BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34990_g1_i1 len=157 path=[1:0-156]

Length=157
                                                                      Score     E

ref|XP_009619683.1|  PREDICTED: LOB domain-containing protein 27-...  49.7    3e-05   
ref|XP_009352961.1|  PREDICTED: LOB domain-containing protein 30-...  45.1    0.001   



>ref|XP_009619683.1| PREDICTED: LOB domain-containing protein 27-like [Nicotiana tomentosiformis]
Length=400

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  156  SLLWEAKSWTEDPVHGPLRKFTRLEQELNALK  61
            S  WEA+ W EDPVHGPL ++ +LEQ+L  LK
Sbjct  117  SFFWEARLWQEDPVHGPLGEYKKLEQQLKELK  148



>ref|XP_009352961.1| PREDICTED: LOB domain-containing protein 30-like [Pyrus x bretschneideri]
Length=339

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  156  SLLWEAKSWTEDPVHGPLRKFTRLEQELNALKASVFQYQPAAMDAA  19
            S +WEA  W +DPV+GPL K+ +LE+E   L+ ++ + Q A+  AA
Sbjct  75   SFIWEAYMWNQDPVNGPLGKYRKLERENELLRNALNEEQNASALAA  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520930743318