BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3500_g1_i2 len=151 path=[1:0-73 2148:74-150]

Length=151
                                                                      Score     E

ref|XP_011085903.1|  PREDICTED: zinc finger BED domain-containing...  54.3    2e-07   
ref|XP_009804558.1|  PREDICTED: zinc finger BED domain-containing...  53.5    4e-07   
ref|XP_011082213.1|  PREDICTED: zinc finger BED domain-containing...  53.1    6e-07   
ref|XP_010326126.1|  PREDICTED: zinc finger BED domain-containing...  52.8    8e-07   
ref|XP_009804634.1|  PREDICTED: zinc finger BED domain-containing...  51.2    1e-06   
ref|XP_009790028.1|  PREDICTED: uncharacterized protein LOC104237553  51.6    1e-06   
ref|XP_009781566.1|  PREDICTED: zinc finger BED domain-containing...  52.0    1e-06   
ref|XP_010675028.1|  PREDICTED: zinc finger BED domain-containing...  53.1    3e-06   
ref|XP_010693749.1|  PREDICTED: zinc finger BED domain-containing...  53.1    3e-06   
ref|XP_009623209.1|  PREDICTED: zinc finger BED domain-containing...  52.0    4e-06   
ref|XP_009608079.1|  PREDICTED: zinc finger BED domain-containing...  51.2    4e-06   
ref|XP_008657379.1|  PREDICTED: uncharacterized protein LOC103636840  51.6    4e-06   
gb|EPS65408.1|  hypothetical protein M569_09369                       51.6    4e-06   
ref|XP_009608078.1|  PREDICTED: zinc finger BED domain-containing...  50.8    5e-06   
ref|XP_009766487.1|  PREDICTED: zinc finger BED domain-containing...  49.7    7e-06   
ref|XP_010314163.1|  PREDICTED: zinc finger BED domain-containing...  50.1    7e-06   
ref|XP_010314161.1|  PREDICTED: zinc finger BED domain-containing...  50.4    1e-05   
ref|XP_009766998.1|  PREDICTED: zinc finger BED domain-containing...  50.4    1e-05   
ref|XP_009780212.1|  PREDICTED: zinc finger BED domain-containing...  50.8    1e-05   
ref|XP_009780905.1|  PREDICTED: uncharacterized protein LOC104229878  49.7    2e-05   
ref|XP_009770558.1|  PREDICTED: zinc finger BED domain-containing...  48.9    2e-05   
ref|XP_009785735.1|  PREDICTED: zinc finger BED domain-containing...  47.8    3e-05   
ref|XP_009769155.1|  PREDICTED: zinc finger BED domain-containing...  47.0    3e-05   
ref|XP_009791353.1|  PREDICTED: zinc finger BED domain-containing...  49.3    4e-05   
ref|XP_009769521.1|  PREDICTED: zinc finger BED domain-containing...  49.3    4e-05   
ref|XP_009595615.1|  PREDICTED: uncharacterized protein LOC104091871  46.6    5e-05   
gb|EAZ01015.1|  hypothetical protein OsI_23049                        48.5    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010319895.1|  PREDICTED: zinc finger BED domain-containing...  48.9    5e-05   
ref|XP_011070561.1|  PREDICTED: uncharacterized protein LOC105156187  48.9    6e-05   
ref|XP_009773687.1|  PREDICTED: zinc finger BED domain-containing...  48.9    6e-05   
ref|XP_009765425.1|  PREDICTED: zinc finger BED domain-containing...  48.9    6e-05   
ref|XP_009757222.1|  PREDICTED: zinc finger BED domain-containing...  47.8    7e-05   
ref|XP_011081417.1|  PREDICTED: zinc finger BED domain-containing...  47.8    7e-05   
ref|XP_009800908.1|  PREDICTED: uncharacterized protein LOC104246726  45.8    8e-05   
ref|XP_009775656.1|  PREDICTED: zinc finger BED domain-containing...  48.5    8e-05   
ref|XP_009590167.1|  PREDICTED: zinc finger BED domain-containing...  48.1    8e-05   
ref|XP_009774458.1|  PREDICTED: zinc finger BED domain-containing...  48.1    9e-05   
ref|XP_010268748.1|  PREDICTED: zinc finger BED domain-containing...  47.8    1e-04   
ref|XP_009771238.1|  PREDICTED: zinc finger BED domain-containing...  48.1    1e-04   
ref|XP_009775590.1|  PREDICTED: zinc finger BED domain-containing...  48.1    1e-04   
ref|XP_009596761.1|  PREDICTED: zinc finger BED domain-containing...  47.4    1e-04   
ref|XP_009777794.1|  PREDICTED: zinc finger BED domain-containing...  47.0    1e-04   
ref|XP_009767890.1|  PREDICTED: uncharacterized protein LOC104218960  47.8    1e-04   
ref|XP_009796184.1|  PREDICTED: zinc finger BED domain-containing...  47.8    2e-04   
ref|XP_009604433.1|  PREDICTED: zinc finger BED domain-containing...  47.4    2e-04   
ref|XP_009757221.1|  PREDICTED: zinc finger BED domain-containing...  46.6    2e-04   
ref|XP_009604434.1|  PREDICTED: zinc finger BED domain-containing...  47.0    2e-04   
ref|XP_009781949.1|  PREDICTED: zinc finger BED domain-containing...  47.4    2e-04   
ref|XP_009622105.1|  PREDICTED: zinc finger BED domain-containing...  46.6    2e-04   
ref|XP_010670292.1|  PREDICTED: zinc finger BED domain-containing...  45.8    3e-04   
ref|XP_009763136.1|  PREDICTED: zinc finger BED domain-containing...  45.8    3e-04   
ref|XP_010315628.1|  PREDICTED: zinc finger BED domain-containing...  46.2    3e-04   
ref|XP_009768907.1|  PREDICTED: zinc finger BED domain-containing...  46.6    3e-04   
ref|XP_009775322.1|  PREDICTED: zinc finger BED domain-containing...  46.2    3e-04   
ref|XP_010247653.1|  PREDICTED: zinc finger BED domain-containing...  45.4    4e-04   
ref|XP_009788201.1|  PREDICTED: zinc finger BED domain-containing...  45.1    5e-04   
ref|XP_009774751.1|  PREDICTED: zinc finger BED domain-containing...  46.2    5e-04   
ref|XP_009618720.1|  PREDICTED: zinc finger BED domain-containing...  45.8    5e-04   
ref|NP_001068267.2|  Os11g0613900                                     45.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009762657.1|  PREDICTED: zinc finger BED domain-containing...  45.4    8e-04   



>ref|XP_011085903.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=247

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            L+ +IV+A++CAQDW+R  ++PISIEE++ ++E  E+EL
Sbjct  197  LSSKIVQAIICAQDWIRKDSKPISIEEDLSEIEMFEQEL  235



>ref|XP_009804558.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=231

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSN--QPISIEENIEDVERIEKELC  31
            LTP++V+ALVC QDWLR  N  QPIS+EE+++ +E++E++L 
Sbjct  179  LTPKLVQALVCLQDWLRNENLKQPISVEEDLDKIEQLEQDLA  220



>ref|XP_011082213.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=236

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            L+P+IV+A++CAQDW+R  ++PISIEE++ ++E  E
Sbjct  201  LSPKIVQAIICAQDWIRKDSKPISIEEDLSEIEIFE  236



>ref|XP_010326126.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Solanum lycopersicum]
Length=234

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEK  40
            LTP++V+ALVC QDWLR   QPISIEE+++ +E++E+
Sbjct  190  LTPKLVQALVCLQDWLRSEPQPISIEEDLDFLEQLEE  226



>ref|XP_009804634.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
4-like [Nicotiana sylvestris]
Length=167

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEKELC  31
            LTP++V+ALVC QDWLR     QPISIEE+++ +E++E++L 
Sbjct  115  LTPKLVQALVCLQDWLRNEKLKQPISIEEDLDKIEQLEQDLA  156



>ref|XP_009790028.1| PREDICTED: uncharacterized protein LOC104237553 [Nicotiana sylvestris]
Length=192

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEKELCCT  25
            LTP++V+ALVC QDWLR     QPIS+EE+++ +E++E++L   
Sbjct  140  LTPKLVQALVCLQDWLRNEKLKQPISVEEDLDKIEQLEQDLASN  183



>ref|XP_009781566.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=232

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKELCCT  25
            LTPR+V+ALVC QDWLR  S  P+ IEE+++++E++E +L  T
Sbjct  181  LTPRLVQALVCVQDWLRNESTTPVKIEEDLDNLEQLEADLINT  223



>ref|XP_010675028.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=712

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            LTP+IVEALVC QDWLR S  P+ +EE +E++E++E ++
Sbjct  663  LTPKIVEALVCGQDWLRAS--PVDVEEKMEEIEKLESDI  699



>ref|XP_010693749.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=754

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            LTP+IVEALVC QDWLR S  P+ +EE +E++E++E ++
Sbjct  705  LTPKIVEALVCGQDWLRAS--PVDVEEKMEEIEKLESDI  741



>ref|XP_009623209.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=367

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEKEL  34
            LTP++V+ALVC QDWLR     QP+S+EE+I+ +E++E++L
Sbjct  315  LTPKLVQALVCLQDWLRNKKLKQPVSVEEDIDKIEQLEQDL  355



>ref|XP_009608079.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nicotiana tomentosiformis]
Length=256

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKELCCT  25
            LTPR+V+ALVC QDWLR  S  P+ IE+N++++E++E E+  T
Sbjct  205  LTPRLVQALVCIQDWLRNESTTPVKIEKNLDNLEQLELEMVNT  247



>ref|XP_008657379.1| PREDICTED: uncharacterized protein LOC103636840 [Zea mays]
Length=341

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            LTP ++EALVC QDWLR S  PI+I+ENIE++  IEKEL
Sbjct  275  LTPFMLEALVCTQDWLRRST-PINIQENIEELTIIEKEL  312



>gb|EPS65408.1| hypothetical protein M569_09369 [Genlisea aurea]
Length=333

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP++VEALVC QDWLR +++ I IEE I ++E+IE
Sbjct  279  LTPKMVEALVCTQDWLRKNHESICIEECITELEKIE  314



>ref|XP_009608078.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nicotiana tomentosiformis]
Length=266

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKE  37
            LTPR+V+ALVC QDWLR  S  P+ IE+N++++E++E E
Sbjct  205  LTPRLVQALVCIQDWLRNESTTPVKIEKNLDNLEQLELE  243



>ref|XP_009766487.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=209

 Score = 49.7 bits (117),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELC  31
            LTPR+V++LVC QDW R  + PI++EE++E +E+IE ++ 
Sbjct  152  LTPRLVQSLVCVQDWFRCDDTPINVEEDLEFLEQIELDMA  191



>ref|XP_010314163.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X2 [Solanum lycopersicum]
Length=231

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 7/47 (15%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE-------KELC  31
            LTPR V+ALVC QDWLR     ISIEE+++ +E++E       KELC
Sbjct  181  LTPRFVQALVCLQDWLRSEPLSISIEEDLDFLEQLEEDFAKLGKELC  227



>ref|XP_010314161.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Solanum lycopersicum]
 ref|XP_010314162.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Solanum lycopersicum]
Length=333

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 7/47 (15%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE-------KELC  31
            LTPR V+ALVC QDWLR     ISIEE+++ +E++E       KELC
Sbjct  283  LTPRFVQALVCLQDWLRSEPLSISIEEDLDFLEQLEEDFAKLGKELC  329



>ref|XP_009766998.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=461

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEK  40
            LTP++V+ALVC QDWLR     QPIS+EE+++ +E++E+
Sbjct  390  LTPKLVQALVCLQDWLRNEKLKQPISVEEDLDKIEQLEQ  428



>ref|XP_009780212.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=811

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKELCCT  25
            LTPR+V+ALVC QDWLR  S  P+ IEE+++++E++E +L  T
Sbjct  760  LTPRLVQALVCVQDWLRNESTTPVKIEEDLDNLEQLEADLINT  802



>ref|XP_009780905.1| PREDICTED: uncharacterized protein LOC104229878 [Nicotiana sylvestris]
Length=305

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRL-SNQPISIEENIEDVERIEKELCCT  25
            LTPR+V+ALVC QDWLR  S  PI IEE+++++E++E E   T
Sbjct  254  LTPRLVQALVCVQDWLRNESITPIKIEEDLDNLEQLEAEFMNT  296



>ref|XP_009770558.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=248

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKELCCT  25
            LTPR+V+ALVC QDWLR  S   I IEE+++++E++E E   T
Sbjct  197  LTPRLVQALVCVQDWLRNESTTSIKIEEDLDNLEQLEAEFMNT  239



>ref|XP_009785735.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=178

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGT  10
            LTP++V++L+C QDWLR    PI +EE++E +E++E +L  ++   T
Sbjct  128  LTPKLVQSLICLQDWLRNEPIPIKVEEDLEYLEQLELDLANSAKDST  174



>ref|XP_009769155.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=136

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRL-SNQPISIEENIEDVERIEKELCCTS  22
            LTPR+V+ALVC QDWLR  S   I IEE+++++E++E E   T 
Sbjct  85   LTPRLVQALVCVQDWLRNESTTSIKIEEDLDNLEQLEAEFMNTG  128



>ref|XP_009791353.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=533

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKEL  34
            LTPR+V+ALVC QDWLR  S  P+ IEE+++++E++E  L
Sbjct  469  LTPRLVQALVCVQDWLRNESTTPVKIEEDLDNLEQLEAVL  508



>ref|XP_009769521.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=487

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEKE  37
            LTP++V+ALVC QDWLR     QPIS+EE+++ +E++E++
Sbjct  421  LTPKLVQALVCLQDWLRNEKLKQPISVEEDLDKIEQLEQD  460



>ref|XP_009595615.1| PREDICTED: uncharacterized protein LOC104091871 [Nicotiana tomentosiformis]
Length=136

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEKELCC  28
            LTP++V+ALVC QDWLR     Q +S+EE+++ +E++E++L  
Sbjct  84   LTPKLVQALVCLQDWLRNKKLKQLVSVEEDLDKIEQLEQDLAS  126



>gb|EAZ01015.1| hypothetical protein OsI_23049 [Oryza sativa Indica Group]
Length=342

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            LTP +VE L+CA DWLR  N  IS+EEN +D+ ++E+EL
Sbjct  291  LTPTMVERLICANDWLRGCNS-ISVEENAKDLSKLEEEL  328



>ref|XP_010319895.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
4-like [Solanum lycopersicum]
Length=640

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEK  40
            LTP++V+ LVC QDW++  ++PIS+EE+I+ +E++E+
Sbjct  592  LTPKLVQTLVCLQDWIKSESRPISVEEDIDVLEQLEQ  628



>ref|XP_011070561.1| PREDICTED: uncharacterized protein LOC105156187 [Sesamum indicum]
Length=663

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVER  49
            L+P+IV+ L+C QDW+R  ++PISIEE++ ++E+
Sbjct  483  LSPKIVQTLICTQDWIRKDSKPISIEEDLSELEQ  516



>ref|XP_009773687.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=494

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGT  10
            LTP++V++L+C QDWLR    PI +EE++E +E++E +L  ++   T
Sbjct  444  LTPKLVQSLICLQDWLRSEPIPIKVEEDLEYLEQLELDLADSAKDST  490



>ref|XP_009765425.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=494

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGT  10
            LTP++V++L+C QDWLR    PI +EE++E +E++E +L  ++   T
Sbjct  444  LTPKLVQSLICLQDWLRSEPIPIKVEEDLEYLEQLELDLADSAKDST  490



>ref|XP_009757222.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009757224.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nicotiana sylvestris]
Length=238

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            LTP++VE L+C QDWLR    P+S+EE+++ +E++E++ 
Sbjct  188  LTPKLVEVLLCLQDWLRSEPLPVSVEEDLDVLEQLEQDF  226



>ref|XP_011081417.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=301

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEK  40
            L+P+IV+AL+C QDW+R  ++ I IEE++ ++E +EK
Sbjct  255  LSPKIVQALICTQDWIRKDSKSIRIEEDLSELEVVEK  291



>ref|XP_009800908.1| PREDICTED: uncharacterized protein LOC104246726 [Nicotiana sylvestris]
Length=119

 Score = 45.8 bits (107),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGT  10
            LTP+ V+ L+C QDW R    PIS+EE+++ +E +E ++    ST T
Sbjct  71   LTPKWVQTLICVQDWFREEKNPISVEEDLKYLEELELDMENNGSTTT  117



>ref|XP_009775656.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=765

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKEL  34
            LTP++V+ALVC QDWLR  S  P+ IEE+++++E++E  L
Sbjct  615  LTPKLVQALVCVQDWLRNESTTPVKIEEDLDNLEQLEAAL  654



>ref|XP_009590167.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
 ref|XP_009590169.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=417

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL--CCTSST  16
            LTP++V++L+C QDWLR    PI +EE++E +E+++ +L  C   ST
Sbjct  367  LTPKLVQSLICLQDWLRSEPIPIKVEEDLEYLEQLKLDLANCAKDST  413



>ref|XP_009774458.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=436

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGTGM  4
            LTP++VE LVC QDWLR  + P++IEE+++ ++ +E++    SS+   M
Sbjct  382  LTPKLVETLVCLQDWLRSESLPVNIEEDLDFLKTLEEDGVNGSSSAASM  430



>ref|XP_010268748.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
Length=367

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEK  40
            L+P++VEAL+C QDWLR    PI I E +++VE+ E+
Sbjct  308  LSPKMVEALICGQDWLRSKPIPIDIREAMDEVEKYEE  344



>ref|XP_009771238.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=522

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP+ V+AL+C QDWLR    PIS+EE+++ +E +E
Sbjct  417  LTPKCVQALICVQDWLREEKNPISVEEDLKYLEELE  452



>ref|XP_009775590.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like, partial [Nicotiana sylvestris]
Length=838

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLR-LSNQPISIEENIEDVERIEKEL  34
            LTPR+V+ALVC QDWLR  S  P+ I+E+++++E++E  L
Sbjct  740  LTPRLVQALVCVQDWLRNESTTPVKIKEDLDNLEQLEAAL  779



>ref|XP_009596761.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=304

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIE  43
            LTP++V+ALVC QDWLR     QP+S+EE+++ +E++E
Sbjct  267  LTPKLVQALVCLQDWLRNEKLKQPVSVEEDLDKIEQLE  304



>ref|XP_009777794.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like, 
partial [Nicotiana sylvestris]
Length=293

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP+ V+AL+C QDWLR    PIS+EE+++ +E +E
Sbjct  200  LTPKCVQALICVQDWLREEKNPISVEEDLKYLEELE  235



>ref|XP_009767890.1| PREDICTED: uncharacterized protein LOC104218960 [Nicotiana sylvestris]
Length=576

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP+ V+AL+C QDWLR    PI++EE+++ +E IE
Sbjct  477  LTPKCVQALICLQDWLREEKNPINVEEDLKYLEEIE  512



>ref|XP_009796184.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=980

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSST  16
            LTP+ V+AL+C QDWLR    PIS+EE+++ +E +E ++    ST
Sbjct  932  LTPKCVQALICVQDWLREEKNPISVEEDLKYLEELELDMENNGST  976



>ref|XP_009604433.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nicotiana tomentosiformis]
Length=485

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP++V++L+C QDWLR    PI +EE++E +E++E
Sbjct  413  LTPKLVQSLICLQDWLRSEPIPIKVEEDLEYLEQLE  448



>ref|XP_009757221.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nicotiana sylvestris]
Length=275

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEK  40
            LTP++VE L+C QDWLR    P+S+EE+++ +E++E+
Sbjct  188  LTPKLVEVLLCLQDWLRSEPLPVSVEEDLDVLEQLEQ  224



>ref|XP_009604434.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009604436.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nicotiana tomentosiformis]
Length=399

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP++V++L+C QDWLR    PI +EE++E +E++E
Sbjct  327  LTPKLVQSLICLQDWLRSEPIPIKVEEDLEYLEQLE  362



>ref|XP_009781949.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=1040

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  150   LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGT  10
             LTP++V++L+C QDWLR    PI +EE++E +E++E +L  ++   T
Sbjct  990   LTPKLVQSLICLQDWLRSEPIPIKVEEDLEYLEQLELDLADSAKDST  1036



>ref|XP_009622105.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=381

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP+ V+ LVC QDWLR    PIS+EE+ E +E +E
Sbjct  307  LTPKCVQTLVCVQDWLREEKNPISVEEDWEYLEELE  342



>ref|XP_010670292.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Beta vulgaris subsp. vulgaris]
Length=237

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 3/40 (8%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPI-SIEENIEDVERIEKEL  34
            LTPR+V+ LVC Q+W+R S  P  SIEE +E+VE++E++L
Sbjct  181  LTPRVVDGLVCVQNWMRAS--PFSSIEECLEEVEQLEEDL  218



>ref|XP_009763136.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=223

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGT  10
            LTP+ V+AL+C QDWLR     IS+EE+++ +E  E ++    ST T
Sbjct  175  LTPKCVQALICVQDWLREEKNSISVEEDLKYLEEFELDMENNGSTTT  221



>ref|XP_010315628.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Solanum lycopersicum]
Length=300

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCC  28
            LTP+IV++L+C QDWLR     I+IEE++E +E++E    C
Sbjct  206  LTPKIVQSLICVQDWLRSEYFSINIEEDLEYLEQLELVAAC  246



>ref|XP_009768907.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=466

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKELCCTSSTGTGM  4
            LTP++VE LVC QDWL+  + P+++EE++  +E +E++    SS+   M
Sbjct  412  LTPKLVETLVCLQDWLQSESLPVNVEEDLNFLEILEEDGLNGSSSAASM  460



>ref|XP_009775322.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=389

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIE  43
            LTP++V+ALVC QDWL+     QPIS+EE+++ +E++E
Sbjct  352  LTPKLVQALVCLQDWLQNEKLKQPISVEEDLDKIEQLE  389



>ref|XP_010247653.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=258

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            LT +I EAL+ AQDW+R S   I++EE+IE+++++E +L
Sbjct  191  LTYKIAEALLYAQDWIRSSQYAINVEEDIEELDKLENDL  229



>ref|XP_009788201.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=233

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP++V++L+C QDWLR    PI +EE++E +E++E
Sbjct  192  LTPKLVQSLICLQDWLRSEPIPIKVEEDLEYLEQLE  227



>ref|XP_009774751.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like, partial [Nicotiana sylvestris]
Length=453

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIE  43
            LTP+ V+AL+C QDWLR    PIS+EE ++ +E ++
Sbjct  417  LTPKCVQALICVQDWLREEKNPISVEEGLKYLEELD  452



>ref|XP_009618720.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=479

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEK  40
            LTP++V+ALVC QDWLR     Q +S+EE+++ +E++E+
Sbjct  382  LTPKLVQALVCLQDWLRNEKLKQSVSVEEDLDKIEQLEQ  420



>ref|NP_001068267.2| Os11g0613900 [Oryza sativa Japonica Group]
 gb|ABA94812.1| hAT family dimerisation domain containing protein [Oryza sativa 
Japonica Group]
 dbj|BAF28630.2| Os11g0613900 [Oryza sativa Japonica Group]
Length=709

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLSNQPISIEENIEDVERIEKEL  34
            LTP +VE L+CA DWLR  N  IS+EEN +D+ ++E+EL
Sbjct  658  LTPTMVERLICANDWLRGCNS-ISVEENAKDLSKLEEEL  695



>ref|XP_009762657.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=500

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = -2

Query  150  LTPRIVEALVCAQDWLRLS--NQPISIEENIEDVERIEK  40
            LTP++V+ALVC QDWLR     Q IS+EE+++ +E++E+
Sbjct  421  LTPKLVQALVCLQDWLRNEKLKQLISVEEDLDKIEQLEQ  459



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524054700018