EIGLLK L VFDVSFN L+G 
Sbjct  206   IVLANNKFHGCVPSSLGNM-SNLNEIILMNNGFRSCLPAEIGLLKNLTVFDVSFNQLIGP  264

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G +  LEQLNVAHN LSG+IPASIC+LP L+NFT+SYN+F   P +C  +   +D
Sbjct  265   LPDTVGGMVSLEQLNVAHNMLSGKIPASICQLPNLENFTFSYNFFTGEPPVCLSLPDFSD  324

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CKAF S PVDCS   C
Sbjct  325   RRNCLPGRPEQRSAAQCKAFLSMPVDCSSFRC  356



>ref|XP_007013226.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY30845.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=740

 Score =   438 bits (1127),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/332 (63%), Positives = 257/332 (77%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP N T +W G  VCNYTGV+CA APD+K+I+TV
Sbjct  70    PSLVFENPRLRNAYIALQAWKQAILSDPFNLTGNWVGSEVCNYTGVFCAAAPDNKKIKTV  129

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F +L++LFELD+SNN   G
Sbjct  130   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFINLKILFELDLSNNRFAG  189

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   +P NFGNSPVSV
Sbjct  190   KFPDVVLKLPKLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFNIPDNFGNSPVSV  249

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L EIILMN    +CLP+EIG+LK L VFDVSFN L+G 
Sbjct  250   IVLANNKFHGCVPSSLGNM-SGLEEIILMNNGFRSCLPEEIGMLKNLTVFDVSFNELMGP  308

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+ +G++  LEQLNVAHN LSGEIPASIC+LP+L+NFT+SYN+F   P +C  ++  +D
Sbjct  309   LPDKIGEMVSLEQLNVAHNMLSGEIPASICKLPKLQNFTFSYNFFTGEPPVCLSLQDFDD  368

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CK+F SKPVDCS   C
Sbjct  369   RRNCLPARPLQRSAAQCKSFLSKPVDCSSFRC  400



>ref|XP_006371912.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
 gb|ERP49709.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
Length=509

 Score =   431 bits (1107),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 247/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F NPRL NA+IALQAWK  I +DP N T +W G  VCNY GV+CAPAPD+K IRTV
Sbjct  71    PSLVFPNPRLRNAYIALQAWKQAIFSDPLNLTANWVGSQVCNYEGVFCAPAPDNKTIRTV  130

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL D+ALFHINSNRF GT+PR F  +RLLFELD+SNN   G
Sbjct  131   AGIDLNHGDIAGYLPEELGLLVDIALFHINSNRFCGTVPRKFKDMRLLFELDLSNNRFAG  190

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP N GNSPVSV
Sbjct  191   KFPQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPENLGNSPVSV  250

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN    +C+P EIGLLK+L V DVSFN L+G 
Sbjct  251   IVLANNKFHGCVPSSLGNM-SNLNEIILMNNGFRSCMPAEIGLLKDLTVLDVSFNQLMGP  309

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP++ G +  LEQLNVAHN LSG+IPASIC+LP L NFT+SYN+F   P +C  +   +D
Sbjct  310   LPDAFGGMASLEQLNVAHNMLSGKIPASICKLPNLDNFTFSYNFFTGEPPVCLSLPDFSD  369

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   C AF S+PVDCS   C
Sbjct  370   RRNCLPARPLQRSAAQCNAFLSRPVDCSSFRC  401



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   440 bits (1131),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/332 (67%), Positives = 254/332 (77%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F N  L +A+IALQAWK  I +DP N T +W G  VC+YTGV+CAP P D  +  V
Sbjct  63    PSLNFPNSHLRDAYIALQAWKLAIISDPLNLTANWVGSDVCSYTGVFCAPLPSDPHLIVV  122

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA I+GTLPEDLGLLTDL LFHINSNRF GTLP SF  L+ L+ELDVSNNLL G
Sbjct  123   AGIDLNHARIAGTLPEDLGLLTDLGLFHINSNRFEGTLPSSFDQLKRLYELDVSNNLLEG  182

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP+V L LP LK+LDIRYN F G++P EV+DL LDA F+N N F  TLP N GNS VSV
Sbjct  183   PFPSVALRLPTLKYLDIRYNNFHGEVPSEVFDLTLDAFFINSNQFRFTLPDNIGNSTVSV  242

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV ANN L GCLP ++A M KTL++IILMN S+ +C+P EIG L +L VFDVSFNNLVG 
Sbjct  243   LVAANNPLTGCLPKTLANMAKTLNQIILMNSSITSCIPPEIGKLDKLTVFDVSFNNLVGP  302

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +KKLEQL+VAHNKLSG IP +IC LPRLKNFTYSYNYFC  PE C K+K ++D
Sbjct  303   LPESIGDMKKLEQLDVAHNKLSGFIPETICALPRLKNFTYSYNYFCGVPEQCTKIKRRDD  362

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             KKNCIP WP QRS E C AF SKPV C   GC
Sbjct  363   KKNCIPDWPKQRSEEECHAFLSKPVYCDANGC  394



>ref|XP_004173680.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like, 
partial [Cucumis sativus]
Length=451

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 247/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N TK+W G  VC+Y GV+CAPAPD+  IRTV
Sbjct  78    PKLVFENDRIRNAYIALQAWKQAILSDPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTV  137

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F +L+LLFELD+SNN   G
Sbjct  138   AGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAG  197

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  198   KFPRVVLELPELKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPENFGNSPVSV  257

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P SI  M + L+EIILMN    +CLP EIG LK L VFDVS N   G 
Sbjct  258   IVLANNKFHGCVPGSIGNMTR-LNEIILMNNGFRSCLPSEIGFLKNLTVFDVSHNEFFGK  316

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G +  LEQLNVAHN LSG+IP SIC+LP L+NFTYSYN+F      C  +   +D
Sbjct  317   LPETIGGMVSLEQLNVAHNFLSGKIPDSICKLPNLQNFTYSYNFFTGEAPSCLALPDFDD  376

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NCIP  P QRS   CK+F SKPVDCS  GC
Sbjct  377   RRNCIPERPVQRSERQCKSFLSKPVDCSSFGC  408



>ref|XP_006299744.1| hypothetical protein CARUB_v10015937mg [Capsella rubella]
 gb|EOA32642.1| hypothetical protein CARUB_v10015937mg [Capsella rubella]
Length=446

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 255/345 (74%), Gaps = 1/345 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             + P +  +   P + P  NPRL  AF ALQAWK  IT+DP  FT +W GP VCNYTGV+C
Sbjct  31    NTPIYPCFPHAPFLPPIGNPRLVKAFTALQAWKFTITSDPNGFTSNWCGPNVCNYTGVFC  90

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA D+  + TVAGIDLNHANI+G LP +LGL TDLALFHINSNRF G LP +   L+LL
Sbjct  91    APALDNPYVLTVAGIDLNHANIAGYLPVELGLFTDLALFHINSNRFQGQLPNTLKCLQLL  150

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
              ELDVSNN LCG+FP+V+ SLP LKFLDIR+N+F+G +P +++DL LDALF+N N F   
Sbjct  151   HELDVSNNKLCGEFPSVIFSLPSLKFLDIRFNEFEGDVPSQLFDLNLDALFINDNKFRFR  210

Query  957   LPRNFGNSPVSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKEL  781
             LP+N GNSPVSVLV ANN+L+G C+PPS   M KTL E+IL N  L  CL  EIG L +L
Sbjct  211   LPKNIGNSPVSVLVLANNDLQGSCVPPSFYNMGKTLHEVILSNSQLTGCLNREIGYLNQL  270

Query  780   KVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCS  601
              VFDVS+NNLVGSLPE++G +K LEQLN+ +NK SG IP SIC L RL+NFTYS+N+F  
Sbjct  271   TVFDVSYNNLVGSLPETIGDMKSLEQLNIQYNKFSGYIPESICRLQRLENFTYSFNFFSG  330

Query  600   APEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              P  C +++  +D++NC+P  P QRSP  CK+F S P DC+  GC
Sbjct  331   EPPSCLRLQEFDDRQNCLPSRPMQRSPAECKSFASYPTDCASFGC  375



>ref|XP_006389464.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
 gb|ERP48378.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
Length=569

 Score =   431 bits (1109),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 248/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP N T +W G  VCNY GV+C+ APD+K IRTV
Sbjct  72    PSLVFENPRLKNAYMALQAWKQAIFSDPLNLTANWVGSQVCNYEGVFCSRAPDNKTIRTV  131

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LG L DLALFHINSNRF GT+P  F  LRLLFELD+SNN   G
Sbjct  132   AGIDLNHGDIAGYLPEELGFLVDLALFHINSNRFCGTIPHKFKKLRLLFELDLSNNRFAG  191

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  192   KFPQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPVNFGNSPVSV  251

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN    +CLP EIGLLK L VFDVSFN L+G 
Sbjct  252   IVLANNKFHGCVPSSLGNM-SNLNEIILMNNGFRSCLPAEIGLLKNLTVFDVSFNQLIGP  310

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G +  LEQLNVAHN LSG+IPASIC+LP L+NFT+SYN+F   P +C  +   +D
Sbjct  311   LPDTVGGMVSLEQLNVAHNMLSGKIPASICQLPNLENFTFSYNFFTGEPPVCLSLPDFSD  370

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CKAF S PVDCS   C
Sbjct  371   RRNCLPGRPEQRSAAQCKAFLSMPVDCSSFRC  402



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   433 bits (1114),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/343 (62%), Positives = 261/343 (76%), Gaps = 10/343 (3%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             KPSHQ            NPRL  A+ ALQAWKHVIT+DP NFT +W G  VCNYTGVYCA
Sbjct  25    KPSHQV----------SNPRLLQAYTALQAWKHVITSDPNNFTANWCGLQVCNYTGVYCA  74

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
             PA DD    TVAGIDLNHANI+G LPE+LGLLTDLALFHINSNRF GT+P SF +LRLL 
Sbjct  75    PALDDPHTITVAGIDLNHANIAGLLPEELGLLTDLALFHINSNRFCGTIPYSFRYLRLLH  134

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             E D+SNN   G FP+ VL +  LK+LDIRYN F G++P  +++LKLDALF+N+N F  +L
Sbjct  135   EFDISNNQFSGQFPSSVLYINSLKYLDIRYNNFHGEVPSALFNLKLDALFLNNNRFQFSL  194

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P+N GNS +SV+V ANN+L+GC+P S+A ++ TL+E+IL+N  L  CLP  +GLL +++V
Sbjct  195   PQNIGNSSLSVIVLANNDLKGCIPSSLANLKDTLNEVILINSGLKGCLPSNLGLLDKVRV  254

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
             FD+  N LVG+LPESMG +K LEQLNVAHNKLSGE+PASIC LP+L+NFTYSYNYFC  P
Sbjct  255   FDIGQNKLVGALPESMGGMKNLEQLNVAHNKLSGEVPASICSLPKLENFTYSYNYFCGEP  314

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              IC K+  ++D+KNCI Y P QRSP+ C  FY+  V+C   GC
Sbjct  315   PICIKLSEQDDRKNCIAYRPLQRSPQECATFYAHLVNCDAFGC  357



>ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
 sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; 
Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
Length=494

 Score =   428 bits (1101),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 203/333 (61%), Positives = 255/333 (77%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T +W G  VCNYTGV+C+ A D+++IRTV
Sbjct  65    PSLIFENPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVCNYTGVFCSKALDNRKIRTV  124

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFH+NSNRF GT+P  F  L+LLFELD+SNN   G
Sbjct  125   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  185   KFPTVVLHLPSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPVSV  244

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  245   IVLANNHFHGCIPTSLVEM-KNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGP  303

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G + ++EQLNVAHN LSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  304   LPESVGGMVEVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLSEFDD  363

Query  561   KKNCIPYWPHQRSPETCKAFYSKP-VDCSVLGC  466
             ++NC+P  P QRS   C AF S+P VDC   GC
Sbjct  364   RRNCLPGRPAQRSSRQCSAFLSRPSVDCGSFGC  396



>ref|XP_010450227.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Camelina sativa]
Length=688

 Score =   435 bits (1118),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 259/333 (78%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+P+ D+++IRTV
Sbjct  54    PSLVFENPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTV  113

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  114   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  173

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP +VL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP+NFG+SPVSV
Sbjct  174   KFPTIVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPKNFGDSPVSV  233

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  234   IVLANNRFHGCVPSSLVEM-KNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGP  292

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHNKLSG+IPASIC+LP+L+NFTYSYN+F     +C  +   +D
Sbjct  293   LPESVGGMVSVEQLNVAHNKLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLTLPEFDD  352

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C   GC
Sbjct  353   RRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFGC  385



>ref|XP_002863246.1| hypothetical protein ARALYDRAFT_497051 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39505.1| hypothetical protein ARALYDRAFT_497051 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 258/333 (77%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+PA D+++IRTV
Sbjct  54    PSLIFENPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPALDNRKIRTV  113

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+S N   G
Sbjct  114   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSYNRFAG  173

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  174   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENFGDSPVSV  233

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  234   IVLANNRFHGCVPSSLVEM-KNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGP  292

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G++  +EQLNVAHNKLSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  293   LPESVGEMVSVEQLNVAHNKLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDD  352

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C    C
Sbjct  353   RRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFIC  385



>emb|CDX94809.1| BnaC03g43790D [Brassica napus]
Length=530

 Score =   429 bits (1102),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 255/333 (77%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T +W G  VC+YTGV+C+ APD++ IRTV
Sbjct  62    PSLVFENPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVCSYTGVFCSRAPDNRRIRTV  121

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFH+NSNRF GT+P  F HL+LLFELD+SNN   G
Sbjct  122   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKHLKLLFELDLSNNRFAG  181

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  182   KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPVSV  241

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S  +M + L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  242   VVLANNRFHGCIPSSFVEM-ENLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGP  300

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHN+LSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  301   LPESVGGMVSVEQLNVAHNQLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDD  360

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRS E C AF S+ PVDC    C
Sbjct  361   RRNCLPSRPAQRSSEQCAAFLSRPPVDCESFKC  393



>ref|XP_002885650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/333 (61%), Positives = 254/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T +W G  VCNYTGV+C+ A D+++IRTV
Sbjct  65    PSLIFENPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVCNYTGVFCSRALDNRKIRTV  124

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFH+NSNRF GT+P  F  L+LLFELD+SNN   G
Sbjct  125   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  185   KFPTVVLHLPSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPVSV  244

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  245   IVLANNHFHGCIPTSLVEM-KNLNEIIFMNNGLNSCLPADIGSLKNVTVFDVSFNELVGP  303

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHN LSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  304   LPESVGGMVAVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDD  363

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRS   C AF S+ PVDC   GC
Sbjct  364   RRNCLPGRPAQRSSRQCSAFLSRPPVDCGSFGC  396



>ref|XP_006406127.1| hypothetical protein EUTSA_v10022219mg [Eutrema salsugineum]
 gb|ESQ47580.1| hypothetical protein EUTSA_v10022219mg [Eutrema salsugineum]
Length=437

 Score =   425 bits (1092),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 250/330 (76%), Gaps = 1/330 (0%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  NPRL  A+ ALQAWK  IT+DP  FT +W GP+VCNYTGV+CAPA D+  + TVAGI
Sbjct  50    PILNPRLLKAYAALQAWKLTITSDPNGFTSNWCGPHVCNYTGVFCAPALDNPYVLTVAGI  109

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLN ANI+G LP +LGLLTDLALFHINSNRF G LP++   L+LL ELDVSNN L G+FP
Sbjct  110   DLNRANIAGYLPLELGLLTDLALFHINSNRFEGQLPKTLKCLKLLHELDVSNNKLSGEFP  169

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
             +V+ SLP LKFLDIR+N F G +P +++DL LDALF+N N F   LP N GNSPVSVLV 
Sbjct  170   SVIFSLPSLKFLDIRFNGFYGDVPSQLFDLNLDALFINDNKFRFRLPENIGNSPVSVLVL  229

Query  912   ANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
             ANN+L+G C+PPS   M KTL E+IL N  L  CL  EIGLL +L VFDVSFN+LVGSLP
Sbjct  230   ANNDLQGSCVPPSFYNMGKTLHEVILSNTHLTGCLNREIGLLNQLTVFDVSFNSLVGSLP  289

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             E+MG +K LEQL +AHNK SG+IP SIC LP L+NFTYS N+F   P +C +++  +D++
Sbjct  290   ETMGDMKSLEQLKIAHNKFSGKIPESICRLPNLENFTYSDNFFSGEPPVCLRLQEFDDRR  349

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC+P  P QRSP  CK+F S P+DC+  GC
Sbjct  350   NCLPLRPMQRSPAECKSFSSYPIDCASFGC  379



>ref|XP_010450229.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Camelina sativa]
Length=733

 Score =   435 bits (1118),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 259/333 (78%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+P+ D+++IRTV
Sbjct  54    PSLVFENPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTV  113

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  114   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  173

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP +VL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP+NFG+SPVSV
Sbjct  174   KFPTIVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPKNFGDSPVSV  233

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  234   IVLANNRFHGCVPSSLVEM-KNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGP  292

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHNKLSG+IPASIC+LP+L+NFTYSYN+F     +C  +   +D
Sbjct  293   LPESVGGMVSVEQLNVAHNKLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLTLPEFDD  352

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C   GC
Sbjct  353   RRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFGC  385



>ref|XP_010527189.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Tarenaya hassleriana]
Length=694

 Score =   434 bits (1115),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 255/333 (77%), Gaps = 3/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A++ALQAWK  I +DP NFT+ W G  VCNYTGV+CAPAPD+ +IRTV
Sbjct  71    PSLVFENPRLRSAYVALQAWKQAILSDPFNFTETWVGSNVCNYTGVFCAPAPDNPQIRTV  130

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFHINSNRF GT+P  FS L+LLFELD+SNN   G
Sbjct  131   AGIDLNHADIAGYLPEELGLLTDLALFHINSNRFCGTVPHRFSQLKLLFELDLSNNRFAG  190

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFGNSPVSV
Sbjct  191   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFQFELPENFGNSPVSV  250

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S++ M K L+EII MN    +CLP +IG L+ + VFDVSFN +VG 
Sbjct  251   IVLANNRFHGCIPASLSNM-KNLNEIIFMNNGFKSCLPTDIGRLRNVTVFDVSFNEIVGP  309

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G++  LEQLNVAHNKLSG+IPASIC+LP+L+NFT+SYNYF   P +C   K    
Sbjct  310   LPEAVGRMVALEQLNVAHNKLSGKIPASICQLPKLENFTFSYNYFTGEPPVCLP-KSXGF  368

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  C AF S+ PVDC    C
Sbjct  369   ERNCLPARPAQRSPGQCAAFLSRPPVDCGSFKC  401



>ref|XP_010488556.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Camelina sativa]
Length=444

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 254/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T DW G  VC+YTGV+C+ A D++ IRTV
Sbjct  67    PSLVFENPRLRSAYIALQAWKQAILSDPNNITLDWIGSNVCSYTGVFCSRALDNRRIRTV  126

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFH+NSNRF GT+PR F  L+LLFELD+SNN   G
Sbjct  127   AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPRKFKQLKLLFELDLSNNRFAG  186

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  187   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPGNLGDSPVSV  246

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+ +M K L+EIILMN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  247   IVLANNHFHGCVPTSLVEM-KNLNEIILMNNHLNSCLPADIGRLKNVTVFDVSFNELVGP  305

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S+G L ++EQLNVAHN LSG+IPAS+C+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  306   LPKSVGGLVEVEQLNVAHNLLSGKIPASVCQLPKLENFTYSYNFFTGEAPVCLRLSQFDD  365

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRS   C AF S+ PVDC    C
Sbjct  366   RRNCLPGRPAQRSSRQCSAFLSRPPVDCRSFSC  398



>ref|XP_010450228.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Camelina sativa]
Length=725

 Score =   434 bits (1117),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 259/333 (78%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+P+ D+++IRTV
Sbjct  54    PSLVFENPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTV  113

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  114   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  173

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP +VL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP+NFG+SPVSV
Sbjct  174   KFPTIVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPKNFGDSPVSV  233

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  234   IVLANNRFHGCVPSSLVEM-KNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGP  292

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHNKLSG+IPASIC+LP+L+NFTYSYN+F     +C  +   +D
Sbjct  293   LPESVGGMVSVEQLNVAHNKLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLTLPEFDD  352

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C   GC
Sbjct  353   RRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFGC  385



>ref|XP_010695983.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Beta 
vulgaris subsp. vulgaris]
Length=362

 Score =   422 bits (1084),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/343 (60%), Positives = 249/343 (73%), Gaps = 5/343 (1%)
 Frame = -3

Query  1494  KPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
              PSHQ  D       F NPRL  A+ ALQAWK  +T DP NFT +WYGP VC Y GVYCA
Sbjct  23    SPSHQQSDHT-----FANPRLEKAYEALQAWKKAMTDDPFNFTSNWYGPDVCTYRGVYCA  77

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
             PA DD  I+TVAGIDLNHANI+G LP++LGLLTDL+LFH+NSNRF GT+P +  + RLL+
Sbjct  78    PALDDSYIQTVAGIDLNHANIAGYLPKELGLLTDLSLFHLNSNRFCGTIPYTIKNWRLLY  137

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             E+DVSNN   G FP V+LSLP LKF+D+RYN F G IP +++DL LDA+F+N+NNFT   
Sbjct  138   EIDVSNNNFNGGFPKVLLSLPYLKFIDVRYNYFDGPIPSKLFDLDLDAIFINNNNFTSKF  197

Query  954   PRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKV  775
             P+N GNSPVSV V A NN +GCLPPSI+KM KTL+EIIL +  L  CLP EIG L +L V
Sbjct  198   PQNIGNSPVSVAVLAYNNFQGCLPPSISKMSKTLNEIILEDSGLKGCLPSEIGELTQLNV  257

Query  774   FDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAP  595
              DVS+N+L G LPESMG++K LEQLNVA N  SG IP SIC LP+L+NFTYS N+F  AP
Sbjct  258   LDVSYNDLSGPLPESMGEMKNLEQLNVAFNMFSGSIPESICSLPKLENFTYSSNFFSDAP  317

Query  594   EICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               C K++  +D+ NCI   P QRS   CK+    P+ C  L C
Sbjct  318   YKCLKLQETDDRLNCIAGRPFQRSASVCKSINDYPISCESLSC  360



>ref|XP_010435287.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=738

 Score =   434 bits (1117),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 205/329 (62%), Positives = 258/329 (78%), Gaps = 2/329 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+P+ D+++IRTVAGID
Sbjct  59    FENPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTVAGID  118

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G FP 
Sbjct  119   LNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGKFPT  178

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP+NFG+SPVSV+V A
Sbjct  179   VVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPKNFGDSPVSVIVLA  238

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG LPES
Sbjct  239   NNRFHGCVPSSLVEM-KNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGPLPES  297

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             +G +  +EQLNVAHNKLSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D++NC
Sbjct  298   VGGMVSVEQLNVAHNKLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPKIDDRRNC  357

Query  549   IPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
              P  P QRSP  CKAF S+ PV+C   GC
Sbjct  358   FPGRPAQRSPGQCKAFLSRPPVNCGSFGC  386



>ref|XP_010440602.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=720

 Score =   434 bits (1115),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 260/333 (78%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP NFT +W G  VCNYTGV+C+P+ ++++IRTV
Sbjct  55    PSLVFENPRLRNAYVALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPSLNNRKIRTV  114

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  115   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  174

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP+NFG+SPVSV
Sbjct  175   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPKNFGDSPVSV  234

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  235   IVLANNRFHGCVPSSLVEM-KNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGP  293

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHNKLSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  294   LPESVGGMVSVEQLNVAHNKLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDD  353

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C   GC
Sbjct  354   RRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFGC  386



>ref|XP_008344101.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4, partial [Malus domestica]
Length=526

 Score =   427 bits (1097),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 248/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN RL NA+IALQA K  I +DP N T +W G  VC YTGV+C  A D+  IRTV
Sbjct  81    PSLVFENDRLRNAYIALQALKQAILSDPLNITGNWVGSNVCKYTGVFCTKALDNSTIRTV  140

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  141   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFNRLKLLFELDLSNNRFAG  200

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  201   KFPRVVLQLPKLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPDNFGNSPVSV  260

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EII+MN    +CLP EIG+LK + VFDVSFN  +GS
Sbjct  261   IVLANNKFHGCVPASLGNM-SNLNEIIMMNNGFRSCLPPEIGMLKNVTVFDVSFNQFLGS  319

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  LEQLNVAHN LSG+IPASIC LP L+NFTYSYN+F S P +C  +   +D
Sbjct  320   LPESIGGMVSLEQLNVAHNLLSGKIPASICSLPNLQNFTYSYNFFTSEPPVCLGLAGFDD  379

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QR+   CK+F SKPVDCS   C
Sbjct  380   KRNCLPNRPAQRTAAQCKSFLSKPVDCSSFRC  411



>emb|CDX83065.1| BnaA01g20650D [Brassica napus]
Length=515

 Score =   426 bits (1096),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 205/330 (62%), Positives = 251/330 (76%), Gaps = 1/330 (0%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  NPRL  A+ ALQAWK  +T+DP  FT +W GP+VCNYTGV+CAP  D+  + TVAGI
Sbjct  47    PIANPRLLKAYAALQAWKFTMTSDPNGFTSNWCGPHVCNYTGVFCAPTLDNPYLLTVAGI  106

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNHANI+G LPE+LGLLTDLALFHINSNRF G LP S + L+LL ELDVSNN L G+FP
Sbjct  107   DLNHANIAGYLPEELGLLTDLALFHINSNRFKGQLPMSLNCLKLLHELDVSNNKLSGEFP  166

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
             +VV +LP LKFLDIR+N F G IP +++DL LDALF+N+NNF   LP N GNS VSVLV 
Sbjct  167   SVVFTLPSLKFLDIRFNGFYGDIPSQLFDLNLDALFINNNNFRFRLPGNIGNSTVSVLVL  226

Query  912   ANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
             ANN+L+G C+PPS   M KTL E+ILMN  +  CL  EIGLL +L VFDVSFNNLVGSLP
Sbjct  227   ANNDLQGSCVPPSFYNMGKTLHEVILMNSQISGCLNREIGLLNQLTVFDVSFNNLVGSLP  286

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             ++MG +K LEQLN+AHNK SG IP  IC LP L+NFTYSYN+F     +C +++  +D++
Sbjct  287   DTMGDMKSLEQLNIAHNKFSGYIPEGICRLPNLENFTYSYNFFSGESPVCLRLQEFDDRR  346

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC+P  P QR P  C++F S P++C+  GC
Sbjct  347   NCLPLKPMQRPPAECRSFSSYPINCASFGC  376



>ref|XP_010532845.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Tarenaya 
hassleriana]
Length=648

 Score =   431 bits (1108),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 203/333 (61%), Positives = 253/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP NFT  W G  VCNYTGV+C+PAPD+  IRTV
Sbjct  77    PSLVFENPRLRSAYIALQAWKQAILSDPFNFTASWVGSNVCNYTGVFCSPAPDNHRIRTV  136

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFHINSNRF GT+P  F  L+LLFELD+SNN   G
Sbjct  137   AGIDLNHADIAGYLPEELGLLTDLALFHINSNRFCGTVPHRFRQLKLLFELDLSNNRFAG  196

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE+++  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  197   KFPTVVLHLPSLKFLDLRFNEFEGSVPKELFNKDLDAIFINHNRFQFELPENFGNSPVSV  256

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V +NN   GC+P S+  M K L+EII MN    +CLP EIG L+ + VFDVSFN +VG 
Sbjct  257   IVLSNNRFHGCIPASLGNM-KNLNEIIFMNNGFKSCLPTEIGRLRNVTVFDVSFNEIVGP  315

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G++  LEQLNVAHN+LSG+IP  IC+LP+L+NFT+SYN+F   P +C ++   +D
Sbjct  316   LPEAVGRMVSLEQLNVAHNRLSGKIPTRICQLPKLENFTFSYNFFPGDPPVCLRLPSFDD  375

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  C AF S+ PVDC    C
Sbjct  376   RRNCLPARPAQRSPGQCAAFLSRPPVDCGSFKC  408



>ref|XP_006300268.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
 gb|EOA33166.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
Length=457

 Score =   424 bits (1090),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 254/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T +W G  VC+YTGV+C+ A D++ IRTV
Sbjct  67    PSLVFENPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVCSYTGVFCSRALDNRRIRTV  126

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LP +LGLLTDLALFH+NSNRF GT+PR+F+ L+LLFELD+SNN   G
Sbjct  127   AGIDLNHGDIAGYLPLELGLLTDLALFHVNSNRFCGTVPRTFNQLKLLFELDLSNNRFAG  186

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  187   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENLGDSPVSV  246

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+ +M K L+EIILMN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  247   IVIANNHFHGCVPTSLVEM-KNLNEIILMNNHLNSCLPADIGRLKNVTVFDVSFNELVGP  305

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G L ++EQLNVAHN LSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  306   LPESVGGLVEVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLSEFDD  365

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRS   C AF S+ PVDC    C
Sbjct  366   RRNCLPGRPAQRSSRQCSAFLSRPPVDCESFSC  398



>ref|XP_009627507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X2 [Nicotiana tomentosiformis]
Length=555

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 249/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F FEN R+ NA+IALQAWK  I +DP N T +W GP VCNYTG++CAPA D+ +IRTV
Sbjct  74    PSFVFENSRIKNAYIALQAWKQAIISDPFNLTANWVGPNVCNYTGIFCAPALDNPKIRTV  133

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DL +FHINSNRF GT+P+ F +L++LFELD+SNN   G
Sbjct  134   AGIDLNHGDIAGYLPEELGLLVDLGIFHINSNRFCGTIPKKFKNLKILFELDLSNNRFAG  193

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSL KL FLDIR+N+F+G +P +++D   DA+F+NHN F+  LP NFGNSPVSV
Sbjct  194   KFPYVVLSLHKLIFLDIRFNEFEGNVPSQLFDRPFDAIFINHNRFSFELPDNFGNSPVSV  253

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP SI  M   L E+I+MN  L +CLP EIG+LK L VFDVSFN L+G 
Sbjct  254   IVLANNRFHGCLPASIGNM-SNLEEVIMMNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGP  312

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE  G+L  LEQLNVAHN L+G IP SIC+LP+L+NFTYSYN+F   P +C ++   +D
Sbjct  313   LPEKFGELVNLEQLNVAHNMLTGSIPKSICQLPKLENFTYSYNFFTGEPPVCLRLAEFDD  372

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRSP  CKAF SK + C    C
Sbjct  373   QRNCLPNRPVQRSPAQCKAFLSKRIHCDAFKC  404



>ref|XP_011043443.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Populus euphratica]
Length=661

 Score =   431 bits (1107),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 247/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F NPRL NA+IALQAWK  I +DP N T +W G  VCNY GV+CAPAPD+K I TV
Sbjct  71    PSLVFPNPRLRNAYIALQAWKQAIFSDPLNLTANWVGSQVCNYEGVFCAPAPDNKTILTV  130

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+PR F  +RLLFELD+SNN   G
Sbjct  131   AGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPRKFKDMRLLFELDLSNNRFAG  190

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP N GNSPVSV
Sbjct  191   KFPQVVLKLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFDLPENLGNSPVSV  250

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P SI  M   L+EIILMN    +C+P EIGLLK+L V DVSFN L+G 
Sbjct  251   IVLANNKFHGCVPSSIGNM-SNLNEIILMNNGFRSCMPAEIGLLKDLTVLDVSFNQLMGP  309

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP++ G +  LEQLNVAHN LSG+IPASIC+LP L NFT+SYN+F   P +C  +   +D
Sbjct  310   LPDAFGGMVSLEQLNVAHNMLSGKIPASICKLPNLDNFTFSYNFFTGEPPVCLSLPDFSD  369

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CKAF S+PVDCS   C
Sbjct  370   RRNCLPARPLQRSAAQCKAFLSRPVDCSSFRC  401



>ref|NP_193070.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
 sp|Q9T0K5.1|LRX3_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 3; Short=AtLRX3; 
Short=LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB40769.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78376.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE83265.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
Length=760

 Score =   434 bits (1115),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 258/333 (77%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+PA D+++IRTV
Sbjct  57    PSLNFENPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPALDNRKIRTV  116

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  117   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  176

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  177   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENFGDSPVSV  236

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  237   IVLANNRFHGCVPSSLVEM-KNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGP  295

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G++  +EQLNVAHN LSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  296   LPESVGEMVSVEQLNVAHNMLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDD  355

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C    C
Sbjct  356   RRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFSC  388



>ref|XP_009627506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=605

 Score =   428 bits (1101),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 249/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F FEN R+ NA+IALQAWK  I +DP N T +W GP VCNYTG++CAPA D+ +IRTV
Sbjct  74    PSFVFENSRIKNAYIALQAWKQAIISDPFNLTANWVGPNVCNYTGIFCAPALDNPKIRTV  133

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DL +FHINSNRF GT+P+ F +L++LFELD+SNN   G
Sbjct  134   AGIDLNHGDIAGYLPEELGLLVDLGIFHINSNRFCGTIPKKFKNLKILFELDLSNNRFAG  193

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSL KL FLDIR+N+F+G +P +++D   DA+F+NHN F+  LP NFGNSPVSV
Sbjct  194   KFPYVVLSLHKLIFLDIRFNEFEGNVPSQLFDRPFDAIFINHNRFSFELPDNFGNSPVSV  253

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP SI  M   L E+I+MN  L +CLP EIG+LK L VFDVSFN L+G 
Sbjct  254   IVLANNRFHGCLPASIGNM-SNLEEVIMMNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGP  312

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE  G+L  LEQLNVAHN L+G IP SIC+LP+L+NFTYSYN+F   P +C ++   +D
Sbjct  313   LPEKFGELVNLEQLNVAHNMLTGSIPKSICQLPKLENFTYSYNFFTGEPPVCLRLAEFDD  372

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRSP  CKAF SK + C    C
Sbjct  373   QRNCLPNRPVQRSPAQCKAFLSKRIHCDAFKC  404



>ref|XP_006476103.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=700

 Score =   431 bits (1108),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 255/332 (77%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F NPR+ NA+IALQAWK  I +DP N T DW G  VC+YTGV+CAPAPD+K IRTV
Sbjct  75    PSLVFANPRIRNAYIALQAWKQAILSDPYNLTADWVGSAVCSYTGVFCAPAPDNKRIRTV  134

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F +L+LLFELD+SNN   G
Sbjct  135   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFENLKLLFELDLSNNRFAG  194

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP V+L LP+LKFLD+RYN+F+G +P+E++D  LDA+F+N+N F   +P NFGNSPVSV
Sbjct  195   KFPKVLLRLPQLKFLDLRYNEFEGTVPRELFDKDLDAIFINNNRFRFEIPDNFGNSPVSV  254

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M + L+EIIL+N  L +CLP EIG+LK + VFDVSFN L+G 
Sbjct  255   IVLANNKFHGCVPSSLGNMSR-LNEIILLNNGLRSCLPPEIGMLKNVTVFDVSFNQLLGP  313

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G++  LEQLNVAHN LSG IPASIC LP L+NFT+SYN+F   P +C  ++  +D
Sbjct  314   LPDTIGRMVSLEQLNVAHNMLSGTIPASICRLPNLQNFTFSYNFFTGEPPVCLSLQAFDD  373

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CK+F SK VDCS   C
Sbjct  374   RRNCLPARPAQRSSAQCKSFLSKRVDCSSFKC  405



>ref|XP_009403414.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 249/332 (75%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F F NPRL +A++ALQAWK  I +DP+NFT +W GP VC Y GVYCAP P +  +  V
Sbjct  67    PSFHFPNPRLRDAYVALQAWKQAILSDPQNFTGNWVGPNVCTYRGVYCAPLPCNSSLNVV  126

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFHINSNRF GT+P  F +L  LFE+D+SNN   G
Sbjct  127   AGIDLNHADIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFRNLGRLFEIDLSNNRFAG  186

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP V+L LP LKFLDIR+N+F+G +P+E++D  LDA+F+NHN F   +P N GNSPVSV
Sbjct  187   KFPRVLLDLPSLKFLDIRFNEFEGAVPRELFDKPLDAIFINHNRFAFDVPDNLGNSPVSV  246

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  RGCLP S+  M  TL+EIILMN  L +CLP EIGLL++L VFDVSFN L+G 
Sbjct  247   IVLANNRFRGCLPASLGNMSNTLNEIILMNNGLRSCLPSEIGLLRKLTVFDVSFNQLLGP  306

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE +  +  LEQL+VAHN LSG IP SIC LP L+NFT+SYN+F   P  C KV+  +D
Sbjct  307   LPEEIRGMVSLEQLDVAHNLLSGRIPESICVLPHLQNFTFSYNFFTGEPPSCLKVQSFDD  366

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QRS + CK+F + PVDCSV  C
Sbjct  367   KRNCLPERPLQRSEKQCKSFLAHPVDCSVFRC  398



>ref|XP_006414071.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
 gb|ESQ55524.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
Length=739

 Score =   432 bits (1110),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 254/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VC+YTGVYCAPAPD++ IRTV
Sbjct  74    PSLVFENPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVCSYTGVYCAPAPDNRRIRTV  133

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  134   AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  193

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAV+L LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  194   KFPAVILQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  253

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  MR  L EII MN    +CLP EIG LK + VFD SFN+LVG 
Sbjct  254   IVVANNQFHGCIPTSLGDMRN-LEEIIFMNNGFDSCLPSEIGRLKNVTVFDFSFNDLVGP  312

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  +EQLNVAHN+ SG+IPASIC+LP+L+NFT+SYN+F   P +C  +   +D
Sbjct  313   LPASIGGMVSMEQLNVAHNRFSGKIPASICQLPKLENFTFSYNFFTGEPPVCLGLAGFDD  372

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  C AF S+ PV+C+  GC
Sbjct  373   RRNCLPARPAQRSPGQCAAFLSRPPVNCASFGC  405



>gb|EYU25784.1| hypothetical protein MIMGU_mgv1a026389mg, partial [Erythranthe 
guttata]
Length=390

 Score =   419 bits (1077),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 202/331 (61%), Positives = 248/331 (75%), Gaps = 3/331 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP L  A+IALQAWK  I +DP NFT DW G  VC+Y GV+CAPA  +  ++ VAGID
Sbjct  43    FENPNLRQAYIALQAWKQSIFSDPFNFTSDWTGSDVCSYGGVFCAPATTNPSVKVVAGID  102

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LPE+LGLLTDLALFHINSNRF G +PRSF  L+LLFELD+SNN   G FP 
Sbjct  103   LNHADIAGFLPEELGLLTDLALFHINSNRFCGIVPRSFKKLKLLFELDLSNNRFVGGFPT  162

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N+F+G +P +V+D  LDA+F+N N F   +P N GNSPVSVLV A
Sbjct  163   VVLSLPSLKFLDLRFNEFEGGVPSQVFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVLA  222

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM KTL+E+ILMN +L  CLP EIGLL+EL VFDVSFNNL G LP +
Sbjct  223   NNNLGGCIPGSIGKMGKTLNELILMNDNLTGCLPPEIGLLRELTVFDVSFNNLQGPLPAA  282

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKH---KNDK  559
             +G ++ LEQLNVAHN+L+GE+ A++C+LPRL+NFTYSYNYF      C +       + +
Sbjct  283   IGSMRSLEQLNVAHNRLTGEVTAAVCQLPRLENFTYSYNYFTKEAAQCGRFGGATVADGE  342

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +NCIP    QRS + C +  +KP DCS   C
Sbjct  343   ENCIPGKSDQRSVKECSSDAAKPFDCSKSKC  373



>ref|XP_004139428.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=608

 Score =   427 bits (1097),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 247/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N TK+W G  VC+Y GV+CAPAPD+  IRTV
Sbjct  78    PKLVFENDRIRNAYIALQAWKQAILSDPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTV  137

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F +L+LLFELD+SNN   G
Sbjct  138   AGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAG  197

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  198   KFPRVVLELPELKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPENFGNSPVSV  257

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P SI  M + L+EIILMN    +CLP EIG LK L VFDVS N   G 
Sbjct  258   IVLANNKFHGCVPGSIGNMTR-LNEIILMNNGFRSCLPSEIGFLKNLTVFDVSHNEFFGK  316

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G +  LEQLNVAHN LSG+IP SIC+LP L+NFTYSYN+F      C  +   +D
Sbjct  317   LPETIGGMVSLEQLNVAHNFLSGKIPDSICKLPNLQNFTYSYNFFTGEAPSCLALPDFDD  376

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NCIP  P QRS   CK+F SKPVDCS  GC
Sbjct  377   RRNCIPERPVQRSERQCKSFLSKPVDCSSFGC  408



>ref|XP_009760538.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nicotiana 
sylvestris]
Length=740

 Score =   431 bits (1107),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 251/332 (76%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F FEN R+ NA+IALQAWK  I +DP N T++W GP VCNYTG++CAPA D+ +IRTV
Sbjct  74    PSFIFENNRIKNAYIALQAWKQAIISDPFNLTENWVGPNVCNYTGIFCAPALDNPKIRTV  133

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DL +FHINSNRF GT+P+ F +L++LFELD+SNN   G
Sbjct  134   AGIDLNHGDIAGYLPEELGLLVDLGIFHINSNRFCGTIPKKFKNLKILFELDLSNNRFAG  193

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLPKL FLDIR+N+F+G +P +++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  194   KFPYVVLSLPKLIFLDIRFNEFEGNVPSQLFDKPLDAIFINHNRFMFELPDNFGNSPVSV  253

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP SI  M   L+E+I+MN  L +CLP EIG+LK L VFDVSFN L+G 
Sbjct  254   IVLANNKFHGCLPASIGNM-SNLNEVIMMNNGLRSCLPTEIGMLKNLTVFDVSFNQLMGP  312

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE  GKL  LEQLNVAHN LSG IP SIC+LP+L+NFTYSYN+F   P +C  +   +D
Sbjct  313   LPEKFGKLVNLEQLNVAHNMLSGSIPKSICQLPKLENFTYSYNFFTGEPPVCLGLPEFDD  372

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRSP  CKAF SK + C    C
Sbjct  373   QRNCLPNRPVQRSPAQCKAFSSKRIHCGAFKC  404



>ref|XP_010254179.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=764

 Score =   431 bits (1108),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 247/332 (74%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPR  NA+IALQAWK  I +DP N T +W G  VCNYTGV+C  A DD  I+TV
Sbjct  77    PSLVFENPRQKNAYIALQAWKQAIISDPLNLTSNWVGSNVCNYTGVFCTSALDDPSIKTV  136

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTD+ALFHINSNRF GT+P  F +L+LLFELD+SNN   G
Sbjct  137   AGIDLNHGDIAGYLPEELGLLTDIALFHINSNRFCGTVPHKFVNLKLLFELDLSNNRFAG  196

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLK+LDIR+N+F+GK+P+E++D  LDA+F+NHN F   LP N GNSPVSV
Sbjct  197   KFPEVVLRLPKLKYLDIRFNEFEGKVPRELFDKDLDAIFINHNRFAFDLPDNLGNSPVSV  256

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M KTL+EIILM     +C+P EIGLLKEL V D+SFN L+G 
Sbjct  257   IVLANNKFHGCVPASLGNMSKTLNEIILMKNGFRSCVPTEIGLLKELTVLDLSFNQLMGP  316

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G +  LEQLNVAHN LSG IPA IC LP LKNFTYSYNYF   P +C  +   +D
Sbjct  317   LPDTIGGMLSLEQLNVAHNMLSGTIPAKICSLPNLKNFTYSYNYFTGEPPVCLSLPDFDD  376

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +KNC+P  P QRS   CK+F S+PV CS   C
Sbjct  377   QKNCLPERPAQRSASQCKSFLSRPVHCSAFRC  408



>ref|XP_002281292.2| PREDICTED: leucine-rich repeat extensin-like protein 4 [Vitis 
vinifera]
Length=752

 Score =   430 bits (1105),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 248/332 (75%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPR  NA+IALQAWK  I +DP N T +W G  VCNYTGVYCA APD+  IRTV
Sbjct  69    PSLVFENPRQRNAYIALQAWKQAILSDPLNLTLNWVGSNVCNYTGVYCAQAPDNSSIRTV  128

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F+ L++LFELD+SNN   G
Sbjct  129   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFAKLKILFELDLSNNRFAG  188

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  189   KFPEVVLHLPTLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFAFDLPDNFGNSPVSV  248

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN L GC+P S+  M  TL+EIILMN    +CLP EIGLLK L V DVS+N L+G 
Sbjct  249   IVVANNKLHGCVPASLGNMADTLNEIILMNNQFRSCLPVEIGLLKNLTVLDVSYNGLLGP  308

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+ +G + +LEQLNVAHN LSG IPASIC+LP L+NFT+SYN+F   P  C  +    D
Sbjct  309   LPKEIGGMVELEQLNVAHNMLSGSIPASICKLPNLENFTFSYNFFTGEPPACLGLADFED  368

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   C +F S+PVDCS   C
Sbjct  369   RRNCLPGRPEQRSAGQCNSFLSRPVDCSSFRC  400



>ref|XP_002862780.1| hypothetical protein ARALYDRAFT_920276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39038.1| hypothetical protein ARALYDRAFT_920276 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   416 bits (1069),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/330 (61%), Positives = 248/330 (75%), Gaps = 1/330 (0%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             + P +  Y   P + P  NPRL  A+ ALQAWK  IT+DP  FT +W GP+VCNYTGVYC
Sbjct  31    TPPINPCYAHAPFLPPIANPRLLKAYAALQAWKFTITSDPNGFTSNWCGPHVCNYTGVYC  90

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             APA D+  + TVAGIDLNHANI+G LP +LGLLTDLALFHINSNRF G LP++   L LL
Sbjct  91    APALDNPYVLTVAGIDLNHANIAGYLPIELGLLTDLALFHINSNRFQGQLPKTLKCLELL  150

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
              ELDVSNN L G+FP+V+ SLP LKFLDIR+N+FQG +P +++DL LDALF+N N F   
Sbjct  151   HELDVSNNKLSGEFPSVIFSLPSLKFLDIRFNEFQGDVPDQLFDLNLDALFINDNKFQFR  210

Query  957   LPRNFGNSPVSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKEL  781
             LP+N GNSPVSVLV AN +L+G C+PPS  KM KTL E+I+ N  +  CL  EIG+L +L
Sbjct  211   LPKNIGNSPVSVLVLANIDLQGSCVPPSFYKMGKTLHELIISNSQITGCLNREIGILNQL  270

Query  780   KVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCS  601
              VFDVS+NNLVGSLPE++G +K LEQLN+AHNK SG IP SIC LP L+NFTYSYN+F  
Sbjct  271   TVFDVSYNNLVGSLPETIGDMKSLEQLNIAHNKFSGYIPESICRLPSLENFTYSYNFFSG  330

Query  600   APEICRKVKHKNDKKNCIPYWPHQRSPETC  511
              P  C +++  +D++NC+P  P QRSP  C
Sbjct  331   EPPACLRLQEFDDRRNCLPSRPMQRSPAEC  360



>ref|XP_008786172.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=678

 Score =   426 bits (1096),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 248/332 (75%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F N  L +A+IALQAWK  I +DP N T +W G  VCNYTGVYCAP P D  +  V
Sbjct  63    PSLNFPNSHLRDAYIALQAWKLAIISDPLNLTANWVGSNVCNYTGVYCAPLPSDPHLTVV  122

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F  L LLFELD+SNN   G
Sbjct  123   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFECLHLLFELDLSNNRFAG  182

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PK ++D  LDA+F+NHN F   +P NFGNSPVSV
Sbjct  183   KFPDVVLGLPSLKFLDLRFNEFEGGVPKALFDKDLDAIFINHNRFAFDIPDNFGNSPVSV  242

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  RGC+P S+ KM +TL+EIIL+N  L +CLP EIGLLK+L VFDVSFN LVG 
Sbjct  243   IVLANNRFRGCVPASLGKMSRTLNEIILLNNGLRSCLPPEIGLLKDLTVFDVSFNQLVGP  302

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S+G +  LEQL+VAHN LSG+IP SIC LPRL+NFT+SYN+F   P +C KV   +D
Sbjct  303   LPDSIGWMLSLEQLDVAHNLLSGQIPTSICTLPRLQNFTFSYNFFTGEPPVCLKVPSFDD  362

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CK+F S PVDC+   C
Sbjct  363   RRNCLPGRPAQRSAAQCKSFLSHPVDCNSFRC  394



>gb|KFK36221.1| hypothetical protein AALP_AA4G093700 [Arabis alpina]
Length=844

 Score =   431 bits (1109),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 258/333 (77%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VCNYTGV+C+P+ D+++IRTV
Sbjct  58    PSLVFENPRLRNAYIALQAWKQAILSDPFNFTSNWIGSNVCNYTGVFCSPSLDNRKIRTV  117

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLL+DLALFH+NSNRF GT+P  F  L+LLFELD+SNN   G
Sbjct  118   AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFKSLKLLFELDLSNNRFAG  177

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  178   KFPAVVLRLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENFGDSPVSV  237

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+ +M K L+EIILMN  L +CLP +IG L+ + VFDVSFN LVG 
Sbjct  238   IVLANNRFHGCIPTSLVEM-KNLNEIILMNNGLNSCLPKDIGRLENVTVFDVSFNELVGV  296

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G++  +EQLNVAHNKLSG+IP SIC+LP+L NFT+SYN+F     +C ++   +D
Sbjct  297   LPESVGEMVSVEQLNVAHNKLSGKIPDSICQLPKLDNFTFSYNFFTGEAPVCLRLPEFDD  356

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRSP  CKAF S+ PV+C    C
Sbjct  357   RRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFSC  389



>ref|XP_009132101.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Brassica 
rapa]
Length=749

 Score =   429 bits (1102),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/333 (61%), Positives = 250/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A++ALQAWK  I +DP NFT +W G  VC+YTGVYCAPAPD+  IRTV
Sbjct  69    PSLVFENPRLRSAYVALQAWKQAILSDPNNFTTNWIGSDVCSYTGVYCAPAPDNPRIRTV  128

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  129   AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  188

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAV+L LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  189   IFPAVILQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  248

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M K L EII MN    +CLP EIG LK + VFD SFN LVGS
Sbjct  249   IVVANNQFHGCIPTSLGDM-KNLEEIIFMNNGFNSCLPSEIGRLKNVTVFDFSFNELVGS  307

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S G +  LEQLNVAHN+ SG+IPASIC+LPRL+NF +SYN+F   P +C  +   +D
Sbjct  308   LPASTGGMVSLEQLNVAHNRFSGKIPASICQLPRLENFNFSYNFFTGEPPVCIGLPGVDD  367

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NCIP  P QRSP  C AF S  PV+C+  GC
Sbjct  368   RRNCIPARPAQRSPGQCAAFLSLPPVNCASFGC  400



>ref|XP_008242638.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=667

 Score =   426 bits (1094),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W G  VC+YTGV+C  A D+  IRTV
Sbjct  76    PSLVFENQRIRNAYIALQAWKQAILSDPLNLTGNWVGSNVCSYTGVFCTKALDNSSIRTV  135

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F  L+LLFELD+SNN   G
Sbjct  136   AGIDLNHGDIAGYLPEELGLLADLALFHINSNRFCGTVPHKFKQLKLLFELDISNNRFAG  195

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  196   KFPRVVLQLPKLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPDNFGNSPVSV  255

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN    +CLP+EIG+LK L VFDVSFN  +GS
Sbjct  256   IVLANNKFHGCVPASLGNM-SNLNEIILMNNGFRSCLPEEIGMLKNLTVFDVSFNQFLGS  314

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G +  LEQLNVAHN LSG IPASIC LPRL+NFTYSYN+F   P +C  +   +D
Sbjct  315   LPETIGGMVSLEQLNVAHNLLSGTIPASICSLPRLQNFTYSYNFFTGEPPVCLGLASFDD  374

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QR    CK+F S+PVDC    C
Sbjct  375   KRNCLPNRPAQRPAAKCKSFLSRPVDCKSFRC  406



>ref|XP_009381253.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=546

 Score =   421 bits (1083),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 244/332 (73%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F F NP L  A++ALQAWK  I +DP NFT +W GP VC+Y GVYCA  P +  +  V
Sbjct  67    PSFHFANPGLRAAYVALQAWKQAILSDPHNFTGNWVGPDVCHYYGVYCASLPCNGSLTVV  126

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F  L  LFE+D+SNN   G
Sbjct  127   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFRQLTRLFEIDISNNRFAG  186

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP V+L LP LKFLDIR+N+F+G +P+E++D  LDA+F+NHN F   +P NFGNSPVSV
Sbjct  187   KFPGVLLELPSLKFLDIRFNEFEGGVPRELFDKPLDAIFINHNRFAFDIPDNFGNSPVSV  246

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  RGC P SI  M  TL+EIILMN  L +CLP EIGLLK+L VFDVSFN L+G 
Sbjct  247   IVLANNRFRGCFPASIGNMSNTLNEIILMNNGLRSCLPPEIGLLKKLTVFDVSFNELLGP  306

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE +G +  LEQL+VAHN LSG IP SICELP L+NFT+SYN+F   P  C KV+  +D
Sbjct  307   LPEEIGGMVSLEQLDVAHNLLSGCIPESICELPHLQNFTFSYNFFTGEPPSCLKVQSFDD  366

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS + C +F S PVDCS   C
Sbjct  367   RRNCLPERPLQRSGKQCGSFLSHPVDCSSFRC  398



>ref|XP_010925532.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Elaeis 
guineensis]
Length=523

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 246/332 (74%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F N  L +A+IALQAWK  I +DP N T +W G  VC+YTGV+CAP P D  +  V
Sbjct  63    PSLNFPNSHLRDAYIALQAWKLAIISDPLNLTANWVGSDVCSYTGVFCAPLPSDPHLIVV  122

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F  L LLFELD+SNN   G
Sbjct  123   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTIPHKFECLHLLFELDLSNNRFAG  182

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LK+LDIR+N+F+G +PK ++D  LDA+F+NHN F   +P N GNSPVSV
Sbjct  183   KFPDVVLRLPSLKYLDIRFNEFEGGVPKALFDKDLDAIFINHNRFAFDIPDNLGNSPVSV  242

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  RGC+P S+  M KTL+EIIL+N  L +CLP EIGLLKEL VFDVSFN LVG 
Sbjct  243   IVLANNRFRGCVPASLGNMSKTLNEIILLNNGLRSCLPPEIGLLKELTVFDVSFNQLVGP  302

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S+  ++ LEQL+VAHN LSG+IPA+IC LP L+NFT+SYN+F   P +C KV   ND
Sbjct  303   LPDSIAWMRSLEQLDVAHNLLSGQIPAAICTLPHLQNFTFSYNFFTGEPPVCLKVPSFND  362

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CK+F S PVDC+   C
Sbjct  363   RRNCLPGRPAQRSAAQCKSFLSHPVDCNSFRC  394



>ref|XP_004287084.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Fragaria 
vesca subsp. vesca]
Length=715

 Score =   427 bits (1097),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 248/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP N T DW G  VC+YTGV+CAPA D+  IRTV
Sbjct  67    PSLVFENPRLRNAYIALQAWKKAILSDPFNLTGDWVGSDVCSYTGVFCAPALDNSSIRTV  126

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F +L+LL+ELD+SNN   G
Sbjct  127   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFRNLKLLYELDISNNRFAG  186

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  187   KFPHVVLHLPELKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFNLPENFGNSPVSV  246

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L EII+MN    +CLP+EIG+LK L VFDVS+N  +G 
Sbjct  247   IVLANNKFHGCVPASLGNM-SNLDEIIMMNNGFRSCLPEEIGMLKNLTVFDVSYNQFLGP  305

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G +  LEQLNVAHN LSG IP +IC LP L+NFTYSYN+F   P +C  +   +D
Sbjct  306   LPDTIGGMVSLEQLNVAHNLLSGSIPPAICSLPSLENFTYSYNFFTGEPPVCLALPGFDD  365

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QRS   CK+F SKPV C   GC
Sbjct  366   KRNCLPNRPLQRSAAQCKSFLSKPVSCQSFGC  397



>ref|XP_009336917.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=750

 Score =   428 bits (1100),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/332 (63%), Positives = 250/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN RL NA+IALQA K  I +DP N T +W G  VCNYTGV+C  A D++ IRTV
Sbjct  81    PSLVFENDRLRNAYIALQALKQAILSDPLNITGNWVGSNVCNYTGVFCTKALDNRTIRTV  140

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  141   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFNRLKLLFELDLSNNRFAG  200

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  201   KFPRVVLQLPKLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPDNFGNSPVSV  260

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN    +CLP EIG+LK L VFDVSFN  +GS
Sbjct  261   IVLANNKFHGCVPASLGNM-SNLNEIILMNNGFRSCLPPEIGMLKNLTVFDVSFNQFLGS  319

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  LEQLNVAHN LSG+IPASIC LP L+NFTYSYN+F S P +C  +   +D
Sbjct  320   LPESIGGMVSLEQLNVAHNLLSGKIPASICSLPNLQNFTYSYNFFTSEPPVCLGLAGFDD  379

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QR+   CK+F SKPVDCS   C
Sbjct  380   KRNCLPNRPAQRTAAQCKSFLSKPVDCSSFRC  411



>ref|XP_006353562.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like, 
partial [Solanum tuberosum]
Length=670

 Score =   425 bits (1093),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 251/332 (76%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W GP VC+YTG++CAPA D+ +IRTV
Sbjct  37    PSMVFENDRIKNAYIALQAWKQAIISDPFNITLNWVGPNVCSYTGIFCAPALDNPKIRTV  96

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDL +FHINSNRF GT+PR FS L++LFELD+SNN   G
Sbjct  97    AGIDLNHGDIAGYLPEELGLLTDLGIFHINSNRFCGTIPRKFSKLKILFELDLSNNRFAG  156

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLPKL FLDIR+N+F+G +P +++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  157   KFPYVVLSLPKLIFLDIRFNEFEGNVPSQLFDKPLDAIFINHNRFAFELPENFGNSPVSV  216

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V A+N+  GCLP SI  M   L+E ILMN  L +CLP EIG+LK L VFDVSFN L+G 
Sbjct  217   IVLASNSFHGCLPASIGNM-SNLNEAILMNNGLRSCLPAEIGVLKNLTVFDVSFNQLMGP  275

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE+ G L  LEQLNVAHN LSG IP SIC+LP+L+NFTYSYN+F   P +C  +   +D
Sbjct  276   LPENFGDLVNLEQLNVAHNMLSGTIPKSICQLPKLENFTYSYNFFTGEPPVCLGLPEFHD  335

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRSP  CKAF SK + CS   C
Sbjct  336   ERNCLPNRPVQRSPGQCKAFLSKKIHCSAFRC  367



>ref|XP_006366874.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Solanum 
tuberosum]
Length=716

 Score =   426 bits (1094),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 251/332 (76%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W GP VC+YTG++CAPA D+ +IRTV
Sbjct  71    PSMVFENDRIKNAYIALQAWKQAIISDPFNITLNWVGPNVCSYTGIFCAPALDNPKIRTV  130

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDL +FHINSNRF GT+PR FS L++LFELD+SNN   G
Sbjct  131   AGIDLNHGDIAGYLPEELGLLTDLGIFHINSNRFCGTIPRKFSKLKILFELDLSNNRFAG  190

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLPKL FLDIR+N+F+G +P +++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  191   KFPYVVLSLPKLIFLDIRFNEFEGNVPSQLFDKPLDAIFINHNRFAFELPENFGNSPVSV  250

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V A+N+  GCLP SI  M   L+E ILMN  L +CLP EIG+LK L VFDVSFN L+G 
Sbjct  251   IVLASNSFHGCLPASIGNM-SNLNEAILMNNGLRSCLPAEIGVLKNLTVFDVSFNQLMGP  309

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE+ G L  LEQLNVAHN LSG IP SIC+LP+L+NFTYSYN+F   P +C  +   +D
Sbjct  310   LPENFGDLVNLEQLNVAHNMLSGTIPKSICQLPKLENFTYSYNFFTGEPPVCLGLPEFHD  369

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRSP  CKAF SK + CS   C
Sbjct  370   ERNCLPNRPVQRSPGQCKAFLSKKIHCSAFRC  401



>ref|XP_010559035.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Tarenaya hassleriana]
Length=383

 Score =   414 bits (1065),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 252/351 (72%), Gaps = 15/351 (4%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVF------------PFENPRLYNAFI---ALQAWKHVITADPKNFTK  1363
             ++P+HQ +  GP +             P  NPRL  A+    ALQAWK +IT+DP NFT+
Sbjct  32    ARPTHQTFHFGPRLPTNPCSGHGSWFPPIANPRLLKAYTXXXALQAWKRLITSDPNNFTE  91

Query  1362  DWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNR  1183
             +W G +VCNYTGV+CA APDD    TVAGIDLN ANI G+LP +LGLL DLALFH+NSNR
Sbjct  92    NWCGAHVCNYTGVFCAAAPDDPFTLTVAGIDLNRANIVGSLPLELGLLNDLALFHLNSNR  151

Query  1182  FTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDL  1003
             F G LP++  +LR L ELDVSNN   G FP +V SLP LKFLDIRYN+F G +PK V+DL
Sbjct  152   FHGELPKTLKYLRFLNELDVSNNKFSGGFPDIVFSLPSLKFLDIRYNEFYGDVPKGVFDL  211

Query  1002  KLDALFVNHNNFTVTLPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSL  823
             KLDALF+N N F  +LP N  NSPVSVLV ANN+L GC+PPS  KM  TL ++IL N  L
Sbjct  212   KLDALFINDNKFRFSLPENIVNSPVSVLVLANNDLYGCIPPSFYKMGNTLHQVILSNNRL  271

Query  822   GACLPDEIGLLKELKVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELP  643
               CL  EIG L  L VFDVSFNNLVG LPE+MG++K LEQLNVAHN+ SGEIP SIC LP
Sbjct  272   TGCLNREIGSLNRLTVFDVSFNNLVGPLPETMGEMKSLEQLNVAHNRFSGEIPKSICTLP  331

Query  642   RLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKP  490
             +L+NFTYS N F   P +C  +++ +D+KNCIP+ P QRS   CK+FYS P
Sbjct  332   KLENFTYSDNLFSGEPPVCLNLRNFDDRKNCIPHRPMQRSYGECKSFYSFP  382



>ref|XP_009408826.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=553

 Score =   420 bits (1080),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 249/332 (75%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F F NPRL +A++ALQAWK  I +DP NFT  W GP VC+Y GV+CAP P ++ +  V
Sbjct  65    PSFRFPNPRLRDAYVALQAWKKAILSDPHNFTGSWVGPNVCSYYGVFCAPLPCNRSLTVV  124

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFHINSNRF GT+P+    L  LFE+D+SNN   G
Sbjct  125   AGIDLNHADIAGYLPEELGLLTDLALFHINSNRFCGTVPQKLRQLTRLFEIDLSNNRFAG  184

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP V+L LP LKFLDIR+N+F+G +P+E++D  LDA+F+NHN     +P N GNSPVSV
Sbjct  185   KFPRVLLELPSLKFLDIRFNEFEGGVPRELFDKPLDAIFINHNRLAFDIPDNIGNSPVSV  244

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  RGCLP S+  M  TL+EIILM+  L +CLP EIGLL++L VFD+SFN L+G 
Sbjct  245   IVLANNRFRGCLPASLGNMSNTLNEIILMDNGLRSCLPPEIGLLRKLTVFDISFNQLLGP  304

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE +G++  LEQL+VAHN LSG IP SIC+LP L+NFT+SYN+F   P  C KV+  +D
Sbjct  305   LPEEIGRMVSLEQLDVAHNLLSGRIPESICQLPHLQNFTFSYNFFTGEPPSCLKVQSFDD  364

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS + C++F S PVDCS   C
Sbjct  365   RRNCLPERPLQRSGKQCESFLSHPVDCSWFRC  396



>ref|XP_008793507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=643

 Score =   423 bits (1088),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 245/332 (74%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F N  L +A+IALQAWK  I +DP N T +W G  VCNYTGVYCAP P D  I  V
Sbjct  63    PSLSFSNSHLRDAYIALQAWKLAIISDPLNLTSNWVGSNVCNYTGVYCAPLPSDPHITVV  122

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F  LRLLFELD+SNN   G
Sbjct  123   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFDRLRLLFELDLSNNRFAG  182

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LK+LD+R+N+F+G +P+ ++D  LDA+F+NHN F   +P N GNSPVSV
Sbjct  183   KFPDVVLRLPSLKYLDLRFNEFEGGVPRSLFDKDLDAIFINHNRFAFDIPDNLGNSPVSV  242

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  RGC+P S+  M +TL+EIIL+N  L +CLP EIGLLKEL V DVSFN LVG 
Sbjct  243   IVLANNRFRGCVPASLGNMSRTLNEIILLNNGLRSCLPPEIGLLKELTVLDVSFNQLVGP  302

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S+G +  LEQL+VAHN LSG+IP SIC LP L+NFT+SYN+F   P +C KV   +D
Sbjct  303   LPDSIGWMLSLEQLDVAHNLLSGKIPTSICTLPHLQNFTFSYNFFTGEPPVCLKVPSFDD  362

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CK+F S PVDC+   C
Sbjct  363   RRNCLPGRPVQRSAAQCKSFLSHPVDCNSFRC  394



>ref|XP_002867981.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44240.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   426 bits (1094),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 251/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W G  VC+YTGVYCAPA D++ IRTV
Sbjct  70    PSLVFENPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVCSYTGVYCAPALDNRRIRTV  129

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  130   AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  189

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  190   IFPTVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  249

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+  M K L EII MN    +CLP +IG LK + VFD SFN LVGS
Sbjct  250   IVVANNHFHGCIPTSLGDM-KNLEEIIFMNNGFNSCLPPQIGRLKNVTVFDFSFNELVGS  308

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQLNVAHN+ SG+IPASIC+LPRL+NFT+SYN+F   P +C  +   +D
Sbjct  309   LPASIGGMVSLEQLNVAHNRFSGKIPASICQLPRLENFTFSYNFFTGEPPVCLGLPGFDD  368

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  369   RRNCLPSRPAQRSPVQCAAFSSLPPVDCGSFGC  401



>ref|XP_008458246.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Cucumis melo]
Length=666

 Score =   423 bits (1087),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 247/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N TK+W G  VC+Y GV+CAPAPD+  IRTV
Sbjct  78    PKLVFENDRIRNAYIALQAWKQAILSDPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTV  137

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F +L+LLFELD+SNN   G
Sbjct  138   AGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAG  197

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  198   KFPRVVLKLPELKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPENFGNSPVSV  257

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P SI  M + L+EIILMN    +CLP EIG LK L VFDVS N   G 
Sbjct  258   IVLANNKFHGCVPGSIGNMTR-LNEIILMNNGFRSCLPPEIGFLKNLTVFDVSHNEFFGK  316

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G +  LEQLNVAHN LSG+IP SIC+LP L+NFTYSYN+F      C  +   +D
Sbjct  317   LPDTIGGMVSLEQLNVAHNFLSGKIPDSICKLPNLQNFTYSYNFFTGEAPSCLALPDFDD  376

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NCIP  P QRS   CK+F SKPVDCS  GC
Sbjct  377   RRNCIPDRPVQRSERQCKSFLSKPVDCSSFGC  408



>gb|KGN60627.1| hypothetical protein Csa_2G004760 [Cucumis sativus]
Length=765

 Score =   426 bits (1094),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 247/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N TK+W G  VC+Y GV+CAPAPD+  IRTV
Sbjct  78    PKLVFENDRIRNAYIALQAWKQAILSDPLNLTKNWVGSDVCHYKGVFCAPAPDNSSIRTV  137

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F +L+LLFELD+SNN   G
Sbjct  138   AGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPHKFKNLKLLFELDLSNNRFAG  197

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  198   KFPRVVLELPELKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPENFGNSPVSV  257

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P SI  M + L+EIILMN    +CLP EIG LK L VFDVS N   G 
Sbjct  258   IVLANNKFHGCVPGSIGNMTR-LNEIILMNNGFRSCLPSEIGFLKNLTVFDVSHNEFFGK  316

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G +  LEQLNVAHN LSG+IP SIC+LP L+NFTYSYN+F      C  +   +D
Sbjct  317   LPETIGGMVSLEQLNVAHNFLSGKIPDSICKLPNLQNFTYSYNFFTGEAPSCLALPDFDD  376

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NCIP  P QRS   CK+F SKPVDCS  GC
Sbjct  377   RRNCIPERPVQRSERQCKSFLSKPVDCSSFGC  408



>ref|XP_004252054.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Solanum 
lycopersicum]
Length=727

 Score =   424 bits (1091),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 250/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W GP VC+YTGV+CAPA D+ +IRTV
Sbjct  72    PSMVFENDRIKNAYIALQAWKQAIISDPFNITMNWVGPNVCSYTGVFCAPALDNPKIRTV  131

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDL +FHINSNRF GT+PR  + L++LFELD+SNN   G
Sbjct  132   AGIDLNHGDIAGYLPEELGLLTDLGIFHINSNRFCGTIPRKLNKLKILFELDLSNNRFAG  191

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLPKL FLDIR+N+F+G +P +++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  192   KFPYVVLSLPKLIFLDIRFNEFEGNVPSQLFDKPLDAIFINHNRFAFELPENFGNSPVSV  251

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V A+N+  GCLP SI  M   L+E ILMN  L +CLP EIGLLK L VFDVSFN L+G 
Sbjct  252   IVLASNSFHGCLPASIGNM-SNLNEAILMNNGLRSCLPAEIGLLKNLTVFDVSFNELMGP  310

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE+ G L  LEQLNVAHN LSG IP SIC+LP+L+NFTYSYN+F   P +C  +   +D
Sbjct  311   LPENFGGLVNLEQLNVAHNMLSGTIPKSICQLPKLENFTYSYNFFTGEPPVCLALPEFHD  370

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRSP  CKAF SK + CS   C
Sbjct  371   QRNCLPNRPVQRSPGQCKAFLSKKIHCSAFKC  402



>ref|XP_007013716.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY31335.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=614

 Score =   421 bits (1081),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 251/341 (74%), Gaps = 0/341 (0%)
 Frame = -3

Query  1488  SHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPA  1309
             S   +D  P    F+N RL +A++ALQAWK  I +DP N T +W G  VCNYTGV+C+PA
Sbjct  57    SGGKFDSVPSQLTFDNSRLRSAYVALQAWKQAIISDPLNLTSNWVGSDVCNYTGVFCSPA  116

Query  1308  PDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFEL  1129
              DD  I+TVAGIDLNH +++G LPE+LGLLTD+ALFHINSNRF G +P SF  L+ LFEL
Sbjct  117   LDDPSIQTVAGIDLNHGDLAGYLPEELGLLTDIALFHINSNRFCGKVPWSFKKLKHLFEL  176

Query  1128  DVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPR  949
             D+SNN   G FP VVL LP LKFLD+R+N+F+GK+P+ ++D  LDA+F+NHN F   LP 
Sbjct  177   DLSNNHFAGKFPYVVLRLPSLKFLDLRFNEFEGKVPEALFDKDLDAIFINHNRFAFELPD  236

Query  948   NFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFD  769
             N GNSPVSV+V ANN   GCLP S+  M KTL+E+ILMN  L +C P EIGLLK L VFD
Sbjct  237   NLGNSPVSVIVLANNRFHGCLPMSLGNMSKTLNEVILMNNGLHSCFPKEIGLLKNLTVFD  296

Query  768   VSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEI  589
             VS+N L+G LP+S+G++  LEQLNVAHN  SG IP S+C LP L+NF+++YN+F   P +
Sbjct  297   VSYNKLMGELPDSIGEMVSLEQLNVAHNMFSGTIPESVCSLPNLRNFSFAYNFFTGEPPV  356

Query  588   CRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             C  ++  +D++NC+   P QRS   CK F S+PVDCSV+ C
Sbjct  357   CLALEEFDDRRNCLRGRPVQRSRLQCKVFLSRPVDCSVIKC  397



>ref|XP_010249819.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=701

 Score =   423 bits (1088),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/345 (58%), Positives = 249/345 (72%), Gaps = 6/345 (2%)
 Frame = -3

Query  1482  QAYDDGP------PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVY  1321
             + YD G       P   FENPRL NA+IALQAWK  + +DP N T +W G  VCNYTGV+
Sbjct  53    EFYDRGEHYVKLDPSLVFENPRLRNAYIALQAWKKAMISDPLNLTGNWVGFDVCNYTGVF  112

Query  1320  CAPAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRL  1141
             CA A DD+ IRTVAGIDLNH +I+G LPE++GLL D+ALFHINSNRF GT+P    +L L
Sbjct  113   CANALDDRSIRTVAGIDLNHGDIAGYLPEEIGLLVDIALFHINSNRFCGTVPHKLVNLTL  172

Query  1140  LFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTV  961
             L+ELD+SNN   G FP VVL LP LK+LDIR+N+F+GK+P+E++D  LDA+F+NHN F  
Sbjct  173   LYELDLSNNRFAGKFPEVVLRLPSLKYLDIRFNEFEGKVPRELFDKDLDAIFINHNRFAF  232

Query  960   TLPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKEL  781
              LP NFGNSPVSV+V ANN   GC+P S+  M KTL+EIILMN    +C+P EIGLLK L
Sbjct  233   NLPDNFGNSPVSVIVLANNKFHGCVPASLGNMSKTLNEIILMNNGFRSCVPKEIGLLKNL  292

Query  780   KVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCS  601
              V D+SFN L+G LP+S+G +  LEQ+NVAHN LSG IP+SIC LP L+NFTYSYN+F  
Sbjct  293   TVLDISFNQLMGPLPDSIGGMVSLEQVNVAHNMLSGNIPSSICLLPNLQNFTYSYNFFTG  352

Query  600   APEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              P +C  +   +D++NC+   P QR    CK+F S  VDCS   C
Sbjct  353   EPPVCLNITGVDDRRNCLRRRPTQRQARVCKSFLSHRVDCSAFRC  397



>ref|XP_006450582.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
 gb|ESR63822.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
Length=503

 Score =   416 bits (1070),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 196/333 (59%), Positives = 250/333 (75%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP F FEN R+ +A+IALQAWK  I +DP N T +W G YVCNYTGV+CA A D+  IRT
Sbjct  64    PPSFKFENSRIRSAYIALQAWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRT  123

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +I+G LPE+LGLL D+ALFH+N+NRF GTLPRSF+ L+LLFELD+SNN   
Sbjct  124   VAGIDLNHGDIAGYLPEELGLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFA  183

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLKFLD+RYN+F+GKIPK ++D  LDA+F+N+N F+  LP N GNSPVS
Sbjct  184   GKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVS  243

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV ANN   GCLP S   M +TL+E+IL N  L +CLP+EIGLLK + VFDVS+N L+G
Sbjct  244   VLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMG  303

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+++ ++  L+QLNVAHN LSG +P S+C LP L+NF++ YN+F     +C  ++  +
Sbjct  304   ELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFD  363

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             DK+NC+   P QRS   C+ F S+ V C+ L C
Sbjct  364   DKRNCLRDKPRQRSTLQCRMFLSRLVYCNTLKC  396



>ref|XP_011078360.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=494

 Score =   416 bits (1069),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A++ALQAWK  I +DP N T DW G  VCNYTGV+CAPA D+  IRTV
Sbjct  78    PSLVFENPRLRSAYVALQAWKKAILSDPHNLTVDWVGSDVCNYTGVFCAPALDNPSIRTV  137

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDL LFHINSNRF GT+P+ F +L++LFELD+SNN   G
Sbjct  138   AGIDLNHGDIAGYLPEELGLLTDLGLFHINSNRFCGTVPKKFKNLKILFELDLSNNRFAG  197

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLK+LD+R+N+F+G +P E++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  198   KFPYVVLRLPKLKYLDLRFNEFEGPVPSELFDKPLDAIFINHNRFAFELPDNFGNSPVSV  257

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN  L +CLP EIGLL+ L VFDVS N L+G 
Sbjct  258   IVLANNKFHGCVPASLGNM-SNLNEIILMNNGLRSCLPPEIGLLRNLTVFDVSHNGLMGP  316

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S+G +  LEQLNVA+N LSG IP SIC LPRL+NFT+SYN+F   P +C  +   +D
Sbjct  317   LPDSVGGMVSLEQLNVAYNMLSGAIPQSICTLPRLENFTFSYNFFTGEPPVCLALPDFDD  376

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CKA  SK + C    C
Sbjct  377   RRNCLPNRPAQRSAAQCKAVLSKKIHCGAFRC  408



>ref|XP_009135898.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Brassica 
rapa]
Length=909

 Score =   429 bits (1103),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 254/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T +W G  VC YTGV+C+ APD++ IRTV
Sbjct  61    PSLVFENPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVCTYTGVFCSRAPDNRRIRTV  120

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTDLALFH+N+NRF GT+P  F HL+LLFELD+SNN   G
Sbjct  121   AGIDLNHADIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFKHLKLLFELDLSNNRFAG  180

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP NFG+SPVSV
Sbjct  181   KFPAVVLDLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPDNFGDSPVSV  240

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S  +M K L+EII MN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  241   VVLANNRFHGCIPSSFVEM-KNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGP  299

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G +  +EQLNVAHN+LSG+IPASIC+LP+L+NFTYSYN+F     +C ++   +D
Sbjct  300   LPESVGGMVSVEQLNVAHNRLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDD  359

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRS E C AF S+ PVDC    C
Sbjct  360   RRNCLPSRPAQRSSEQCAAFLSRPPVDCESFKC  392



>gb|KFK28537.1| hypothetical protein AALP_AA7G009800 [Arabis alpina]
Length=738

 Score =   424 bits (1089),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 250/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT +W+G  VC+YTGVYC+PA D+  IRTV
Sbjct  50    PSLVFENPRLRNAYIALQAWKQAILSDPNNFTTNWFGSNVCSYTGVYCSPALDNNRIRTV  109

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP DLGLLTDLALFH+NSNRF GT+P  FS L+LLFELD+SNN   G
Sbjct  110   AGIDLNHADIAGYLPRDLGLLTDLALFHVNSNRFCGTVPNRFSRLKLLFELDLSNNRFAG  169

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP V+L LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   +P N G+SPVSV
Sbjct  170   IFPTVILDLPSLKFLDLRFNEFEGSVPRELFSKDLDAIFLNHNRFRFEIPDNLGDSPVSV  229

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+  M K L EII M     +CLP+EIG LK + VFD SFN LVGS
Sbjct  230   IVIANNHFHGCVPTSLGDM-KNLEEIIFMENGFNSCLPNEIGKLKNVTVFDFSFNELVGS  288

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQLNVAHN+ SG+IPASIC LP+L+NFTYSYN+F     +CR +   +D
Sbjct  289   LPVSIGGMVSLEQLNVAHNRFSGKIPASICSLPKLENFTYSYNFFTGESPVCRGLVGFDD  348

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NC+P  P QRSP  C AF S  PV+C+  GC
Sbjct  349   RRNCLPARPSQRSPGQCAAFLSLPPVNCASFGC  381



>ref|XP_010925096.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Elaeis guineensis]
Length=441

 Score =   414 bits (1063),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 248/332 (75%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F F NPRL NA+IALQAWK  I +DP N T +W GP VCNYT VYCAP P D  +  V
Sbjct  65    PTFVFPNPRLRNAYIALQAWKLAIFSDPLNLTANWVGPDVCNYTSVYCAPLPSDPHLTVV  124

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LP++LGLL+DLAL HINSNRF G +PR+F HLRLLFELD+SNN L G
Sbjct  125   AGIDLNHGDIAGYLPDELGLLSDLALLHINSNRFCGIVPRTFGHLRLLFELDLSNNRLAG  184

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP +VL LP L++LD+RYN+F+G +PK ++D  LDA+F+N+N F   +P N GNSPVSV
Sbjct  185   KFPEIVLQLPSLRYLDLRYNEFEGGVPKALFDKDLDAIFINNNRFVFDIPENLGNSPVSV  244

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +VFANN  RGCLP SI  M KTL+EII +N  L ACLP EIGLLK L VFDVSFN LVG 
Sbjct  245   VVFANNRFRGCLPRSIGNMSKTLNEIIFLNNGLTACLPPEIGLLKSLTVFDVSFNQLVGP  304

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+  +  LEQL+VAHN LSG+IPA IC LPRL+NFTYSYN+F   P  C +V   ++
Sbjct  305   LPTSIAGMLSLEQLDVAHNLLSGQIPAQICLLPRLQNFTYSYNFFTGEPPQCLRVPSFDE  364

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              +NC+P  P QRS   CK+F S+P+DC+   C
Sbjct  365   LQNCLPGRPAQRSDSQCKSFLSQPIDCAAFRC  396



>ref|XP_010449482.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Camelina 
sativa]
Length=825

 Score =   426 bits (1094),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 250/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP NFT +W G  VC YTGV+CAPA D++ IRTV
Sbjct  76    PTLVFENPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVCGYTGVFCAPALDNRRIRTV  135

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  136   AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  195

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  196   IFPAVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  255

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+  MR  L EII MN    +CLP +IG LK + VFD SFN LVG 
Sbjct  256   IVVANNHFHGCIPTSLGDMRN-LEEIIFMNNGFNSCLPSQIGRLKNVTVFDFSFNELVGP  314

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQLNVAHN+ SG+IPASIC+LPRL+NFT+SYN+F   P +C  +   +D
Sbjct  315   LPASVGGMVSLEQLNVAHNRFSGKIPASICQLPRLENFTFSYNFFTGEPPVCLGLPGFDD  374

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  375   RRNCLPARPAQRSPGQCAAFSSLPPVDCGSFGC  407



>gb|KDO79655.1| hypothetical protein CISIN_1g041736mg [Citrus sinensis]
Length=500

 Score =   415 bits (1067),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 249/333 (75%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP F FEN R+ +A+IALQAWK  I +DP N T +W G YVCNYTGV+CA A D+  IRT
Sbjct  64    PPSFKFENSRIRSAYIALQAWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRT  123

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +I+  LPE+LGLL D+ALFH+N+NRF GTLPRSF+ L+LLFELD+SNN   
Sbjct  124   VAGIDLNHGDIASYLPEELGLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFA  183

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLKFLD+RYN+F+GKIPK ++D  LDA+F+N+N F+  LP N GNSPVS
Sbjct  184   GKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVS  243

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV ANN   GCLP S   M +TL+E+IL N  L +CLP+EIGLLK + VFDVS+N L+G
Sbjct  244   VLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMG  303

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+++ ++  L+QLNVAHN LSG +P S+C LP L+NF++ YN+F     +C  ++  +
Sbjct  304   ELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFD  363

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             DK+NC+   P QRS   C+ F S+ V C+ L C
Sbjct  364   DKRNCLRDKPRQRSTLQCRMFLSRLVYCNTLKC  396



>ref|NP_193602.4| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
 sp|Q9SN46.2|LRX5_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 5; Short=AtLRX5; 
Short=LRR/EXTENSIN5; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE84074.1| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
Length=857

 Score =   426 bits (1095),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 251/336 (75%), Gaps = 2/336 (1%)
 Frame = -3

Query  1470  DGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEI  1291
             D  P   FENPRL NA+IALQAWK  I +DP NFT +W G  VC+YTGVYCAPA D++ I
Sbjct  66    DVDPSLVFENPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVCSYTGVYCAPALDNRRI  125

Query  1290  RTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNL  1111
             RTVAGIDLNHA+I+G LP++LGLLTDLALFHINSNRF GT+P  F+ L+LLFELD+SNN 
Sbjct  126   RTVAGIDLNHADIAGYLPQELGLLTDLALFHINSNRFCGTVPHRFNRLKLLFELDLSNNR  185

Query  1110  LCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSP  931
               G FP VVL LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SP
Sbjct  186   FAGIFPTVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSP  245

Query  930   VSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNL  751
             VSV+V ANN+  GC+P S+  MR  L EII M     +CLP +IG LK + VFD SFN L
Sbjct  246   VSVIVVANNHFHGCIPTSLGDMRN-LEEIIFMENGFNSCLPSQIGRLKNVTVFDFSFNEL  304

Query  750   VGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKH  571
             VGSLP S+G +  +EQLNVAHN+ SG+IPA+IC+LPRL+NFT+SYN+F   P +C  +  
Sbjct  305   VGSLPASIGGMVSMEQLNVAHNRFSGKIPATICQLPRLENFTFSYNFFTGEPPVCLGLPG  364

Query  570   KNDKKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
              +D++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  365   FDDRRNCLPARPAQRSPGQCAAFSSLPPVDCGSFGC  400



>ref|XP_004296668.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Fragaria 
vesca subsp. vesca]
Length=372

 Score =   410 bits (1053),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/333 (60%), Positives = 249/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             SKPSHQ     P  FP  N RL+ A+ ALQAWK+ IT+DP NFT +W GP VC+Y GVYC
Sbjct  31    SKPSHQV-SYSPQTFPV-NARLHKAYQALQAWKYAITSDPNNFTANWCGPDVCSYKGVYC  88

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             A A DD +I TVAG+DLNHANI+G+LPE+LGLL D+AL HINSN F GT+P SF  L LL
Sbjct  89    AQALDDPDITTVAGVDLNHANIAGSLPEELGLLVDIALLHINSNNFCGTIPSSFRGLYLL  148

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELD+SNN   G FP+ VL LP LK+LDIRYN F+G+IP  ++DLKLDALF+N+N F  +
Sbjct  149   YELDISNNQFSGSFPSSVLYLPSLKYLDIRYNNFEGRIPPALFDLKLDALFLNNNKFKCS  208

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP+N GNS VS +V ANNN +G  P S+AKM+ TL+E++L N  L  CLP  IG L +L+
Sbjct  209   LPQNIGNSTVSAIVLANNNFKGGFPSSLAKMKDTLNEVVLTNSGLEGCLPWNIGCLDKLR  268

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVS N L GSLPESMG +K LE LNVA+N  SG+IPAS+C L +L++F  S NYFC  
Sbjct  269   VFDVSNNKLDGSLPESMGGMKSLELLNVANNGFSGQIPASVCSLHKLESFNSSSNYFCGQ  328

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFY  499
             PE+C +++  +D+KNCIPY P QRS + C +F+
Sbjct  329   PEMCVRLRETDDRKNCIPYRPLQRSAKECASFH  361



>emb|CAB37452.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78869.1| extensin-like protein [Arabidopsis thaliana]
Length=839

 Score =   425 bits (1092),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 251/336 (75%), Gaps = 2/336 (1%)
 Frame = -3

Query  1470  DGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEI  1291
             D  P   FENPRL NA+IALQAWK  I +DP NFT +W G  VC+YTGVYCAPA D++ I
Sbjct  66    DVDPSLVFENPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVCSYTGVYCAPALDNRRI  125

Query  1290  RTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNL  1111
             RTVAGIDLNHA+I+G LP++LGLLTDLALFHINSNRF GT+P  F+ L+LLFELD+SNN 
Sbjct  126   RTVAGIDLNHADIAGYLPQELGLLTDLALFHINSNRFCGTVPHRFNRLKLLFELDLSNNR  185

Query  1110  LCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSP  931
               G FP VVL LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SP
Sbjct  186   FAGIFPTVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSP  245

Query  930   VSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNL  751
             VSV+V ANN+  GC+P S+  MR  L EII M     +CLP +IG LK + VFD SFN L
Sbjct  246   VSVIVVANNHFHGCIPTSLGDMRN-LEEIIFMENGFNSCLPSQIGRLKNVTVFDFSFNEL  304

Query  750   VGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKH  571
             VGSLP S+G +  +EQLNVAHN+ SG+IPA+IC+LPRL+NFT+SYN+F   P +C  +  
Sbjct  305   VGSLPASIGGMVSMEQLNVAHNRFSGKIPATICQLPRLENFTFSYNFFTGEPPVCLGLPG  364

Query  570   KNDKKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
              +D++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  365   FDDRRNCLPARPAQRSPGQCAAFSSLPPVDCGSFGC  400



>ref|XP_006476177.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=514

 Score =   414 bits (1064),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 249/333 (75%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP F FEN R+ +A+IALQAWK  I +DP N T +W G YVCNYTGV+CA A D+  IRT
Sbjct  64    PPSFKFENSRIRSAYIALQAWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRT  123

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +I+  LPE+LGLL D+ALFH+N+NRF GTLPRSF+ L+LLFELD+SNN   
Sbjct  124   VAGIDLNHGDIASYLPEELGLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFA  183

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLKFLD+RYN+F+GKIPK ++D  LDA+F+N+N F+  LP N GNSPVS
Sbjct  184   GKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVS  243

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV ANN   GCLP S   M +TL+E+IL N  L +CLP+EIGLLK + VFDVS+N L+G
Sbjct  244   VLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMG  303

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+++ ++  L+QLNVAHN LSG +P S+C LP L+NF++ YN+F     +C  ++  +
Sbjct  304   ELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFD  363

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             DK+NC+   P QRS   C+ F S+ V C+ L C
Sbjct  364   DKRNCLRDKPRQRSTLQCRMFLSRLVYCNTLKC  396



>ref|XP_010513507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=719

 Score =   421 bits (1081),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 253/333 (76%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL +A+IALQAWK  I +DP N T DW G  VC+YTGV+C+ A D++ IRTV
Sbjct  62    PSLVFENPRLRSAYIALQAWKQAILSDPNNITLDWIGSNVCSYTGVFCSRALDNRRIRTV  121

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LPE+LGLLTD+ALFH+NSNRF GT+PR F  L+LLFELD+SNN   G
Sbjct  122   AGIDLNHADIAGYLPEELGLLTDVALFHVNSNRFCGTVPRKFKQLKLLFELDLSNNRFAG  181

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  182   KFPTVVLQLPSLKFLDLRFNEFEGTVPKELFSKPLDAIFINHNRFRFELPENLGDSPVSV  241

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+ +M K L+EIILMN  L +CLP +IG LK + VFDVSFN LVG 
Sbjct  242   IVLANNHFHGCVPTSLVEM-KNLNEIILMNNHLNSCLPADIGRLKNVTVFDVSFNELVGP  300

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S+G L ++EQLNVAHN LSG+IPASIC+LP+L+NFTYSYN+F     +C  +   +D
Sbjct  301   LPKSVGGLVEVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLGLSQFDD  360

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             ++NC+P  P QRS   C AF S+ PVDC    C
Sbjct  361   RRNCLPGRPAQRSSRQCSAFLSRPPVDCGSFSC  393



>ref|XP_010439825.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=862

 Score =   425 bits (1092),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 251/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP NFT +W G  VC+YTGV+CAPA D++ IRTV
Sbjct  72    PTLVFENPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVCSYTGVFCAPALDNRRIRTV  131

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  132   AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  191

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  192   IFPAVVLQLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  251

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+  MR  L EII MN    +CLP +IG LK + VFD SFN LVG 
Sbjct  252   IVVANNHFHGCIPTSLGDMRN-LEEIIFMNNGFNSCLPSQIGRLKNVTVFDFSFNELVGP  310

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQLNVAHN+ SG+IPAS+C+LPRL+NFT+SYN+F   P +C  +   +D
Sbjct  311   LPGSVGGMVSLEQLNVAHNRFSGKIPASVCQLPRLENFTFSYNFFTGEPPVCLGLPGFDD  370

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  371   RRNCLPARPAQRSPGQCAAFSSLPPVDCGSFGC  403



>ref|XP_010434501.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X2 [Camelina sativa]
Length=768

 Score =   421 bits (1082),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 249/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP NFT +W G  VC+YTGV+CAPA D++ IRTV
Sbjct  71    PTLVFENPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVCSYTGVFCAPALDNRRIRTV  130

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  131   AGIDLNHVDIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  190

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  191   IFPAVVLQLPSLKFLDLRFNEFEGPVPKELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  250

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+  MR  L EII MN    +CLP +IG LK + VFD SFN LVG 
Sbjct  251   IVVANNHFHGCIPTSLGDMRN-LEEIIFMNNGFNSCLPSQIGRLKNVTVFDFSFNELVGP  309

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQLNVAHN+ SG+IPASIC+LPRL+NFT+SYN+F     +C  +   +D
Sbjct  310   LPASVGGMVSLEQLNVAHNRFSGKIPASICQLPRLENFTFSYNFFTGELPVCLGLPGFDD  369

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  370   RRNCLPARPAQRSPGQCAAFSSLPPVDCGSFGC  402



>ref|XP_010088853.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
 gb|EXB37050.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
Length=777

 Score =   421 bits (1083),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ +A+IALQAWK+ I +DP N T DW G  VC YTGV+CAPA D+ +IRTV
Sbjct  84    PSLTFENDRIRSAYIALQAWKNAILSDPNNLTTDWVGSNVCKYTGVFCAPALDNPKIRTV  143

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F  L+LLFELD+SNN   G
Sbjct  144   AGIDLNHGDIAGYLPEELGLLVDLALFHINSNRFCGTVPHKFKELKLLFELDLSNNRFAG  203

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  204   KFPEVVLKLPSLKFLDLRFNEFEGTVPKELFDKPLDAIFINHNRFVFDLPDNFGNSPVSV  263

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EII+MN    +CLP EIG LK L VFDVSFN L+G 
Sbjct  264   IVLANNKFHGCVPSSLGNM-TNLNEIIMMNNGFKSCLPPEIGSLKNLTVFDVSFNQLLGP  322

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             +PES G L  +EQLNVAHN LSG+IPASIC LP L+NFT+SYN+F   P  C  ++  +D
Sbjct  323   IPESFGGLVNIEQLNVAHNMLSGKIPASICSLPNLQNFTFSYNFFTGEPPACLGLEGFDD  382

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CKAF S+PVDC    C
Sbjct  383   RRNCLPKRPAQRSAGQCKAFLSRPVDCGSFKC  414



>ref|XP_006285388.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
 gb|EOA18286.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
Length=747

 Score =   420 bits (1080),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/333 (60%), Positives = 249/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP NFT +W G  VC+YTGV+CAPA D++ IRTV
Sbjct  67    PSLVFENPRLRNAYVALQAWKQAILSDPNNFTTNWIGSDVCSYTGVFCAPALDNRRIRTV  126

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  127   AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  186

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP V+L LP LKFLD+R+N+F+G +P+E++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  187   VFPTVILHLPSLKFLDLRFNEFEGPVPRELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  246

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+  MR  L EII MN    +CLP +IG LK + VFD SFN LVG 
Sbjct  247   IVVANNHFHGCIPTSLGDMRN-LEEIIFMNNGFNSCLPSQIGRLKNVTVFDFSFNELVGP  305

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQLNVAHN+ SG+IPASIC+LPRL+NFT+S N+F   P +C  +   +D
Sbjct  306   LPASVGGMVSLEQLNVAHNRFSGKIPASICQLPRLENFTFSNNFFTGEPPVCLALPGFDD  365

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  366   RRNCLPARPAQRSPGQCAAFSSLPPVDCGSFGC  398



>ref|XP_007227690.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
 gb|EMJ28889.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
Length=413

 Score =   409 bits (1050),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 247/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    F NPRL +A++ALQAWK  + +DP   T +W G  VC+YTGV+C+ A DD  + T
Sbjct  33    PSSLVFHNPRLRSAYVALQAWKQAMLSDPLGQTSNWVGSNVCSYTGVFCSRALDDPSVET  92

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH  I+G LPE+LGLL+D+ALFHINSNRF G++P+SFS L+LLFELD+SNN   
Sbjct  93    VAGIDLNHGGIAGYLPEELGLLSDIALFHINSNRFCGSVPKSFSKLKLLFELDLSNNRFA  152

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLKFLD+R+N+F+GK+PKE++D  LDA+F+NHN F+  LP N GNSPVS
Sbjct  153   GKFPLVVLRLPKLKFLDLRFNEFEGKVPKELFDKDLDAIFINHNMFSFELPDNLGNSPVS  212

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANNN  GC+P S+  M K L+E++L N    +CLP EIG+LK++ VFDVS+N +VG
Sbjct  213   VIVLANNNFHGCVPASLGNMSKNLNEVVLTNNGFHSCLPKEIGMLKDVTVFDVSYNRIVG  272

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPE++G++  LE+LNVAHN L G IP S+CEL  L+NF++ +N+F S P +C K++  +
Sbjct  273   ELPEAVGEMVSLEKLNVAHNMLRGNIPESVCELQNLRNFSFEHNFFTSEPPMCLKLEKFD  332

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D KNC+   P QR+   CK   SK V CS  GC
Sbjct  333   DSKNCLRRRPKQRTMLHCKLALSKGVRCSSFGC  365



>ref|XP_010434500.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X1 [Camelina sativa]
Length=780

 Score =   421 bits (1081),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/333 (60%), Positives = 249/333 (75%), Gaps = 2/333 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA++ALQAWK  I +DP NFT +W G  VC+YTGV+CAPA D++ IRTV
Sbjct  71    PTLVFENPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVCSYTGVFCAPALDNRRIRTV  130

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LP++LGLLTDLALFH+NSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  131   AGIDLNHVDIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  190

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++   LDA+F+NHN F   LP N G+SPVSV
Sbjct  191   IFPAVVLQLPSLKFLDLRFNEFEGPVPKELFSKDLDAIFINHNRFRFELPDNLGDSPVSV  250

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN+  GC+P S+  MR  L EII MN    +CLP +IG LK + VFD SFN LVG 
Sbjct  251   IVVANNHFHGCIPTSLGDMRN-LEEIIFMNNGFNSCLPSQIGRLKNVTVFDFSFNELVGP  309

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQLNVAHN+ SG+IPASIC+LPRL+NFT+SYN+F     +C  +   +D
Sbjct  310   LPASVGGMVSLEQLNVAHNRFSGKIPASICQLPRLENFTFSYNFFTGELPVCLGLPGFDD  369

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NC+P  P QRSP  C AF S  PVDC   GC
Sbjct  370   RRNCLPARPAQRSPGQCAAFSSLPPVDCGSFGC  402



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   416 bits (1070),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 198/329 (60%), Positives = 241/329 (73%), Gaps = 1/329 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP     N RL++AF ALQAWK+ IT DPKN T +W GP VC+YTGVYCAPAPD+  I T
Sbjct  51    PPPQQRSNARLFDAFYALQAWKNKITGDPKNLTSNWCGPNVCSYTGVYCAPAPDNPHITT  110

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLN   ISG+L E+LGLLTDLA+ H+NSN+F GTLP SF +LRLL+ELD+SNNL  
Sbjct  111   VAGIDLNGGTISGSLTEELGLLTDLAVLHLNSNQFKGTLPASFRNLRLLYELDISNNLFS  170

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G+FP+ VL LP LK+LD+RYN   GK+P E++D+KLDA+ +N+NNF + LP N GNS VS
Sbjct  171   GEFPSAVLRLPSLKYLDMRYNNLCGKVPSELFDMKLDAVLINNNNFGLGLPENIGNSTVS  230

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV +NNNL G LPP I +M   ++EI L N  L  CL DE+G L EL VFDVS N LVG
Sbjct  231   VLVASNNNLGGSLPPGIGRMATNINEIALANTGLIGCLSDELGDLNELTVFDVSGNGLVG  290

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             SLPE+MG ++ LE++N+A NK SGEIPAS+C L +L  F Y  NYFC  P  C KVK ++
Sbjct  291   SLPENMGSMESLEEVNIAGNKFSGEIPASVCSLQKLAKFNYGDNYFCGEPGSCLKVKERD  350

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCS  478
             D KNCI   P QRSP  C    S+PV C+
Sbjct  351   DSKNCITSRPKQRSPRECH-LKSQPVGCT  378



>gb|EPS61338.1| hypothetical protein M569_13456, partial [Genlisea aurea]
Length=387

 Score =   406 bits (1044),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 198/328 (60%), Positives = 242/328 (74%), Gaps = 1/328 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FEN RL +A+IALQAWK  I +DP N T DW G  VC YTGV+CA A DD E+RTVAGID
Sbjct  29    FENDRLRSAYIALQAWKEAILSDPYNLTADWVGSDVCGYTGVFCAQAIDDPEVRTVAGID  88

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNH +I+G LPE+LGLL DL LFHINSNRF G +P  F +L+ LFELD+SNN   G FP 
Sbjct  89    LNHGDIAGYLPEELGLLVDLGLFHINSNRFCGKIPTKFRNLKTLFELDLSNNRFAGKFPR  148

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLPKL +LDIRYN+F+G +P E++D  LDA+F+N+N F   LP NFGNSPVSV+V A
Sbjct  149   VVLSLPKLVYLDIRYNEFEGTVPPELFDKPLDAIFINNNRFAFELPDNFGNSPVSVIVVA  208

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NN+  GC+P S+  M + L+EI+ +N  L +CLP+EIG L  L VFDVSFN L+G LPE+
Sbjct  209   NNHFHGCVPASLGNMTR-LNEILFLNNGLRSCLPEEIGRLVNLTVFDVSFNQLLGPLPEN  267

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             +  L KLEQLNVAHN LSG+IPASICELP LKNFT+SYN+F   P  C  +   +D++NC
Sbjct  268   LEGLVKLEQLNVAHNFLSGKIPASICELPNLKNFTFSYNFFTGEPPSCLALPASSDRRNC  327

Query  549   IPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +   P QRS   CK F SK + CS + C
Sbjct  328   LSGRPAQRSAAQCKGFLSKKIHCSAIKC  355



>ref|XP_008776836.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
 ref|XP_008779029.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
Length=640

 Score =   415 bits (1067),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 242/332 (73%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F F N RL +A+IALQAWK  I +DP N T +W GP VCNYTGVYC P P D  +  V
Sbjct  54    PTFAFPNLRLRDAYIALQAWKLAIISDPLNLTANWVGPNVCNYTGVYCGPLPSDPHLTVV  113

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AG+DLNH +++G LP++LGLL+DLALFHINSNRF G +P +F  LRLLFELD+SNN   G
Sbjct  114   AGVDLNHGDVAGYLPDELGLLSDLALFHINSNRFCGGVPGTFHRLRLLFELDLSNNRFAG  173

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP L++LD+RYN+F+G +PK ++D  LDA+FVN+N F   +P N GNSP SV
Sbjct  174   KFPDVVLRLPSLRYLDLRYNEFEGGVPKALFDKDLDAIFVNNNRFVFDIPDNLGNSPASV  233

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +VFANN   GCLPPSI  M +TL+EII +N  L +CLP EIGLL  L VFDVSFN LVG 
Sbjct  234   VVFANNRFHGCLPPSIGNMSRTLNEIIFLNNGLRSCLPPEIGLLGNLTVFDVSFNQLVGP  293

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP S+G +  LEQL+VAHN LSG+IP  IC LPRL+NFTYSYN+F   P  C +V   +D
Sbjct  294   LPSSIGGMVSLEQLDVAHNLLSGQIPPEICRLPRLQNFTYSYNFFTGEPPECLRVPSFDD  353

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QRS   CK+F S  +DCS   C
Sbjct  354   RRNCLPGRPAQRSDTQCKSFLSHYIDCSSFHC  385



>gb|EAY91133.1| hypothetical protein OsI_12740 [Oryza sativa Indica Group]
 gb|EAY91134.1| hypothetical protein OsI_12741 [Oryza sativa Indica Group]
Length=394

 Score =   406 bits (1044),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 239/330 (72%), Gaps = 4/330 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++A QAWKH IT DPKN T+DW GP+VCNYTGVYCA APDD  + TVAG+DLN
Sbjct  59    NERLEAAYVAFQAWKHAITEDPKNLTEDWCGPFVCNYTGVYCAAAPDDPHVLTVAGVDLN  118

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +I+G LP+ LGLL D+AL H+NSNRF GTLP S  H+RLLFELDVSNNLL G FPA +
Sbjct  119   HGDIAGCLPDHLGLLADVALLHLNSNRFRGTLPPSMQHMRLLFELDVSNNLLAGAFPAFL  178

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYD--LKLDALFVNHNNFTVTLPR-NFGNSPVSVLVF  913
              SLP LKFLD+R+N F G++P  V+   L LDA+F N N F V+L   +  NS  SV+V 
Sbjct  179   TSLPGLKFLDLRFNAFDGELPAAVFGRRLGLDAIFANDNRFNVSLSSASLTNSTASVIVL  238

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+L+V D+S N L G LP 
Sbjct  239   ANTRLAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLRVLDLSHNELAGELPA  298

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKN  553
             S+G ++ LE LNV HN L+GE+P +ICELPRL+N T + NYFC  P  C  V  ++D+ N
Sbjct  299   SVGDMESLEVLNVGHNMLAGEVPEAICELPRLRNLTIAGNYFCDEPVSCLHVPLRDDRMN  358

Query  552   CIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             CIP WPHQRSPE C AF  + P  C+V GC
Sbjct  359   CIPDWPHQRSPEECIAFAHRPPPHCAVDGC  388



>ref|XP_010049719.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=732

 Score =   418 bits (1074),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 249/328 (76%), Gaps = 1/328 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENPRL NA++ALQA K  I +DP NFT +W GP VC+Y+ VYC+PAPDD  +RTVAG+D
Sbjct  63    FENPRLRNAYVALQALKQAILSDPNNFTANWVGPDVCSYSNVYCSPAPDDPSVRTVAGVD  122

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNH +I+G LPE+LGLL DLALFH+NSNRF G++P+ F +L+ L+ELD+SNN   G FP 
Sbjct  123   LNHGDIAGYLPEELGLLADLALFHLNSNRFCGSVPQKFRNLKRLYELDLSNNRFAGKFPR  182

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVL LP LKFLD+R+N+F G +P+E++D  LDA+F+N N F   LP N G+SPVSV+V A
Sbjct  183   VVLELPALKFLDLRFNEFDGSVPRELFDKDLDAIFINDNRFRFDLPDNLGHSPVSVIVLA  242

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NN+  GCLP SI +M K L+E+ILMN    +CLP ++G LK + VFDVS N L G LPES
Sbjct  243   NNDFGGCLPQSIVEM-KNLNEVILMNNGFKSCLPSQLGELKNVTVFDVSVNQLAGPLPES  301

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             +GK+  LEQLNVAHN+LSG+IPAS+C LP+L+NFT+S N+F   P  C ++   +D+KNC
Sbjct  302   VGKMVSLEQLNVAHNRLSGKIPASVCGLPKLQNFTFSDNFFTGEPPACLRLPAVDDRKNC  361

Query  549   IPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +   P QRSP  C+A  S+PVDCS  GC
Sbjct  362   LAGRPAQRSPIQCRASASRPVDCSAFGC  389



>ref|XP_011019702.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X4 [Populus euphratica]
Length=469

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 247/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    F+NPRL +A+IALQAWK  I +DP N T +W G  VC+YTGV+CA + D+  I+T
Sbjct  65    PACLKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVCSYTGVFCATSLDNSSIQT  124

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +++G L E+LGLLTD+ALFH+NSNRF G +PRSF  L+LL+ELD+SNN   
Sbjct  125   VAGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCGKVPRSFKKLKLLYELDLSNNRFA  184

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLK+LD+R+N+F+G +PKE++D  LDA+F+NHN F + LP NFGNSPVS
Sbjct  185   GRFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFMNHNRFALELPDNFGNSPVS  244

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN   GC P S+  M KTL+E+ILMN  L +CLP EIGLLK++ VFD S N L G
Sbjct  245   VIVLANNKFHGCFPTSLVNMSKTLNEVILMNNGLRSCLPREIGLLKKVTVFDASNNKLFG  304

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             SLP+++G+++ LE LNVAHN LSG IP S+C LP LKNF+Y+YN+F   P  C  +++ +
Sbjct  305   SLPDNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLKNFSYAYNFFTGEPPACLDLENFD  364

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D +NC+   P QRS   CK F S+PV C    C
Sbjct  365   DGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKC  397



>ref|XP_004512961.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=745

 Score =   417 bits (1072),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F+N R+ NA++ALQAWKH I +DP+N T DW G  VCNYT VYCAPA D+ +I+TV
Sbjct  73    PNLVFQNNRIKNAYVALQAWKHAILSDPRNCTVDWVGSNVCNYTNVYCAPALDNPKIQTV  132

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFH+NSNRF GT+P  F +L++LFELD+SNN   G
Sbjct  133   AGIDLNHCDIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFENLKILFELDLSNNRFAG  192

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PK ++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  193   KFPEVVLRLPELKFLDLRFNEFEGTVPKALFDKDLDAIFINHNRFVFDLPDNFGNSPVSV  252

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC P     M   L+EIILMN    +CLPDEIGLLK L VFDVSFN  +G 
Sbjct  253   IVLANNRFHGCFPAGFGNM-TNLNEIILMNNGFQSCLPDEIGLLKNLTVFDVSFNKFLGP  311

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G    LEQLNVAHN LSG+IP SIC+LP LKNFTYSYN+F   P  C  V   +D
Sbjct  312   LPEAIGGAVSLEQLNVAHNYLSGKIPESICKLPNLKNFTYSYNFFTGEPPSCLAVPAFDD  371

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QRS + CK+F S  +DC+   C
Sbjct  372   KQNCLPARPKQRSEKLCKSFLSHHIDCNSFRC  403



>ref|XP_011019700.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
 ref|XP_011019701.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Populus euphratica]
Length=482

 Score =   408 bits (1049),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 247/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    F+NPRL +A+IALQAWK  I +DP N T +W G  VC+YTGV+CA + D+  I+T
Sbjct  65    PACLKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVCSYTGVFCATSLDNSSIQT  124

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +++G L E+LGLLTD+ALFH+NSNRF G +PRSF  L+LL+ELD+SNN   
Sbjct  125   VAGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCGKVPRSFKKLKLLYELDLSNNRFA  184

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLK+LD+R+N+F+G +PKE++D  LDA+F+NHN F + LP NFGNSPVS
Sbjct  185   GRFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFMNHNRFALELPDNFGNSPVS  244

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN   GC P S+  M KTL+E+ILMN  L +CLP EIGLLK++ VFD S N L G
Sbjct  245   VIVLANNKFHGCFPTSLVNMSKTLNEVILMNNGLRSCLPREIGLLKKVTVFDASNNKLFG  304

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             SLP+++G+++ LE LNVAHN LSG IP S+C LP LKNF+Y+YN+F   P  C  +++ +
Sbjct  305   SLPDNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLKNFSYAYNFFTGEPPACLDLENFD  364

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D +NC+   P QRS   CK F S+PV C    C
Sbjct  365   DGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKC  397



>ref|NP_001050725.1| Os03g0637600 [Oryza sativa Japonica Group]
 gb|AAR01729.1| putative leucine-rich receptor-like protein kinase [Oryza sativa 
Japonica Group]
 gb|ABF97794.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12639.1| Os03g0637600 [Oryza sativa Japonica Group]
 gb|EAZ27885.1| hypothetical protein OsJ_11839 [Oryza sativa Japonica Group]
 dbj|BAG90773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97345.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98688.1| unnamed protein product [Oryza sativa Japonica Group]
Length=394

 Score =   405 bits (1041),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/330 (59%), Positives = 238/330 (72%), Gaps = 4/330 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++A QAWKH IT DPKN T+DW GP+VCNYTGVYCA APDD  + TVAG+DLN
Sbjct  59    NERLEAAYVAFQAWKHAITEDPKNLTEDWCGPFVCNYTGVYCAAAPDDPHVLTVAGVDLN  118

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +I+G LP+ LGLL D+AL H+NSNRF GTLP S  H+RLLFELDVSNNLL G FPA +
Sbjct  119   HGDIAGCLPDHLGLLADVALLHLNSNRFRGTLPPSMQHMRLLFELDVSNNLLAGAFPAFL  178

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYD--LKLDALFVNHNNFTVTLPR-NFGNSPVSVLVF  913
              SLP LKFLD+R+N F G++P  V+   L LDA+F N N F V+L   +  NS  SV+V 
Sbjct  179   TSLPGLKFLDLRFNAFDGELPAAVFGRRLGLDAIFANDNRFNVSLSSASLTNSTASVIVL  238

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+L+V D+S N L G LP 
Sbjct  239   ANTRLAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLRVLDLSHNELAGELPA  298

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKN  553
             S+G ++ LE LNV HN L+GE+P +ICELPRL+N T + NYFC  P  C  V  ++D+ N
Sbjct  299   SVGDMESLEVLNVGHNMLAGEVPEAICELPRLRNLTIAGNYFCDEPVSCLHVPLRDDRMN  358

Query  552   CIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             CIP WPHQRSPE C AF  + P  C+  GC
Sbjct  359   CIPDWPHQRSPEECIAFAHRPPPHCAADGC  388



>ref|XP_011019699.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Populus euphratica]
Length=492

 Score =   408 bits (1049),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 247/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    F+NPRL +A+IALQAWK  I +DP N T +W G  VC+YTGV+CA + D+  I+T
Sbjct  65    PACLKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVCSYTGVFCATSLDNSSIQT  124

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +++G L E+LGLLTD+ALFH+NSNRF G +PRSF  L+LL+ELD+SNN   
Sbjct  125   VAGIDLNHGDMAGHLVEELGLLTDIALFHVNSNRFCGKVPRSFKKLKLLYELDLSNNRFA  184

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLK+LD+R+N+F+G +PKE++D  LDA+F+NHN F + LP NFGNSPVS
Sbjct  185   GRFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFMNHNRFALELPDNFGNSPVS  244

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN   GC P S+  M KTL+E+ILMN  L +CLP EIGLLK++ VFD S N L G
Sbjct  245   VIVLANNKFHGCFPTSLVNMSKTLNEVILMNNGLRSCLPREIGLLKKVTVFDASNNKLFG  304

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             SLP+++G+++ LE LNVAHN LSG IP S+C LP LKNF+Y+YN+F   P  C  +++ +
Sbjct  305   SLPDNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLKNFSYAYNFFTGEPPACLDLENFD  364

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D +NC+   P QRS   CK F S+PV C    C
Sbjct  365   DGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKC  397



>ref|XP_010688564.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=607

 Score =   412 bits (1058),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 195/329 (59%), Positives = 250/329 (76%), Gaps = 3/329 (1%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   F NP+L +A+IALQAWK  I +DP N+T +W G  VC+YTGV+CAP+PD+  + T
Sbjct  68    PPNLQFLNPKLRDAYIALQAWKQAILSDPYNYTVNWVGSDVCHYTGVFCAPSPDNSSVLT  127

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHA+I+G LPE+LGLL DLALFHIN+NRF GT+P++F ++RLL E+D+SNN   
Sbjct  128   VAGIDLNHADIAGYLPEELGLLRDLALFHINTNRFCGTVPQNFRNMRLLHEIDLSNNRFA  187

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVLSLP LKFLD+R+N+F+G +P++++D  LDA+F+NHN F   LP NFGNSPVS
Sbjct  188   GRFPKVVLSLPSLKFLDLRFNEFEGNVPRQLFDKDLDAIFINHNRFKFELPDNFGNSPVS  247

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN+  GC+P S+  M   L+EII+MN    +CLP  +GLL+ L VFDVSFN L+G
Sbjct  248   VIVLANNDFHGCIPESLVHM-SNLNEIIMMNNGFRSCLPSNMGLLQNLTVFDVSFNELMG  306

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             SLPES+G++  LEQL+VAHN  SG IP SIC+LP L+NFTYSYN+F   P  C ++    
Sbjct  307   SLPESVGQIMSLEQLDVAHNMFSGNIPPSICKLPNLQNFTYSYNFFTGEPPACLRLPSFE  366

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCS  478
             D++NCIP  P QRS   C+A   KPVDCS
Sbjct  367   DRRNCIPRRPVQRSARQCRAL--KPVDCS  393



>gb|KDP27758.1| hypothetical protein JCGZ_19787 [Jatropha curcas]
Length=732

 Score =   415 bits (1066),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 254/347 (73%), Gaps = 9/347 (3%)
 Frame = -3

Query  1479  AYDDGP------PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             A++D P      P F F+NPRL  A+IALQAWK  I +DP NFT +W GP VC+Y GV+C
Sbjct  24    AHEDEPLAIHVDPTFKFDNPRLRQAYIALQAWKQAIYSDPFNFTANWNGPDVCSYLGVFC  83

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             AP P + +IR VAGIDLNHA+I+G LP +LGLLTDLALFHINSNRF G +P +F  L+LL
Sbjct  84    APFPKNPKIRVVAGIDLNHADIAGYLPPELGLLTDLALFHINSNRFCGVVPSTFHKLKLL  143

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
              ELD+SNN   G FP VVLSLP LK+LD+R+N+F+G +P +++D   DA+F+N N F   
Sbjct  144   HELDISNNRFVGKFPKVVLSLPALKYLDLRFNEFEGSVPSKLFDQPFDAIFLNDNRFQFG  203

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             +PRN GNSPVSVLV ANNNL GC+P SI  M KTL+EIILMN +L  CLP EIGLLK++ 
Sbjct  204   IPRNLGNSPVSVLVLANNNLGGCIPTSIGNMGKTLNEIILMNDNLTGCLPSEIGLLKQVT  263

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFN+L GSLP ++G +KK+EQL++AHN  +G IPAS+C+LP L+NFTYS+NYF   
Sbjct  264   VFDVSFNHLQGSLPSTIGNMKKVEQLDIAHNSFTGVIPASVCQLPNLQNFTYSFNYFTGE  323

Query  597   PEICRKVKHK---NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                C  +      N  KNCIP   +QRS + C +  ++PVDCS   C
Sbjct  324   APSCAAIGGSVVTNGTKNCIPGKLNQRSAKECSSNAARPVDCSKFKC  370



>gb|EPS67208.1| hypothetical protein M569_07569, partial [Genlisea aurea]
Length=313

 Score =   400 bits (1027),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 240/313 (77%), Gaps = 0/313 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
              +NPRL++AF+A Q+WK  IT DPK FT +W G  VCNY GVYCAPAPDD  + TVAG+D
Sbjct  1     LQNPRLFDAFLAFQSWKLAITDDPKGFTSNWVGHDVCNYRGVYCAPAPDDPGVITVAGVD  60

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+++G LPE+LGLL D+ALFH+NSNRF G+LP  F  L+LLFELD+SNNL CG FPA
Sbjct  61    LNHADVAGVLPEELGLLCDVALFHLNSNRFQGSLPAEFCKLKLLFELDLSNNLFCGGFPA  120

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VV  LP LKFLD+R+N+F G +P EV+DL+LDALF+N N F +TLP N GNSPVSVLV A
Sbjct  121   VVFKLPSLKFLDLRFNKFVGDVPPEVFDLQLDALFLNDNAFKLTLPPNLGNSPVSVLVAA  180

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             N    G LPP++ +M +TL+EI+L+N  L   LPDEIG L +L VFDV FN+L+G+LPES
Sbjct  181   NIFGFGILPPAVGQMAETLNEIVLLNSGLLGSLPDEIGQLTKLTVFDVGFNHLIGTLPES  240

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             +GK+  LEQLNVAHNKL+G IP  IC LPRL+NFTYS NYFCS P  C+ +   +  +NC
Sbjct  241   IGKMVSLEQLNVAHNKLTGNIPEGICLLPRLQNFTYSDNYFCSVPRSCQNLSPDDGDENC  300

Query  549   IPYWPHQRSPETC  511
             IP    QRSP  C
Sbjct  301   IPCKADQRSPLEC  313



>ref|XP_010525315.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 6 [Tarenaya hassleriana]
Length=410

 Score =   403 bits (1035),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/356 (57%), Positives = 251/356 (71%), Gaps = 13/356 (4%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVF------------PFENPRLYNAFIALQAWKHVITADPKNFTKDWY  1354
             ++P+HQ +  GP +             P  NPRL  A+ A + ++     +P    ++W 
Sbjct  32    ARPAHQTFHFGPRLPTNPCSGHGSWFPPIANPRLLKAYTAGEKFEKKNXTEPGQ-PENWC  90

Query  1353  GPYVCNYTGVYCAPAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTG  1174
             GP+VCNYTGV+CA APDD    TVAGIDLN ANI G+LP +LGLL DLALFH+NSNRF G
Sbjct  91    GPHVCNYTGVFCAAAPDDPFTLTVAGIDLNRANIVGSLPLELGLLNDLALFHLNSNRFHG  150

Query  1173  TLPRSFSHLRLLFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLD  994
              LP++  +LR L ELDVSNN   G FP +V SLP LKFLDIRYN+F G +PK V+DLKLD
Sbjct  151   ELPKTLKYLRFLNELDVSNNKFSGGFPDIVFSLPSLKFLDIRYNEFYGDVPKGVFDLKLD  210

Query  993   ALFVNHNNFTVTLPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGAC  814
             ALF+N N F  +LP N  NSPVSVLV ANN+L GC+PPS  KM  TL ++IL N  L  C
Sbjct  211   ALFINDNKFRFSLPENIVNSPVSVLVLANNDLYGCIPPSFYKMGNTLHQVILSNNRLTGC  270

Query  813   LPDEIGLLKELKVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLK  634
             L  EIG L  L VFDVSFNNLVG LPE+MG++K LEQLNVAHN+ SGEIP SIC LP+L+
Sbjct  271   LNREIGSLNRLTVFDVSFNNLVGPLPETMGEMKNLEQLNVAHNRFSGEIPKSICILPKLE  330

Query  633   NFTYSYNYFCSAPEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NFTYS N+F   P++C  +++ +D+KNCIP+ P QRS   CK+FY+ P+DC   GC
Sbjct  331   NFTYSDNFFSGEPQVCLNLRNFDDRKNCIPHRPMQRSYGECKSFYAYPIDCGSFGC  386



>ref|XP_004512856.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=642

 Score =   410 bits (1054),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 242/332 (73%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IA QAWK  I +DP+NFT +W G  VC+YTGVYCA A D+  IRTV
Sbjct  40    PSLVFENNRIRNAYIAFQAWKQAILSDPQNFTTNWVGSNVCSYTGVYCAQALDNPNIRTV  99

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP++LGLL DLALFHINSNRF GT+P SF+ L+LLFELD+SNN   G
Sbjct  100   AGIDLNHADIAGYLPDELGLLVDLALFHINSNRFCGTVPHSFNKLKLLFELDLSNNRFAG  159

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLDIR+N+F+G +PKE++D  LDA+FVN N F   LP NFGNSPVSV
Sbjct  160   KFPEVVLRLPVLKFLDIRFNEFEGSVPKELFDKDLDAIFVNDNRFAFELPENFGNSPVSV  219

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  +GC+P S+  M   L+EI  MN +  +CLP EIG+LK L VFDVSFN LVG 
Sbjct  220   VVLANNKFQGCIPSSLGNM-SNLNEINFMNNAFRSCLPSEIGMLKNLTVFDVSFNQLVGP  278

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G    LEQLNVA N  SG+IPASIC LP LKNFT+S N+F   P  C  V   +D
Sbjct  279   LPDAIGGAVSLEQLNVADNSFSGKIPASICMLPNLKNFTFSDNFFTGEPPACFGVPAIDD  338

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K NC+P  P Q+ P  C+ F SKP+DC    C
Sbjct  339   KGNCLPSRPFQKPPGQCQTFLSKPLDCKSFRC  370



>ref|XP_010050506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=425

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 234/313 (75%), Gaps = 1/313 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPR+ +A+IALQAWK  I +DPKN+T DW G  VCNYTGVYCAPA DD +IRTV
Sbjct  76    PSLKFENPRIRSAYIALQAWKEAILSDPKNYTADWVGSDVCNYTGVYCAPAIDDPKIRTV  135

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P  F  L+LLFELD+SNN   G
Sbjct  136   AGIDLNHGDIAGYLPEELGLLADLALFHINSNRFCGTVPHKFDRLKLLFELDLSNNRFAG  195

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FPAVVL LP LKFLD+R+N+F+G +PKE++D  LDA+F+N N F   LP NFGNSPVSV
Sbjct  196   KFPAVVLRLPSLKFLDLRFNEFEGTVPKELFDKDLDAIFINDNRFRFELPDNFGNSPVSV  255

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EII MN  L +CLP ++G LK + VFD S N LVG 
Sbjct  256   IVLANNKFHGCVPSSLVNM-SNLNEIIFMNNGLRSCLPTQVGKLKNVTVFDFSHNELVGP  314

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+ + K+  LEQLNVAHN LSG+IPA IC LPRL+NFTYSYN+F   P  C ++   +D
Sbjct  315   LPDGVAKMVSLEQLNVAHNLLSGKIPAGICTLPRLENFTYSYNFFTGEPPSCLRLPDFDD  374

Query  561   KKNCIPYWPHQRS  523
             ++NC+P  P   S
Sbjct  375   RRNCLPNRPSDFS  387



>gb|KHN21547.1| Leucine-rich repeat extensin-like protein 5 [Glycine soja]
Length=588

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F+N RL NA+IALQAWK  I +DP+N T DW G  VC+YTGVYCAPA D+  IRTV
Sbjct  41    PSLVFQNDRLRNAYIALQAWKQAILSDPRNQTTDWVGSQVCSYTGVYCAPALDNPNIRTV  100

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LP++LGLL DLALFHINSNRF GT+P  F  L+LL+ELD+SNN   G
Sbjct  101   AGIDLNHGDIAGYLPQELGLLVDLALFHINSNRFCGTVPHKFDRLKLLYELDLSNNRFAG  160

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+N N F   LP N GNSPVSV
Sbjct  161   KFPEVVLRLPSLKFLDLRFNEFEGTVPRELFDKDLDAIFINDNRFVFDLPDNLGNSPVSV  220

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN +  +CLP EIGLLK L VFDVSFN L+G 
Sbjct  221   IVLANNRFHGCIPASLGNM-SNLNEIILMNNAFRSCLPSEIGLLKNLTVFDVSFNQLLGP  279

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP ++G    LEQLNVAHN LSG+IPASIC LP L+NFTYS+N+F S P  C  +   +D
Sbjct  280   LPNAVGNAVSLEQLNVAHNLLSGQIPASICMLPHLQNFTYSFNFFTSEPPACLALPAFDD  339

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             + NC+P  P QR P  CK+F+SKPVDC+   C
Sbjct  340   RLNCLPARPAQRPPPQCKSFFSKPVDCNSFKC  371



>ref|XP_002308630.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
 gb|EEE92153.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
Length=487

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 245/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    F+NPRL +A+IALQAWK  I +DP N T +W G  VCNYTGV+CA + D+  I+T
Sbjct  3     PACLKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVCNYTGVFCATSLDNSSIQT  62

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +++G L  +LGLLTD+ALFH+NSNRF G +P+SF  L+LL+ELD+SNN   
Sbjct  63    VAGIDLNHGDMAGHLVAELGLLTDIALFHVNSNRFCGKVPKSFKKLKLLYELDLSNNRFA  122

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLK+LD+R+N+F+G +PKE++D  LDA+F+NHN F + LP NFGNSPVS
Sbjct  123   GRFPYVVLDLPKLKYLDLRFNEFEGDLPKELFDKDLDAIFINHNRFALELPDNFGNSPVS  182

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN   GC P S+  M K L+E+ILMN  L +CLP EIGLLK++ VFD S N L G
Sbjct  183   VIVLANNKFHGCFPTSLVNMSKNLNEVILMNNGLRSCLPREIGLLKKVTVFDASNNKLFG  242

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             SLP+++G+++ LE LNVAHN LSG IP S+C LP LKNF+Y+YN+F   P  C  +++ +
Sbjct  243   SLPDNIGEMESLELLNVAHNMLSGNIPGSVCLLPHLKNFSYAYNFFTGEPPACLDLENFD  302

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D +NC+   P QRS   CK F S+PV C    C
Sbjct  303   DGRNCLRNRPKQRSTLQCKVFLSRPVKCEAFKC  335



>ref|XP_010655031.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Vitis 
vinifera]
Length=737

 Score =   411 bits (1057),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 195/332 (59%), Positives = 250/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL  A+IALQAWK  I +DP NFT +W GP VC+Y GVYCAP+  +  ++ V
Sbjct  35    PKLKFENPRLRQAYIALQAWKTAIFSDPFNFTSNWVGPQVCSYMGVYCAPSLSNPSLKVV  94

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP +LGLL+DLALFH+NSNRF G +P S   ++LL+ELD+SNN   G
Sbjct  95    AGIDLNHADIAGYLPSELGLLSDLALFHLNSNRFCGIVPSSLKRMKLLYELDISNNRFVG  154

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLS+P LKFLD+R+N+F+G +P ++++  LDA+F+N N F   +P+N GNSPVSV
Sbjct  155   SFPNVVLSMPSLKFLDLRFNEFEGPVPSQLFNKDLDAVFLNDNRFQFGIPQNLGNSPVSV  214

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV ANNNL GC+P SI KM KTL+EIILMN +L +CLP +IGLLKE+ VFDVSFN+L GS
Sbjct  215   LVLANNNLGGCIPGSIGKMGKTLNEIILMNDNLTSCLPPQIGLLKEVTVFDVSFNHLQGS  274

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP ++GK+K LEQL+VAHN  +G IP SIC+LPRL+NFTYS+NYF     +C  +   + 
Sbjct  275   LPPAIGKMKSLEQLDVAHNSFTGAIPPSICQLPRLENFTYSFNYFTGEAPVCAAIT-GDG  333

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NCIP    QRS   C +  ++PVDCS   C
Sbjct  334   RQNCIPGKTDQRSSSMCSSQAARPVDCSKSKC  365



>emb|CDY10310.1| BnaC05g29690D [Brassica napus]
Length=498

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 203/330 (62%), Positives = 250/330 (76%), Gaps = 1/330 (0%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  NPRL  A+ ALQAWK  +T+DP  FT +W GP+VCNYTGV+CAP  D+  + TVAGI
Sbjct  47    PIANPRLLKAYAALQAWKFTMTSDPNGFTSNWCGPHVCNYTGVFCAPTLDNPYLLTVAGI  106

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNHANI+G LPE+LGLLTDLAL HINSNRF G LP S + L+LL ELDVSNN L G+FP
Sbjct  107   DLNHANIAGYLPEELGLLTDLALLHINSNRFKGQLPMSLNCLKLLHELDVSNNKLSGEFP  166

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
             +VV +LP LKFLDIR+N F G +P +++DL LDALF+N+NNF   LP N GNS VSVLV 
Sbjct  167   SVVFTLPSLKFLDIRFNGFYGDVPSQLFDLNLDALFINNNNFRFRLPGNIGNSTVSVLVL  226

Query  912   ANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
             ANN+L+G C+PPS   M KTL E+ILMN  +  CL  EIGLL +L VFDVSFNNLVGSLP
Sbjct  227   ANNDLQGSCVPPSFYNMGKTLHEVILMNSQISGCLNREIGLLNQLTVFDVSFNNLVGSLP  286

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             ++MG +K LEQLN+AHNK SG IP  IC LP L+NFTYSYN+F     +C +++  +D++
Sbjct  287   DTMGDMKSLEQLNIAHNKFSGYIPEGICRLPNLENFTYSYNFFSGESPVCLRLQEFDDRR  346

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC+P  P QR P  C++F S P++C+  GC
Sbjct  347   NCLPLKPMQRPPAECRSFSSYPINCASFGC  376



>ref|XP_011019927.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Populus 
euphratica]
Length=773

 Score =   412 bits (1058),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 193/329 (59%), Positives = 250/329 (76%), Gaps = 1/329 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENPR+  A+IALQ+WK  I +DP NFT +W G  VC+Y G++CAP+P +K++R VAGID
Sbjct  49    FENPRIRRAYIALQSWKQAIHSDPFNFTANWKGSDVCSYMGIFCAPSPQNKKVRVVAGID  108

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LP +LGLLTDLALFHINSNRF G +P SFS ++LL ELD+SNN   G FP 
Sbjct  109   LNHADIAGYLPTELGLLTDLALFHINSNRFCGVVPNSFSKMKLLHELDLSNNRFVGKFPK  168

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LK+LD+R+N+F+G +P +++D  LDA+F+N N F   +P N GNSPVSVLVFA
Sbjct  169   VVLSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLNDNRFQFGIPENLGNSPVSVLVFA  228

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM KTL+EIILM+ +L  CLP +IG+LKE+ VFDVSFN+L GSLP S
Sbjct  229   NNNLGGCIPGSIGKMGKTLNEIILMSDNLTGCLPPQIGMLKEVTVFDVSFNHLQGSLPSS  288

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKH-KNDKKN  553
             +G +K +EQL++AHN  +G IPAS+C+LP L+NFT+S+NYF      C  +    N  +N
Sbjct  289   IGNMKSVEQLDIAHNSFTGVIPASVCQLPNLQNFTFSFNYFTGEAPSCAAIGGISNGTQN  348

Query  552   CIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             CIP   +QRS + C +  ++PVDCS   C
Sbjct  349   CIPGKTNQRSAKQCSSEAARPVDCSKFKC  377



>ref|XP_008357497.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3, partial [Malus domestica]
Length=557

 Score =   405 bits (1040),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 243/333 (73%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    FEN RL +A+IALQAWK  + +DP++   +W G  VC YTGV+CA APDD  ++T
Sbjct  68    PDXLVFENSRLRSAYIALQAWKQAMVSDPRDQISNWVGSDVCKYTGVFCAQAPDDPSVQT  127

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHA+I+G LPE+LGLL+D+ALFHINSNRF G +P+SF+ L+LLFELD+SNN   
Sbjct  128   VAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGKVPKSFNKLQLLFELDLSNNRFA  187

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LP LKFLD+R+N+F+G++PKE++D  LDA+F+NHN F+  LP NFGNSPVS
Sbjct  188   GXFPDVVLQLPALKFLDLRFNEFEGEVPKELFDKDLDAIFINHNRFSFELPNNFGNSPVS  247

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANNN  GC+P S+  M K L+E++L N    +CLP EIG+LK++ VFDVS N  VG
Sbjct  248   VIVLANNNFHGCVPASLGNMSKNLNELVLTNNGFHSCLPREIGMLKKVTVFDVSHNRFVG  307

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+ + +++ LEQLNVAHN L G IP  +CEL  L  F+  +N+F   P +C K+K  +
Sbjct  308   ELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAKFSIEHNFFTVEPPMCLKLKEFD  367

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D KNC+   P QR+   CK   SK VDCS  GC
Sbjct  368   DSKNCLRKRPKQRTLLQCKLALSKKVDCSSFGC  400



>ref|XP_003524389.2| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Glycine 
max]
Length=597

 Score =   406 bits (1043),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F+N RL NA+IALQAWK  I +DP+N T DW G  VC+YTGVYCAPA D+  IRTV
Sbjct  41    PSLVFQNDRLRNAYIALQAWKQAILSDPRNQTTDWVGSQVCSYTGVYCAPALDNPNIRTV  100

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LP++LGLL DLALFHINSNRF GT+P  F  L+LL+ELD+SNN   G
Sbjct  101   AGIDLNHGDIAGYLPQELGLLVDLALFHINSNRFCGTVPHKFDRLKLLYELDLSNNRFAG  160

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+N N F   LP N GNSPVSV
Sbjct  161   KFPEVVLRLPSLKFLDLRFNEFEGTVPRELFDKDLDAIFINDNRFVFDLPDNLGNSPVSV  220

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN +  +CLP EIGLLK L VFDVSFN L+G 
Sbjct  221   IVLANNRFHGCIPASLGNM-SNLNEIILMNNAFRSCLPSEIGLLKNLTVFDVSFNQLLGP  279

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP ++G    +EQLNVAHN LSG+IPASIC LP L+NFTYS+N+F S P  C  +   +D
Sbjct  280   LPNAVGNAVSMEQLNVAHNLLSGQIPASICMLPHLQNFTYSFNFFTSEPPACLVLPAFDD  339

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             + NC+P  P QR P  CK+F+SKPVDC+   C
Sbjct  340   RLNCLPARPAQRPPPQCKSFFSKPVDCNSFKC  371



>ref|XP_008337109.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3 [Malus domestica]
Length=480

 Score =   402 bits (1033),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 244/328 (74%), Gaps = 0/328 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENPRL +A+ ALQAWK  + +DP + T +W G  VC YTGV+CA APDD  ++TVAGID
Sbjct  73    FENPRLRSAYTALQAWKRAMVSDPWDQTSNWVGSDVCKYTGVFCAQAPDDPSVQTVAGID  132

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LPE+LGLL D+ALFHINSNRF G +P+SF+ L+LLFELD+SNN   G+FP 
Sbjct  133   LNHADIAGFLPEELGLLLDIALFHINSNRFCGKVPKSFNKLKLLFELDLSNNRFAGEFPD  192

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVL LP LKFLD+R+N+F+GK+PKE++D  LDA+F+NHN F+  LP NFG SPVSV+V A
Sbjct  193   VVLQLPALKFLDLRFNEFEGKVPKELFDKDLDAIFINHNRFSFQLPDNFGKSPVSVIVLA  252

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNN  GC+P S+  M K L+E++L +    +CLP EIG+LK +++FDVS N +VG LP+ 
Sbjct  253   NNNFHGCVPASLGNMSKNLNELVLAHNGFHSCLPKEIGMLKNVRLFDVSHNRVVGELPKE  312

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             + +++ LE LNVAHN L G IP  +CEL  LK F++ +N+F S P +C K++  +D KNC
Sbjct  313   IVEMESLEXLNVAHNMLRGTIPEGVCELQNLKKFSFEHNFFTSEPLMCLKLEEFDDSKNC  372

Query  549   IPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +   P QR+   CK   SK VDCS  GC
Sbjct  373   LRKRPKQRTFLQCKLALSKKVDCSSFGC  400



>ref|XP_008219840.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=559

 Score =   404 bits (1037),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 245/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    F NPRL +A++ALQAWK  + +DP   T +W G  +C+YTGV+C+ A DD  + T
Sbjct  62    PSSLVFHNPRLRSAYVALQAWKQAMLSDPLGETSNWVGSNICSYTGVFCSRALDDPSVET  121

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH  I+G LPE+LGLL+D+ALFHINSNRF G++P+SFS L+LLFELD+SNN   
Sbjct  122   VAGIDLNHGGIAGYLPEELGLLSDIALFHINSNRFCGSVPKSFSKLKLLFELDLSNNRFA  181

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLKFLD+R+N+F+GK+PKE++D  LDA+F+NHN F+  LP NFGNSPVS
Sbjct  182   GKFPLVVLQLPKLKFLDLRFNEFEGKVPKELFDKDLDAIFINHNRFSFKLPDNFGNSPVS  241

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANNN  GC+P S+  M K L+E++L N    +CLP EIG+LK++ +FDVS+N +VG
Sbjct  242   VIVLANNNFHGCVPASLGNMSKNLNEVVLTNNGFHSCLPKEIGMLKDVTLFDVSYNQIVG  301

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPE++G++  LE LNVAHN L G IP S+CEL  L+NF++ +N+F S    C K++  +
Sbjct  302   ELPEAVGEMVSLEALNVAHNMLRGNIPESVCELQNLRNFSFEHNFFTSEQPTCLKLEKFD  361

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D KNC+   P QR+   CK   SK V CS  GC
Sbjct  362   DSKNCLRRRPKQRTMLHCKLALSKGVRCSSFGC  394



>ref|XP_008378297.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Malus 
domestica]
Length=577

 Score =   404 bits (1038),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 243/333 (73%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    FEN RL +A+IALQAWK  + +DP++   +W G  VC YTGV+CA APDD  ++T
Sbjct  68    PDXLVFENSRLRSAYIALQAWKQAMVSDPRDQISNWVGSDVCKYTGVFCAQAPDDPSVQT  127

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHA+I+G LPE+LGLL+D+ALFHINSNRF G +P+SF+ L+LLFELD+SNN   
Sbjct  128   VAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGKVPKSFNKLQLLFELDLSNNRFA  187

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LP LKFLD+R+N+F+G++PKE++D  LDA+F+NHN F+  LP NFGNSPVS
Sbjct  188   GXFPDVVLQLPALKFLDLRFNEFEGEVPKELFDKDLDAIFINHNRFSFELPNNFGNSPVS  247

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANNN  GC+P S+  M K L+E++L N    +CLP EIG+LK++ VFDVS N  VG
Sbjct  248   VIVLANNNFHGCVPASLGNMSKNLNELVLTNNGFHSCLPREIGMLKKVTVFDVSHNRFVG  307

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+ + +++ LEQLNVAHN L G IP  +CEL  L  F+  +N+F   P +C K+K  +
Sbjct  308   ELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAKFSIEHNFFTVEPPMCLKLKEFD  367

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D KNC+   P QR+   CK   SK VDCS  GC
Sbjct  368   DSKNCLRKRPKQRTLLQCKLALSKKVDCSSFGC  400



>ref|XP_006372265.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
 gb|ERP50062.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
Length=461

 Score =   400 bits (1027),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 251/348 (72%), Gaps = 7/348 (2%)
 Frame = -3

Query  1488  SHQAYDDGP------PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTG  1327
             S  A++DG           FENPR+  A+IALQ+WK  I +DP NFT +W G  VC+Y G
Sbjct  24    SSAAHEDGDHDINVDSTLKFENPRIRRAYIALQSWKQAIFSDPFNFTANWNGSDVCSYMG  83

Query  1326  VYCAPAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHL  1147
             V+CAP+P +K+IR VAGIDLNHA+I+G LP +LGL+ DLAL HINSNRF G +P SF  +
Sbjct  84    VFCAPSPKNKKIRVVAGIDLNHADIAGYLPTELGLIIDLALLHINSNRFCGVVPSSFRKM  143

Query  1146  RLLFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNF  967
             +LL ELD+SNN L G FP VV+SLP LK+LD+R+N+F+G +P +++D  LDA+F+N N F
Sbjct  144   KLLHELDLSNNRLMGKFPKVVVSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLNDNRF  203

Query  966   TVTLPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLK  787
                +P N GNSP SVLV ANNNL GC+P SI KM KTL+EIILMN +L  CLP +IG+LK
Sbjct  204   RFGIPENLGNSPASVLVLANNNLGGCIPGSIGKMSKTLNEIILMNDNLTGCLPPQIGMLK  263

Query  786   ELKVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYF  607
             E+ VFDVSFN+L G+LP S+G +K +EQL++AHN  +G +PAS+ +LP L+NFTYS+NYF
Sbjct  264   EVTVFDVSFNHLQGALPSSIGNMKSVEQLDIAHNSFTGVVPASVYQLPNLQNFTYSFNYF  323

Query  606   CSAPEICRKVKH-KNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                   C  +    N  +NCIP   +QRS + C +  ++P+DCS   C
Sbjct  324   TGEAPSCAAIGAVSNGTQNCIPGKMNQRSAKQCSSEAARPIDCSKFKC  371



>emb|CBI26296.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   398 bits (1023),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 237/344 (69%), Gaps = 41/344 (12%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             S PSHQ     PP+    NPR+ NA+ ALQAWKHVI +DPKNFT +W G           
Sbjct  113   SAPSHQDSYSPPPL---PNPRILNAYTALQAWKHVILSDPKNFTSNWCG-----------  158

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
                                         DLGLLTDLALFHINSNRF GTLP SF HLRLL
Sbjct  159   ---------------------------FDLGLLTDLALFHINSNRFCGTLPDSFRHLRLL  191

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             +ELD+SNN   G FP+VVL LP LKFLDIRYN+F+G IP  ++DLKLDA+FVN+N F  +
Sbjct  192   YELDISNNRFKGQFPSVVLCLPSLKFLDIRYNEFEGDIPTGLFDLKLDAIFVNNNKFKSS  251

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             LP N GNSPVSV+VFANNNL GCLP S++KM KTL+E+I+ N  L  CL  EIGLLK + 
Sbjct  252   LPGNIGNSPVSVIVFANNNLNGCLPSSLSKMAKTLNELIITNAGLKGCLSPEIGLLKNVT  311

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVS N LVG LPE++G++K LEQLNVAHNKLSGEIP +IC LP L+NFTYSYNYFC  
Sbjct  312   VFDVSSNELVGPLPETIGEMKSLEQLNVAHNKLSGEIPETICSLPNLENFTYSYNYFCGE  371

Query  597   PEICRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             P  C K+   +D+KNCIP  P QRSPE C AF ++PVDC   GC
Sbjct  372   PPTCLKLPANDDQKNCIPDRPMQRSPEECAAFLAQPVDCGAFGC  415



>gb|EPS58069.1| hypothetical protein M569_16746, partial [Genlisea aurea]
Length=334

 Score =   394 bits (1013),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/330 (58%), Positives = 239/330 (72%), Gaps = 0/330 (0%)
 Frame = -3

Query  1455  FPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAG  1276
             F FEN  L  A+IALQAWK  I +DP NFT+ W GP VC+Y GV+CAP+  +  +R VAG
Sbjct  2     FRFENSNLRRAYIALQAWKRAIFSDPFNFTESWTGPDVCSYGGVFCAPSLGNGSVRVVAG  61

Query  1275  IDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDF  1096
             IDLNHA+I+G LPE LGLL +LALFHIN+NRF G +P+SF  L+LLFELD+SNN   G F
Sbjct  62    IDLNHADIAGYLPEKLGLLEELALFHINTNRFCGLVPKSFRRLKLLFELDLSNNRFVGKF  121

Query  1095  PAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLV  916
             P+VVLSLP LK+LD+R+N F+G +P EV+D  LDA+F+N N F   +P N GNSPVSVLV
Sbjct  122   PSVVLSLPSLKYLDLRFNDFEGVVPAEVFDKDLDAIFLNDNRFRWGIPENLGNSPVSVLV  181

Query  915   FANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
              ANN L GC+P SI KM KTL+++IL+N +L  CLP EIG L +L VFDVSFN + G LP
Sbjct  182   LANNELGGCIPHSIGKMEKTLNQLILLNDNLTGCLPHEIGKLDQLTVFDVSFNAIQGPLP  241

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
               +G ++ LEQL+VA N+L+GEIPA+IC LPRL NFTYSYN+F   P  C      + ++
Sbjct  242   SEIGNMRSLEQLDVARNRLTGEIPAAICRLPRLLNFTYSYNFFTGTPPHCGGGVVSDGRE  301

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NCIP    QRS   C +  +KP DCS   C
Sbjct  302   NCIPGKIGQRSGGECSSPAAKPFDCSKSKC  331



>ref|XP_009352479.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=521

 Score =   401 bits (1030),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN RL NA+IALQA K  I +DP N T +W G  VC YTGV+C  A D++ IRTV
Sbjct  76    PSLVFENDRLRNAYIALQALKQAILSDPFNITGNWVGSNVCKYTGVFCTKALDNRTIRTV  135

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLAL HINSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  136   AGIDLNHGDIAGYLPEELGLLTDLALLHINSNRFCGTVPHKFNRLKLLFELDLSNNRFAG  195

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  196   KFPRVVLQLPKLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFRFDLPDNFGNSPVSV  255

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN    +CLP EIG+LK L VFDVSFN  +GS
Sbjct  256   IVLANNKFHGCVPASLGNM-SNLNEIILMNNGFRSCLPPEIGMLKNLTVFDVSFNQFLGS  314

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G +  LEQLNVAHN LSG+IPASIC LP L+NFTYSYN+F   P  C  +   +D
Sbjct  315   LPETIGGMVSLEQLNVAHNLLSGKIPASICSLPSLQNFTYSYNFFTGEPPACLGLAGFDD  374

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QR+   CK+F SKPVDCS   C
Sbjct  375   KRNCLPNRPAQRTAAQCKSFLSKPVDCSSFRC  406



>ref|XP_011093910.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Sesamum 
indicum]
Length=784

 Score =   409 bits (1052),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 200/331 (60%), Positives = 247/331 (75%), Gaps = 3/331 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP L  A+IALQAWK  I +DP NFT +W G  VC+Y GV+CAP+  +   R VAGID
Sbjct  61    FENPSLRQAYIALQAWKKAIFSDPFNFTANWTGSNVCSYGGVFCAPSLSNSSARVVAGID  120

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LP++LGLLTDLALFHINSNRF G +P SF  L+LLFELD+SNN   G FP 
Sbjct  121   LNHADIAGYLPDELGLLTDLALFHINSNRFCGVVPNSFKKLKLLFELDLSNNRFVGGFPK  180

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N+F+G +P +V+D  LDALF+N N F   +P N GNSPVSVLV A
Sbjct  181   VVLSLPSLKFLDLRFNEFEGGVPSQVFDKDLDALFLNDNRFQFGIPENLGNSPVSVLVLA  240

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI  M KTL+E+ILMN +L  CLP +IG+LKEL VFDVSFNNL G LP  
Sbjct  241   NNNLGGCIPGSIGNMGKTLNELILMNDNLTGCLPPQIGMLKELTVFDVSFNNLQGPLPSE  300

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFC-SAPEICR--KVKHKNDK  559
             + +++ LEQL+VAHN+L+GE+PA++C+LPRL+NFTYSYNYF   APE  R       + +
Sbjct  301   VSRMRSLEQLDVAHNRLTGEVPAAVCQLPRLQNFTYSYNYFTREAPECSRFGGGAVSDGR  360

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +NCIP   +QRS   C +  +KP DCS   C
Sbjct  361   ENCIPNKSNQRSARECSSDAAKPFDCSKSKC  391



>ref|XP_007152809.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
 gb|ESW24803.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
Length=725

 Score =   407 bits (1047),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 250/332 (75%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F FEN RL NA+IALQAWKH I +DPKN T DW GP VCNYT V+CAPA D+ +I TV
Sbjct  70    PSFRFENNRLRNAYIALQAWKHAILSDPKNLTLDWVGPNVCNYTSVFCAPALDNPKINTV  129

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLAL HIN+NRF GT+P  F  L+LLFELD+SNN   G
Sbjct  130   AGIDLNHGDIAGYLPEELGLLTDLALLHINTNRFCGTVPHKFDKLKLLFELDLSNNRFAG  189

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D +LDA+F+N N F   LP NFGNSPVSV
Sbjct  190   KFPDVVLRLPQLKFLDLRFNEFEGTVPKELFDKELDAIFINDNRFVFDLPENFGNSPVSV  249

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P  I  M K L+EIILMN +  +C P+EIGLL  L VFDVSFN L+G 
Sbjct  250   IVLANNRFHGCVPAGIGNM-KGLNEIILMNNAFRSCFPEEIGLLTNLTVFDVSFNQLLGP  308

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++G    LEQLNVAHN LSG+IP SIC+LP L+NFT+SYN+F   P  CR +   +D
Sbjct  309   LPEAIGGAVGLEQLNVAHNLLSGKIPESICKLPNLQNFTFSYNFFTGEPPRCRALPAADD  368

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P+QRS   CK+F S PVDC    C
Sbjct  369   RRNCLPARPYQRSAGQCKSFLSHPVDCKSFRC  400



>ref|XP_011078162.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Sesamum 
indicum]
Length=712

 Score =   407 bits (1046),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 195/331 (59%), Positives = 244/331 (74%), Gaps = 3/331 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP L  A+IALQAWK  I +DP NFT +W GP VC+Y GV+CA +  +  +R VAGID
Sbjct  59    FENPSLRRAYIALQAWKQAIFSDPFNFTANWTGPDVCSYGGVFCATSQSNSSVRVVAGID  118

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LP++LGLLTDLALFHINSNRF G +P SF  L+LLFELD+SNN   G FP 
Sbjct  119   LNHADIAGYLPDELGLLTDLALFHINSNRFCGVVPESFEKLKLLFELDLSNNRFVGGFPT  178

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N+F+G +P  ++D  LDALF+N N F   +P N GNSPVSVLV A
Sbjct  179   VVLSLPSLKFLDLRFNEFEGGVPATIFDKDLDALFLNDNRFRFGIPENLGNSPVSVLVLA  238

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM +TL+E+ILMN +L  CLP +IG L++L VFDVSFNNL G LP  
Sbjct  239   NNNLGGCIPGSIGKMGRTLNELILMNDNLTGCLPPQIGRLRKLTVFDVSFNNLQGPLPAE  298

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK---NDK  559
             + +++ LEQLNVAHN+L+GE+PA+IC+LPRL+NFTYSYNYF      C +       + +
Sbjct  299   ITRMRSLEQLNVAHNRLTGEVPANICQLPRLQNFTYSYNYFTREAPQCSRFGGGTVYDGR  358

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +NCIP   +QRS   C +  +KP DC    C
Sbjct  359   ENCIPNKSNQRSARECSSDAAKPFDCRKSKC  389



>gb|EPS66877.1| hypothetical protein M569_07899 [Genlisea aurea]
Length=358

 Score =   395 bits (1014),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 243/329 (74%), Gaps = 1/329 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P  P  NPRL+ A +A+QA  H IT DPK FT +WYGP VC+Y G+ CAP PDD +  TV
Sbjct  28    PGCPTPNPRLFAASLAIQALLHSITDDPKGFTANWYGPDVCSYKGIVCAPPPDDPDSTTV  87

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHANI+GTLPE+LGLLTDLA+FH+NSNRFTGT+P  FS ++LL+E D+SNNL  G
Sbjct  88    AGIDLNHANIAGTLPEELGLLTDLAIFHLNSNRFTGTVPEGFSDMKLLYEFDISNNLFSG  147

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL +P LK+LD+R+N F GKIP  V+DLKLDA F N+N FT +LP + GNS VSV
Sbjct  148   YFPEVVLRIPSLKYLDLRFNTFVGKIPAAVFDLKLDAFFFNNNGFTFSLPSSLGNSSVSV  207

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV AN    G LPP I ++  TL+EI+L+N  L   LP EIG L EL V DVSFNNL G+
Sbjct  208   LVAANVAGIGSLPPDIGRLSGTLTEIVLLNSGLSGVLPAEIGQLTELTVLDVSFNNLTGT  267

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G L +LEQLNV HN+LSG+IP SIC LP L+NFTYS NYFCSAP+ C  +++ + 
Sbjct  268   LPESIGNLARLEQLNVGHNRLSGDIPESICLLPNLQNFTYSDNYFCSAPDSCDDLRNSDG  327

Query  561   KKNCIPYWPHQRSPETCKAFY-SKPVDCS  478
               NCIP   +QRS E C+ F   +  DCS
Sbjct  328   ADNCIPCEDNQRSDEECRPFCPEESDDCS  356



>ref|XP_006351117.1| PREDICTED: leucine-rich repeat extensin-like protein 2-like [Solanum 
tuberosum]
Length=724

 Score =   407 bits (1046),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/328 (59%), Positives = 250/328 (76%), Gaps = 0/328 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP++ +A+IALQ WK  + +DP NFT +W GP VC+Y GV+CAP+ +D  IR VAGID
Sbjct  48    FENPKIRDAYIALQYWKTAMFSDPFNFTANWTGPDVCSYGGVFCAPSLNDDSIRVVAGID  107

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G+L  +LGLLTDL LFH+NSNRF G +P++FSHL+LL ELD+SNN   G FP 
Sbjct  108   LNHADIAGSLVAELGLLTDLVLFHLNSNRFCGVVPKTFSHLKLLRELDLSNNRFVGGFPK  167

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N F+G +P E++D  LDALF+N N F   +P N GNSPVSVLVFA
Sbjct  168   VVLSLPSLKFLDLRFNDFEGPVPSELFDKDLDALFLNDNRFRFGIPENLGNSPVSVLVFA  227

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NN+L GC+P SI KM KTL+E+ILMN +L  CLP EIGLLK+L VFDVSFN + GSLP +
Sbjct  228   NNDLGGCIPASIGKMGKTLNELILMNDNLTGCLPMEIGLLKKLTVFDVSFNKIQGSLPLT  287

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             + K++ +E+LNVAHNKL+G IPASIC+LPRL+NFTYS+NYF     +C   +  + ++NC
Sbjct  288   VSKMRSVEELNVAHNKLTGVIPASICQLPRLQNFTYSFNYFTGEAPVCAATRSGDGQENC  347

Query  549   IPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             I    +QRS + C +  +KP DC    C
Sbjct  348   IVGKKNQRSAKECSSDDAKPYDCKKSKC  375



>ref|XP_008463374.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Cucumis 
melo]
Length=771

 Score =   408 bits (1049),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 245/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W G  VCNY GV+CAP+ D+ +IRTV
Sbjct  58    PSLVFENDRIRNAYIALQAWKLAILSDPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTV  117

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GTLP  F  L+LL+ELD+SNN   G
Sbjct  118   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAG  177

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  178   KFPDVVLKLPTLKFLDLRFNEFEGSVPRELFDKDLDAIFINHNRFRFELPDNFGNSPVSV  237

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M + L+EII+MN  L +CLP EIG LK L VFDVS N LVG 
Sbjct  238   IVLANNKFHGCVPSSLGNMTR-LNEIIMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGP  296

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE+ G L  LEQLNVA N LSG+IP SICELP+L+NFT+S N+F   P  C +V   +D
Sbjct  297   LPETFGGLVSLEQLNVADNFLSGKIPESICELPKLQNFTFSNNFFSGEPPACLRVPDFSD  356

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+   P QRS   C AF S+PVDC+   C
Sbjct  357   RRNCLAGRPGQRSTGQCNAFLSRPVDCNAFKC  388



>ref|XP_008365636.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Malus domestica]
Length=505

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 238/332 (72%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN RL NA+IALQA K  I +DP N T +W G  VC YT V+   A D++ IRTV
Sbjct  126   PSLVFENDRLRNAYIALQALKQAILSDPFNITGNWVGSNVCKYTXVFXTKALDNRTIRTV  185

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GT+P  F+ L+LLFELD+SNN   G
Sbjct  186   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFNXLKLLFELDLSNNRFAG  245

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LPKLKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NF NSPVSV
Sbjct  246   KFPRVVLQLPKLKFLDLRFNEFEGXVPKELFDKDLDAIFINHNRFRFBLPDNFXNSPVSV  305

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC P S+  M   L+EIILMN    +CLP EI +LK L VFDVSFN  +GS
Sbjct  306   IVLANNKFHGCXPASLGNM-SNLNEIILMNNGFXSCLPPEIXMLKNLTVFDVSFNQFLGS  364

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE++  +  LEQLNVAHN LSG+I  SIC LP L+NFTYSYN+F   P  C  +   +D
Sbjct  365   LPETIXGMVSLEQLNVAHNLLSGKIXXSICSLPSLQNFTYSYNFFTGEPPACLGLAGFDD  424

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             K+NC+P  P QR+   CK+F SKPVDC    C
Sbjct  425   KRNCLPNRPAQRTAAQCKSFLSKPVDCISFRC  456



>ref|XP_009377376.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=679

 Score =   405 bits (1040),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 243/333 (73%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    FEN RL +A+IALQAWK  + +DP +   +W G  VC YTGV+CA APDD  ++T
Sbjct  68    PASLVFENSRLRSAYIALQAWKQAMVSDPLDQISNWVGSDVCKYTGVFCAQAPDDPSVQT  127

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHA+I+G LPE+LGLL+D+ALFHINSNRF G +P+SF  L+LLFELD+SNN   
Sbjct  128   VAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGKVPKSFKKLQLLFELDLSNNRFA  187

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G+FP VVL LP LKFLD+R+N+F+G+IPKE++D  LDA+F+NHN F+  LP NFGNSPVS
Sbjct  188   GEFPDVVLQLPALKFLDLRFNEFEGEIPKELFDKDLDAIFINHNRFSFKLPNNFGNSPVS  247

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANNN  GC+P S+ KM K L+E++L N    +CLP EIG+LK++ VFDVS N  VG
Sbjct  248   VIVLANNNFHGCVPASLGKMSKNLNELVLTNNGFHSCLPREIGMLKKVTVFDVSHNRFVG  307

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+ + +++ LEQLNVAHN L G IP  +CEL  L  F++ +N F   P +C K++  +
Sbjct  308   ELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAKFSFEHNLFTVEPPMCLKLEEFD  367

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D KNC+   P QR+   CK   SK VDCS  GC
Sbjct  368   DSKNCLRKRPKQRTLLQCKLALSKKVDCSSFGC  400



>ref|XP_002324259.1| hypothetical protein POPTR_0018s01010g [Populus trichocarpa]
 gb|EEF02824.1| hypothetical protein POPTR_0018s01010g [Populus trichocarpa]
Length=496

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/333 (59%), Positives = 248/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   F+NPRL +A+IALQAWK  I +DP N T +W GP VCNYTGV+CA A DD  I+T
Sbjct  65    PPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPDVCNYTGVFCATALDDSSIQT  124

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +++G L E+LGLLTD+ALFHINSNRF G +P++   L+LL+ELD+SNN   
Sbjct  125   VAGIDLNHGDMAGHLVEELGLLTDIALFHINSNRFCGRVPKTLKKLKLLYELDLSNNRFA  184

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLK+LD+R+N+F+G +PKE+++  LDA+FVNHN F + LP NFGNSPVS
Sbjct  185   GGFPCVVLDLPKLKYLDLRFNEFEGDLPKELFNKDLDAIFVNHNRFALELPNNFGNSPVS  244

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN   GC PPS+A M KTL+E+ILMN  L +CLP EIGLLK++ VFD S N LVG
Sbjct  245   VMVLANNKFHGCFPPSLANMSKTLNEVILMNNGLRSCLPKEIGLLKKVTVFDASNNKLVG  304

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             SLP+++G ++ LEQLNVAHN LSGEI  S+C LP LK+F+Y+YN+    P  C  ++  +
Sbjct  305   SLPDTIGDMESLEQLNVAHNMLSGEIHDSVCLLPHLKSFSYAYNFITGEPPACLDLEDFD  364

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D +NC    P QRS   CK F S+PV C    C
Sbjct  365   DSRNCFRVRPKQRSTLQCKVFLSRPVHCEAFNC  397



>ref|XP_009348443.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=745

 Score =   407 bits (1045),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/328 (57%), Positives = 246/328 (75%), Gaps = 0/328 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENPRL +A+ ALQAWK  + +DP++ T +W G  VC YTGV+CA APDD  ++TVAGID
Sbjct  73    FENPRLRSAYTALQAWKRAMVSDPRDQTSNWVGSDVCKYTGVFCAQAPDDPSVQTVAGID  132

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LPE+LGLL D+ALFHINSNRF G +P+SF+ L+LLFELD+SNN   G+FP 
Sbjct  133   LNHADIAGFLPEELGLLLDIALFHINSNRFCGKVPKSFNKLKLLFELDLSNNRFAGEFPD  192

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVL LP LKFLD+R+N+F+GK+PKE++D  LDA+F+NHN F+  LP NFG SPVSV+V A
Sbjct  193   VVLQLPALKFLDLRFNEFEGKVPKELFDKDLDAIFINHNRFSFQLPDNFGKSPVSVIVLA  252

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNN  GC+P S+ KM K L+E++L N    +CLP EIG+L  +++FDVS N +VG LP+ 
Sbjct  253   NNNFHGCVPASLGKMSKNLNELVLANNRFHSCLPKEIGMLTNVRLFDVSHNRIVGELPKE  312

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             + +++ LEQLNVAHN L G IP  +CEL  LK F++ +N+F S P +C K++  +D KNC
Sbjct  313   IVEMESLEQLNVAHNMLRGTIPEGVCELQNLKKFSFEHNFFTSEPLMCLKLEEFDDSKNC  372

Query  549   IPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +   P QR+   CK   SK +DCS  GC
Sbjct  373   LRKRPKQRTFLQCKLALSKKIDCSSFGC  400



>ref|XP_007014601.1| Leucine-rich repeat/extensin 2 [Theobroma cacao]
 gb|EOY32220.1| Leucine-rich repeat/extensin 2 [Theobroma cacao]
Length=748

 Score =   406 bits (1044),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 245/332 (74%), Gaps = 4/332 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENPRL  A+IALQAWK  I +DP NFT +W GP VC+Y G+YCAP+P + +IR VAGID
Sbjct  44    FENPRLREAYIALQAWKSAIFSDPFNFTANWDGPDVCSYMGIYCAPSPSNPKIRVVAGID  103

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LP +LG LTDLALFH+NSNRF G +P SF  ++LL ELD+SNN   G FP 
Sbjct  104   LNHADIAGYLPPELGRLTDLALFHLNSNRFCGVVPASFRRMKLLHELDLSNNRFVGKFPN  163

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LK+LD+R+N+F+G +P +++D +LDALF+N N F   +P N GNSPVSVLVFA
Sbjct  164   VVLSLPSLKYLDLRFNEFEGSVPSKLFDKQLDALFLNDNRFRFGIPENLGNSPVSVLVFA  223

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NN+L GC+P SI  M KTL+EIILMN +L  CLP +IG+L EL VFDVSFN+L GSLP +
Sbjct  224   NNDLGGCIPGSIGMMGKTLNEIILMNDNLTGCLPPQIGMLTELTVFDVSFNHLQGSLPST  283

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKV----KHKND  562
             +G +K LEQLNVAHN  +G IPA+ C+LP L+NFTYS+NYF   P  C  +    K  N 
Sbjct  284   IGNMKSLEQLNVAHNSFTGVIPANACQLPNLQNFTYSFNYFTGEPPSCSAISGGGKVTNG  343

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               NCIP    QRS   C +  ++PV+CS   C
Sbjct  344   TMNCIPGKKGQRSSRECSSDAARPVNCSKFKC  375



>ref|XP_003630813.1| Extensin-like protein [Medicago truncatula]
 gb|AET05289.1| LRR extensin-like protein [Medicago truncatula]
Length=712

 Score =   405 bits (1041),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 201/341 (59%), Positives = 246/341 (72%), Gaps = 3/341 (1%)
 Frame = -3

Query  1488  SHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPA  1309
             S Q  D+  P   FEN R+ NA+IALQA K  I +DP NFT +W G  VC+YTG+YCA A
Sbjct  23    SAQTIDN--PSLVFENNRIQNAYIALQALKQAILSDPLNFTTNWVGSNVCSYTGIYCAQA  80

Query  1308  PDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFEL  1129
              D+  IRTVAGIDLNHA+I+G LP++LGLLTDLALFHINSNRF GT+P +F  L+LLFEL
Sbjct  81    LDNPNIRTVAGIDLNHADIAGYLPDELGLLTDLALFHINSNRFCGTVPHTFQKLKLLFEL  140

Query  1128  DVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPR  949
             D+SNN   G FP VVLSLP LKFLDIR+N+F+G +PKE++D  LDA+F+N N F   LP 
Sbjct  141   DLSNNRFAGKFPKVVLSLPVLKFLDIRFNEFEGTVPKELFDKDLDAIFINDNRFAFDLPE  200

Query  948   NFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFD  769
             N GNSPVSV+VFANN  +GC+P SI  M   L+EI  +N    +CLP EIGLLK L VFD
Sbjct  201   NLGNSPVSVVVFANNKFKGCIPSSIGNMSN-LNEINFLNNLFKSCLPSEIGLLKNLTVFD  259

Query  768   VSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEI  589
             V FN LVG LP ++G    LE+LNVAHN  SG+IP+SIC LP LKNFT+S N+F   P  
Sbjct  260   VGFNQLVGPLPAAIGGAVSLEELNVAHNMFSGKIPSSICMLPNLKNFTFSDNFFTGEPPA  319

Query  588   CRKVKHKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             C  +   +D++NC+P  P Q++   C +F SKPVDC   GC
Sbjct  320   CFGLPASDDRRNCLPARPFQKTLVECASFLSKPVDCKSFGC  360



>ref|XP_008342893.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
 ref|XP_008362444.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=432

 Score =   395 bits (1015),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 236/326 (72%), Gaps = 4/326 (1%)
 Frame = -3

Query  1446  ENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDL  1267
              NPRLY AF+ALQAWKHVI +DP N T +W GP VCNY GVYC+PA DD +I+ V+GIDL
Sbjct  69    SNPRLYQAFLALQAWKHVIYSDPYNITTNWVGPSVCNYMGVYCSPALDDPKIQVVSGIDL  128

Query  1266  NHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAV  1087
             NH +I+G LPE+ GLL+DLAL H+NSNRF G LP+S ++L LLFELD+SNN   G FP V
Sbjct  129   NHRDIAGFLPEEFGLLSDLALIHLNSNRFCGILPQSMANLTLLFELDLSNNRFVGPFPTV  188

Query  1086  VLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN  907
             VLSLP L +LD+RYN+F+G +P E++  KLDA+FVN+N  T  +P + G S  SV+VFAN
Sbjct  189   VLSLPTLGYLDLRYNEFEGPLPPELFRKKLDAIFVNNNRLTSVIPASLGGSSASVVVFAN  248

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
             NN  GCLPPSI     TL E++L+N SL  CLP E+G L +L+V DVS+N LVG +P SM
Sbjct  249   NNFGGCLPPSIVNFAGTLEELLLINTSLSGCLPQEVGFLYKLRVLDVSYNKLVGPIPYSM  308

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK----NDK  559
               L  LEQLN+AHN L+G +PA +C LP L NFT+SYNYFC     C+ +  K    +++
Sbjct  309   TGLSHLEQLNLAHNMLTGIVPAGVCXLPNLANFTFSYNYFCEEEGXCQNLTSKGIAFDER  368

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDC  481
             +NC P  P+QR+ + C A    PVDC
Sbjct  369   RNCFPEKPYQRTQKECNAILEHPVDC  394



>ref|XP_004148723.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like, 
partial [Cucumis sativus]
Length=740

 Score =   405 bits (1041),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 245/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W G  VCNY GV+CAP+ D+ +IRTV
Sbjct  47    PSLVFENDRIRNAYIALQAWKLAILSDPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTV  106

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GTLP  F  L+LL+ELD+SNN   G
Sbjct  107   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAG  166

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  167   KFPDVVLKLPTLKFLDLRFNEFEGNVPRELFDKDLDAIFINHNRFRFELPDNFGNSPVSV  226

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP S+  M + L+EII+MN  L +CLP EIG LK L VFDVS N LVG 
Sbjct  227   IVLANNKFHGCLPSSLGNMTR-LNEIIMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGP  285

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE+ G L  LEQLNVA+N LSG+IP +ICELP+L+NFT+S N+F   P  C +V   +D
Sbjct  286   LPETFGGLVSLEQLNVANNFLSGKIPENICELPKLQNFTFSNNFFSGEPPACLRVPDFSD  345

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+     QRS   C AF S+PVDC+   C
Sbjct  346   RRNCLAGRSGQRSTGQCNAFLSRPVDCNAFKC  377



>ref|XP_002514492.1| LRX2, putative [Ricinus communis]
 gb|EEF47892.1| LRX2, putative [Ricinus communis]
Length=766

 Score =   405 bits (1042),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 246/336 (73%), Gaps = 4/336 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F FENPRL  A+IALQA K  I +DP NFT +W GP VC+Y GV+CAP+P + +IR V
Sbjct  41    PSFKFENPRLGQAYIALQALKQSIFSDPFNFTTNWKGPNVCSYMGVFCAPSPSNPKIRVV  100

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP +LGLLTDLALFH+NSNRF G +P +F  L+LL ELD+SNN   G
Sbjct  101   AGIDLNHADIAGYLPPELGLLTDLALFHLNSNRFCGVVPATFRKLKLLHELDLSNNRFVG  160

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP V+LSLP LK+LD+R+N+F+G +P  ++D  LDA+F+N N F   +P N GNSPVSV
Sbjct  161   KFPKVLLSLPSLKYLDLRFNEFEGSVPSNLFDRPLDAIFLNDNRFQFGIPENLGNSPVSV  220

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV ANNNL GC+P SI  M KTL+EIILMN +L  CLP EIGLLKEL VFDVSFNNL GS
Sbjct  221   LVLANNNLGGCIPGSIGNMGKTLNEIILMNDNLTGCLPPEIGLLKELTVFDVSFNNLQGS  280

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK--  568
             LP S+G +KK+EQL++AHN  +G +PASIC+LP L+NFTYS+NYF      C  +     
Sbjct  281   LPSSIGNMKKVEQLDIAHNSFTGVVPASICQLPSLQNFTYSFNYFTGEAPSCAAIGGSRV  340

Query  567   --NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                  KNCIP    QRS + C +  ++PV+CS   C
Sbjct  341   LTKGTKNCIPGKMDQRSAKECSSEKARPVNCSKFKC  376



>gb|KGN65364.1| hypothetical protein Csa_1G383520 [Cucumis sativus]
Length=775

 Score =   406 bits (1043),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 245/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W G  VCNY GV+CAP+ D+ +IRTV
Sbjct  57    PSLVFENDRIRNAYIALQAWKLAILSDPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTV  116

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GTLP  F  L+LL+ELD+SNN   G
Sbjct  117   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAG  176

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  177   KFPDVVLKLPTLKFLDLRFNEFEGNVPRELFDKDLDAIFINHNRFRFELPDNFGNSPVSV  236

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP S+  M + L+EII+MN  L +CLP EIG LK L VFDVS N LVG 
Sbjct  237   IVLANNKFHGCLPSSLGNMTR-LNEIIMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGP  295

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE+ G L  LEQLNVA+N LSG+IP +ICELP+L+NFT+S N+F   P  C +V   +D
Sbjct  296   LPETFGGLVSLEQLNVANNFLSGKIPENICELPKLQNFTFSNNFFSGEPPACLRVPDFSD  355

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+     QRS   C AF S+PVDC+   C
Sbjct  356   RRNCLAGRSGQRSTGQCNAFLSRPVDCNAFKC  387



>ref|XP_008229070.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Prunus 
mume]
Length=434

 Score =   394 bits (1013),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 236/326 (72%), Gaps = 4/326 (1%)
 Frame = -3

Query  1446  ENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDL  1267
              NPRL+ AF+ALQAWK VI +DP NFT +W GP VCNY GV+CAPA DD  I+ VAGIDL
Sbjct  68    SNPRLHLAFLALQAWKRVIYSDPYNFTSNWVGPSVCNYKGVFCAPALDDPRIQVVAGIDL  127

Query  1266  NHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAV  1087
             N  NI+G LPE+LGLL DLAL H+NSNRF G LP+S ++L LL+ELD+SNN   G FP V
Sbjct  128   NKGNIAGFLPEELGLLCDLALIHLNSNRFCGILPQSMANLTLLYELDLSNNRFVGPFPTV  187

Query  1086  VLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN  907
             VLSLP LK+LD+RYN+F+G +  +++  KLDA+FVN+N FT  LP  FG S  SVLVFAN
Sbjct  188   VLSLPTLKYLDLRYNEFEGPLSPQLFKKKLDAIFVNNNRFTNVLPATFGGSSASVLVFAN  247

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
             NN  GCLPPSI     TL E++L+N +L  CLP EIG L +L+V DVS+N LVG +P SM
Sbjct  248   NNFGGCLPPSIVSFADTLEELLLINTNLSGCLPQEIGFLYKLRVLDVSYNKLVGPIPYSM  307

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK----NDK  559
               L  LEQLN+AHN ++G +P  +C LP L NFT+SYNYFC    IC+ +  K    +D+
Sbjct  308   AGLSHLEQLNLAHNSMTGIVPDGVCCLPNLANFTFSYNYFCEEEGICQNLTSKGIAFDDR  367

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDC  481
             +NC+P  P+QRS + C A    PVDC
Sbjct  368   QNCLPEKPYQRSQKECNATLEHPVDC  393



>ref|XP_004170319.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=785

 Score =   406 bits (1043),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 245/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN R+ NA+IALQAWK  I +DP N T +W G  VCNY GV+CAP+ D+ +IRTV
Sbjct  57    PSLVFENDRIRNAYIALQAWKLAILSDPLNQTANWVGSNVCNYFGVFCAPSLDNPKIRTV  116

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFHINSNRF GTLP  F  L+LL+ELD+SNN   G
Sbjct  117   AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTLPHRFDRLKLLYELDLSNNRFAG  176

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  177   KFPDVVLKLPTLKFLDLRFNEFEGNVPRELFDKDLDAIFINHNRFRFELPDNFGNSPVSV  236

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP S+  M + L+EII+MN  L +CLP EIG LK L VFDVS N LVG 
Sbjct  237   IVLANNKFHGCLPSSLGNMTR-LNEIIMMNNGLNSCLPPEIGALKNLTVFDVSSNELVGP  295

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE+ G L  LEQLNVA+N LSG+IP +ICELP+L+NFT+S N+F   P  C +V   +D
Sbjct  296   LPETFGGLVSLEQLNVANNFLSGKIPENICELPKLQNFTFSNNFFSGEPPACLRVPDFSD  355

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+     QRS   C AF S+PVDC+   C
Sbjct  356   RRNCLAGRSGQRSTGQCNAFLSRPVDCNAFKC  387



>ref|XP_009336235.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=432

 Score =   394 bits (1013),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 235/326 (72%), Gaps = 4/326 (1%)
 Frame = -3

Query  1446  ENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDL  1267
              NPRLY AF+ALQAWKHVI +DP N T +W GP VCNY GVYC+PA DD +I+ V+GIDL
Sbjct  69    SNPRLYRAFLALQAWKHVIYSDPYNITTNWVGPSVCNYMGVYCSPALDDPKIQVVSGIDL  128

Query  1266  NHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAV  1087
             NH +I+G LPE+ GLL+DLAL H+NSNRF G LP+S ++L LLFELD+SNN   G FP V
Sbjct  129   NHRDIAGFLPEEFGLLSDLALIHLNSNRFCGILPQSMANLTLLFELDLSNNRFVGPFPTV  188

Query  1086  VLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN  907
             VLSLP L +LD+RYN+F+G +P E++  KLDA+FVN+N  T  +P   G S  SV+VFAN
Sbjct  189   VLSLPTLGYLDLRYNEFEGPLPPELFSKKLDAIFVNNNRLTSVIPATLGGSSASVVVFAN  248

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
             NN  GCLPPSI     TL E++L+N SL  CLP E+G L +L+V DVS N LVG +P S+
Sbjct  249   NNFGGCLPPSIVNFANTLEELLLINTSLSGCLPQEVGFLYKLRVLDVSSNKLVGPIPYSL  308

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK----NDK  559
               L  LEQLN+AHNKL+G +PA +C LP L NFT+SYNYFC     C+ +  K    +++
Sbjct  309   AGLSHLEQLNLAHNKLTGIVPAGVCCLPNLANFTFSYNYFCEEEGTCQNLTSKGIAFDER  368

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDC  481
             +NC P  P+QR+ + C A    PVDC
Sbjct  369   RNCFPEKPYQRTQKECNAILEHPVDC  394



>ref|XP_007160348.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
 gb|ESW32342.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
Length=740

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 239/332 (72%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F+N RL +A+IALQAWK  I +DP+N T DW G  VC YTGVYCAPA D+  I+TV
Sbjct  54    PSLVFQNNRLRDAYIALQAWKLAILSDPQNQTTDWVGSQVCTYTGVYCAPALDNPSIQTV  113

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFHINSNRF GT+P +F  L LL ELD+SNN   G
Sbjct  114   AGIDLNHRDIAGYLPEELGLLVDLALFHINSNRFCGTVPHTFHKLILLHELDLSNNRFAG  173

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+N N F   LP NFGNSPVSV
Sbjct  174   SFPEVVLHLPSLKFLDLRFNEFEGTVPRELFDKDLDAIFINDNRFVFDLPDNFGNSPVSV  233

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN    +CLP EIGLLK L VFDVSFN L+G 
Sbjct  234   IVLANNRFHGCIPHSLGNM-SNLNEIILMNNEFRSCLPSEIGLLKNLTVFDVSFNQLLGP  292

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP ++G    LEQLNVAHN LSG+IP SIC LP L NFTYS N+F   P  C  +   +D
Sbjct  293   LPTAVGNAVSLEQLNVAHNLLSGQIPPSICMLPHLLNFTYSSNFFTGEPPACLALPAFDD  352

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             + NC+P  P QR P  C+AF SKPVDC+   C
Sbjct  353   RLNCLPARPVQRPPAQCQAFLSKPVDCNSFNC  384



>ref|XP_008347715.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=403

 Score =   392 bits (1008),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 241/334 (72%), Gaps = 3/334 (1%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P    FEN RL +A+IALQAWK  + +DP++   +W G  VC YTGV+CA APDD  ++T
Sbjct  68    PDALVFENSRLRSAYIALQAWKQAMVSDPRDQISNWVGSDVCKYTGVFCAQAPDDPSVQT  127

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHA+I+G LPE+LGLL+D+ALFHINSNRF G +P+SF+ L+LLFELD+SNN   
Sbjct  128   VAGIDLNHADIAGFLPEELGLLSDIALFHINSNRFCGKVPKSFNKLQLLFELDLSNNRFA  187

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LP LKFLD+R+N+F+G++PKE++D  LDA+F+NHN F+  LP NFGNSPVS
Sbjct  188   GXFPDVVLQLPALKFLDLRFNEFEGEVPKELFDKDLDAIFINHNRFSFELPNNFGNSPVS  247

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANNN  GC+P S+  M K L+E++L N    +CLP EIG+LK++ VFDVS N  VG
Sbjct  248   VIVLANNNFHGCVPASLGNMSKNLNELVLTNNGFHSCLPREIGMLKKVTVFDVSHNRFVG  307

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+ + +++ LEQLNVAHN L G IP  +CEL  L  F+  +N+F   P +C K+K  +
Sbjct  308   ELPKEIVEMESLEQLNVAHNMLRGTIPEGVCELQNLAKFSIEHNFFTVEPPMCLKLKEFD  367

Query  564   DKKNCIPYWPHQRSPETCKAFYSK---PVDCSVL  472
             D KNC+   P QR+   CK   SK   P  C +L
Sbjct  368   DSKNCLRKRPKQRTLLQCKLALSKKGQPNFCDIL  401



>emb|CDP14269.1| unnamed protein product [Coffea canephora]
Length=736

 Score =   403 bits (1036),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 247/332 (74%), Gaps = 2/332 (1%)
 Frame = -3

Query  1455  FPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAG  1276
             F FENP L  A+IALQAWK  I +DP NFT++W GP VC+Y GVYCAP+P +  +R VAG
Sbjct  57    FNFENPSLQQAYIALQAWKQAIFSDPFNFTRNWVGPDVCSYNGVYCAPSPANASLRVVAG  116

Query  1275  IDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDF  1096
             IDLNH +I+G LP +LGLLTDLALFH+NSNRF G +P++F +L+LLFELD+SNN   G F
Sbjct  117   IDLNHGDIAGFLPPELGLLTDLALFHLNSNRFCGVIPKTFKNLKLLFELDLSNNRFVGGF  176

Query  1095  PAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLV  916
             P VVLSLP LKFLD+R+N F+G +P +V+D  LDALF+N N F   +P N GNSPVSVLV
Sbjct  177   PGVVLSLPLLKFLDLRFNDFEGPVPSQVFDKDLDALFLNDNRFRFGIPPNLGNSPVSVLV  236

Query  915   FANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
              ANN L GC+P SI  M +TL+E+I +N +L  C+P EIGLL +L VFDVSFN+L G LP
Sbjct  237   LANNKLGGCIPGSIGNMARTLNELIFLNDNLTGCIPPEIGLLTKLTVFDVSFNSLQGPLP  296

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK--ND  562
              ++G+++ LEQL+VAHN+L+G IPASIC+LP L+NFTYS+NYF     +C  +  +  + 
Sbjct  297   STIGRMRSLEQLDVAHNRLTGVIPASICQLPNLQNFTYSFNYFTGEAPVCGAISGRVADG  356

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NCI    +QRS E C +  +KP DC    C
Sbjct  357   RENCIAGKSNQRSAEECSSDAAKPFDCRKSQC  388



>ref|XP_004249854.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Solanum 
lycopersicum]
Length=685

 Score =   401 bits (1031),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/328 (59%), Positives = 246/328 (75%), Gaps = 0/328 (0%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FEN R+ +A+IALQ WK  + +DP NFT +W GP VC+Y GV+CAP+  D  IR VAGID
Sbjct  48    FENSRIRDAYIALQYWKTAMFSDPFNFTANWTGPNVCSYGGVFCAPSLMDDSIRVVAGID  107

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G+L  +LGLLTDL LFH+NSNRF G +P++FSHL+LL ELD+SNN   G FP 
Sbjct  108   LNHADIAGSLVAELGLLTDLVLFHLNSNRFCGVVPKTFSHLKLLRELDLSNNRFVGGFPK  167

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N F+G +P  ++D  LDALF+N N F   +P N GNSPVSVLVFA
Sbjct  168   VVLSLPSLKFLDLRFNDFEGPVPSGLFDKDLDALFLNDNRFRFGIPENLGNSPVSVLVFA  227

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NN+L GC+P SI KM KTL+E+ILMN +L  CLP EIGLL +L VFDVSFN + GSLP +
Sbjct  228   NNDLGGCIPASIGKMGKTLNELILMNDNLTGCLPMEIGLLNKLTVFDVSFNKIQGSLPST  287

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNC  550
             + K++ +E+LNVAHNKL+G IPASIC+LPRL+NFTYS+NYF     +C   +  + ++NC
Sbjct  288   VSKMRSVEELNVAHNKLTGVIPASICQLPRLQNFTYSFNYFTGEAPVCAATRSGDGQENC  347

Query  549   IPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             I    +QRS + C +  +KP DC    C
Sbjct  348   IVGKKNQRSAKECSSDDAKPYDCRKSKC  375



>ref|XP_006651620.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Oryza 
brachyantha]
Length=387

 Score =   391 bits (1005),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 241/330 (73%), Gaps = 4/330 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++A QAWKH IT DPKN TKDW GP+VCNYTGV+CA APDD    TVAG+DLN
Sbjct  53    NERLEAAYVAFQAWKHAITEDPKNLTKDWCGPFVCNYTGVFCAAAPDDPHTLTVAGVDLN  112

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +I+G LP+ LGLL D+AL H+NSNRF G LP S  H+RLLFELDVSNNLL G FPA +
Sbjct  113   HGDIAGCLPDHLGLLADVALLHLNSNRFRGMLPPSMQHMRLLFELDVSNNLLSGAFPAFL  172

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVY--DLKLDALFVNHNNFTVTL-PRNFGNSPVSVLVF  913
              SLPKLKFLD+R+N F G++P  V+   L LDALF N+N F V+L  ++  NS  SV+V 
Sbjct  173   TSLPKLKFLDLRFNGFDGELPDAVFGRQLGLDALFANNNRFNVSLSSKSLTNSTASVIVL  232

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+LKV D+S N+L G LP+
Sbjct  233   ANTRLAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLKVLDLSHNDLAGELPD  292

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKN  553
             S+G ++ LE LNV +N L+GE+P +ICELPRL+N T + NYFC  P  C  V  ++D+ N
Sbjct  293   SIGDMESLEVLNVGYNMLAGEVPEAICELPRLRNLTIAGNYFCDEPVSCLHVPLRDDRMN  352

Query  552   CIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             CIP WPHQRSPE C AF  + P  C+  GC
Sbjct  353   CIPDWPHQRSPEECIAFAHRPPPHCAADGC  382



>ref|XP_011081863.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=525

 Score =   395 bits (1016),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 235/332 (71%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DPKN T +W GP VCNY GV+C PAPD+   RTV
Sbjct  63    PSHKFENPRLENAYIALQAWKETILSDPKNMTTNWVGPDVCNYKGVFCWPAPDNTCERTV  122

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGID+NHA+I+G+LP +LGLL DLALFH+NSNRF GT+P+SF +LRLLFELD+SNN   G
Sbjct  123   AGIDINHADIAGSLPHELGLLFDLALFHLNSNRFCGTIPQSFVNLRLLFELDLSNNRFAG  182

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LK+LDIRYN+F+G++PK ++D   DA+F+N N F+  LP N GNSPVSV
Sbjct  183   KFPEVVLHLPSLKYLDIRYNEFEGELPKGLFDKDFDAIFINSNRFSSALPENIGNSPVSV  242

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN L GCLP S+  M  TL E+I+ N  L +C P EIG LK L V DVS N L+G 
Sbjct  243   IVMANNMLEGCLPASLGSMAATLQELIITNNGLLSCFPSEIGKLKNLTVLDVSHNKLMGP  302

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+S+G +  LEQLNV HN LSG+I   +C+LP LK F Y YN+F      C  +   +D
Sbjct  303   LPDSIGNMDSLEQLNVEHNLLSGKISIRMCQLPNLKAFAYDYNFFSDESPACLNLPKYDD  362

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              KNC    P QRS   C+ F S+ V+CS   C
Sbjct  363   TKNCFRGRPMQRSELQCQRFLSRKVNCSSFKC  394



>gb|KEH30699.1| LRR/extensin [Medicago truncatula]
Length=424

 Score =   392 bits (1006),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 238/330 (72%), Gaps = 4/330 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             NPRLY AF+ALQAWKHVI +DPKN T +W GP VCNYTG+YCAP+ DD +I  VAGIDLN
Sbjct  56    NPRLYRAFLALQAWKHVIYSDPKNITSNWVGPSVCNYTGIYCAPSLDDPKITVVAGIDLN  115

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             HA+I+G LP++L  L DL+L H+NSNRF G +P++FS+L  L+ELD+SNN   G FP+VV
Sbjct  116   HADIAGFLPDELAFLCDLSLLHLNSNRFCGIIPKTFSNLTHLYELDLSNNRFVGPFPSVV  175

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
             LSLP L +LD+RYN+F+G +P E+++   DA F+N+N FT ++PRN G S  SV+VFANN
Sbjct  176   LSLPSLTYLDLRYNEFEGPLPPELFNKAFDAFFLNNNRFTSSIPRNLGKSKASVMVFANN  235

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
                GCLP SI     TL E++L+N S+  CLP ++G L +L+V DVSFNN+VG +P S+ 
Sbjct  236   KFGGCLPESIVNFANTLEELLLINTSISGCLPQQVGFLYKLRVLDVSFNNIVGPIPYSLA  295

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK----NDKK  556
              L  LEQLN+ HN +SG +P  ICELP L NFT+SYN+FC    IC+ +  K    +D++
Sbjct  296   GLSHLEQLNLGHNMMSGIVPVGICELPNLVNFTFSYNFFCEEEGICKNLTSKKIAFDDRR  355

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NC+P    QRS + C A    PVDC  L C
Sbjct  356   NCLPEKALQRSEKECSAKLEHPVDCFELCC  385



>gb|KEH27082.1| LRR extensin-like protein [Medicago truncatula]
Length=835

 Score =   405 bits (1040),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 241/332 (73%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F N R+ NA++ALQA+K  I +DP+N T DW G  VC+YT V+CAPA D+ +I TV
Sbjct  69    PTLVFSNNRIKNAYVALQAFKQAILSDPRNCTVDWVGSDVCSYTNVFCAPALDNPKINTV  128

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFH+N+NRF GT+P  F  L++LFELD+SNN   G
Sbjct  129   AGIDLNHCDIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFEKLKILFELDLSNNRFAG  188

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  189   KFPEVVLRLPELKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFNLPENFGNSPVSV  248

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP  I  M + L+EII MN    ACLP+E+GLLK L VFDVSFN  +G 
Sbjct  249   IVLANNRFHGCLPAGIGNMTR-LNEIIAMNNGFQACLPEEVGLLKNLTVFDVSFNKFLGP  307

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE  G    LE LNVAHN LSG+IPASIC LP L NFTYSYN+F   P  C  +   +D
Sbjct  308   LPEKYGNAVGLEVLNVAHNYLSGQIPASICALPNLVNFTYSYNFFTGEPPQCLVLPAADD  367

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QR  +TCKAF S  V+C+   C
Sbjct  368   RQNCLPARPRQRPAKTCKAFASHHVNCNAFRC  399



>ref|XP_003620502.1| Extensin-like protein [Medicago truncatula]
Length=838

 Score =   405 bits (1040),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 241/332 (73%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   F N R+ NA++ALQA+K  I +DP+N T DW G  VC+YT V+CAPA D+ +I TV
Sbjct  69    PTLVFSNNRIKNAYVALQAFKQAILSDPRNCTVDWVGSDVCSYTNVFCAPALDNPKINTV  128

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLLTDLALFH+N+NRF GT+P  F  L++LFELD+SNN   G
Sbjct  129   AGIDLNHCDIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFEKLKILFELDLSNNRFAG  188

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP+LKFLD+R+N+F+G +PKE++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  189   KFPEVVLRLPELKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFVFNLPENFGNSPVSV  248

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GCLP  I  M + L+EII MN    ACLP+E+GLLK L VFDVSFN  +G 
Sbjct  249   IVLANNRFHGCLPAGIGNMTR-LNEIIAMNNGFQACLPEEVGLLKNLTVFDVSFNKFLGP  307

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPE  G    LE LNVAHN LSG+IPASIC LP L NFTYSYN+F   P  C  +   +D
Sbjct  308   LPEKYGNAVGLEVLNVAHNYLSGQIPASICALPNLVNFTYSYNFFTGEPPQCLVLPAADD  367

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QR  +TCKAF S  V+C+   C
Sbjct  368   RQNCLPARPRQRPAKTCKAFASHHVNCNAFRC  399



>ref|XP_003566833.2| PREDICTED: leucine-rich repeat extensin-like protein 3, partial 
[Brachypodium distachyon]
Length=518

 Score =   395 bits (1014),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/332 (54%), Positives = 241/332 (73%), Gaps = 1/332 (0%)
 Frame = -3

Query  1458  VFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVA  1279
              + F NPRL +A++ALQ+WK  I +DP+N T  W GP VC Y GV+CAP+  D  +  VA
Sbjct  20    AYAFPNPRLRDAYVALQSWKRAILSDPRNVTGSWSGPDVCAYYGVFCAPSESDHYLTVVA  79

Query  1278  GIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGD  1099
             G+DLNHA+++G LPE+LGLL+DL++FH+NSNRF G +PRSF +L LL ELD+SNN   G 
Sbjct  80    GVDLNHADLAGHLPEELGLLSDLSVFHVNSNRFCGVVPRSFHNLGLLHELDLSNNRFVGA  139

Query  1098  FPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVL  919
             FP VVL +P LK+LD+RYN+F+G +P E++D  LDA+F+N N F   +P N GNSP SVL
Sbjct  140   FPDVVLRMPSLKYLDLRYNEFEGAVPPELFDRPLDAIFINSNRFRFQIPDNVGNSPASVL  199

Query  918   VFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSL  739
             V ANN+  GCLP S+A M  TL+EIILMN  L +C+P E+G+L EL V D+S N L+GS+
Sbjct  200   VLANNDFGGCLPASVANMSSTLNEIILMNTGLKSCVPPELGMLAELTVLDLSHNQLMGSI  259

Query  738   PESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDK  559
             P  + KL+ +EQL++ +N+L+G++P  IC LPRL+NFTYSYNY    P+ C  VK  +D+
Sbjct  260   PAELAKLRNIEQLDLGYNRLTGDVPEGICRLPRLQNFTYSYNYITGEPQTCLHVKALDDR  319

Query  558   KNCIPYWPHQRSPETCK-AFYSKPVDCSVLGC  466
             +NCIPY P QRSP+ C  A   + V+C    C
Sbjct  320   RNCIPYRPDQRSPDQCHFASNYQHVNCDAFRC  351



>emb|CDP03355.1| unnamed protein product [Coffea canephora]
Length=782

 Score =   402 bits (1034),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 247/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL NA+IALQAWK  I +DP NFT DW G  VC YTGV+CAPAPD+ +IRTV
Sbjct  69    PTLTFENPRLRNAYIALQAWKEAILSDPSNFTGDWVGSDVCKYTGVFCAPAPDNPKIRTV  128

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP +LGLLTDL LFHINSNRF GT+P +F HL +LFELD+SNN   G
Sbjct  129   AGIDLNHADIAGYLPAELGLLTDLGLFHINSNRFCGTIPGTFKHLEILFELDLSNNRFAG  188

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLPKL FLDIR+N+F+G +P +++D  LDA+F+NHN F   LP NFGNSPVSV
Sbjct  189   KFPYVVLSLPKLIFLDIRFNEFEGTVPPQLFDKPLDAIFINHNRFAFELPDNFGNSPVSV  248

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P SI  M   L+E+I +N +  +C+P+EIGLLK L V D+SFN L+G 
Sbjct  249   IVLANNKFHGCVPASIGNM-SNLNEVIFLNNAFRSCVPEEIGLLKNLTVLDLSFNQLMGP  307

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP+++G L  LEQL+VAHN L G IP SIC+LPRL+NFT+S+N+F   P  C  +   +D
Sbjct  308   LPDNIGGLVSLEQLDVAHNMLRGSIPQSICQLPRLQNFTFSFNFFTGEPPTCLALPAFDD  367

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NC+P  P QR    CKAF SK + CS   C
Sbjct  368   RQNCLPARPAQRPAAQCKAFLSKKIHCSAFKC  399



>ref|XP_010107567.1| Leucine-rich repeat extensin-like protein 2 [Morus notabilis]
 gb|EXC16249.1| Leucine-rich repeat extensin-like protein 2 [Morus notabilis]
Length=789

 Score =   402 bits (1034),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 247/335 (74%), Gaps = 3/335 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL  A+IALQAWK  I +DP NFT +W G  VC+Y+GV+CAP P + ++R V
Sbjct  41    PTLNFENPRLRRAYIALQAWKQAIFSDPLNFTANWNGADVCSYSGVFCAPFPANPKLRVV  100

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             +G+DLNHA+I+G LP +LGLL+DLALFH+NSNRF G +P +F  ++LL ELD+SNN   G
Sbjct  101   SGVDLNHADIAGYLPPELGLLSDLALFHLNSNRFCGVVPATFRRMKLLHELDISNNRFVG  160

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLP LK+LD+R+N+F+G +P +++D  LDA+F+N N F   +P+N GNSPVSV
Sbjct  161   KFPKVVLSLPSLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPKNLGNSPVSV  220

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV ANNNL GC+P SI KM KTL+EIIL+N +L  CLP +IGLLK L VFDVSFNNL GS
Sbjct  221   LVIANNNLGGCIPGSIGKMGKTLNEIILLNDNLTGCLPPQIGLLKNLMVFDVSFNNLQGS  280

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK--  568
             LP  +G ++ LEQL+VAHNK +G IP+SIC+LPRL+NFTYS+NYF      C        
Sbjct  281   LPVEIGNMRSLEQLDVAHNKFTGVIPSSICQLPRLQNFTYSFNYFTGEAPSCTAAGGGVV  340

Query  567   -NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              N ++NCI     QRS   C +  ++PVDCS  GC
Sbjct  341   FNGRQNCIAGKSDQRSKRQCASDDARPVDCSKFGC  375



>ref|XP_010040127.1| PREDICTED: leucine-rich repeat extensin-like protein 2, partial 
[Eucalyptus grandis]
Length=439

 Score =   391 bits (1004),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 242/330 (73%), Gaps = 2/330 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FEN RL  A+IALQAWK  I +DP NFT +W+GP VC+Y GV+CAP+P +  +R VAGID
Sbjct  42    FENGRLRKAYIALQAWKQAIFSDPFNFTANWHGPNVCSYKGVFCAPSPSNSSLRVVAGID  101

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LP +LGLL  LALFH+NSNRF G++P +F H++LL+ELD+SNN   G FP 
Sbjct  102   LNHADIAGFLPRELGLLRHLALFHLNSNRFCGSVPSTFRHMKLLWELDLSNNRFVGQFPE  161

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVL LP LK+LD+R+N+F+G +P +++D  LDA+F+N N     +P+N G SPVSVLV A
Sbjct  162   VVLRLPSLKYLDLRFNEFEGGVPSKLFDKDLDAIFLNDNRLRFGIPQNLGKSPVSVLVLA  221

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NN+L GC+P SI +M KTL+EIIL+N +L  CLP ++ LLK++ VFDVSFN L G LP  
Sbjct  222   NNDLGGCIPSSIGEMGKTLNEIILLNDNLTGCLPPQVKLLKQITVFDVSFNRLQGPLPSG  281

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICR--KVKHKNDKK  556
             +G +KKLEQLN+AHN  +G I +S+C LP L+NFTYS+NYF      C   +++  + ++
Sbjct  282   IGAMKKLEQLNIAHNGFTGVILSSVCRLPMLQNFTYSFNYFNGEAPTCSSARIRTLDGRQ  341

Query  555   NCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             NCIP    QRS   C +  ++PV CS L C
Sbjct  342   NCIPRKTDQRSSRECSSAAARPVKCSQLKC  371



>ref|XP_008665106.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Zea mays]
 tpg|DAA50376.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=390

 Score =   389 bits (999),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 235/333 (71%), Gaps = 5/333 (2%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             PF N RL  A+IALQAWKH I  DPKN T DW GP+VCNYTGV+C  A DD  I TVAGI
Sbjct  53    PF-NDRLDAAYIALQAWKHAIIEDPKNLTADWCGPFVCNYTGVFCTAAQDDPHILTVAGI  111

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNH  I+G LP+ +GLL D+AL H+NSNRF GTLP S  H+RLL+ELD SNNL  G FP
Sbjct  112   DLNHGRIAGFLPDHIGLLADVALIHLNSNRFHGTLPPSMQHMRLLYELDASNNLFSGGFP  171

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVY--DLKLDALFVNHNNFTVTL-PRNFGNSPVSV  922
             + + SLP LK+LD+R+N F G +P  V+   L LDALF N+N F VTL  ++  NS  SV
Sbjct  172   SFLTSLPSLKYLDLRFNSFDGDLPDAVFGRQLNLDALFANNNRFNVTLSSQSLTNSTASV  231

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+L+V D+S N L G 
Sbjct  232   IVLANTELTGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLRVLDLSHNELAGE  291

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G ++ LE LNVA+N+LSG +P SIC LP+LKN T + NYFC  P  C  V  ++D
Sbjct  292   LPESVGDMESLEVLNVAYNQLSGVVPESICLLPKLKNLTVAGNYFCGEPVSCLHVPLRDD  351

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             + NCIP WPHQR+ E C AF  + PV C   GC
Sbjct  352   RMNCIPEWPHQRTHEECIAFEHRPPVHCGANGC  384



>ref|XP_010520859.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Tarenaya 
hassleriana]
Length=452

 Score =   391 bits (1005),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 240/333 (72%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   F N RL  A++ALQAWK V+ +DP N T +W G  VCNYTG++C+P+ DD  I+T
Sbjct  43    PPFLIFGNERLERAYVALQAWKRVMISDPFNLTANWEGSSVCNYTGIFCSPSLDDPSIQT  102

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+GIDLNH +I+G LP++LGLLTD+ALFH+NSNRF GT+PR F  L LLFELD+SNN   
Sbjct  103   VSGIDLNHGDIAGHLPDELGLLTDIALFHVNSNRFCGTIPRGFIQLGLLFELDLSNNRFA  162

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VV+ LPKLKFLD+R+N+F+G++P+ +++  LDA+F+NHN F   +P N  NSPVS
Sbjct  163   GKFPDVVIGLPKLKFLDLRFNEFEGELPESLFEKDLDAIFLNHNRFNSKIPGNICNSPVS  222

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V A+N   GC+P +  KM  TL+EII+ N  L +CLP EIGLLK + VFDVS+N LVG
Sbjct  223   VIVLASNGFEGCIPVNFGKMANTLNEIIMTNNGLHSCLPKEIGLLKNVTVFDVSYNWLVG  282

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPE++G++  LEQLNV  N LSG +P ++C L +LKNF++ YNYF   P  C  ++  N
Sbjct  283   ELPETIGEMTNLEQLNVERNILSGIMPDNLCSLKKLKNFSFGYNYFTGGPPSCLNLEGYN  342

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D  NC+    +QRS   CK F SKPVDC    C
Sbjct  343   DTMNCLKDERNQRSVLECKVFLSKPVDCDSFKC  375



>emb|CDP14813.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   389 bits (999),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 190/343 (55%), Positives = 243/343 (71%), Gaps = 4/343 (1%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             S    Q Y   P      NPRL  A++ALQAWK VI +DPKNFT +W GP VCNYTGVYC
Sbjct  32    STRHRQHYRHHPTNKATINPRLQQAYVALQAWKKVIYSDPKNFTSNWIGPSVCNYTGVYC  91

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             AP PD+ +I+ VAGIDLN A+I+G LPE+LGLL+DLAL H+NSNRF G LP+S ++L LL
Sbjct  92    APYPDNTKIQVVAGIDLNFADIAGFLPEELGLLSDLALIHLNSNRFCGILPQSLANLTLL  151

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             FELD+SNN   G FP+VVLSLP LKFLDIR+N+F+G +P +++  KLDA+F+N+N FT  
Sbjct  152   FELDLSNNRFVGPFPSVVLSLPTLKFLDIRFNEFEGPLPAQLFAKKLDAVFLNNNLFTSV  211

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             +P N G S  SV+VFANN   GCLPPSIA    TL E++L+N SL  CLP E+G L +L+
Sbjct  212   IPPNLGLSSASVVVFANNKFGGCLPPSIANFANTLEELLLINTSLTGCLPPEVGYLYKLR  271

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             V DVS N +VG +P S+  L  LE LN+AHN  +G++PA +C LP L NFTYSYN+FC  
Sbjct  272   VLDVSSNRVVGPIPYSLAGLAHLELLNLAHNMFTGDVPAGVCVLPNLSNFTYSYNFFCEE  331

Query  597   PEICRKVKHK----NDKKNCIPYWPHQRSPETCKAFYSKPVDC  481
               IC  +  +    +D++NC+   P QR+ + C A Y  PV+C
Sbjct  332   EGICMNLTSRGIAFDDRRNCLLEKPLQRTKKECTAVYEHPVEC  374



>ref|XP_002464196.1| hypothetical protein SORBIDRAFT_01g013940 [Sorghum bicolor]
 gb|EER91194.1| hypothetical protein SORBIDRAFT_01g013940 [Sorghum bicolor]
Length=391

 Score =   388 bits (996),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 237/333 (71%), Gaps = 5/333 (2%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             PF N RL  A++ALQAWKH I  DPKN T DW GP+VCNYTGV+C  A DD  I TVAGI
Sbjct  54    PF-NDRLDAAYVALQAWKHAIIEDPKNLTADWCGPFVCNYTGVFCTAALDDPHILTVAGI  112

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNH  I+G LP+ +GLL D+AL H+NSNRF GTLP S  H+RLL+ELD+SNNL  G FP
Sbjct  113   DLNHGRIAGFLPDHIGLLADVALIHLNSNRFHGTLPPSMQHMRLLYELDISNNLFSGGFP  172

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVY--DLKLDALFVNHNNFTVTL-PRNFGNSPVSV  922
             + + SLP LK+LD+R+N+F G++P  V+   L LDALF N+N F VTL  ++  NS  SV
Sbjct  173   SFLTSLPSLKYLDLRFNKFDGELPDAVFGRQLSLDALFANNNRFNVTLSSKSLTNSTASV  232

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+L+V D+S N L G 
Sbjct  233   IVLANTELAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLRVLDLSRNELAGE  292

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G ++ LE LNV +N+LSG +P SIC LP+LKN T + NYFC  P  C  +  ++D
Sbjct  293   LPESVGDMESLEVLNVGYNQLSGVVPESICLLPKLKNLTVAGNYFCGEPVSCLHIPVRDD  352

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             + NCIP WPHQR+ E C AF  + PV C   GC
Sbjct  353   RMNCIPEWPHQRTHEECIAFEHRPPVHCGADGC  385



>ref|XP_002872172.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48431.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   389 bits (998),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 237/333 (71%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  + +DP N T +W+G  VC+Y GV C+ + DD  ++T
Sbjct  42    PPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRVCDYNGVVCSSSLDDPLVKT  101

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN   
Sbjct  102   VSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPVGFSQLSLLFELDLSNNRFA  161

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VV+ LPKLK+LD+RYN+F+G++P+ ++D +LDALF+N N F   +P N GNSPVS
Sbjct  162   GKFPEVVIGLPKLKYLDLRYNEFEGQLPESLFDKELDALFLNSNRFVNKIPVNMGNSPVS  221

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV A+N   GC+P S  KM KTL+EIILM+  L +CLP+++GLL+ + V DVS+N LVG
Sbjct  222   VLVLASNRFEGCIPTSFGKMGKTLNEIILMDNGLQSCLPNDMGLLQNVTVLDVSYNWLVG  281

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+SMG+++ LE LNV  N LSG IP  +C L +L+ F Y  NYF   P  CR +++ N
Sbjct  282   ELPKSMGQMENLEVLNVERNMLSGLIPEELCSLEKLREFRYGSNYFTGEPATCRYLENYN  341

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                NC+     QRS   CK F SKPVDC    C
Sbjct  342   YTMNCLKDERDQRSMMECKMFLSKPVDCDSFKC  374



>ref|XP_006394807.1| hypothetical protein EUTSA_v10004209mg [Eutrema salsugineum]
 gb|ESQ32093.1| hypothetical protein EUTSA_v10004209mg [Eutrema salsugineum]
Length=449

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/333 (55%), Positives = 233/333 (70%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  I +DP N T +W+G  VC+Y GV C+ + DD  I+T
Sbjct  43    PPYLVFENARLERAYVALQAWKRAIISDPWNLTANWFGSRVCDYNGVVCSSSLDDPSIKT  102

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN   
Sbjct  103   VSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPLGFSQLSLLFELDLSNNRFA  162

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP +V+ LPKLK+LD+RYN+ +G++P+ ++D  LDALF+N N F   +P N GNSPVS
Sbjct  163   GKFPELVIGLPKLKYLDLRYNELEGELPESLFDKDLDALFLNSNRFVSKIPVNMGNSPVS  222

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV A+N   GC+P S  KM KTL+EIILM+  L +CLP+++GLL+ + V DVS+N LVG
Sbjct  223   VLVLASNRFEGCIPTSFGKMGKTLNEIILMDNGLQSCLPNDMGLLRNVTVLDVSYNWLVG  282

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPESMG+++KLE LNV  N LSG IP  +C L  LK F +  NYF   P  C  ++  N
Sbjct  283   ELPESMGQMEKLEVLNVERNMLSGVIPEELCSLKNLKEFRFGSNYFTGEPSTCCNLESYN  342

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                NC+     QRS   CK F SKPVDC    C
Sbjct  343   STMNCLKDEKDQRSTMECKLFLSKPVDCDSFKC  375



>ref|NP_001130107.1| uncharacterized protein LOC100191200 precursor [Zea mays]
 gb|ACF78236.1| unknown [Zea mays]
 gb|ACG35415.1| systemin receptor SR160 precursor [Zea mays]
 gb|ACN28853.1| unknown [Zea mays]
 gb|ACN28919.1| unknown [Zea mays]
 gb|AFW67369.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=379

 Score =   386 bits (991),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 243/335 (73%), Gaps = 2/335 (1%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP     + RL  A++ALQA +  IT DPK  T++W GP VCNY GVYCAPAPDD   RT
Sbjct  29    PPAVAVNSSRLEKAYVALQALRRAITDDPKKLTENWCGPDVCNYFGVYCAPAPDDPCQRT  88

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VA +DLNH +++GTLPE+LGLL+DLA+FH+NSNRF G+LP S   L LL E+DVSNN L 
Sbjct  89    VASVDLNHGDLAGTLPEELGLLSDLAVFHLNSNRFCGSLPESLRSLHLLHEIDVSNNRLS  148

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP+ +L LP ++++DIR+N F G++P  ++D K+DALF+N+N+F  TLP +F NS  S
Sbjct  149   GPFPSQLLCLPSVQYVDIRFNNFCGEVPAAIFDKKIDALFINNNHFEFTLPASFTNSTAS  208

Query  924   VLVFAN-NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLV  748
             V+V AN   + GCLP SI  M  TL+E+IL+N  + +C+P EIG L +L V D+SFN++ 
Sbjct  209   VIVLANLPRVSGCLPSSIGDMAGTLNELILLNSGISSCIPPEIGKLDKLTVLDLSFNSIA  268

Query  747   GSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK  568
             G+LP+++G ++ LEQL+VAHN+L+GEIP SICELP LKNFTYSYN+FC  P  C +V   
Sbjct  269   GALPDTIGGMRALEQLDVAHNRLTGEIPESICELPHLKNFTYSYNFFCGEPRRCLEVPRV  328

Query  567   NDKKNCIPYWPHQRSPETCKAFYSKP-VDCSVLGC  466
             +D++NCI   P QR  E C +F  +P V C   GC
Sbjct  329   DDRQNCIAGRPDQRPGEECVSFLHQPQVHCDAHGC  363



>ref|XP_006453735.1| hypothetical protein CICLE_v10010678mg, partial [Citrus clementina]
 gb|ESR66975.1| hypothetical protein CICLE_v10010678mg, partial [Citrus clementina]
Length=698

 Score =   396 bits (1018),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 247/336 (74%), Gaps = 8/336 (2%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAP-DDKEIRTVAGI  1273
             FENPRL  A+IALQAWK  I +DP NFT +W G  VC+Y GV+CA +P +   +R VA I
Sbjct  49    FENPRLREAYIALQAWKAAIFSDPFNFTANWNGSDVCSYMGVFCARSPFNSPSLRVVASI  108

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNHA+I+G LP ++G LTDLA+FHINSNRF G +P +F  L+LL+E+D+SNN   G+FP
Sbjct  109   DLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPTTFRRLKLLYEVDLSNNRFVGNFP  168

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
              V LSLPKLK+LD+R+N+F+G +P +++D  LDA+F+N N F   +P N GNSPVSVLVF
Sbjct  169   KVFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVF  228

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             ANN+L GC+P SI KM KTL+EIILMN +L  CLP +IG+LK L VFDVSFN+L GSLP 
Sbjct  229   ANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPS  288

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICR-------KVK  574
             S+G +K LEQLNVAHN+ +G IP+S+C+LP L+NFTYS+NYF   P  C        ++ 
Sbjct  289   SIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFTGEPPSCTAAAGGGGRMM  348

Query  573   HKNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               N  KNCIP    QRS + C +  ++P DCS + C
Sbjct  349   VSNGTKNCIPGKADQRSSKECSSEAARPADCSKMQC  384



>ref|XP_010035772.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
 gb|KCW47235.1| hypothetical protein EUGRSUZ_K01044 [Eucalyptus grandis]
Length=415

 Score =   387 bits (993),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 237/325 (73%), Gaps = 4/325 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             NPRLY+A+IALQAWK VI +DP+NFT +W G  VCNYTGV+CA A DD +I+ VAGIDLN
Sbjct  48    NPRLYHAYIALQAWKRVIYSDPRNFTTNWSGLSVCNYTGVFCAKALDDPKIQVVAGIDLN  107

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             HA+I+G +PE+LGLLTDLALFH+NSNRF G LP+S S+L LL+ELD+SNN   G FP+VV
Sbjct  108   HADIAGLIPEELGLLTDLALFHLNSNRFCGVLPQSLSNLALLYELDLSNNRFVGPFPSVV  167

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
             LS+P L +LDIRYN+F+G +P E++   LDALF+N+N  T  +P + G +  SVLV ANN
Sbjct  168   LSMPSLHYLDIRYNEFEGSLPPELFKKSLDALFLNNNRLTNAIPASLGQTSSSVLVLANN  227

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
             N  GCLPPSIA    TL E++L+N+SL  CLP E+G L +L+V DVS N++ G +P S+ 
Sbjct  228   NFGGCLPPSIADSADTLEELLLINISLSGCLPPEVGFLYKLRVLDVSLNHVEGPIPYSIA  287

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK----NDKK  556
              L  LEQLNV HN ++G +P+ +C LP L NFT+SYNYFC     C  +  K    ++  
Sbjct  288   GLAHLEQLNVGHNMMTGVVPSGVCILPSLANFTFSYNYFCEEEGTCMNLTSKGIAYDESH  347

Query  555   NCIPYWPHQRSPETCKAFYSKPVDC  481
             NC+P  P QRS + C+A    PVDC
Sbjct  348   NCLPEKPFQRSEKECQAALEHPVDC  372



>ref|XP_010091486.1| hypothetical protein L484_010328 [Morus notabilis]
 gb|EXB44637.1| hypothetical protein L484_010328 [Morus notabilis]
Length=398

 Score =   386 bits (991),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 239/332 (72%), Gaps = 6/332 (2%)
 Frame = -3

Query  1446  ENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDL  1267
              NPRL+ AFIALQAWK  I +DP NFT +W GP VCNYTGVYCAP+  D + + VAGIDL
Sbjct  42    SNPRLHQAFIALQAWKAAIQSDPNNFTTNWVGPSVCNYTGVYCAPSIHDNKTQVVAGIDL  101

Query  1266  NHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAV  1087
             NHA+I+G+LP++LGLL+DLAL H+NSNRF G LP + S+L LL+ELD+SNN   G FPA+
Sbjct  102   NHADIAGSLPDELGLLSDLALIHLNSNRFCGVLPSTLSNLSLLYELDISNNRFVGPFPAI  161

Query  1086  VLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFT-VTLPRNFGNSPVSVLVFA  910
             V+SLP L FLDIR+N F+G +P +++  KLDA+F+N+N FT  ++P     S  +VLVFA
Sbjct  162   VISLPMLNFLDIRFNDFEGSVPPQLFAKKLDAVFLNNNRFTSFSIPSFISGSSATVLVFA  221

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNN  GCLPPSI     TL E++L+N +L  CLP+E+G L +LKVFDVS+N +VG +P S
Sbjct  222   NNNYGGCLPPSIVNFANTLEELVLINTNLSGCLPEEVGFLYKLKVFDVSYNKIVGPIPYS  281

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK-----N  565
             M  L  LEQLN+ HN ++GE+P  IC LP L N T SYN+FC    +CR +  K     +
Sbjct  282   MAGLYHLEQLNLGHNMMTGEVPDGICMLPNLLNLTVSYNFFCEEDGVCRNLTSKKGVKFD  341

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLG  469
             D++NC+P    QRS + CKA   +PV+C + G
Sbjct  342   DRRNCLPERRLQRSEKECKAALDRPVECILGG  373



>ref|XP_006473926.1| PREDICTED: leucine-rich repeat extensin-like protein 2-like [Citrus 
sinensis]
Length=705

 Score =   396 bits (1018),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 246/335 (73%), Gaps = 7/335 (2%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAP-DDKEIRTVAGI  1273
             FENPRL  A+IALQAWK  I +DP NFT +W G  VC+Y GV+CA +P +   +R VA I
Sbjct  49    FENPRLREAYIALQAWKAAIFSDPFNFTANWNGSDVCSYMGVFCARSPFNSPSLRVVASI  108

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNHA+I+G LP ++G LTDLA+FHINSNRF G +P +F  L+LL+E+D+SNN   G FP
Sbjct  109   DLNHADIAGYLPPEIGRLTDLAIFHINSNRFCGVVPSTFRRLKLLYEVDLSNNRFVGKFP  168

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
              + LSLPKLK+LD+R+N+F+G +P +++D  LDA+F+N N F   +P N GNSPVSVLVF
Sbjct  169   KLFLSLPKLKYLDLRFNEFEGSVPSKLFDKDLDAIFLNDNRFQFGIPENLGNSPVSVLVF  228

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             ANN+L GC+P SI KM KTL+EIILMN +L  CLP +IG+LK L VFDVSFN+L GSLP 
Sbjct  229   ANNDLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKNLTVFDVSFNHLQGSLPS  288

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICR------KVKH  571
             S+G +K LEQLNVAHN+ +G IP+S+C+LP L+NFTYS+NYF   P  C       ++  
Sbjct  289   SIGNMKSLEQLNVAHNRFTGVIPSSVCQLPNLQNFTYSFNYFSGEPPSCTAAAGGGRMMV  348

Query  570   KNDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              N  KNCIP    QRS E C +  ++P DCS + C
Sbjct  349   SNGTKNCIPGKADQRSSEECSSEAARPADCSKMQC  383



>tpg|DAA58808.1| TPA: leucine-rich repeat (LRR) family protein, partial [Zea mays]
Length=555

 Score =   391 bits (1005),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 235/333 (71%), Gaps = 1/333 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P + F NPRL +A++ALQAW+  I +DP N T  W GP VC Y GVYCAP+P D ++  V
Sbjct  66    PSYAFPNPRLRDAYVALQAWRRAILSDPHNVTGSWTGPDVCAYAGVYCAPSPQDPDLTVV  125

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             A +DLNHA+++G LPE+LGLL DLA+ H+NSNRF G +PRS   L  L ELD+SNN L G
Sbjct  126   ASVDLNHADLAGHLPEELGLLADLAVLHLNSNRFCGLVPRSLDKLHALHELDLSNNRLVG  185

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP L++LD+R+N F+G +P E++D  LDA+F+N N F   +P NFGNSP SV
Sbjct  186   AFPDVVLRLPSLRYLDLRFNDFEGPVPSELFDRPLDAIFINSNRFRFQIPDNFGNSPASV  245

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV ANN+  GCLP S+A M  TL+EIILMN  L +C+P E+G L  L V D+SFN L+G+
Sbjct  246   LVLANNDFGGCLPASVANMSSTLNEIILMNTGLKSCVPPELGALMGLTVLDLSFNKLMGA  305

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             +P+ + +L  +EQL++ HN+L G++P  IC LP L+NFTYSYN+    P +C  VK  +D
Sbjct  306   IPDELARLHSIEQLDLGHNRLVGDVPEEICRLPHLQNFTYSYNFITGEPPVCLHVKSLDD  365

Query  561   KKNCIPYWPHQRSPETCKAFYS-KPVDCSVLGC  466
             ++NCIPY P QRSPE C  F +   V+C    C
Sbjct  366   RRNCIPYRPDQRSPEQCNFFRNHHHVNCDAFKC  398



>ref|XP_006842252.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
 gb|ERN03927.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
Length=874

 Score =   400 bits (1029),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 241/332 (73%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P F FEN RL  A+IALQAWK  I +DP N T +W GP VCNYTGV+C+ + D   +  V
Sbjct  107   PSFEFENSRLREAYIALQAWKMAIISDPMNITGNWIGPIVCNYTGVFCSKSLDGLNLTVV  166

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH++I+G LP++LG LTDLAL H+NSNRF GT+P +F  L+LL+ELD+SNN   G
Sbjct  167   AGIDLNHSDIAGYLPDELGKLTDLALLHLNSNRFCGTIPHTFKRLKLLYELDLSNNRFAG  226

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVL LP LK+LD+RYN+F+G +P  +++  LDA+F+NHN F   +P NFGNSPVSV
Sbjct  227   RFPTVVLKLPTLKYLDLRYNEFEGPVPSSLFNRPLDAIFLNHNRFHFEIPENFGNSPVSV  286

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN  RGC+P S+AKM  TL+EII+MN  L  C+P+E G LK L V DVSFN LVG+
Sbjct  287   VVLANNRFRGCIPSSLAKMAPTLNEIIIMNNGLSGCVPEEFGALKNLTVLDVSFNKLVGN  346

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LP ++G L  LEQLNVAHN LSG+IP  IC LP L NFT+SYN+F   P +C ++   +D
Sbjct  347   LPLNLGGLVSLEQLNVAHNMLSGQIPPQICSLPNLDNFTFSYNFFEGEPPVCLRLPSFDD  406

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             ++NCI   P QR  + CK+F S  VDC  + C
Sbjct  407   RRNCINGRPKQRPRKQCKSFLSHRVDCGSVKC  438



>ref|XP_002463746.1| hypothetical protein SORBIDRAFT_01g005300 [Sorghum bicolor]
 gb|EER90744.1| hypothetical protein SORBIDRAFT_01g005300 [Sorghum bicolor]
Length=394

 Score =   385 bits (990),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 243/328 (74%), Gaps = 2/328 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++ALQA K  IT DPK  TK+W GP VCNY GVYCAPAPDD   RTVAG+DLN
Sbjct  45    NSRLEKAYVALQALKRAITDDPKKLTKNWCGPDVCNYFGVYCAPAPDDPCQRTVAGVDLN  104

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GTLPE+LGLL+DLA+FH+NSNRF G+LP+S   L LL E+DVSNN L G FP+ +
Sbjct  105   HGDLAGTLPEELGLLSDLAVFHLNSNRFCGSLPQSLRSLHLLHEIDVSNNQLSGPFPSQL  164

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN-  907
             L LP ++++DIR+N F G++P  ++D K+DALF+N+N+F  +LP +F NS  SV+V AN 
Sbjct  165   LCLPNVQYVDIRFNNFCGEVPAAIFDKKIDALFINNNHFEFSLPDSFTNSTASVIVLANL  224

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
               + GCLP SI  M  TL+E+IL+N  + +C+P EIG L +L V D+SFNN+ G+LP+++
Sbjct  225   PRVSGCLPSSIGDMAGTLNELILLNSGISSCIPPEIGKLDKLTVLDLSFNNIAGTLPDTI  284

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             G ++ LEQL+VAHN+L+GEIP SICELP LKNFTYSYN+FC  P  C +V   +D++NCI
Sbjct  285   GNMRALEQLDVAHNRLAGEIPESICELPHLKNFTYSYNFFCGEPHRCLEVPRIDDRQNCI  344

Query  546   PYWPHQRSPETCKAFYSKP-VDCSVLGC  466
                P QR  E C +F  +P V C   GC
Sbjct  345   AGRPDQRPGEECISFLHQPRVHCDGHGC  372



>ref|XP_010493816.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Camelina 
sativa]
Length=432

 Score =   387 bits (993),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 236/333 (71%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  + +DP N T +W+G  VC+Y GV C+ + DD  ++T
Sbjct  41    PPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRVCDYNGVVCSSSLDDPLVKT  100

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN   
Sbjct  101   VSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPVGFSQLSLLFELDLSNNRFA  160

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VV+ LPKLK+LD+RYN+F+G++P+ ++D  LDALF+N N F   +P N GNSPVS
Sbjct  161   GKFPKVVIGLPKLKYLDLRYNEFEGELPESLFDKDLDALFLNSNRFVSKIPVNMGNSPVS  220

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV A+N   GC+P S  KM KTL+EIILM+  L +CLPD++GLL+ + V D+S+N LVG
Sbjct  221   VLVLASNRFEGCIPTSFGKMGKTLNEIILMDNGLQSCLPDDMGLLRNVTVLDISYNLLVG  280

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+SMG ++ LE LNV  N LSG +P  +C L +L++F Y  NYF   P  CR +++ N
Sbjct  281   ELPKSMGVMENLEVLNVERNMLSGVMPDELCSLEKLRDFRYGSNYFTGEPSTCRYLENYN  340

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                NC+     QRS   C AF SKPVDC    C
Sbjct  341   YTMNCLKDTRDQRSTMECTAFLSKPVDCDSFKC  373



>ref|XP_010454895.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Camelina 
sativa]
Length=432

 Score =   387 bits (993),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 235/333 (71%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  + +DP N T +W+G  VC+Y GV C+ + DD  ++T
Sbjct  41    PPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRVCDYNGVVCSSSLDDPSVKT  100

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN   
Sbjct  101   VSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPVGFSQLSLLFELDLSNNRFA  160

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VV+ LPKLK+LD+RYN+F+G++P+ ++D  LDALF+N N F   +P N GNSPVS
Sbjct  161   GKFPKVVIGLPKLKYLDLRYNEFEGELPESLFDKDLDALFLNSNRFVSKIPVNMGNSPVS  220

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV A+N   GC+P S  KM KTL+EIILM+  L +CLPD++G L+ + V D+S+N LVG
Sbjct  221   VLVLASNRFEGCIPTSFGKMGKTLNEIILMDNGLQSCLPDDMGFLRNVTVLDISYNLLVG  280

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+SMG ++ LE LNV  N LSG +P  +C L +L++F Y  NYF   P  CR +++ N
Sbjct  281   ELPKSMGVMENLEVLNVERNMLSGVMPDELCSLEKLRDFRYGSNYFTGEPSTCRYLENYN  340

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                NC+     QRS   C AF SKPVDC    C
Sbjct  341   YTMNCLKDTRDQRSTMECTAFLSKPVDCDSFKC  373



>ref|XP_004292960.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Fragaria 
vesca subsp. vesca]
Length=524

 Score =   390 bits (1001),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 240/334 (72%), Gaps = 1/334 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHV-ITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIR  1288
             PP   F NPR+  A+IALQAWK + + +DP  +T +W G  VCNYTGV+CA A DD  I 
Sbjct  62    PPSLVFPNPRIRTAYIALQAWKQIAMLSDPLGYTANWVGSNVCNYTGVFCAQALDDPTIE  121

Query  1287  TVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLL  1108
             TVAGIDLNHA+I+G LP +LG L+D+ LFH+NSNRF GT+P+SFS L+LL ELD+SNN  
Sbjct  122   TVAGIDLNHADIAGYLPVELGHLSDITLFHVNSNRFCGTVPKSFSKLKLLHELDLSNNRF  181

Query  1107  CGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPV  928
              G FP V+L LP LK+LDIR+N+F+G+IPK+++D  LDA+F+N N FT  LP N GNSPV
Sbjct  182   AGKFPLVLLQLPALKYLDIRFNEFEGRIPKKLFDKHLDAIFLNDNRFTHELPHNLGNSPV  241

Query  927   SVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLV  748
             SV+V ANN   GCLP S+  M K L+E+IL    L +CLPDEIG LK L V DVS N+L+
Sbjct  242   SVIVLANNKFHGCLPASLGNMSKNLNELILTRSGLYSCLPDEIGKLKNLTVLDVSHNDLI  301

Query  747   GSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK  568
             G LP ++G++  LE+LNVAHNKL+G IP SIC LP LK F++  N+F   P +C  ++  
Sbjct  302   GELPHALGEMLSLEELNVAHNKLTGTIPGSICGLPNLKKFSFQDNFFTGEPPMCLDLEQF  361

Query  567   NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +D +NC+   P+QRS   CK F SK V CS   C
Sbjct  362   DDSRNCLRDRPNQRSMLQCKLFLSKSVGCSSFEC  395



>ref|XP_010424321.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Camelina 
sativa]
Length=432

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 235/333 (71%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  + +DP N T +W+G  VC+Y GV C+ A DD  ++T
Sbjct  41    PPYLIFENVRLERAYVALQAWKRTMISDPWNLTANWFGSRVCDYNGVVCSSALDDPLVKT  100

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  F  L LLFELD+SNN   
Sbjct  101   VSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPVGFLQLSLLFELDLSNNRFA  160

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VV+ LPKLK+LD+RYN+F+G++P+ ++D  LDALF+N N F   +P N GNSPVS
Sbjct  161   GKFPKVVIGLPKLKYLDLRYNEFEGELPESLFDKDLDALFLNSNRFVSKIPVNMGNSPVS  220

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV A+N   GC+P S  KM KTL+EIILM+  L +CLPD++GLL+ + V D+S+N LVG
Sbjct  221   VLVLASNRFEGCIPTSFGKMGKTLNEIILMDNGLQSCLPDDMGLLRNVTVLDISYNLLVG  280

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+SMG ++ LE LNV  N LSG +P  +C L +L++F Y  NYF   P  CR +++ N
Sbjct  281   ELPKSMGVMENLEVLNVERNMLSGVMPDELCSLEKLRDFRYGSNYFTGEPSTCRYLENYN  340

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                NC+     QRS   C AF SKPVDC    C
Sbjct  341   YTMNCLKDMRDQRSTMECTAFLSKPVDCDSFKC  373



>ref|XP_010252148.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=770

 Score =   397 bits (1019),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 244/335 (73%), Gaps = 7/335 (2%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             F NPRL  A+IALQ WK  I +DP NFT +W GP VC+Y+GVYC+P+  +  +  V+GID
Sbjct  49    FANPRLRQAYIALQTWKTAIFSDPFNFTANWNGPNVCSYSGVYCSPSLFNSSVTVVSGID  108

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G LP +LGLLTDLALFH+NSNRF G +PR+F  L+LL+ELD+SNN   G FP 
Sbjct  109   LNHADIAGYLPPELGLLTDLALFHLNSNRFCGIVPRTFRRLKLLYELDLSNNRFVGRFPD  168

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LK+LD+R+N F+G IP  ++D  LDA+F+N N F   +P N GNSPVSV+V A
Sbjct  169   VVLSLPSLKYLDLRFNDFEGSIPSGLFDKDLDAIFLNDNRFRFGIPDNLGNSPVSVIVLA  228

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM  TL+EIILMN +L  CLP EIGLLK++ VFD+SFN++ G LP +
Sbjct  229   NNNLGGCIPSSIGKMGHTLNEIILMNDNLTGCLPSEIGLLKDVTVFDISFNHIQGPLPPA  288

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK------  568
             +G++K LEQL+VAHN  +G +PA +C+LPRL+NFTYS+NYF      C  +         
Sbjct  289   IGRMKSLEQLDVAHNMFTGVVPAVVCQLPRLENFTYSFNYFTGEAPKCAALISGGAGRVL  348

Query  567   -NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
              +D+KNCIP  P QRS   C +  ++PVDCS   C
Sbjct  349   LDDRKNCIPGKPDQRSSRECSSQAAQPVDCSKFKC  383



>ref|XP_010228296.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brachypodium 
distachyon]
Length=370

 Score =   384 bits (985),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/342 (54%), Positives = 237/342 (69%), Gaps = 10/342 (3%)
 Frame = -3

Query  1485  HQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAP  1306
             HQ  D+        NPRL  A+ ALQA KH IT DP+N T +W GP VC Y GV+CA A 
Sbjct  33    HQTADN--------NPRLQRAYSALQALKHAITDDPRNLTSNWCGPDVCAYYGVFCAAAL  84

Query  1305  DDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELD  1126
             DD   R VAG+DLNH +I+GT P++LGLLTD+A+ H+NSNRF GTLP +   L LL ELD
Sbjct  85    DDPCSRAVAGLDLNHGDIAGTFPDELGLLTDIAVLHLNSNRFAGTLPETLPKLSLLHELD  144

Query  1125  VSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRN  946
             VSNN L G FP  +L LP +K++DIR+N   G +P  ++D  +DALF+N+N+F   LP N
Sbjct  145   VSNNRLSGGFPQHILCLPNVKYVDIRFNNLCGPVPPAIFDKNIDALFINNNHFEFELPEN  204

Query  945   FGNSPVSVLVFAN-NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFD  769
              GNSP SV+V AN   L GC+PPSI KM  TL+E++++N  + +C+P EIG L+EL V D
Sbjct  205   LGNSPASVIVLANLGKLSGCIPPSIGKMAGTLNELVILNSGVKSCIPQEIGQLRELTVLD  264

Query  768   VSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEI  589
             +SFN L G+LPESM  L+ LEQL+VAHN+LSG IP +IC LPRL NFTYS+NYFC  PE 
Sbjct  265   LSFNELQGTLPESMAGLRSLEQLDVAHNELSGHIPEAICALPRLANFTYSFNYFCGEPER  324

Query  588   CRKVKHKNDKKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             C  ++  +D++NCI   P QR  + C AF  + PV C   GC
Sbjct  325   CAALRRNDDRQNCIAGRPDQRPADQCLAFLHRPPVHCDPHGC  366



>ref|NP_197937.1| leucine-rich repeat extensin-like protein 7 [Arabidopsis thaliana]
 sp|Q4PSE6.1|LRX7_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 7; Short=AtLRX7; 
Short=LRR/EXTENSIN7; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAY78836.1| leucine-rich repeat family protein [Arabidopsis thaliana]
 gb|AED93461.1| leucine-rich repeat extensin-like protein 7 [Arabidopsis thaliana]
Length=433

 Score =   385 bits (990),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 236/333 (71%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  + +DP N T +W+G  VC+Y GV C+ + DD  ++T
Sbjct  41    PPYLIFENVRLERAYVALQAWKRAMISDPWNLTTNWFGSRVCDYNGVVCSESLDDPLVKT  100

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLN  +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN   
Sbjct  101   VSGVDLNQGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPVGFSQLSLLFELDLSNNRFA  160

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VV+ LPKLK+LD+RYN+F+G++P+ ++D  LDALF+N N F   +P N GNSPVS
Sbjct  161   GKFPEVVIGLPKLKYLDLRYNEFEGELPESLFDKDLDALFLNSNRFRSKIPVNMGNSPVS  220

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV A+N   GC+PPS  KM KTL+EIILM+  L +C+P+++GLL+ + V D+S+N LVG
Sbjct  221   VLVLASNRFEGCIPPSFGKMGKTLNEIILMDNGLQSCIPNDMGLLQNVTVLDISYNWLVG  280

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+SMG+++ LE LNV  N LSG IP  +C L +L++F Y  NYF   P  CR +++ N
Sbjct  281   ELPKSMGQMENLEVLNVERNMLSGLIPDELCSLEKLRDFRYGSNYFTGEPATCRYLENYN  340

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                NC      QRS   CK F SKPVDC    C
Sbjct  341   YTMNCFKDVRDQRSMMECKMFLSKPVDCDSFKC  373



>ref|XP_007225572.1| hypothetical protein PRUPE_ppa019759m1g, partial [Prunus persica]
 gb|EMJ26771.1| hypothetical protein PRUPE_ppa019759m1g, partial [Prunus persica]
Length=508

 Score =   388 bits (996),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 237/334 (71%), Gaps = 2/334 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENPRL  A+IALQAWK  I +DP NFT  W G  VC+Y GV+CAP       R V
Sbjct  2     PTLKFENPRLRQAYIALQAWKAAIFSDPFNFTSSWNGSDVCSYMGVFCAPKSTGAHGRVV  61

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+I+G LP +LGLL+DLALFH+NSNRF G +P S   ++LL ELD+SNN   G
Sbjct  62    AGIDLNHADIAGYLPPELGLLSDLALFHLNSNRFCGVVPSSLRLMKLLHELDLSNNRFVG  121

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
             DFP VV SLP LK+LD+R+N+F+G +P +++D  LDALF+N N F   +P N GNSPVSV
Sbjct  122   DFPKVVFSLPSLKYLDLRFNEFEGSVPSQLFDKDLDALFLNDNRFQFGIPPNLGNSPVSV  181

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV ANNNL GC+P SI  M KTL+EIIL+N +L  CLP +IGLL  L VFDVSFN L G 
Sbjct  182   LVLANNNLGGCIPGSIGNMAKTLNEIILLNDNLTGCLPPQIGLLTNLTVFDVSFNRLQGP  241

Query  741   LPESMGK-LKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK-  568
             LP ++GK +K LEQL+VA N+L+G IPASIC+LPRL NFTYS+NYF      C   K+  
Sbjct  242   LPSTIGKNMKSLEQLDVARNRLTGVIPASICQLPRLHNFTYSFNYFTGEAPACAANKNNI  301

Query  567   NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             N +KNCI     QRS   C +  ++PVDC  L C
Sbjct  302   NGRKNCIRGKLDQRSARECASPAARPVDCRKLQC  335



>ref|XP_004982365.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Setaria 
italica]
Length=387

 Score =   384 bits (985),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 238/333 (71%), Gaps = 5/333 (2%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             PF N RL  A+IALQAWKH IT DPKN T +W GP+VCNYTGV+C  APDD  I TVAG+
Sbjct  50    PF-NDRLDAAYIALQAWKHAITEDPKNLTANWCGPFVCNYTGVFCTAAPDDPHILTVAGV  108

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLNH  I+G LP+ LGLL D+AL H+NSNRF GTLP S  H+RLLFELDVSNNLL G FP
Sbjct  109   DLNHGRIAGFLPDHLGLLADVALLHLNSNRFHGTLPGSMQHMRLLFELDVSNNLLSGAFP  168

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYD--LKLDALFVNHNNFTVTL-PRNFGNSPVSV  922
             + + SLP LK+LD+R+N+F G +P  V+   L LDA+F N+N F VTL  R   NS  SV
Sbjct  169   SFLTSLPSLKYLDLRFNKFDGDLPDSVFGGKLSLDAIFANNNRFNVTLSSRTLANSTASV  228

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V AN  L GCLPPSI  M  TL E++L+N S+ +C+P EIG LK+LKV D+S N L G 
Sbjct  229   IVLANTELAGCLPPSIGDMADTLVELVLLNTSISSCIPPEIGKLKKLKVLDLSHNKLAGE  288

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             LPES+G ++ LE LNV +N+LSG +P SIC LP+L+N T + NYFC  P  C  V  ++D
Sbjct  289   LPESVGDMESLEVLNVGYNQLSGVVPESICLLPKLRNLTVTGNYFCGEPVSCLHVPLRDD  348

Query  561   KKNCIPYWPHQRSPETCKAFYSK-PVDCSVLGC  466
             + NCIP WPHQR+ E C AF  + PV C   GC
Sbjct  349   RMNCIPEWPHQRTHEECIAFEHRPPVHCGADGC  381



>gb|KFK39565.1| hypothetical protein AALP_AA3G260700 [Arabis alpina]
Length=338

 Score =   382 bits (980),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 228/303 (75%), Gaps = 2/303 (1%)
 Frame = -3

Query  1491  PSHQAYDDGPPVFP-FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCA  1315
             P++     GP  FP   NPRL  A+ ALQAWK  IT+DP  FT +W GP+VCNYTGV+CA
Sbjct  33    PTNPCLAHGPNWFPPLVNPRLLKAYAALQAWKLTITSDPNGFTSNWCGPHVCNYTGVFCA  92

Query  1314  PAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLF  1135
              A D+  + TVAGIDLNHANI+G LP +LGLLTDLALFHINSN F G LP++ + L LL 
Sbjct  93    SALDNPYVLTVAGIDLNHANIAGYLPVELGLLTDLALFHINSNHFEGQLPKTLNCLNLLH  152

Query  1134  ELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTL  955
             ELDVSNN L G+FP+V+ SLP LKFLDIR+N F G +P +++DL LDALF+N N F   L
Sbjct  153   ELDVSNNKLSGEFPSVIFSLPSLKFLDIRFNDFYGDVPDQLFDLSLDALFINDNKFRFRL  212

Query  954   PRNFGNSPVSVLVFANNNLRG-CLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             P+N GNSPVSVLV ANN+LRG C+PPS  KM KTL E+IL N  L  CL  E+GLL +L 
Sbjct  213   PKNIGNSPVSVLVLANNDLRGSCVPPSFYKMGKTLHEVILSNSQLTGCLNREVGLLNQLT  272

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             VFDVSFNNLVG LPE++G +K LEQLN+AHNK SG IP SIC LP L+NFTYSYN+F   
Sbjct  273   VFDVSFNNLVGPLPETIGDMKSLEQLNIAHNKFSGNIPESICRLPNLENFTYSYNFFSGE  332

Query  597   PEI  589
             P +
Sbjct  333   PPL  335



>emb|CDX88190.1| BnaA06g27810D [Brassica napus]
Length=419

 Score =   384 bits (987),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 237/334 (71%), Gaps = 1/334 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEI-R  1288
             PP F FEN RL  A++ALQAWK  + +DP N T +W+GP VC+Y GV C+ + DD  I +
Sbjct  45    PPYFVFENVRLERAYVALQAWKRTMISDPWNLTLNWFGPRVCDYNGVVCSESLDDPSINK  104

Query  1287  TVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLL  1108
             TV+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN  
Sbjct  105   TVSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPLGFSQLSLLFELDLSNNRF  164

Query  1107  CGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPV  928
              G FP +V+ LPKLK+LD+RYN+F+G +P+ +++  LDALF+N N FT  +P N G+SPV
Sbjct  165   AGKFPELVIGLPKLKYLDLRYNEFEGGLPESLFEKDLDALFLNSNRFTSKIPVNMGSSPV  224

Query  927   SVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLV  748
             SVLV A+N   GC+P S +KM KTL+EIILM+  L +CLP+++GLL+ + V D+S+N+LV
Sbjct  225   SVLVLASNRFDGCIPTSFSKMGKTLNEIILMDNGLQSCLPNDMGLLQNVTVLDISYNSLV  284

Query  747   GSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK  568
             G LPESMG+++ LE LNV  N  SG IP  IC L  L+ F Y  NYF   P  CR ++  
Sbjct  285   GELPESMGQMESLEVLNVERNMFSGVIPEEICLLKNLREFIYGSNYFTGEPPTCRYLETY  344

Query  567   NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             N   NC+     QRS   CK F SKPVDC    C
Sbjct  345   NSTMNCLKDVKVQRSATECKVFLSKPVDCDSYKC  378



>dbj|BAJ86997.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96974.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   383 bits (984),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 232/327 (71%), Gaps = 1/327 (0%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             +PRL  A++ALQA K  IT DPKN T +W GP VC Y GV+CAP+ DD   R VAG+DLN
Sbjct  50    SPRLQPAYVALQALKRAITDDPKNLTGNWCGPDVCAYYGVFCAPSLDDPCARAVAGVDLN  109

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GTLP +LG LTDLA+ H+NSNRF G LP S   L LL ELDVSNNLL G FP  +
Sbjct  110   HGDLAGTLPFELGHLTDLAVLHLNSNRFAGGLPDSLPKLSLLHELDVSNNLLSGGFPQHI  169

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
             L LP +K++DIR+N   G +P  ++D K+DALF+N N+F   LP NFGNSP SV+V AN 
Sbjct  170   LCLPNVKYVDIRFNNLCGPVPPAIFDKKIDALFINDNHFDFELPENFGNSPASVIVLANL  229

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
              LRGC+P S+ +M  TL+E++++N  + +C+P EIG L+EL V DVSFN L G+LPESM 
Sbjct  230   RLRGCIPASVGRMGGTLNELLMINSGIRSCIPQEIGWLRELTVLDVSFNQLQGTLPESMA  289

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIP  544
              +  LEQL+VAHN+L+G IP  IC LPRL NFTYSYNYFC  PE C  ++  +D++NCI 
Sbjct  290   GMHALEQLDVAHNELTGHIPEGICALPRLANFTYSYNYFCGEPERCTALRRNDDRQNCIA  349

Query  543   YWPHQRSPETCKAFYSK-PVDCSVLGC  466
               P QR  + C AF  + PV C   GC
Sbjct  350   GRPDQRPADQCLAFLHRPPVHCDGHGC  376



>ref|XP_007043626.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOX99457.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=410

 Score =   384 bits (985),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 243/343 (71%), Gaps = 8/343 (2%)
 Frame = -3

Query  1497  SKPSHQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYC  1318
             + P H+ ++  P    F NP+L  A+ ALQAWK VI +DP NFT +W G  VCNYTGV+C
Sbjct  36    ASPHHRHHNRSP----FPNPKLQQAYNALQAWKRVIYSDPHNFTSNWVGHDVCNYTGVFC  91

Query  1317  APAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLL  1138
             AP P DK+I+ VAGIDLN A+I+G LP++  LL+DLAL HINSNRF G LP++ ++L LL
Sbjct  92    APPPYDKKIKVVAGIDLNGADIAGFLPDEFALLSDLALIHINSNRFCGILPQTLANLSLL  151

Query  1137  FELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVT  958
             FELD+SNN   G FP VVLSLP L++LDIRYN+F+G +P +++   LDA+FVN+N F+  
Sbjct  152   FELDLSNNRFVGPFPYVVLSLPSLQYLDIRYNEFEGPLPAQLFSRSLDAIFVNNNRFSNV  211

Query  957   LPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELK  778
             +P NF  S  SV+VFANN L GCLPPSI+    TL E++L+N SL  CLP E+G L +LK
Sbjct  212   IPSNFVGSSASVVVFANNKLGGCLPPSISNFANTLEELLLINTSLSGCLPPEVGYLYKLK  271

Query  777   VFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSA  598
             V DVS NNLVG +P S+  L  LEQLN+AHN ++G +P  +C LP L NFT+SYN+FC  
Sbjct  272   VLDVSNNNLVGPIPYSLAGLAHLEQLNLAHNMMTGIVPMGVCILPNLANFTFSYNFFCEE  331

Query  597   PEICRKVKHK----NDKKNCIPYWPHQRSPETCKAFYSKPVDC  481
               IC+ +       +D++NC+P  P+QRS + C+     PVDC
Sbjct  332   EGICQNLTSNGIAFDDRRNCLPEKPNQRSQKECQGVLEHPVDC  374



>ref|XP_004981448.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Setaria 
italica]
Length=402

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 241/328 (73%), Gaps = 2/328 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++ALQA K  IT DPK  TK+W GP VCNY GVYCA APDD   RTVAG+DLN
Sbjct  54    NSRLEKAYVALQALKRAITDDPKKLTKNWCGPDVCNYFGVYCAAAPDDSCQRTVAGVDLN  113

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GTLPE+LGLL+DLA+FH+NSNRF+G+LP S   L LL E+DVSNN L G FP+ +
Sbjct  114   HGDLAGTLPEELGLLSDLAVFHLNSNRFSGSLPESLRSLHLLHEIDVSNNQLTGPFPSQL  173

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN-  907
             L LP ++++DIR+N F G++P  +++ K+DALF+N+N+F  TLP +F NS  SV+V AN 
Sbjct  174   LCLPNVQYVDIRFNNFCGEVPAAIFEKKIDALFINNNHFEFTLPESFTNSTASVIVLANL  233

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
               + GCLP SI  M  TL+E+IL+N  + +C+P EIG L +L V D+SFN++ G+LP+++
Sbjct  234   PRVGGCLPSSIGDMAGTLNELILLNSGISSCIPPEIGKLDKLTVLDLSFNSITGTLPDTI  293

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             G ++ LEQL+VAHN+L+GEIP SICELP LKNFTYSYN+FC  P  C +V   +D++NCI
Sbjct  294   GNMRALEQLDVAHNQLAGEIPESICELPHLKNFTYSYNFFCGEPHRCLEVPRIDDRQNCI  353

Query  546   PYWPHQRSPETCKAFYSKP-VDCSVLGC  466
                P QR  E C +F  +P   C   GC
Sbjct  354   AGRPDQRPGEECISFLHRPKAHCDAHGC  381



>ref|XP_011026539.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
Length=502

 Score =   387 bits (993),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 245/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   F+NPRL +A+IALQAWK  I +DP N T +W GP VCNYTGV+CA A D+  I+T
Sbjct  73    PPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPDVCNYTGVFCATALDNSSIQT  132

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +++G L E+LGLL D+ALFHINSNRF G +P++   L+LL+ELD+SNN   
Sbjct  133   VAGIDLNHGDMAGHLVEELGLLADIALFHINSNRFCGRVPKTLKKLKLLYELDLSNNRFA  192

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLK+LD+R+N+F+G +PKE+++  LDA+FVNHN F + LP NFGNSPVS
Sbjct  193   GGFPCVVLDLPKLKYLDLRFNEFEGDLPKELFNKDLDAIFVNHNRFALELPNNFGNSPVS  252

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN   GC P S+A M +TL+E+IL N  L +CLP EIGLLK++ VFD S N LVG
Sbjct  253   VMVLANNKFHGCFPTSLANMSRTLNEVILTNNGLRSCLPREIGLLKKVTVFDASNNKLVG  312

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             +LP+++G ++ LEQLNVAHN LSG+I  S+C LP LK+F+Y+YN+    P  C  ++  +
Sbjct  313   ALPDTIGDMESLEQLNVAHNMLSGDIHDSVCLLPHLKSFSYAYNFITGEPPACLDLEDFD  372

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D +NC    P QRS   CK F S+PV C    C
Sbjct  373   DSRNCFRARPKQRSTLQCKVFLSRPVHCEAFNC  405



>ref|XP_011018198.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 2 [Populus euphratica]
Length=576

 Score =   389 bits (999),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/344 (55%), Positives = 248/344 (72%), Gaps = 4/344 (1%)
 Frame = -3

Query  1497  SKPSHQAYD---DGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTG  1327
             S  +H+  D   D  P   FENPR+  A+IALQ+WK  I +DP NFT +W G  VC+Y G
Sbjct  28    SSAAHEDGDHDMDADPTLKFENPRIRXAYIALQSWKQAIFSDPFNFTANWNGSDVCSYMG  87

Query  1326  VYCAPAPDDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHL  1147
             V+CAP+P +K+IR VAGIDLNHA+I+G LP + GL+TDLAL HINSNRF G +P SF  +
Sbjct  88    VFCAPSPKNKKIRVVAGIDLNHADIAGYLPTEPGLITDLALLHINSNRFCGVVPSSFRKM  147

Query  1146  RLLFELDVSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNF  967
             +LL ELD+SNN   G FP VVLSLP LK+LD+R+N+F+G +P +++D  LDA+F+N N F
Sbjct  148   KLLNELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNEFEGFVPSQLFDKPLDAIFLNDNRF  207

Query  966   TVTLPRNFGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLK  787
                +P N GNSPVSV+V ANNNL  C+P +I KM KTL+EIILMN +L  CLP  IG+LK
Sbjct  208   RFGIPENVGNSPVSVVVLANNNLGWCIPDNIGKMGKTLNEIILMNDNLTGCLPPRIGMLK  267

Query  786   ELKVFDVSFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYF  607
             E+ VFDVSFN+L G+LP S+G +K +EQL++AHN  +G +P  +C+LP L+NFTYS+NYF
Sbjct  268   EVTVFDVSFNHLQGALPSSIGNMKSVEQLDIAHNSFTGVVPDIVCQLPNLQNFTYSFNYF  327

Query  606   CSAPEICRKVK-HKNDKKNCIPYWPHQRSPETCKAFYSKPVDCS  478
                   C  +    N  +NCIP   +QRS + C +  ++PVDCS
Sbjct  328   TGEAPSCAAIGVVSNGTQNCIPGKMNQRSAKQCSSEAARPVDCS  371



>ref|XP_006289956.1| hypothetical protein CARUB_v10003584mg [Capsella rubella]
 gb|EOA22854.1| hypothetical protein CARUB_v10003584mg [Capsella rubella]
Length=429

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 234/333 (70%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  + +DP N T +W+G  VC+Y GV C+ + D+  ++T
Sbjct  41    PPYLIFENVRLERAYVALQAWKRAMISDPWNLTTNWFGSRVCDYNGVVCSSSLDEPLVKT  100

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN   
Sbjct  101   VSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPVGFSQLSLLFELDLSNNRFA  160

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VV+ LPKLK+LD+RYN+F+G +P+ ++D  LDALF+N N F   +P N GNSPVS
Sbjct  161   GKFPEVVIGLPKLKYLDLRYNEFEGALPESLFDKDLDALFLNSNRFVSKIPVNMGNSPVS  220

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV A+N   GC+P S  KM KTL+EIILM+  L +CLP+++GLL+ + V D+S+N LVG
Sbjct  221   VLVLASNRFEGCIPTSFGKMGKTLNEIILMDNGLQSCLPNDMGLLRNVTVLDISYNWLVG  280

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LP+SMG ++ LE LNV  N LSG IP  +C L +L+ F Y  NYF   P  CR +++ N
Sbjct  281   ELPKSMGAMENLEVLNVERNMLSGVIPEELCALEKLREFKYGSNYFTGEPSTCRYLENYN  340

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
                NC+     QRS   CK F SKP+DC    C
Sbjct  341   YTMNCLKDERDQRSMMECKVFLSKPIDCDSFKC  373



>ref|XP_009151086.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Brassica 
rapa]
Length=419

 Score =   383 bits (984),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 237/334 (71%), Gaps = 1/334 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEI-R  1288
             PP F FEN RL  A++ALQAWK  + +DP N T +W+GP VC+Y GV C+ + DD  I +
Sbjct  45    PPYFVFENVRLERAYVALQAWKRTMISDPWNLTLNWFGPRVCDYNGVVCSESLDDPSINK  104

Query  1287  TVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLL  1108
             TV+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GTLP  FS L LLFELD+SNN  
Sbjct  105   TVSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTLPLGFSQLSLLFELDLSNNRF  164

Query  1107  CGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPV  928
              G FP +V+ LPKLK+LD+RYN+F+G +P+ +++  LDALF+N N FT  +P N G+SPV
Sbjct  165   AGKFPELVIGLPKLKYLDLRYNEFEGGLPESLFEKDLDALFLNSNRFTSKIPVNMGSSPV  224

Query  927   SVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLV  748
             SVLV A+N   GC+P S +KM KTL+EIILM+  L +CLP+++GLL+ + V D+S+N+LV
Sbjct  225   SVLVLASNRFDGCIPTSFSKMGKTLNEIILMDNGLQSCLPNDMGLLQNVTVLDISYNSLV  284

Query  747   GSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK  568
             G LPESMG+++ LE LNV  N  SG IP  IC L  L+ F Y  NYF   P  CR ++  
Sbjct  285   GELPESMGQMESLEVLNVERNMFSGVIPEEICLLKNLREFIYGSNYFTGEPPTCRYLETY  344

Query  567   NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             N   NC+     QRS   CK F SKPVDC    C
Sbjct  345   NSTMNCLKDVKVQRSATECKVFLSKPVDCDSYKC  378



>ref|NP_001051547.1| Os03g0795300 [Oryza sativa Japonica Group]
 gb|AAT76416.1| putative leucine-rich receptor-like protein kinase [Oryza sativa 
Japonica Group]
 gb|ABF99333.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13461.1| Os03g0795300 [Oryza sativa Japonica Group]
 dbj|BAG89046.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   382 bits (981),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 236/328 (72%), Gaps = 2/328 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++ALQA K  IT DPKN T  W GP VC Y GVYCA APDD   RTVAG+DLN
Sbjct  44    NSRLEKAYVALQALKRAITDDPKNLTHSWCGPEVCGYFGVYCAAAPDDPCARTVAGVDLN  103

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GTLPE+LGLLTDLA+FH+NSNRF G+LP S  +L  L E+DVSNN L G FP+ +
Sbjct  104   HGDLAGTLPEELGLLTDLAVFHLNSNRFCGSLPDSLRNLHRLHEIDVSNNHLSGSFPSQL  163

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN-  907
             L LP LK++D+R+N   G++P  +++ K+DALF+N+NNF   L  +F NS  SV+V AN 
Sbjct  164   LCLPDLKYVDLRFNNLCGEVPAAIFEKKIDALFINNNNFDFKLTESFSNSTASVIVLANL  223

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
               L GCLP SI  M +TL+E++L+N  + +C+P EIG L +L V D+SFN+  G+LPE++
Sbjct  224   PKLGGCLPSSIGDMAETLNELVLLNSGISSCIPPEIGKLDKLTVLDLSFNDFAGALPETI  283

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             G ++ LEQLNVAHN L+GEIP SIC LP LKNFTYS+N+FC  P  C +V H +D++NCI
Sbjct  284   GHMRALEQLNVAHNGLAGEIPDSICALPHLKNFTYSHNFFCGEPHRCLEVPHVDDRQNCI  343

Query  546   PYWPHQRSPETCKAFYSK-PVDCSVLGC  466
                P QRS E C AF  + PV C   GC
Sbjct  344   AGRPDQRSGEECIAFLHRPPVHCDAHGC  371



>ref|XP_002516600.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45941.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=516

 Score =   386 bits (992),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/331 (55%), Positives = 239/331 (72%), Gaps = 1/331 (0%)
 Frame = -3

Query  1455  FPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAG  1276
             F F+NPRL  A+IALQ+WK  + +DP N T +W G  VC+YTG++C  APD+  I+TVA 
Sbjct  73    FKFDNPRLKTAYIALQSWKQAMISDPNNLTANWVGCDVCSYTGIFCWTAPDNSSIQTVAA  132

Query  1275  IDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDF  1096
             IDLNH +I+G L E+LGLLTD+ALFHINSNRF G +P+S  +L  L+ELD+SNN   G F
Sbjct  133   IDLNHGDIAGHLVEELGLLTDIALFHINSNRFCGRVPKSLKNLNFLYELDLSNNRFAGRF  192

Query  1095  PAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLV  916
             P VVL LP LK+LD+R+N+F+G +P+E++D  LDA+F+N N F+  LP N GNSPVS LV
Sbjct  193   PNVVLDLPDLKYLDLRFNEFEGNVPRELFDKDLDAIFINDNRFSFKLPDNIGNSPVSALV  252

Query  915   FANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLP  736
              ANNN  GCLP S   M  TL E+IL N  L +C P+EIGLLK+L+VFD S+N L+G LP
Sbjct  253   LANNNFHGCLPASFRNMSGTLYELILRNNGLSSCFPEEIGLLKKLQVFDASYNKLMGELP  312

Query  735   ESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKK  556
             +++GKLK LE  +V+HN LSG IP S+C LP+L+NF+++YN+    P +C +V+  +D +
Sbjct  313   DTIGKLKNLEHFDVSHNFLSGTIPESVCLLPKLQNFSFAYNFITGEPPVCLEVEEFDDFR  372

Query  555   NCIPYWPHQRSPETCKAFY-SKPVDCSVLGC  466
             NC+   P QRS   C  F  S+PVDC    C
Sbjct  373   NCLRGRPTQRSRLQCIMFLKSRPVDCQAFNC  403



>ref|XP_003532491.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Glycine 
max]
Length=735

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 246/332 (74%), Gaps = 1/332 (0%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FEN RL NA+IALQAWK  I +DP+N T DW G  VC+YTGVYCAPA D  +IRTV
Sbjct  65    PSLAFENDRLRNAYIALQAWKQAILSDPRNQTADWVGSDVCSYTGVYCAPALDIPKIRTV  124

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNH +I+G LPE+LGLL DLALFH+NSNRF GT+P  F  L+LL+ELD+SNN   G
Sbjct  125   AGIDLNHCDIAGYLPEELGLLLDLALFHVNSNRFCGTVPHKFERLKLLYELDLSNNRFAG  184

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
             +FP VVL LP LKFLD+R+N+F+G +P+E++D  LDA+F+N N F   LP NFGNSPVSV
Sbjct  185   NFPEVVLRLPSLKFLDLRFNEFEGTVPRELFDKDLDAIFINDNRFVFDLPDNFGNSPVSV  244

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             +V ANN   GC+P S+  M   L+EIILMN +  +CLP EIGLLK L VFDVSFN L+G 
Sbjct  245   IVLANNRFHGCIPASLGNM-SNLNEIILMNNAFRSCLPSEIGLLKNLTVFDVSFNQLLGP  303

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKND  562
             +P ++G    LEQLNVAHN LSG+IPASIC LP L+NFTYS+N+F   P  C  +   +D
Sbjct  304   IPNAVGNAVSLEQLNVAHNLLSGQIPASICMLPHLQNFTYSFNFFTGEPPACLALPAFDD  363

Query  561   KKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             + NC+P  P QR P  CK+F SKPVDC+   C
Sbjct  364   RVNCLPARPLQRPPAQCKSFLSKPVDCNSFKC  395



>gb|EAY92168.1| hypothetical protein OsI_13881 [Oryza sativa Indica Group]
Length=393

 Score =   382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 235/328 (72%), Gaps = 2/328 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++ALQA K  IT DPKN T  W GP VC Y GVYCA APDD   RTVAG+DLN
Sbjct  44    NSRLEKAYVALQALKRAITDDPKNLTHSWCGPEVCGYFGVYCAAAPDDPCARTVAGVDLN  103

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GTLPE+LGLLTDLA+FH+NSNRF G+LP S  +L  L E+DVSNN L G FP+ +
Sbjct  104   HGDLAGTLPEELGLLTDLAVFHLNSNRFCGSLPDSLRNLHRLHEIDVSNNHLSGSFPSQL  163

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN-  907
             L LP LK++D+R+N   G++P  +++ K+DALF+N+NNF   L  +F NS  SV+V AN 
Sbjct  164   LCLPDLKYVDLRFNNLCGEVPAAIFEKKIDALFINNNNFDFKLTESFSNSTASVIVLANL  223

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
               L GCLP SI  M +TL+E++L+N  + +C+P EIG L +L V D+SFN   G+LPE++
Sbjct  224   PKLGGCLPSSIGDMAETLNELVLLNSGISSCIPPEIGKLDKLTVLDLSFNGFAGALPETI  283

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             G ++ LEQLNVAHN L+GEIP SIC LP LKNFTYS+N+FC  P  C +V H +D++NCI
Sbjct  284   GHMRALEQLNVAHNGLAGEIPDSICALPHLKNFTYSHNFFCGEPHRCLEVPHVDDRQNCI  343

Query  546   PYWPHQRSPETCKAFYSK-PVDCSVLGC  466
                P QRS E C AF  + PV C   GC
Sbjct  344   AGRPDQRSGEECIAFLHRPPVHCDAHGC  371



>dbj|BAF48663.1| leucine-rich repeat/extensin [Nicotiana plumbaginifolia]
 dbj|BAF48664.1| leucine-rich repeat/extensin [Nicotiana plumbaginifolia]
Length=725

 Score =   392 bits (1008),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 192/331 (58%), Positives = 244/331 (74%), Gaps = 3/331 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP+L  A+IALQ WK  + +DP NFT +W GP VC+Y GV+CA +  +  IR VAGID
Sbjct  45    FENPKLRVAYIALQTWKAAMFSDPFNFTANWTGPNVCSYGGVFCAQSLTNDSIRVVAGID  104

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G L  +LGLLTDL LFH+NSNRF G +P++FSHL+LL ELD+SNN   G FP 
Sbjct  105   LNHADIAGYLVPELGLLTDLVLFHLNSNRFCGIVPKTFSHLKLLRELDLSNNRFVGGFPK  164

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N F+G +P +++D  LDALF+N N F   +P N GNSPVSVLVFA
Sbjct  165   VVLSLPSLKFLDLRFNDFEGPVPSKLFDKDLDALFLNDNRFRFGIPENLGNSPVSVLVFA  224

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM  TL+E+ILMN +L  CLP EIG+LK+L VFDVSFN + G LP +
Sbjct  225   NNNLGGCIPASIGKMSNTLNELILMNDNLTGCLPMEIGMLKKLTVFDVSFNKIQGPLPST  284

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEIC---RKVKHKNDK  559
             + +++ +EQLNVAHNKL+G IPASIC+LPRL+NFTYS+NYF     +C   R  +  + +
Sbjct  285   VSRMRSVEQLNVAHNKLTGVIPASICQLPRLQNFTYSFNYFTGEAPVCAATRSGRIVDGE  344

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +NCI     QRS + C +  +KP DC    C
Sbjct  345   ENCIAGKEDQRSAKECSSDDAKPYDCRKSQC  375



>ref|XP_003526272.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Glycine 
max]
Length=419

 Score =   382 bits (981),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 239/333 (72%), Gaps = 4/333 (1%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  N RL+ AF+ LQAWK VI +DP NFT +W GP VCNYTGV+CAP+ DD ++  VAGI
Sbjct  51    PSLNTRLHMAFLGLQAWKQVIYSDPNNFTSNWVGPSVCNYTGVFCAPSLDDPKVTVVAGI  110

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLN A+++G LP ++GLL+DLA+ H+++NRF G LP+SF++L LL+ELD+SNN   G FP
Sbjct  111   DLNFADLAGFLPNEIGLLSDLAVLHLSNNRFCGILPKSFTNLTLLYELDLSNNRFVGPFP  170

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
              VV SLP LK+LD+RYN+F+G +P ++++  +DA+FVN+N F  T+P N G    SVLVF
Sbjct  171   LVVFSLPLLKYLDLRYNEFEGPLPPQLFNNTIDAIFVNNNRFISTIPPNLGKISASVLVF  230

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             ANN   GCLP SI     TL E++L+N SL  CLP ++G L +L+V DVSFN++VG +P 
Sbjct  231   ANNKFGGCLPESIVNFADTLEELVLINTSLSGCLPQQLGFLYKLRVLDVSFNSIVGPIPY  290

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK----N  565
             S+  L  LEQLN+ HN +SG +P  +CELP L NFT+SYN+FC    IC+ +  K    +
Sbjct  291   SLSGLSHLEQLNLGHNMMSGTVPVGVCELPNLANFTFSYNFFCEEEGICKNLTSKRIVFD  350

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D++NC+P  P QRS + CKA    PVDCS L C
Sbjct  351   DRRNCLPEKPLQRSEKECKAKLEHPVDCSELCC  383



>ref|XP_009608702.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nicotiana 
tomentosiformis]
Length=715

 Score =   392 bits (1006),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 192/331 (58%), Positives = 244/331 (74%), Gaps = 3/331 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP+L  A+IALQ WK  + +DP NFT +W GP VC+Y GV+CA +  +  IR VAGID
Sbjct  45    FENPKLRVAYIALQTWKAAMFSDPFNFTANWTGPNVCSYGGVFCAQSLTNDSIRVVAGID  104

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G L  +LGLLTDL LFH+NSNRF G +P++FSHL+LL ELD+SNN   G FP 
Sbjct  105   LNHADIAGYLVPELGLLTDLVLFHLNSNRFCGIVPKTFSHLKLLRELDLSNNRFVGGFPK  164

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N F+G +P +++D  LDALF+N N F   +P N GNSPVSVLVFA
Sbjct  165   VVLSLPSLKFLDLRFNDFEGPVPSKLFDKDLDALFLNDNRFRFGIPDNLGNSPVSVLVFA  224

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM  TL+E+ILMN +L  CLP EIG+LK+L VFDVSFN + G LP +
Sbjct  225   NNNLGGCIPASIGKMGNTLNELILMNDNLTGCLPMEIGMLKKLTVFDVSFNKIQGPLPST  284

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEIC---RKVKHKNDK  559
             + +++ +EQLNVAHNKL+G IPASIC+LPRL+NFTYS+NYF     +C   R  +  + +
Sbjct  285   VSRMRSVEQLNVAHNKLTGVIPASICQLPRLQNFTYSFNYFTGEAPVCAAARSGRVIDGE  344

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +NCI     QRS + C +  +KP DC    C
Sbjct  345   ENCIAGKEDQRSAKECSSDDAKPYDCRKSQC  375



>gb|KHN01115.1| Pollen-specific leucine-rich repeat extensin-like protein 3 [Glycine 
soja]
Length=418

 Score =   382 bits (981),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 239/333 (72%), Gaps = 4/333 (1%)
 Frame = -3

Query  1452  PFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGI  1273
             P  N RL+ AF+ LQAWK VI +DP NFT +W GP VCNYTGV+CAP+ DD ++  VAGI
Sbjct  51    PSLNTRLHMAFLGLQAWKQVIYSDPNNFTSNWVGPSVCNYTGVFCAPSLDDPKVTVVAGI  110

Query  1272  DLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFP  1093
             DLN A+++G LP ++GLL+DLA+ H+++NRF G LP+SF++L LL+ELD+SNN   G FP
Sbjct  111   DLNFADLAGFLPNEIGLLSDLAVLHLSNNRFCGILPKSFTNLTLLYELDLSNNRFVGPFP  170

Query  1092  AVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVF  913
              VV SLP LK+LD+RYN+F+G +P ++++  +DA+FVN+N F  T+P N G    SVLVF
Sbjct  171   LVVFSLPLLKYLDLRYNEFEGPLPPQLFNNTIDAIFVNNNRFISTIPPNLGKISASVLVF  230

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             ANN   GCLP SI     TL E++L+N SL  CLP ++G L +L+V DVSFN++VG +P 
Sbjct  231   ANNKFGGCLPESIVNFADTLEELVLINTSLSGCLPQQLGFLYKLRVLDVSFNSIVGPIPY  290

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK----N  565
             S+  L  LEQLN+ HN +SG +P  +CELP L NFT+SYN+FC    IC+ +  K    +
Sbjct  291   SLSGLSHLEQLNLGHNMMSGTVPVGVCELPNLANFTFSYNFFCEEEGICQNLTSKRIVFD  350

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D++NC+P  P QRS + CKA    PVDCS L C
Sbjct  351   DRRNCLPEKPLQRSEKECKAKLEHPVDCSELCC  383



>ref|XP_003557501.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brachypodium 
distachyon]
Length=396

 Score =   381 bits (978),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 237/328 (72%), Gaps = 2/328 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++ALQA K  IT DPK  T++W GP VC+Y GVYCA APDD   RTVA +DLN
Sbjct  51    NSRLEKAYVALQALKRAITDDPKKLTENWCGPDVCSYRGVYCATAPDDPCARTVASVDLN  110

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GTLPE+LGLL+DLA+FH+NSNRF G LP S   L LL E+DVSNN L G FP+ +
Sbjct  111   HGDLAGTLPEELGLLSDLAVFHLNSNRFCGALPDSLRSLHLLHEIDVSNNQLSGTFPSQL  170

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN-  907
             L LP ++++DIR+N F G++PK V++ K+DALF+N+N+F  TLP NF NS  SV+V AN 
Sbjct  171   LCLPNVQYVDIRFNNFCGEVPKAVFEKKIDALFINNNHFEFTLPENFSNSTASVIVLANL  230

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
               L GCLP SI  M  TL+E++L+N  + +C+P EIG L +L V D+SFN++ G LP+++
Sbjct  231   PRLGGCLPSSIGDMAGTLNELVLLNSGISSCIPPEIGKLDKLTVLDLSFNSIAGKLPDTI  290

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             G ++ LEQLN+AHN L+G+IP SIC LP LKNFTYS+NYFC  P  C +V   +D++NCI
Sbjct  291   GNMRALEQLNIAHNMLAGDIPESICALPHLKNFTYSHNYFCGEPHRCLQVPRIDDRQNCI  350

Query  546   PYWPHQRSPETCKAFYSK-PVDCSVLGC  466
                P QRS E C  F  + PV C   GC
Sbjct  351   AGRPDQRSGEQCIEFMHRPPVHCDAHGC  378



>gb|KFK27830.1| hypothetical protein AALP_AA8G435400 [Arabis alpina]
Length=446

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 236/333 (71%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   FEN RL  A++ALQAWK  + +DP N T +W+G  VC+Y GV C+ + DD  I+T
Sbjct  44    PPYLIFENERLERAYVALQAWKQAMISDPWNLTLNWFGSRVCDYNGVVCSSSIDDPLIKT  103

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             V+G+DLNH +I+G LPE+LGLLTD+ALFH+NSNRF GT+P  FS L LL+ELD+SNN   
Sbjct  104   VSGVDLNHGDIAGHLPEELGLLTDIALFHVNSNRFCGTIPLGFSQLSLLYELDLSNNRFA  163

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP+VV+ LP LK+LD+RYN+F+G +P+ +++  LDALF+N N FT  +P N GNSPVS
Sbjct  164   GKFPSVVIGLPSLKYLDLRYNEFEGGLPESLFEKDLDALFLNSNRFTSKIPVNMGNSPVS  223

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V A+N   GC+P S  +M KTL+EIILM+  L +C+P+++GLLK + V DVS+N LVG
Sbjct  224   VMVLASNRFEGCIPTSFGRMGKTLNEIILMDNGLQSCIPNDMGLLKNVTVLDVSYNWLVG  283

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
              LPESMG+++ LE LNV  N LSG IP  IC L  L  F +  NYF   P +CR ++  N
Sbjct  284   ELPESMGQMENLEVLNVERNMLSGVIPEEICALNNLIEFKFGSNYFTGEPLMCRNLESYN  343

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +  NC+     QR+   CK F SKPVDC+   C
Sbjct  344   NTMNCLKDEKAQRTTMECKVFLSKPVDCNSYKC  376



>gb|EMT04692.1| hypothetical protein F775_21578 [Aegilops tauschii]
Length=385

 Score =   379 bits (974),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 235/336 (70%), Gaps = 5/336 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P+ PF N RL  A+IA QAWKHVIT DPKN T DW GP+VCNYTGV+CA APDD  I TV
Sbjct  46    PLSPF-NERLDAAYIAFQAWKHVITEDPKNLTADWCGPFVCNYTGVFCAAAPDDPCILTV  104

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AG+DLNH  I+G L + LGLL DLA+ H+NSNRF GTLP S  H+RLLFELDVSNNLL G
Sbjct  105   AGVDLNHGRIAGVLTDHLGLLADLAVLHLNSNRFHGTLPTSMQHMRLLFELDVSNNLLSG  164

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVY--DLKLDALFVNHNNFTVTLPR-NFGNSP  931
              FP+ + SLP LK+LD+R+N F G++P  V+   L LDALF N N F V+L   +  NS 
Sbjct  165   AFPSFLTSLPSLKYLDLRFNDFDGELPDAVFGRQLSLDALFANDNRFNVSLASGSLTNST  224

Query  930   VSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNL  751
              SV+V AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+LKV D+S N  
Sbjct  225   ASVIVLANTKLAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLKVLDLSHNEF  284

Query  750   VGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKH  571
              G LPES+G ++ LE +NV +N LSG +P +IC LP LKN T   NYFC  P  C  V  
Sbjct  285   AGELPESIGDMESLEVINVGYNMLSGAVPETICLLPNLKNLTVVGNYFCEEPVSCLHVPR  344

Query  570   KNDKKNCIPYWPHQRSPETCKAF-YSKPVDCSVLGC  466
             ++D+ NCIP WPHQRS E C AF +  PV C   GC
Sbjct  345   RDDRMNCIPDWPHQRSHEQCIAFEHRPPVHCGADGC  380



>ref|XP_003540926.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like isoform 
X1 [Glycine max]
Length=417

 Score =   380 bits (976),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 243/344 (71%), Gaps = 9/344 (3%)
 Frame = -3

Query  1485  HQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAP  1306
             HQ +   PP+    N RL  AF+ LQAWK VI +DP NFT +W GP VCNYTGVYCAP+ 
Sbjct  44    HQ-HTQNPPL----NSRLDMAFLGLQAWKQVIYSDPNNFTSNWVGPSVCNYTGVYCAPSL  98

Query  1305  DDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELD  1126
             DD ++  VAGIDLN A+++G LP ++GLL+DLA+ H+++NRF G LP SF++L LL+ELD
Sbjct  99    DDPKVTVVAGIDLNFADLAGFLPNEIGLLSDLAVLHLSNNRFCGILPMSFTNLTLLYELD  158

Query  1125  VSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRN  946
             +SNN   G FP VVLSL  LK+LD+RYN+F+G +P ++++  +DA+FVN+N F+ T+P N
Sbjct  159   LSNNRFVGPFPLVVLSLHMLKYLDLRYNEFEGPLPPQLFNNTIDAIFVNNNRFSSTIPPN  218

Query  945   FGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDV  766
              G    SV+VFANN   GCLP SI     TL E++L+N SL  CLP ++G L +L+V DV
Sbjct  219   LGKISASVVVFANNKFGGCLPESIVNFADTLEELVLINTSLSGCLPQQVGFLYKLRVLDV  278

Query  765   SFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEIC  586
             SFNN+VG +P S+  L  LEQLN+ HN +SG +P  +CELP L NFT+SYN+FC    IC
Sbjct  279   SFNNIVGPIPYSLSGLSHLEQLNLGHNMMSGTVPVGVCELPNLANFTFSYNFFCEEEGIC  338

Query  585   RKVKHK----NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             + +  K    +D++NC+P  P QRS + CKA    PVDCS L C
Sbjct  339   QNLTSKRIVFDDRRNCLPEKPLQRSEKECKAKLEHPVDCSELCC  382



>ref|XP_004955608.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Setaria 
italica]
Length=437

 Score =   381 bits (978),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 229/327 (70%), Gaps = 1/327 (0%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             NPRL  A++ALQA K  IT DPKN T+ W GP VC Y GV+CA APDD    TVAG+DLN
Sbjct  105   NPRLQRAYVALQALKRAITDDPKNLTRGWCGPDVCAYFGVFCAAAPDDPHALTVAGLDLN  164

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GT PE+LG+L+DLAL H+NSNRF G LP S   L LL ELDVSNN L G FP  +
Sbjct  165   HGDLAGTFPEELGMLSDLALLHLNSNRFAGGLPESLPKLHLLHELDVSNNRLSGGFPQHI  224

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFANN  904
             L LP +K++D+R+N   G +P  ++D  LDALF+N N+F   LP NFGNSP SV+V AN 
Sbjct  225   LCLPNVKYVDLRFNNLCGPVPPAIFDKPLDALFLNDNHFDFELPENFGNSPASVVVLANI  284

Query  903   NLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESMG  724
              LRGC+P S+ +M  TL+E++++N  L +C+P E+G L+EL V D+SFN L G LPESM 
Sbjct  285   RLRGCIPQSVGRMAGTLNELVILNSGLRSCIPQEVGWLRELTVLDLSFNQLQGMLPESMA  344

Query  723   KLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCIP  544
              + KLEQL+VAHN+L G IP  IC LP L+NFTYSYNYFC+ P  C  ++  +D++NCI 
Sbjct  345   GMHKLEQLDVAHNELWGHIPEGICALPSLRNFTYSYNYFCTEPRRCLDIRRVDDRQNCIA  404

Query  543   YWPHQRSPETCKAFYSK-PVDCSVLGC  466
               P QR  + C AF  + P  C   GC
Sbjct  405   GRPDQRPGDQCLAFLHRPPPHCDEHGC  431



>ref|XP_009758506.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Nicotiana 
sylvestris]
Length=709

 Score =   390 bits (1001),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 245/331 (74%), Gaps = 3/331 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP+L  A+IALQ WK  + +DP NFT +W GP VC+Y GV+CA +  +  IR VAGID
Sbjct  45    FENPKLRVAYIALQTWKAAMFSDPFNFTANWTGPNVCSYGGVFCAQSLTNDSIRVVAGID  104

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G L  +LGLLTDL LFH+NSNRF G +P++FSHL+LL ELD+SNN   G FP 
Sbjct  105   LNHADIAGYLVPELGLLTDLVLFHLNSNRFCGIVPKTFSHLKLLRELDLSNNRFVGGFPK  164

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N F+G +P +++D  LDALF+N N F   +P N GNSPVSVLVFA
Sbjct  165   VVLSLPSLKFLDLRFNDFEGPVPSKLFDKDLDALFLNDNRFRFGIPENLGNSPVSVLVFA  224

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM  +L+E+ILMN +L +CLP EIG+LK+L VFDVSFN + G LP +
Sbjct  225   NNNLGGCIPASIGKMGNSLNELILMNDNLTSCLPMEIGMLKKLTVFDVSFNKIQGPLPST  284

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEIC---RKVKHKNDK  559
             + +++ +EQLNVAHNKL+G IPASIC+LPRL+NFTYS+NYF     +C   R  +  + +
Sbjct  285   VSRMRSVEQLNVAHNKLTGVIPASICQLPRLQNFTYSFNYFKGEAPVCAATRSGRVIDGE  344

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +NCI     QRS + C +  +KP DC    C
Sbjct  345   ENCIAGKEDQRSAKECSSDDAKPYDCRKSQC  375



>gb|EMS66895.1| Leucine-rich repeat extensin-like protein 6 [Triticum urartu]
Length=385

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 235/336 (70%), Gaps = 5/336 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P+ PF N RL  A+IA QAWKHVIT DPKN T DW GP+VCNYTGV+CA APDD  I TV
Sbjct  46    PLSPF-NERLDAAYIAFQAWKHVITEDPKNLTADWCGPFVCNYTGVFCAAAPDDPCILTV  104

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AG+DLNH  I+G L + LGLL DLA+ H+NSNRF GTLP S  H+RLLFELDVSNNLL G
Sbjct  105   AGVDLNHGRIAGVLTDHLGLLADLAVLHLNSNRFHGTLPTSMQHMRLLFELDVSNNLLSG  164

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVY--DLKLDALFVNHNNFTVTLPR-NFGNSP  931
              FP+ + SLP LK+LD+R+N F G++P  V+   L LDALF N N F V+L   +  NS 
Sbjct  165   PFPSFLTSLPSLKYLDLRFNDFDGELPDAVFGRQLSLDALFANDNRFNVSLASGSLTNST  224

Query  930   VSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNL  751
              SV+V AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+LKV D+S N  
Sbjct  225   ASVIVLANTKLAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLKVLDLSHNEF  284

Query  750   VGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKH  571
              G LPES+G ++ LE +NV +N LSG +P +IC LP LKN T   NYFC  P  C  V  
Sbjct  285   AGELPESIGDMESLEVINVGYNMLSGAVPETICLLPNLKNLTVVGNYFCEEPVSCLHVPR  344

Query  570   KNDKKNCIPYWPHQRSPETCKAF-YSKPVDCSVLGC  466
             ++D+ NCIP WPHQRS E C AF +  PV C   GC
Sbjct  345   RDDRMNCIPDWPHQRSHEQCIAFEHRPPVHCGADGC  380



>ref|XP_011026538.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Populus euphratica]
Length=614

 Score =   387 bits (993),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 245/333 (74%), Gaps = 0/333 (0%)
 Frame = -3

Query  1464  PPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             PP   F+NPRL +A+IALQAWK  I +DP N T +W GP VCNYTGV+CA A D+  I+T
Sbjct  73    PPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPDVCNYTGVFCATALDNSSIQT  132

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNH +++G L E+LGLL D+ALFHINSNRF G +P++   L+LL+ELD+SNN   
Sbjct  133   VAGIDLNHGDMAGHLVEELGLLADIALFHINSNRFCGRVPKTLKKLKLLYELDLSNNRFA  192

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LPKLK+LD+R+N+F+G +PKE+++  LDA+FVNHN F + LP NFGNSPVS
Sbjct  193   GGFPCVVLDLPKLKYLDLRFNEFEGDLPKELFNKDLDAIFVNHNRFALELPNNFGNSPVS  252

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             V+V ANN   GC P S+A M +TL+E+IL N  L +CLP EIGLLK++ VFD S N LVG
Sbjct  253   VMVLANNKFHGCFPTSLANMSRTLNEVILTNNGLRSCLPREIGLLKKVTVFDASNNKLVG  312

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKN  565
             +LP+++G ++ LEQLNVAHN LSG+I  S+C LP LK+F+Y+YN+    P  C  ++  +
Sbjct  313   ALPDTIGDMESLEQLNVAHNMLSGDIHDSVCLLPHLKSFSYAYNFITGEPPACLDLEDFD  372

Query  564   DKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             D +NC    P QRS   CK F S+PV C    C
Sbjct  373   DSRNCFRARPKQRSTLQCKVFLSRPVHCEAFNC  405



>tpg|DAA51888.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=392

 Score =   379 bits (972),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 180/328 (55%), Positives = 240/328 (73%), Gaps = 2/328 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++ALQA K  IT DPK  TK+W GP VC+Y GV+CAPAPDD   RTVA +DLN
Sbjct  44    NSRLEKAYVALQALKRAITDDPKKLTKNWCGPDVCSYFGVFCAPAPDDPCQRTVASVDLN  103

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H +++GTLPE+LGLL+DLA+FH+NSNRF+G+LP S   L LL E+DVSNN L G FP  +
Sbjct  104   HGDLAGTLPEELGLLSDLAVFHLNSNRFSGSLPDSLRSLHLLHEIDVSNNQLSGPFPPQL  163

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFAN-  907
             L LP ++++DIR+N F G++P  ++D K+DALF+N+N+F  TLP +F NS  SV+V AN 
Sbjct  164   LCLPNVQYVDIRFNNFCGEVPAAIFDKKVDALFINNNHFEFTLPDSFTNSTASVIVLANL  223

Query  906   NNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPESM  727
               + GCLP SI  M  TL+E+IL+N  + +C+P EIG L +L V D+SFN++ G+LP+++
Sbjct  224   QRVSGCLPSSIGDMAATLNELILLNSGISSCIPPEIGKLDKLTVLDLSFNSIAGTLPDTI  283

Query  726   GKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKNCI  547
             G ++ LEQL+VAHN+L+GEIP S+C LP LKNFTYSYN+FC  P  C +V   +D++NCI
Sbjct  284   GNMRALEQLDVAHNRLAGEIPESVCGLPHLKNFTYSYNFFCGEPHRCLEVPRVDDRQNCI  343

Query  546   PYWPHQRSPETCKAFYSKP-VDCSVLGC  466
                P QR  E C +F  +P V C   GC
Sbjct  344   AGRPDQRPGEECISFLHQPRVRCDAHGC  371



>ref|XP_010431693.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Camelina 
sativa]
Length=743

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/336 (57%), Positives = 240/336 (71%), Gaps = 5/336 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENP L  A+IALQ+WK  I +DP NFT +W G  VC+Y G++CAP+P  K  R V
Sbjct  54    PSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSK-TRVV  112

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+++G LP +LGLLTDLALFH+NSNRF G +P +F H++LLFELD+SNN   G
Sbjct  113   AGIDLNHADMAGYLPRELGLLTDLALFHLNSNRFCGEVPITFKHMKLLFELDLSNNRFVG  172

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLP LKFLD+RYN+F+G IP +++D +LDA+F+NHN F   +P N GNSPVS 
Sbjct  173   KFPNVVLSLPSLKFLDLRYNEFEGGIPAKLFDKELDAIFLNHNRFRFGIPENMGNSPVSA  232

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV A+N+L GC+P SI  M KTL+EIIL N +L  CLP +IG LK + VFDVSFN+L G 
Sbjct  233   LVLADNDLGGCIPGSIGLMGKTLNEIILSNDNLTGCLPPQIGNLKNVTVFDVSFNSLSGP  292

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK--  568
             LP S+G +K LEQLNVA+N+ +G IP+SIC+L  L+NFTYS N+F      C  +     
Sbjct  293   LPSSIGNMKSLEQLNVANNRFTGVIPSSICQLSNLENFTYSSNFFTGDAPRCAALSGDDV  352

Query  567   --NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               N   NCI     QRS E C +  S+PVDCS  GC
Sbjct  353   AVNGSMNCIAGKERQRSSEECSSPASRPVDCSKFGC  388



>dbj|BAF48665.1| leucine-rich repeat/extensin 1 [Nicotiana tabacum]
Length=723

 Score =   389 bits (999),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 245/331 (74%), Gaps = 3/331 (1%)
 Frame = -3

Query  1449  FENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGID  1270
             FENP+L  A+IALQ WK  + +DP NFT +W GP VC+Y GV+CA +  +  IR VAGID
Sbjct  45    FENPKLRVAYIALQTWKAAMFSDPFNFTANWTGPNVCSYGGVFCAQSLTNDSIRVVAGID  104

Query  1269  LNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPA  1090
             LNHA+I+G L  +LGLLTDL LFH+NSNRF G +P++FSHL+LL ELD+SNN   G FP 
Sbjct  105   LNHADIAGYLVPELGLLTDLVLFHLNSNRFCGIVPKTFSHLKLLRELDLSNNRFVGGFPK  164

Query  1089  VVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSVLVFA  910
             VVLSLP LKFLD+R+N F+G +P +++D  LDALF+N N F   +P N GNSPVSVLVFA
Sbjct  165   VVLSLPSLKFLDLRFNDFEGPVPSKLFDKDLDALFLNDNRFRFGIPENLGNSPVSVLVFA  224

Query  909   NNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPES  730
             NNNL GC+P SI KM  +L+E+ILMN +L +CLP EIG+LK+L VFDVSFN + G LP +
Sbjct  225   NNNLGGCIPASIGKMGNSLNELILMNDNLTSCLPMEIGMLKKLTVFDVSFNKIQGPLPST  284

Query  729   MGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEIC---RKVKHKNDK  559
             + +++ +EQLNVAHNKL+G IPASIC+LPRL+NFT+S+NYF     +C   R  +  + +
Sbjct  285   VSRMRSVEQLNVAHNKLTGVIPASICQLPRLQNFTFSFNYFKGEAPVCAATRSGRVIDGE  344

Query  558   KNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
             +NCI     QRS + C +  +KP DC    C
Sbjct  345   ENCIAGKEDQRSAKECSSDDAKPYDCRKSQC  375



>ref|XP_010473462.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Camelina sativa]
Length=734

 Score =   389 bits (998),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 239/336 (71%), Gaps = 5/336 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENP L  A+IALQ+WK  I +DP NFT +W G  VC+Y G++CAP+P  K  R V
Sbjct  48    PSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSK-TRVV  106

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+++G LP +LGLLTDLALFH+NSNRF G +P +F H++LLFELD+SNN   G
Sbjct  107   AGIDLNHADMAGYLPRELGLLTDLALFHLNSNRFCGEVPITFKHMKLLFELDLSNNRFVG  166

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLP LKFLD+RYN+F+G IP +++D +LDA+F+NHN F   +P N GNSPVS 
Sbjct  167   KFPNVVLSLPSLKFLDLRYNEFEGGIPAKLFDKELDAIFLNHNRFRFGIPENMGNSPVSA  226

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV A+N+L GC+P SI  M KTL+EIIL N +L  CLP +IG LK + VFD+SFN L G 
Sbjct  227   LVLADNDLGGCIPGSIGFMGKTLNEIILSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGP  286

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK--  568
             LP S+G +K LEQLNVA+N+ +G IP+SIC+L  L+NFTYS N+F      C  +     
Sbjct  287   LPSSIGNMKSLEQLNVANNRFTGVIPSSICQLSNLENFTYSSNFFTGDAPRCAALSGDDV  346

Query  567   --NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               N   NCI     QRS E C +  S+PVDCS  GC
Sbjct  347   AVNGSMNCIAGKERQRSSEECSSPASRPVDCSKFGC  382



>ref|XP_009415697.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   385 bits (989),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 239/341 (70%), Gaps = 3/341 (1%)
 Frame = -3

Query  1485  HQAYDDGPPVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAP  1306
             H  +D     FP  NP L +A+IA+QAWK  I +DP N T +W GP VCNYTGV+C+P P
Sbjct  42    HDGHDADDSAFP--NPHLRDAYIAIQAWKLAIISDPLNLTGNWVGPGVCNYTGVFCSPLP  99

Query  1305  DDKEIRTVAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELD  1126
              D  +  VAG+DLNH +++G LP  LGLL DL L HINSNRF GTLPRS   L LL ELD
Sbjct  100   SDPNLTVVAGVDLNHGDLAGYLPHQLGLLADLGLLHINSNRFCGTLPRSLRRLALLHELD  159

Query  1125  VSNNLLCGDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRN  946
             VSNN L G FP VVL LP L++LD+R+N+F+G +P E++D  LDA+F+NHN F   +P N
Sbjct  160   VSNNRLAGPFPDVVLRLPSLRYLDLRFNEFEGAVPPELFDRDLDAIFINHNLFAFDIPEN  219

Query  945   FGNSPVSVLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDV  766
              GNSPVSV+V ANN   GCLP ++  M +TL+EIILMN  L +C P EIGLL+ L V D+
Sbjct  220   LGNSPVSVVVLANNRFHGCLPATLGNMSRTLNEIILMNNGLSSCFPPEIGLLRSLTVLDI  279

Query  765   SFNNLVGSLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEIC  586
             SFN LVG LP S+  +  LEQL+VAHN LSG IPASIC LPRLKNFTYSYN+F   P  C
Sbjct  280   SFNKLVGPLPGSVAGMLSLEQLDVAHNLLSGGIPASICALPRLKNFTYSYNFFTGEPPQC  339

Query  585   RKVKHKNDKKNCIPYWPHQRSPETCKAFY-SKPVDCSVLGC  466
               V+  +D++NC+   P QRS   C++F    PVDCS  GC
Sbjct  340   LAVESFDDRRNCLADRPRQRSDRQCQSFLPHHPVDCSTFGC  380



>ref|XP_009417528.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Musa 
acuminata subsp. malaccensis]
Length=651

 Score =   386 bits (991),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/336 (55%), Positives = 239/336 (71%), Gaps = 4/336 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHV-ITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRT  1285
             P F F+N RL +A+IALQ WK   I +DP+N T +W GP VC+Y GVYCA +PDD  +  
Sbjct  52    PSFQFQNSRLRDAYIALQTWKRTAIFSDPQNLTGNWVGPEVCSYFGVYCAASPDDPYLTV  111

Query  1284  VAGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLC  1105
             VAGIDLNHA+++G LP +LGLLTDLALFH+NSNRF GT+P +F  LRLL+ELD+SNN   
Sbjct  112   VAGIDLNHADLAGYLPRELGLLTDLALFHLNSNRFCGTVPPTFRRLRLLYELDLSNNRFV  171

Query  1104  GDFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVS  925
             G FP VVL LP L++LD+R+N F+G IP  +++  LDA+F+N N     +P   G+SPVS
Sbjct  172   GKFPEVVLHLPALRYLDLRFNDFEGPIPPALFERPLDAIFLNSNRLRAGIPATLGHSPVS  231

Query  924   VLVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVG  745
             VLV ANN+L GC+P SI  M  TL+EIIL+N +L  C+P E+GLL+ + VFDVSFN L G
Sbjct  232   VLVLANNDLGGCIPSSIGGMANTLNEIILLNDNLTGCIPTEVGLLRRVTVFDVSFNRLQG  291

Query  744   SLPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK-  568
              LPES+  +  +EQL+VAHN+L+G IP  +C+LPRL+NFTYSYN+F   P  C +     
Sbjct  292   PLPESIAGMVSVEQLDVAHNRLTGRIPPGVCDLPRLQNFTYSYNFFTGQPPSCGRGGRSA  351

Query  567   --NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               + K NCIP  P QRSP+ C +  ++P DC    C
Sbjct  352   VFDGKANCIPGQPDQRSPKQCSSAVAQPFDCRKSKC  387



>ref|XP_010473463.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Camelina sativa]
Length=718

 Score =   388 bits (996),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/336 (57%), Positives = 239/336 (71%), Gaps = 5/336 (1%)
 Frame = -3

Query  1461  PVFPFENPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTV  1282
             P   FENP L  A+IALQ+WK  I +DP NFT +W G  VC+Y G++CAP+P  K  R V
Sbjct  48    PSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSK-TRVV  106

Query  1281  AGIDLNHANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCG  1102
             AGIDLNHA+++G LP +LGLLTDLALFH+NSNRF G +P +F H++LLFELD+SNN   G
Sbjct  107   AGIDLNHADMAGYLPRELGLLTDLALFHLNSNRFCGEVPITFKHMKLLFELDLSNNRFVG  166

Query  1101  DFPAVVLSLPKLKFLDIRYNQFQGKIPKEVYDLKLDALFVNHNNFTVTLPRNFGNSPVSV  922
              FP VVLSLP LKFLD+RYN+F+G IP +++D +LDA+F+NHN F   +P N GNSPVS 
Sbjct  167   KFPNVVLSLPSLKFLDLRYNEFEGGIPAKLFDKELDAIFLNHNRFRFGIPENMGNSPVSA  226

Query  921   LVFANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGS  742
             LV A+N+L GC+P SI  M KTL+EIIL N +L  CLP +IG LK + VFD+SFN L G 
Sbjct  227   LVLADNDLGGCIPGSIGFMGKTLNEIILSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGP  286

Query  741   LPESMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHK--  568
             LP S+G +K LEQLNVA+N+ +G IP+SIC+L  L+NFTYS N+F      C  +     
Sbjct  287   LPSSIGNMKSLEQLNVANNRFTGVIPSSICQLSNLENFTYSSNFFTGDAPRCAALSGDDV  346

Query  567   --NDKKNCIPYWPHQRSPETCKAFYSKPVDCSVLGC  466
               N   NCI     QRS E C +  S+PVDCS  GC
Sbjct  347   AVNGSMNCIAGKERQRSSEECSSPASRPVDCSKFGC  382



>ref|XP_003562088.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brachypodium 
distachyon]
 ref|XP_010232311.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brachypodium 
distachyon]
Length=385

 Score =   376 bits (965),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 189/330 (57%), Positives = 236/330 (72%), Gaps = 4/330 (1%)
 Frame = -3

Query  1443  NPRLYNAFIALQAWKHVITADPKNFTKDWYGPYVCNYTGVYCAPAPDDKEIRTVAGIDLN  1264
             N RL  A++A QAWKH I  DPKN T DW GP+VCNYTGV+CAPAPDD  I TVAG+DLN
Sbjct  51    NERLEAAYVAFQAWKHAIVEDPKNLTVDWCGPFVCNYTGVFCAPAPDDPCILTVAGVDLN  110

Query  1263  HANISGTLPEDLGLLTDLALFHINSNRFTGTLPRSFSHLRLLFELDVSNNLLCGDFPAVV  1084
             H  ++G+L + LGLL D+A+ H+NSNRF GTLP S  H+RLL+ELDVSNNLL G FP+ +
Sbjct  111   HGRLAGSLTDHLGLLADVAVLHLNSNRFHGTLPASMQHMRLLYELDVSNNLLSGAFPSFL  170

Query  1083  LSLPKLKFLDIRYNQFQGKIPKEVY--DLKLDALFVNHNNFTVTL-PRNFGNSPVSVLVF  913
              SLP LK+LD+R+N F G++P  V+  +L LDALF N N F V+L   +  NS  SV+V 
Sbjct  171   TSLPSLKYLDLRFNDFDGQLPDAVFGRELSLDALFANDNRFNVSLVSGSLTNSTASVIVL  230

Query  912   ANNNLRGCLPPSIAKMRKTLSEIILMNVSLGACLPDEIGLLKELKVFDVSFNNLVGSLPE  733
             AN  L GCLPPSI  M  TL E+IL+N S+ +C+P EIG LK+LKV D+S N+L G LPE
Sbjct  231   ANTKLAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLKVLDLSRNDLAGELPE  290

Query  732   SMGKLKKLEQLNVAHNKLSGEIPASICELPRLKNFTYSYNYFCSAPEICRKVKHKNDKKN  553
             S+G ++ LE +NV +N LSG++P SIC LPRLKN T   NYFC  P  C  +  ++D+ N
Sbjct  291   SIGDMESLEVINVGYNLLSGQVPESICLLPRLKNLTLVGNYFCEEPVSCLHIPRRDDRMN  350

Query  552   CIPYWPHQRSPETCKAF-YSKPVDCSVLGC  466
             CIP WPHQR  E C AF +  PV C+  GC
Sbjct  351   CIPDWPHQRPHEECIAFEHRPPVHCAADGC  380



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4578576018408