BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34956_g1_i1 len=1048 path=[1026:0-1047]

Length=1048
                                                                      Score     E

ref|XP_009784818.1|  PREDICTED: dehydrodolichyl diphosphate synth...    312   1e-100   
ref|XP_011079168.1|  PREDICTED: dehydrodolichyl diphosphate synth...    309   4e-100   
gb|EYU30377.1|  hypothetical protein MIMGU_mgv1a026755mg                303   4e-98    
ref|XP_009784841.1|  PREDICTED: dehydrodolichyl diphosphate synth...    300   1e-96    
ref|XP_009597268.1|  PREDICTED: dehydrodolichyl diphosphate synth...    299   3e-96    
ref|XP_010531001.1|  PREDICTED: dehydrodolichyl diphosphate synth...    292   2e-93    
ref|XP_008235694.1|  PREDICTED: dehydrodolichyl diphosphate synth...    285   1e-90    
ref|XP_007200535.1|  hypothetical protein PRUPE_ppa009495mg             285   2e-90    
gb|KDP34987.1|  hypothetical protein JCGZ_09275                         284   2e-90    
ref|XP_002884068.1|  undecaprenyl pyrophosphate synthetase family...    284   5e-90    
gb|AGE89405.1|  cis-prenyltransferase CPT3                              283   6e-90    
ref|XP_010489390.1|  PREDICTED: dehydrodolichyl diphosphate synth...    281   5e-89    
ref|XP_010467536.1|  PREDICTED: dehydrodolichyl diphosphate synth...    280   1e-88    
ref|NP_565420.1|  cis-prenyltransferase 1                               280   1e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KDO73216.1|  hypothetical protein CISIN_1g038167mg                   279   2e-88    
ref|XP_007224278.1|  hypothetical protein PRUPE_ppa019993mg             278   4e-88    
ref|XP_010266352.1|  PREDICTED: dehydrodolichyl diphosphate synth...    280   4e-88    
gb|AAM19345.1|AF499435_1  hypothetical protein                          278   6e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CDY54367.1|  BnaC03g74550D                                          279   7e-88    
ref|XP_006298226.1|  hypothetical protein CARUB_v10014285mg             277   1e-87    
ref|XP_009344673.1|  PREDICTED: dehydrodolichyl diphosphate synth...    278   2e-87    
emb|CDY29180.1|  BnaA06g25770D                                          276   2e-87    
ref|XP_010514797.1|  PREDICTED: dehydrodolichyl diphosphate synth...    276   3e-87    
ref|XP_009150784.1|  PREDICTED: dehydrodolichyl diphosphate synth...    275   4e-87    
emb|CDY64459.1|  BnaCnng43920D                                          275   5e-87    
gb|AGE89403.1|  cis-prenyltransferase CPT1                              276   1e-86    
gb|AGE89404.1|  cis-prenyltransferase CPT2                              275   1e-86    
ref|XP_008337297.1|  PREDICTED: dehydrodolichyl diphosphate synth...    277   2e-86    
ref|XP_006409282.1|  hypothetical protein EUTSA_v10023082mg             273   4e-86    
ref|XP_004289930.1|  PREDICTED: dehydrodolichyl diphosphate synth...    273   9e-86    
gb|AIQ81190.1|  cis-prenyltransferase 3                                 273   1e-85    
gb|AIY22525.1|  cis-prenyltransferase                                   273   1e-85    
gb|AIQ81188.1|  cis-prenyltransferase 1                                 271   2e-85    
ref|XP_006855750.1|  hypothetical protein AMTR_s00044p00169460          271   8e-85    
ref|XP_008369161.1|  PREDICTED: dehydrodolichyl diphosphate synth...    269   1e-84    
ref|XP_008455158.1|  PREDICTED: dehydrodolichyl diphosphate synth...    269   3e-84    
ref|XP_004307838.1|  PREDICTED: dehydrodolichyl diphosphate synth...    268   4e-84    
gb|EPS71981.1|  hypothetical protein M569_02778                         267   8e-84    
ref|XP_008223909.1|  PREDICTED: LOW QUALITY PROTEIN: dehydrodolic...    270   9e-84    
ref|XP_004170399.1|  PREDICTED: LOW QUALITY PROTEIN: dehydrodolic...    267   1e-83    
ref|XP_006488125.1|  PREDICTED: dehydrodolichyl diphosphate synth...    266   2e-83    
ref|XP_009339468.1|  PREDICTED: dehydrodolichyl diphosphate synth...    266   2e-83    
dbj|BAB71776.1|  cis-prenyltransferase                                  266   2e-83    Hevea brasiliensis [jebe]
gb|AAM92881.1|  cis-prenyltransferase 2                                 266   3e-83    Hevea brasiliensis [jebe]
gb|AAM92880.1|  cis-prenyltransferase 1                                 265   5e-83    Hevea brasiliensis [jebe]
gb|AAX31281.1|  cis-prenyltransferase                                   265   8e-83    Hevea brasiliensis [jebe]
ref|XP_002263977.1|  PREDICTED: dehydrodolichyl diphosphate synth...    265   8e-83    Vitis vinifera
emb|CDP17924.1|  unnamed protein product                                265   1e-82    
dbj|BAB71777.1|  cis-prenyltransferase                                  265   1e-82    Hevea brasiliensis [jebe]
ref|XP_006424601.1|  hypothetical protein CICLE_v10030317mg             265   1e-82    
gb|KDP34988.1|  hypothetical protein JCGZ_09276                         262   2e-82    
dbj|BAB92023.1|  cis-prenyltransferase1                                 263   4e-82    Hevea brasiliensis [jebe]
gb|ABQ65716.1|  cis-prenyltransferase                                   263   4e-82    Hevea brasiliensis [jebe]
dbj|BAF98305.1|  cis-prenyl transferase                                 263   5e-82    Hevea brasiliensis [jebe]
ref|XP_010696123.1|  PREDICTED: dehydrodolichyl diphosphate synth...    262   6e-82    
emb|CDP21907.1|  unnamed protein product                                262   9e-82    
emb|CAN61413.1|  hypothetical protein VITISV_029565                     265   1e-81    Vitis vinifera
ref|XP_006443858.1|  hypothetical protein CICLE_v10023380mg             262   1e-81    
sp|Q8W3U4.1|HRT2_HEVBR  RecName: Full=Rubber cis-polyprenyltransf...    261   2e-81    Hevea brasiliensis [jebe]
emb|CBI37101.3|  unnamed protein product                                260   2e-81    
gb|AAR88763.1|  cis-prenyltransferase                                   261   2e-81    Hevea brasiliensis [jebe]
gb|EYU22482.1|  hypothetical protein MIMGU_mgv1a011616mg                260   3e-81    
ref|XP_008795438.1|  PREDICTED: dehydrodolichyl diphosphate synth...    261   3e-81    
dbj|BAF98304.1|  cis-prenyl transferase                                 260   5e-81    Hevea brasiliensis [jebe]
ref|XP_009610628.1|  PREDICTED: dehydrodolichyl diphosphate synth...    260   6e-81    
ref|XP_008807985.1|  PREDICTED: dehydrodolichyl diphosphate synth...    259   1e-80    
ref|XP_009788451.1|  PREDICTED: dehydrodolichyl diphosphate synth...    259   1e-80    
dbj|BAB92024.1|  cis-prenyltransferase2                                 259   1e-80    Hevea brasiliensis [jebe]
ref|XP_006353865.1|  PREDICTED: dehydrodolichyl diphosphate synth...    258   3e-80    
ref|XP_010317610.1|  PREDICTED: dehydrodolichyl diphosphate synth...    258   4e-80    
ref|XP_006852364.1|  hypothetical protein AMTR_s00049p00221660          256   3e-79    
ref|XP_010914203.1|  PREDICTED: dehydrodolichyl diphosphate synth...    253   4e-78    
gb|AGC94749.1|  dehydrodolichyl diphosphate synthase 6                  251   7e-78    
gb|AFU61137.2|  cis-prenyltransferase                                   247   4e-76    
dbj|BAC16756.1|  cis-prenyltransferase                                  249   4e-76    Periploca sepium
gb|AAM92882.1|  cis-prenyltransferase 3                                 248   5e-76    Hevea brasiliensis [jebe]
ref|XP_010679242.1|  PREDICTED: dehydrodolichyl diphosphate synth...    247   5e-76    
ref|XP_007043050.1|  Undecaprenyl pyrophosphate synthetase family...    246   3e-75    
gb|KGN43747.1|  hypothetical protein Csa_7G064570                       251   4e-75    
gb|AAK62455.1|AF387010_1  Unknown protein                               241   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578517.1|  PREDICTED: dehydrodolichyl diphosphate synth...    243   3e-74    
gb|ABK51403.1|  LLA-66                                                  243   4e-74    Lilium longiflorum [Easter lily]
ref|XP_010237112.1|  PREDICTED: dehydrodolichyl diphosphate synth...    243   4e-74    
ref|XP_011071080.1|  PREDICTED: dehydrodolichyl diphosphate synth...    242   9e-74    
ref|XP_010227989.1|  PREDICTED: dehydrodolichyl diphosphate synth...    241   1e-73    
ref|XP_003564260.1|  PREDICTED: dehydrodolichyl diphosphate synth...    241   1e-73    
ref|XP_009782358.1|  PREDICTED: dehydrodolichyl diphosphate synth...    239   3e-73    
ref|XP_006655828.1|  PREDICTED: dehydrodolichyl diphosphate synth...    240   5e-73    
ref|XP_008367932.1|  PREDICTED: dehydrodolichyl diphosphate synth...    241   6e-73    
ref|XP_009782357.1|  PREDICTED: dehydrodolichyl diphosphate synth...    238   1e-72    
ref|XP_004964740.1|  PREDICTED: dehydrodolichyl diphosphate synth...    239   1e-72    
ref|XP_010252332.1|  PREDICTED: dehydrodolichyl diphosphate synth...    239   2e-72    
gb|KCW53272.1|  hypothetical protein EUGRSUZ_J02531                     236   3e-72    
ref|NP_001056920.1|  Os06g0167400                                       238   3e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010907458.1|  PREDICTED: dehydrodolichyl diphosphate synth...    237   5e-72    
ref|XP_009397541.1|  PREDICTED: dehydrodolichyl diphosphate synth...    235   2e-71    
ref|XP_009397540.1|  PREDICTED: dehydrodolichyl diphosphate synth...    235   4e-71    
gb|EEC82421.1|  hypothetical protein OsI_26813                          234   7e-71    Oryza sativa Indica Group [Indian rice]
gb|ACG24253.1|  dehydrodolichyl diphosphate synthase 6                  233   2e-70    Zea mays [maize]
ref|XP_008807986.1|  PREDICTED: dehydrodolichyl diphosphate synth...    231   4e-70    
ref|NP_001131688.1|  uncharacterized protein LOC100193048               232   7e-70    Zea mays [maize]
ref|XP_009597269.1|  PREDICTED: dehydrodolichyl diphosphate synth...    229   7e-70    
ref|XP_009631075.1|  PREDICTED: dehydrodolichyl diphosphate synth...    231   9e-70    
ref|XP_003576597.1|  PREDICTED: dehydrodolichyl diphosphate synth...    231   1e-69    
ref|XP_007043051.1|  Dehydrodolichyl diphosphate synthase 6             232   1e-69    
gb|ACG35019.1|  dehydrodolichyl diphosphate synthase 6                  231   2e-69    Zea mays [maize]
ref|NP_001060237.1|  Os07g0607700                                       229   6e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010456500.1|  PREDICTED: dehydrodolichyl diphosphate synth...    228   7e-69    
ref|XP_006400842.1|  hypothetical protein EUTSA_v10014376mg             227   2e-68    
gb|ACN26437.1|  unknown                                                 231   2e-68    Zea mays [maize]
gb|EAZ40603.1|  hypothetical protein OsJ_25064                          229   2e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659229.1|  PREDICTED: dehydrodolichyl diphosphate synth...    232   5e-68    
ref|XP_009782359.1|  PREDICTED: dehydrodolichyl diphosphate synth...    224   1e-67    
ref|XP_004137059.1|  PREDICTED: dehydrodolichyl diphosphate synth...    226   1e-67    
ref|XP_010914205.1|  PREDICTED: dehydrodolichyl diphosphate synth...    224   2e-67    
gb|KFK27579.1|  hypothetical protein AALP_AA8G402200                    224   2e-67    
ref|XP_010443847.1|  PREDICTED: dehydrodolichyl diphosphate synth...    222   2e-66    
ref|XP_010483698.1|  PREDICTED: dehydrodolichyl diphosphate synth...    222   2e-66    
ref|XP_004962927.1|  PREDICTED: dehydrodolichyl diphosphate synth...    222   3e-66    
gb|KFK27580.1|  hypothetical protein AALP_AA8G402300                    221   4e-66    
gb|EPS62793.1|  cis-prenyltransferase                                   219   2e-65    
ref|XP_007043056.1|  Undecaprenyl pyrophosphate synthetase family...    219   4e-65    
dbj|BAB91250.1|  cis-prenyltransferase                                  216   6e-65    Hevea brasiliensis [jebe]
ref|XP_006279833.1|  hypothetical protein CARUB_v10028181mg             218   8e-65    
ref|XP_010443850.1|  PREDICTED: dehydrodolichyl diphosphate synth...    216   6e-64    
ref|XP_007043052.1|  Dehydrodolichyl diphosphate synthase 6             218   1e-63    
ref|XP_006281674.1|  hypothetical protein CARUB_v10027814mg             214   2e-63    
gb|AAM65193.1|  undecaprenyl diphosphate synthase                       214   3e-63    Arabidopsis thaliana [mouse-ear cress]
emb|CDX80166.1|  BnaC09g35760D                                          214   3e-63    
dbj|BAB08234.1|  undecaprenyl pyrophosphate synthetase-like protein     213   3e-63    Arabidopsis thaliana [mouse-ear cress]
emb|CDY31543.1|  BnaA10g13280D                                          214   3e-63    
ref|NP_200859.1|  cis-prenyltransferase 9                               213   4e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456508.1|  PREDICTED: dehydrodolichyl diphosphate synth...    212   1e-62    
ref|XP_010483699.1|  PREDICTED: dehydrodolichyl diphosphate synth...    212   2e-62    
ref|XP_002864688.1|  undecaprenyl pyrophosphate synthetase family...    212   2e-62    
ref|XP_009120581.1|  PREDICTED: dehydrodolichyl diphosphate synth...    210   7e-62    
ref|XP_009389291.1|  PREDICTED: dehydrodolichyl diphosphate synth...    209   2e-61    
ref|XP_009120583.1|  PREDICTED: dehydrodolichyl diphosphate synth...    207   1e-60    
emb|CDY31542.1|  BnaA10g13290D                                          207   1e-60    
ref|XP_010238237.1|  PREDICTED: dehydrodolichyl diphosphate synth...    205   3e-60    
ref|XP_006340955.1|  PREDICTED: LOW QUALITY PROTEIN: rubber cis-p...    204   8e-60    
ref|XP_008777175.1|  PREDICTED: dehydrodolichyl diphosphate synth...    202   1e-59    
ref|XP_006386229.1|  hypothetical protein POPTR_0002s04050g             203   2e-59    
dbj|BAB08233.1|  undecaprenyl pyrophosphate synthetase-like protein     201   2e-58    Arabidopsis thaliana [mouse-ear cress]
gb|EEC80087.1|  hypothetical protein OsI_21824                          202   2e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_010914206.1|  PREDICTED: dehydrodolichyl diphosphate synth...    199   2e-58    
ref|NP_200858.1|  dehydrodolichyl diphosphate synthase 7                201   2e-58    Arabidopsis thaliana [mouse-ear cress]
emb|CDX80162.1|  BnaC09g35800D                                          200   8e-58    
ref|XP_010103260.1|  Dehydrodolichyl diphosphate synthase 6             186   7e-52    
gb|ADE76815.1|  unknown                                                 185   1e-51    
ref|XP_004289931.1|  PREDICTED: dehydrodolichyl diphosphate synth...    182   2e-51    
ref|XP_002532224.1|  undecaprenyl diphosphate synthase, putative        184   1e-50    Ricinus communis
gb|KDP43760.1|  hypothetical protein JCGZ_22387                         183   1e-50    
ref|XP_002975000.1|  hypothetical protein SELMODRAFT_102749             182   2e-50    
ref|XP_008241952.1|  PREDICTED: rubber cis-polyprenyltransferase ...    182   3e-50    
ref|XP_007522612.1|  PREDICTED: dehydrodolichyl diphosphate synth...    182   3e-50    
ref|XP_007202102.1|  hypothetical protein PRUPE_ppa007586mg             182   4e-50    
emb|CDP18561.1|  unnamed protein product                                177   6e-50    
ref|XP_011022162.1|  PREDICTED: dehydrodolichyl diphosphate synth...    181   9e-50    
ref|XP_006924448.1|  PREDICTED: dehydrodolichyl diphosphate synthase    181   9e-50    
ref|NP_080420.2|  dehydrodolichyl diphosphate syntase complex sub...    180   1e-49    Mus musculus [mouse]
gb|EDL30040.1|  dehydrodolichyl diphosphate synthase, isoform CRA_a     180   1e-49    
ref|XP_011022157.1|  PREDICTED: dehydrodolichyl diphosphate synth...    181   2e-49    
ref|XP_008146265.1|  PREDICTED: dehydrodolichyl diphosphate synth...    179   2e-49    
ref|XP_008517718.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   3e-49    
ref|XP_005353142.1|  PREDICTED: dehydrodolichyl diphosphate synth...    179   3e-49    
gb|EPY77518.1|  dehydrodolichyl diphosphate synthase isoform 2          179   3e-49    
ref|XP_006159506.1|  PREDICTED: dehydrodolichyl diphosphate synth...    179   3e-49    
ref|NP_001231052.1|  dehydrodolichyl diphosphate synthase               179   4e-49    
ref|XP_003364481.1|  PREDICTED: dehydrodolichyl diphosphate synth...    179   4e-49    
ref|XP_007522611.1|  PREDICTED: dehydrodolichyl diphosphate synth...    179   5e-49    
ref|XP_004671262.1|  PREDICTED: dehydrodolichyl diphosphate synth...    179   5e-49    
ref|XP_002750512.2|  PREDICTED: dehydrodolichyl diphosphate synth...    178   5e-49    Callithrix jacchus [common marmoset]
ref|XP_004741156.1|  PREDICTED: non-histone chromosomal protein H...    178   6e-49    
ref|XP_006189546.1|  PREDICTED: dehydrodolichyl diphosphate synth...    178   7e-49    
ref|NP_001011978.1|  dehydrodolichyl diphosphate synthase               178   8e-49    Rattus norvegicus [brown rat]
ref|XP_006196879.1|  PREDICTED: dehydrodolichyl diphosphate synth...    178   8e-49    
ref|XP_010378712.1|  PREDICTED: dehydrodolichyl diphosphate synta...    178   8e-49    
ref|XP_006862321.1|  PREDICTED: dehydrodolichyl diphosphate synth...    178   9e-49    
dbj|BAC29643.1|  unnamed protein product                                178   9e-49    Mus musculus [mouse]
ref|XP_003271703.2|  PREDICTED: dehydrodolichyl diphosphate synth...    178   9e-49    
ref|XP_004425831.1|  PREDICTED: dehydrodolichyl diphosphate synth...    178   1e-48    
ref|XP_004592278.1|  PREDICTED: dehydrodolichyl diphosphate synth...    178   1e-48    
ref|XP_006102018.1|  PREDICTED: dehydrodolichyl diphosphate synthase    177   1e-48    
ref|XP_009449602.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   1e-48    
ref|XP_005079629.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   1e-48    
gb|ELK02098.1|  Dehydrodolichyl diphosphate synthase                    177   1e-48    
ref|XP_006975699.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   1e-48    
ref|XP_004678707.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   1e-48    
dbj|BAC28657.1|  unnamed protein product                                177   2e-48    Mus musculus [mouse]
ref|XP_007648553.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   2e-48    
gb|KDO71463.1|  hypothetical protein CISIN_1g017611mg                   178   2e-48    
ref|XP_005875214.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   2e-48    
ref|XP_004603526.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   2e-48    
ref|XP_006382994.1|  hypothetical protein POPTR_0005s10380g             178   2e-48    
ref|XP_006467074.1|  PREDICTED: dehydrodolichyl diphosphate synth...    178   2e-48    
ref|XP_006425294.1|  hypothetical protein CICLE_v10025904mg             178   2e-48    
ref|XP_007111387.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   2e-48    
ref|XP_004266689.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   2e-48    
ref|XP_007178720.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   3e-48    
ref|XP_004705138.1|  PREDICTED: dehydrodolichyl diphosphate synth...    177   3e-48    
gb|EDL30041.1|  dehydrodolichyl diphosphate synthase, isoform CRA_b     177   3e-48    
ref|XP_005004328.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   3e-48    
ref|XP_004377136.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   3e-48    
ref|XP_004642897.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   3e-48    
ref|XP_010343684.1|  PREDICTED: dehydrodolichyl diphosphate synta...    176   3e-48    
ref|XP_007459177.1|  PREDICTED: LOW QUALITY PROTEIN: dehydrodolic...    177   3e-48    
ref|XP_010593406.1|  PREDICTED: dehydrodolichyl diphosphate synta...    177   3e-48    
ref|XP_005203239.1|  PREDICTED: dehydrodolichyl diphosphate synta...    176   3e-48    
dbj|BAE90366.1|  unnamed protein product                                175   4e-48    
ref|XP_004478838.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   4e-48    
ref|XP_008146264.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   4e-48    
gb|EFB27183.1|  hypothetical protein PANDA_001151                       176   4e-48    Ailuropoda melanoleuca
ref|XP_008835042.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   4e-48    
gb|AAH03643.1|  Dehydrodolichyl diphosphate synthase                    176   4e-48    Homo sapiens [man]
ref|XP_002521712.1|  undecaprenyl diphosphate synthase, putative        177   4e-48    Ricinus communis
ref|NP_995583.1|  dehydrodolichyl diphosphate syntase complex sub...    176   4e-48    Homo sapiens [man]
ref|XP_006055514.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   4e-48    
ref|XP_004671263.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   5e-48    
ref|XP_002913352.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   5e-48    
ref|XP_007933962.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   6e-48    
ref|XP_005079628.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   6e-48    
ref|XP_005607366.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   7e-48    
ref|XP_006189547.1|  PREDICTED: dehydrodolichyl diphosphate synth...    176   8e-48    
ref|XP_008998948.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   8e-48    
ref|XP_004881152.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   9e-48    
ref|XP_004741155.1|  PREDICTED: non-histone chromosomal protein H...    175   9e-48    
ref|XP_004603527.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   9e-48    
ref|XP_007046514.1|  Undecaprenyl pyrophosphate synthetase family...    176   1e-47    
ref|XP_010992037.1|  PREDICTED: dehydrodolichyl diphosphate synta...    175   1e-47    
ref|XP_007043053.1|  Undecaprenyl pyrophosphate synthetase family...    171   1e-47    
ref|XP_006196878.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   1e-47    
ref|XP_006239076.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   1e-47    
ref|XP_010378711.1|  PREDICTED: dehydrodolichyl diphosphate synta...    175   1e-47    
ref|XP_006862322.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   1e-47    
gb|AFK37712.1|  unknown                                                 171   1e-47    
ref|XP_001109252.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   1e-47    Macaca mulatta [rhesus macaque]
ref|XP_004592279.1|  PREDICTED: dehydrodolichyl diphosphate synth...    175   1e-47    
ref|XP_008693072.1|  PREDICTED: dehydrodolichyl diphosphate synthase    174   1e-47    
ref|XP_854980.2|  PREDICTED: dehydrodolichyl diphosphate synthase...    174   2e-47    Canis lupus familiaris [dogs]
ref|XP_513233.2|  PREDICTED: dehydrodolichyl diphosphate synthase...    174   2e-47    Pan troglodytes
ref|XP_004678708.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   2e-47    
ref|XP_006975698.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   2e-47    
ref|XP_005848062.1|  hypothetical protein CHLNCDRAFT_10741              172   2e-47    
ref|XP_007625406.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   2e-47    
ref|XP_002716147.1|  PREDICTED: dehydrodolichyl diphosphate synthase    174   3e-47    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008517713.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   3e-47    
ref|XP_008517711.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   3e-47    
ref|XP_005676872.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   3e-47    
ref|XP_010631415.1|  PREDICTED: dehydrodolichyl diphosphate synta...    174   3e-47    
ref|XP_008071234.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   3e-47    
ref|XP_001507272.2|  PREDICTED: dehydrodolichyl diphosphate synthase    172   3e-47    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_005317699.1|  PREDICTED: dehydrodolichyl diphosphate synthase    174   3e-47    
ref|XP_007111385.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   3e-47    
ref|XP_001657391.1|  dehydrodolichyl diphosphate synthase (dedol-...    173   3e-47    Aedes aegypti
ref|XP_005875213.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   4e-47    
dbj|BAB14439.1|  unnamed protein product                                174   4e-47    Homo sapiens [man]
ref|XP_004394760.1|  PREDICTED: dehydrodolichyl diphosphate synthase    174   4e-47    
ref|XP_005961358.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   4e-47    
ref|XP_007178717.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   4e-47    
ref|XP_004005140.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   4e-47    
ref|XP_003471352.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   4e-47    
ref|XP_003934858.1|  PREDICTED: dehydrodolichyl diphosphate synta...    173   5e-47    
ref|XP_005203237.1|  PREDICTED: dehydrodolichyl diphosphate synta...    173   5e-47    
ref|XP_003415461.2|  PREDICTED: dehydrodolichyl diphosphate synta...    174   5e-47    
ref|XP_002532223.1|  undecaprenyl diphosphate synthase, putative        174   5e-47    Ricinus communis
ref|XP_004642898.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   5e-47    
gb|KHN38874.1|  Dehydrodolichyl diphosphate synthase 6                  173   5e-47    
ref|XP_007178721.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   5e-47    
ref|XP_004705139.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   5e-47    
ref|XP_004478835.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   5e-47    
ref|XP_008835039.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   5e-47    
ref|XP_007111388.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   6e-47    
ref|XP_010593409.1|  PREDICTED: dehydrodolichyl diphosphate synta...    173   6e-47    
ref|XP_010029587.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   6e-47    
ref|NP_079163.2|  dehydrodolichyl diphosphate syntase complex sub...    173   6e-47    Homo sapiens [man]
ref|XP_006883546.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   7e-47    
ref|XP_010029584.1|  PREDICTED: dehydrodolichyl diphosphate synth...    174   7e-47    
ref|XP_006055513.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   7e-47    
ref|XP_004881153.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   7e-47    
ref|XP_007648552.1|  PREDICTED: dehydrodolichyl diphosphate synth...    173   7e-47    
ref|XP_010828406.1|  PREDICTED: dehydrodolichyl diphosphate synta...    173   7e-47    
gb|ELR56278.1|  Dehydrodolichyl diphosphate synthase                    173   8e-47    
ref|XP_006934489.1|  PREDICTED: dehydrodolichyl diphosphate synthase    173   8e-47    
ref|XP_007933961.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   9e-47    
ref|NP_001030423.1|  dehydrodolichyl diphosphate syntase complex ...    172   1e-46    
gb|EHB00778.1|  Dehydrodolichyl diphosphate synthase                    172   1e-46    
ref|XP_006587570.1|  PREDICTED: rubber cis-polyprenyltransferase ...    173   1e-46    
gb|AES62193.2|  undecaprenyl pyrophosphate synthase                     173   1e-46    
ref|XP_005895942.1|  PREDICTED: dehydrodolichyl diphosphate synthase    172   1e-46    
ref|XP_005676869.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   1e-46    
ref|XP_004881151.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   2e-46    
ref|XP_004509437.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   2e-46    
ref|XP_003548811.1|  PREDICTED: rubber cis-polyprenyltransferase ...    172   2e-46    
gb|ETN66137.1|  dehydrodolichyl diphosphate synthase (dedol-pp sy...    172   2e-46    
ref|XP_005617806.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   2e-46    
ref|XP_007078233.1|  PREDICTED: dehydrodolichyl diphosphate synthase    173   2e-46    
ref|XP_006883545.1|  PREDICTED: dehydrodolichyl diphosphate synth...    171   3e-46    
ref|XP_003227419.1|  PREDICTED: dehydrodolichyl diphosphate synthase    171   3e-46    
ref|XP_010134486.1|  PREDICTED: dehydrodolichyl diphosphate synth...    171   4e-46    
ref|XP_010631400.1|  PREDICTED: dehydrodolichyl diphosphate synta...    171   4e-46    
ref|XP_008071233.1|  PREDICTED: dehydrodolichyl diphosphate synth...    171   4e-46    
ref|XP_007863115.1|  Di-trans-poly-cis-decaprenylcistransferase         169   4e-46    
ref|XP_003629126.1|  Undecaprenyl pyrophosphate synthetase              171   5e-46    
ref|XP_003591942.1|  Undecaprenyl pyrophosphate synthetase              172   8e-46    
ref|XP_004509436.1|  PREDICTED: dehydrodolichyl diphosphate synth...    172   8e-46    
ref|XP_005394915.1|  PREDICTED: dehydrodolichyl diphosphate synth...    170   9e-46    
ref|XP_005058192.1|  PREDICTED: dehydrodolichyl diphosphate synth...    170   1e-45    
ref|XP_002734350.1|  PREDICTED: dehydrodolichyl diphosphate synth...    169   1e-45    
gb|KFB41404.1|  AGAP002026-PA-like protein                              169   1e-45    
gb|EMD38029.1|  hypothetical protein CERSUDRAFT_93552                   167   2e-45    
ref|XP_004206352.1|  PREDICTED: dehydrodolichyl diphosphate synth...    169   3e-45    
gb|EFX71721.1|  hypothetical protein DAPPUDRAFT_189103                  166   5e-45    
emb|CDR42398.1|  CYFA0S09e02718g1_1                                     167   5e-45    
ref|XP_010300914.1|  PREDICTED: dehydrodolichyl diphosphate synta...    168   6e-45    
ref|XP_001355345.1|  GA10557                                            166   1e-44    
ref|XP_005496209.1|  PREDICTED: dehydrodolichyl diphosphate synth...    167   1e-44    
ref|XP_002194939.1|  PREDICTED: dehydrodolichyl diphosphate synthase    167   1e-44    
ref|XP_009096865.1|  PREDICTED: dehydrodolichyl diphosphate synthase    167   1e-44    
ref|XP_008633260.1|  PREDICTED: dehydrodolichyl diphosphate synth...    167   1e-44    
gb|ACO12045.1|  Dehydrodolichyl diphosphate synthase                    165   1e-44    
ref|XP_005427144.1|  PREDICTED: dehydrodolichyl diphosphate synthase    167   2e-44    
ref|XP_321028.5|  AGAP002026-PA                                         167   2e-44    
ref|XP_008918787.1|  PREDICTED: dehydrodolichyl diphosphate synth...    167   2e-44    
ref|XP_007156234.1|  hypothetical protein PHAVU_003G269600g             167   2e-44    
ref|XP_004287734.1|  PREDICTED: dehydrodolichyl diphosphate synth...    167   2e-44    
ref|XP_002599080.1|  hypothetical protein BRAFLDRAFT_281462             166   3e-44    
ref|XP_002532221.1|  undecaprenyl diphosphate synthase, putative        166   3e-44    
ref|NP_001079475.1|  uncharacterized protein LOC379162                  166   4e-44    
ref|XP_007361307.1|  dehydrodolichyl diphosphate synthetase             163   5e-44    
gb|AGO12358.1|  AaceriAER003Cp                                          164   5e-44    
ref|XP_004518042.1|  PREDICTED: dehydrodolichyl diphosphate synth...    165   6e-44    
ref|XP_005529741.1|  PREDICTED: dehydrodolichyl diphosphate synthase    165   6e-44    
ref|XP_007438626.1|  PREDICTED: dehydrodolichyl diphosphate synthase    166   6e-44    
ref|XP_005991061.1|  PREDICTED: dehydrodolichyl diphosphate synth...    164   6e-44    
ref|NP_572425.1|  CG10778, isoform A                                    164   7e-44    
ref|XP_008918786.1|  PREDICTED: dehydrodolichyl diphosphate synth...    165   8e-44    
gb|AAH54312.1|  LOC398626 protein                                       165   9e-44    
ref|XP_011056807.1|  PREDICTED: dehydrodolichyl diphosphate synta...    164   9e-44    
ref|NP_001082651.1|  dehydrodolichyl diphosphate synthase               164   1e-43    
ref|XP_001978589.1|  GG17596                                            163   1e-43    
ref|XP_005991059.1|  PREDICTED: dehydrodolichyl diphosphate synth...    164   1e-43    
dbj|BAB91251.1|  cis-prenyltransferase                                  160   1e-43    
gb|ACO10812.1|  Dehydrodolichyl diphosphate synthase                    162   1e-43    
gb|ADD24194.1|  Dehydrodolichyl diphosphate synthase                    162   1e-43    
ref|XP_002044466.1|  GM11961                                            163   2e-43    
ref|NP_998352.1|  dehydrodolichyl diphosphate synthase                  164   2e-43    
ref|XP_003681214.1|  hypothetical protein TDEL_0D04190                  162   2e-43    
emb|CDF89103.1|  ZYBA0S03-09208g1_1                                     162   2e-43    
emb|CDH16187.1|  probable Dehydrodolichyl diphosphate synthase RER2     162   2e-43    
ref|NP_984863.1|  AER003Cp                                              162   3e-43    
ref|XP_002112470.1|  hypothetical protein TRIADDRAFT_56521              164   3e-43    
ref|XP_007491432.1|  PREDICTED: dehydrodolichyl diphosphate synth...    161   3e-43    
ref|XP_001836730.1|  dehydrodolichyl diphosphate synthetase             161   4e-43    
ref|XP_002120306.1|  PREDICTED: dehydrodolichyl diphosphate synth...    162   5e-43    
ref|XP_003765022.1|  PREDICTED: dehydrodolichyl diphosphate synthase    162   5e-43    
emb|CDQ58099.1|  unnamed protein product                                162   6e-43    
ref|XP_002101214.1|  GE17496                                            161   7e-43    
ref|XP_001363539.1|  PREDICTED: dehydrodolichyl diphosphate synth...    162   7e-43    
ref|XP_006631578.1|  PREDICTED: dehydrodolichyl diphosphate synth...    162   7e-43    
ref|XP_010082728.1|  PREDICTED: dehydrodolichyl diphosphate synth...    162   8e-43    
ref|XP_004287733.1|  PREDICTED: dehydrodolichyl diphosphate synth...    162   8e-43    
ref|XP_001836739.1|  undecaprenyl pyrophosphate synthetase              160   8e-43    
ref|XP_002494570.1|  ZYRO0A04598p                                       160   8e-43    
ref|XP_009941738.1|  PREDICTED: dehydrodolichyl diphosphate synth...    162   1e-42    
ref|XP_008321175.1|  PREDICTED: dehydrodolichyl diphosphate synth...    161   1e-42    
ref|XP_005806544.1|  PREDICTED: dehydrodolichyl diphosphate synth...    162   1e-42    
ref|XP_972722.1|  PREDICTED: dehydrodolichyl diphosphate synthase       160   1e-42    
ref|XP_003706678.1|  PREDICTED: dehydrodolichyl diphosphate synth...    160   1e-42    
ref|XP_008429294.1|  PREDICTED: dehydrodolichyl diphosphate synthase    161   1e-42    
gb|EFW46430.2|  dehydrodolichyl diphosphate synthase                    164   1e-42    
gb|EFN89604.1|  Dehydrodolichyl diphosphate synthase                    160   2e-42    
ref|XP_004078359.1|  PREDICTED: dehydrodolichyl diphosphate synth...    161   2e-42    
ref|XP_008321176.1|  PREDICTED: dehydrodolichyl diphosphate synth...    161   2e-42    
ref|XP_004348226.1|  dehydrodolichyl diphosphate synthase               164   2e-42    
ref|XP_009048217.1|  hypothetical protein LOTGIDRAFT_225491             161   2e-42    
gb|EKC39111.1|  Dehydrodolichyl diphosphate synthase                    161   2e-42    
gb|KFH64476.1|  hypothetical protein MVEG_09210                         162   2e-42    
ref|XP_010166626.1|  PREDICTED: dehydrodolichyl diphosphate synth...    160   2e-42    
ref|XP_009507537.1|  PREDICTED: dehydrodolichyl diphosphate synth...    160   3e-42    
ref|XP_009572296.1|  PREDICTED: dehydrodolichyl diphosphate synth...    160   3e-42    
ref|XP_011102450.1|  rer2p                                              159   3e-42    
ref|NP_001152808.1|  dehydrodolichyl diphosphate synthase               160   3e-42    
ref|XP_003489875.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   3e-42    
ref|XP_005142758.1|  PREDICTED: dehydrodolichyl diphosphate synthase    160   3e-42    
ref|XP_010185672.1|  PREDICTED: dehydrodolichyl diphosphate synth...    160   4e-42    
ref|XP_007893112.1|  PREDICTED: dehydrodolichyl diphosphate synthase    160   4e-42    
ref|XP_009486488.1|  PREDICTED: dehydrodolichyl diphosphate synth...    160   4e-42    
ref|XP_001992481.1|  GH24772                                            159   4e-42    
ref|XP_002106417.1|  GD16139                                            159   5e-42    
ref|XP_010017928.1|  PREDICTED: dehydrodolichyl diphosphate synth...    160   5e-42    
gb|ACO15354.1|  Dehydrodolichyl diphosphate synthase                    159   5e-42    
gb|EFN87056.1|  Dehydrodolichyl diphosphate synthase                    159   5e-42    
ref|XP_007491433.1|  PREDICTED: dehydrodolichyl diphosphate synth...    158   5e-42    
ref|XP_002055664.1|  GJ19485                                            159   6e-42    
ref|XP_008036571.1|  Di-trans-poly-cis-decaprenylcistransferase         158   6e-42    
gb|KFZ50023.1|  Dehydrodolichyl diphosphate synthase                    159   8e-42    
ref|XP_005652221.1|  Di-trans-poly-cis-decaprenylcistransferase         157   8e-42    
gb|KDQ12894.1|  hypothetical protein BOTBODRAFT_176038                  157   8e-42    
ref|XP_010146924.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   9e-42    
emb|CEG79297.1|  Putative Di-trans,poly-cis-decaprenylcistransferase    157   9e-42    
ref|XP_009469049.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   9e-42    
ref|XP_009910993.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   9e-42    
ref|XP_009700494.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   9e-42    
ref|XP_005238323.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_009646775.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_009274484.1|  PREDICTED: dehydrodolichyl diphosphate synthase    159   1e-41    
ref|XP_009507536.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
gb|EOB00794.1|  Dehydrodolichyl diphosphate synthase                    159   1e-41    
ref|XP_445362.1|  hypothetical protein                                  157   1e-41    
ref|XP_009965302.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_004551084.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_009680687.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   1e-41    
ref|XP_007236311.1|  PREDICTED: dehydrodolichyl diphosphate synthase    159   1e-41    
ref|XP_010127509.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_006791776.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_005302086.1|  PREDICTED: dehydrodolichyl diphosphate synthase    159   1e-41    
ref|XP_010899354.1|  PREDICTED: dehydrodolichyl diphosphate synta...    159   1e-41    
ref|XP_009561752.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_005500721.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
ref|XP_009880488.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   1e-41    
gb|KFQ81965.1|  Dehydrodolichyl diphosphate synthase                    159   2e-41    
ref|XP_003676568.1|  hypothetical protein NCAS_0E01380                  157   2e-41    
ref|XP_005826203.1|  dehydrodolichyl diphosphate synthase               156   2e-41    
ref|XP_005020379.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   2e-41    
ref|XP_005455383.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   2e-41    
ref|XP_009680685.1|  PREDICTED: dehydrodolichyl diphosphate synth...    158   2e-41    
ref|XP_010017927.1|  PREDICTED: dehydrodolichyl diphosphate synth...    158   2e-41    
gb|KDR09151.1|  Dehydrodolichyl diphosphate synthase                    157   2e-41    
ref|XP_009808171.1|  PREDICTED: dehydrodolichyl diphosphate synth...    158   2e-41    
ref|XP_001606412.1|  PREDICTED: dehydrodolichyl diphosphate synthase    157   2e-41    
ref|XP_010213819.1|  PREDICTED: LOW QUALITY PROTEIN: dehydrodolic...    158   2e-41    
ref|NP_001107380.1|  dehydrodolichyl diphosphate synthase               158   2e-41    
gb|EGW10185.1|  Dehydrodolichyl diphosphate synthase                    157   3e-41    
ref|XP_010294880.1|  PREDICTED: dehydrodolichyl diphosphate synth...    158   3e-41    
ref|XP_007553890.1|  PREDICTED: dehydrodolichyl diphosphate synthase    158   3e-41    
ref|XP_010001974.1|  PREDICTED: dehydrodolichyl diphosphate synth...    158   3e-41    
gb|ELU03274.1|  hypothetical protein CAPTEDRAFT_181282                  158   3e-41    
ref|XP_003035731.1|  hypothetical protein SCHCODRAFT_81158              156   3e-41    
emb|CDH10334.1|  probable Dehydrodolichyl diphosphate synthase RER2     156   3e-41    
ref|XP_009873542.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   4e-41    
ref|XP_008293188.1|  PREDICTED: dehydrodolichyl diphosphate synthase    157   4e-41    
ref|NP_001155508.1|  dehydrodolichyl diphosphate synthase-like          156   4e-41    
ref|XP_417694.2|  PREDICTED: dehydrodolichyl diphosphate synthase...    157   4e-41    
ref|XP_009700493.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   4e-41    
ref|XP_008499770.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   4e-41    
ref|XP_010127508.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   5e-41    
ref|XP_009954976.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   5e-41    
ref|XP_005455382.1|  PREDICTED: dehydrodolichyl diphosphate synth...    158   5e-41    
ref|XP_009906763.1|  PREDICTED: dehydrodolichyl diphosphate synthase    157   5e-41    
gb|KDN36462.1|  Undecaprenyl diphosphate synthase                       158   6e-41    
ref|XP_006019314.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   6e-41    
ref|XP_005925586.1|  PREDICTED: dehydrodolichyl diphosphate synth...    159   6e-41    
ref|XP_003379731.1|  undecaprenyl diphosphate synthase                  155   7e-41    
ref|XP_005500722.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   7e-41    
ref|XP_009680686.1|  PREDICTED: dehydrodolichyl diphosphate synth...    155   8e-41    
ref|XP_005020380.1|  PREDICTED: dehydrodolichyl diphosphate synth...    157   9e-41    
ref|XP_001843572.1|  dehydrodolichyl diphosphate synthase               156   9e-41    
ref|XP_006270267.1|  PREDICTED: dehydrodolichyl diphosphate synthase    157   9e-41    
ref|XP_008939490.1|  PREDICTED: dehydrodolichyl diphosphate synthase    156   1e-40    
gb|KDQ61267.1|  hypothetical protein JAAARDRAFT_577209                  155   1e-40    
gb|KFQ30603.1|  Dehydrodolichyl diphosphate synthase                    156   1e-40    
ref|XP_005020383.1|  PREDICTED: dehydrodolichyl diphosphate synth...    154   1e-40    
ref|XP_010204571.1|  PREDICTED: dehydrodolichyl diphosphate synth...    156   1e-40    
ref|XP_002010213.1|  GI14820                                            155   1e-40    
ref|XP_009873534.1|  PREDICTED: dehydrodolichyl diphosphate synth...    156   1e-40    
ref|XP_001843571.1|  conserved hypothetical protein                     156   1e-40    
ref|XP_004340918.1|  dehydrodolichyl diphosphate synthase               156   2e-40    
ref|XP_003214211.1|  PREDICTED: dehydrodolichyl diphosphate synta...    156   2e-40    
ref|XP_008499769.1|  PREDICTED: dehydrodolichyl diphosphate synth...    156   2e-40    
gb|KDR69210.1|  hypothetical protein GALMADRAFT_230735                  154   2e-40    
emb|CAD21109.1|  probable cis-prenyltransferase                         154   2e-40    
gb|KDQ61268.1|  hypothetical protein JAAARDRAFT_191362                  154   2e-40    
emb|CDK29802.1|  unnamed protein product                                154   3e-40    
ref|XP_006139211.1|  PREDICTED: dehydrodolichyl diphosphate synth...    155   3e-40    
ref|XP_007064866.1|  PREDICTED: dehydrodolichyl diphosphate synth...    155   3e-40    
ref|XP_006677764.1|  hypothetical protein BATDEDRAFT_10818              154   3e-40    
ref|XP_004947721.1|  PREDICTED: dehydrodolichyl diphosphate synth...    154   3e-40    
gb|ACO08958.1|  Dehydrodolichyl diphosphate synthase                    155   4e-40    
ref|WP_009611041.1|  UDP pyrophosphate synthase                         152   4e-40    
ref|XP_003646878.1|  hypothetical protein Ecym_5299                     153   5e-40    
gb|KFM69409.1|  Dehydrodolichyl diphosphate synthase                    155   5e-40    
gb|KDQ31462.1|  hypothetical protein PLEOSDRAFT_1075531                 152   6e-40    
gb|EPS93837.1|  hypothetical protein FOMPIDRAFT_1135412                 153   6e-40    
ref|XP_001883502.1|  predicted protein                                  152   7e-40    
emb|CAK38787.1|  unnamed protein product                                153   7e-40    
ref|XP_003671174.2|  hypothetical protein NDAI_0G01550                  153   9e-40    
ref|XP_005188021.1|  PREDICTED: dehydrodolichyl diphosphate synth...    153   9e-40    
ref|XP_002067366.1|  GK16221                                            153   9e-40    
ref|XP_010736454.1|  PREDICTED: dehydrodolichyl diphosphate synta...    154   9e-40    
dbj|BAO41406.1|  dehydrodolichyl diphosphate synthetase                 152   1e-39    
ref|XP_007298341.1|  Di-trans-poly-cis-decaprenylcistransferase         152   1e-39    
ref|XP_005353144.1|  PREDICTED: dehydrodolichyl diphosphate synth...    152   2e-39    
ref|XP_007064867.1|  PREDICTED: dehydrodolichyl diphosphate synth...    153   2e-39    
ref|XP_004356055.1|  Dehydrodolichyl diphosphate synthase               154   2e-39    
ref|WP_024833905.1|  UDP pyrophosphate synthase [                       150   3e-39    
ref|XP_008544812.1|  PREDICTED: dehydrodolichyl diphosphate synthase    150   3e-39    
gb|AAM92879.1|  cis-prenyltransferase 12                                148   3e-39    
gb|ERL95139.1|  hypothetical protein D910_12408                         150   3e-39    
gb|ENN77807.1|  hypothetical protein YQE_05691                          150   4e-39    



>ref|XP_009784818.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
sylvestris]
 ref|XP_009784824.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
sylvestris]
 ref|XP_009784832.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
sylvestris]
Length=324

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 193/247 (78%), Gaps = 6/247 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRRY++K  I E  GYRA FLA++C++ YCYELGVKY TIYAF IDNFK
Sbjct  39   IPNHIAFILDGNRRYAKKWNIAEATGYRAGFLAVMCMLKYCYELGVKYTTIYAFGIDNFK  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+++LMDLML K+E L+K ++ ++EYGVR+HFVG+L LL+ R++ AA K M+AT  
Sbjct  99   RRPEEVQYLMDLMLEKIEGLIKQESIVNEYGVRVHFVGDLKLLNERVRVAAEKAMQATVN  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckek-kkLMNGTaaggaaaaaaEER-----VITVV  632
            N+N TLL+C+ YTST+EI+HA +  C EK K++    A         EE+     +I +V
Sbjct  159  NTNSTLLICVAYTSTDEILHAVQSSCLEKWKEIQELDANQAQNGEITEEKQELKHIIKLV  218

Query  633  DLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLK  812
            D+E+H +MGLAP+ D+L+RTSGETR SNFLLWQT+SCLLYSP  LFPEIGLRHLVWAVL 
Sbjct  219  DIERHTYMGLAPDPDVLIRTSGETRHSNFLLWQTTSCLLYSPKVLFPEIGLRHLVWAVLN  278

Query  813  FQRAHPY  833
            FQR +P+
Sbjct  279  FQRLYPH  285



>ref|XP_011079168.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Sesamum indicum]
 ref|XP_011079172.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Sesamum indicum]
 ref|XP_011079177.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Sesamum indicum]
 ref|XP_011079181.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Sesamum indicum]
Length=284

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 196/249 (79%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFILDGNRRY++K  + E +GYRA FL+L+ +I YCYELGVKYV+IYAFSIDNF+
Sbjct  33   VPNHLAFILDGNRRYAKKWNLGEGMGYRAGFLSLMSLIKYCYELGVKYVSIYAFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ +MDLML K+E LLK ++ +++YGVR++F+GNL LL   ++ AA + M+AT  
Sbjct  93   RRPEEVQCVMDLMLEKIEGLLKEESLVNQYGVRVYFIGNLKLLHEPVRLAAERAMKATSN  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE---ERVITVVDLE  641
            N+N  LL+C+ YTST+EIVHAA+E C++K      +A    +    E   + VI + D+E
Sbjct  153  NNNSILLICVAYTSTDEIVHAAQESCEDKWATTQSSANIKDSQDGEEKDTDDVIKLSDIE  212

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
             HM+M +AP+ DILVRTSGETRLSNFLLWQTS+CLLYSP AL+PEIGLRHLVW VL FQR
Sbjct  213  SHMYMRVAPDPDILVRTSGETRLSNFLLWQTSNCLLYSPKALWPEIGLRHLVWGVLNFQR  272

Query  822  AHPYLQKRR  848
            AHPYL++ R
Sbjct  273  AHPYLERGR  281



>gb|EYU30377.1| hypothetical protein MIMGU_mgv1a026755mg [Erythranthe guttata]
Length=257

 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 190/246 (77%), Gaps = 5/246 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRRY++K  + E +GYRA FL+L+ +  YC ELGVKYVTIYAFSIDNFK
Sbjct  14   IPNHIAFILDGNRRYAKKRNLNEGMGYRAGFLSLMTLCKYCCELGVKYVTIYAFSIDNFK  73

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++ +MDLML K++ +LK ++ + +YGVR++F+GNL LL+  ++ AA K MEAT  
Sbjct  74   RKPHEVDAVMDLMLEKIQGMLKEESIVSQYGVRVYFIGNLELLNEHVRQAAVKAMEATSN  133

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N    LL+C+ YTST+EIVHAA E C+ K+  +  +      A    E  + VVD+E+HM
Sbjct  134  NDKIVLLICVAYTSTDEIVHAARESCEAKRARVRSS-----GAREGNEEELKVVDIERHM  188

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +MG+AP+ DILVRTSGETRLSNFLLWQTS+C+LYSP AL+PEIGLRHLVWAVL +QR  P
Sbjct  189  YMGVAPDPDILVRTSGETRLSNFLLWQTSNCVLYSPRALWPEIGLRHLVWAVLNYQRVFP  248

Query  831  YLQKRR  848
             L++RR
Sbjct  249  LLERRR  254



>ref|XP_009784841.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
sylvestris]
 ref|XP_009784849.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
sylvestris]
Length=286

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 194/252 (77%), Gaps = 6/252 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFILDGNRRY++K  +  + GYRA F+A++ ++ YCY LGVKY+TIYAFSIDNFK
Sbjct  33   IPNHVAFILDGNRRYAKKRNMAVSNGYRAGFMAIMSMLKYCYVLGVKYMTIYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+++LMDLML K+E LL  ++ +++YGVR+HFVGNL LL   ++ AA K M+AT  
Sbjct  93   RRPEEVQYLMDLMLEKIEGLLHKESVVNQYGVRVHFVGNLKLLSEPVRVAAEKAMQATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckek----kkLMNGTaaggaaaaaaEE--RVITVV  632
            N+N TLL+C+ Y+ST+EIVHA +  C+EK    ++L              +E  ++I +V
Sbjct  153  NTNSTLLICVAYSSTDEIVHAVQSSCQEKWNEIQELNANQPQNVEVTKEIQELNQIIQLV  212

Query  633  DLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLK  812
            D+E+HM+M LA   D+L+RTSGETRLSNFLLWQT++CLLYSP  LFPEIGLRHL+WAVL 
Sbjct  213  DIERHMYMRLAHNPDMLIRTSGETRLSNFLLWQTTNCLLYSPKVLFPEIGLRHLIWAVLH  272

Query  813  FQRAHPYLQKRR  848
            FQR +P+L+KR+
Sbjct  273  FQRLYPHLEKRK  284



>ref|XP_009597268.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 191/251 (76%), Gaps = 6/251 (2%)
 Frame = +3

Query  114  PKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKR  293
            P H+AFILDGNRRY++K  +    GYRA F+A++ ++ YCY LGVKY+TIYAFSIDNFKR
Sbjct  34   PNHVAFILDGNRRYAKKRNMAVGNGYRAGFMAVMSMLKYCYVLGVKYMTIYAFSIDNFKR  93

Query  294  RPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKN  473
            RP+E+++LMDLML K+E LL  ++ +++YGVR+HFVGNL LL   ++ AA K M+AT  N
Sbjct  94   RPEEVQYLMDLMLEKIEGLLHKESVVNQYGVRVHFVGNLKLLTEPVRVAAEKAMQATADN  153

Query  474  SNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----NGTaaggaaaaaaE-ERVITVVD  635
            +N TLL+C+ Y+ST+EIVHA E  C+EK   +     N            E  ++I +VD
Sbjct  154  TNSTLLICVAYSSTDEIVHAVESSCQEKWNEIQELNANQPQNVEETKEIRELNQIIKLVD  213

Query  636  LEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKF  815
            +E+HM+M LAP+ D+L+RTSGETRLSNFLLWQT+SCLLYSP  LFPEIGLRHL+WAVL F
Sbjct  214  IERHMYMRLAPDPDMLIRTSGETRLSNFLLWQTTSCLLYSPKVLFPEIGLRHLIWAVLHF  273

Query  816  QRAHPYLQKRR  848
            QR  P+L+K++
Sbjct  274  QRLFPHLEKKK  284



>ref|XP_010531001.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Tarenaya hassleriana]
 ref|XP_010531002.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Tarenaya hassleriana]
Length=292

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 189/248 (76%), Gaps = 2/248 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K  + E  G++A F AL+ ++ YCYELG+KYVTIYAFSIDNFK
Sbjct  42   VPSHLAFIMDGNRRYAKKHGLAEGSGHKAGFSALMSILRYCYELGIKYVTIYAFSIDNFK  101

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ LMDLML K+E+LL+ ++ + EYG+R++F+GNL LL   ++AAA KVM+AT K
Sbjct  102  RRPEEVQSLMDLMLEKIESLLEKESIIQEYGMRVYFIGNLKLLSDPVRAAAEKVMKATAK  161

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE--ERVITVVDLEK  644
            NS   LLVC+ YTST+EIV+A E+ C  K   +    + G      E  +  I VVD+EK
Sbjct  162  NSRVVLLVCVAYTSTDEIVNAVEQSCLNKLDEIPARVSHGKLQGDMENHDHTIRVVDIEK  221

Query  645  HMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRA  824
            +M M + P+ DIL+R+SGETRLSNFLLWQTS C LYSP AL+PEIGL HLVWA+L FQR 
Sbjct  222  NMRMAVVPDPDILIRSSGETRLSNFLLWQTSHCPLYSPAALWPEIGLWHLVWAILNFQRN  281

Query  825  HPYLQKRR  848
            H YL+K++
Sbjct  282  HSYLEKKK  289



>ref|XP_008235694.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Prunus 
mume]
 ref|XP_008235695.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Prunus 
mume]
Length=290

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 183/255 (72%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K K+ E  G+R  FLAL+ ++ YCYELGV+YVTIYAFSIDNFK
Sbjct  33   IPHHIAFIMDGNRRYAKKRKLKEGDGHRVGFLALMSMLKYCYELGVRYVTIYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ LMDLM  K+E L+K ++ ++ YG+++HF+GNL LL   ++ AA + MEAT  
Sbjct  93   RDPEEVQSLMDLMREKIEGLIKEESIVNRYGIKVHFIGNLKLLSEPVRLAAERAMEATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMN------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTST+EIVHA   + E   ++  +MN      G    G       E ++
Sbjct  153  NSRGVLSICIAYTSTDEIVHAVQESCEEKSDEISVMNASGAGYGLLQLGGNEKEERENIV  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+EKHM+M +AP+ DIL+RTSGETRLSNFLLWQ++ C LYSP  L+PEIG RH  WA
Sbjct  213  KLTDIEKHMYMAVAPDPDILIRTSGETRLSNFLLWQSAHCCLYSPSVLWPEIGFRHFAWA  272

Query  804  VLKFQRAHPYLQKRR  848
            +L FQR++ YL ++R
Sbjct  273  ILSFQRSYFYLDRKR  287



>ref|XP_007200535.1| hypothetical protein PRUPE_ppa009495mg [Prunus persica]
 gb|EMJ01734.1| hypothetical protein PRUPE_ppa009495mg [Prunus persica]
Length=290

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 183/255 (72%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K K+ E  G+R  FLAL+ ++ YCYELGV+YVTIYAFSIDNFK
Sbjct  33   IPHHIAFIMDGNRRYAKKRKLKEGDGHRVGFLALMSMLKYCYELGVRYVTIYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ LMDLM  K+E L+K ++ ++ YG+++HF+GNL LL   ++ AA + MEAT  
Sbjct  93   RDPEEVKSLMDLMREKIEGLIKEESIVNRYGIKVHFIGNLKLLSEPVRLAAERAMEATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMN------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTST+EIVHA   + E   ++  +MN      G    G       E ++
Sbjct  153  NSRGVLSICIAYTSTDEIVHAVQESCEEKSDEISVMNASGAGYGLLQLGGNEKEERENIV  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+EKHM+M +AP+ DIL+RTSGETRLSNFLLWQ++ C LYSP  L+PEIG RH  WA
Sbjct  213  KLTDIEKHMYMAVAPDPDILIRTSGETRLSNFLLWQSAHCYLYSPSVLWPEIGFRHFTWA  272

Query  804  VLKFQRAHPYLQKRR  848
            +L FQR++ YL ++R
Sbjct  273  ILSFQRSYFYLDRKR  287



>gb|KDP34987.1| hypothetical protein JCGZ_09275 [Jatropha curcas]
Length=280

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 186/250 (74%), Gaps = 6/250 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRR+++K K+    G++A F AL+ ++ YCYELGVKYVT+YAFSIDNF+
Sbjct  30   IPSHLAFIMDGNRRFAKKEKLGPGAGHKAGFSALMLILKYCYELGVKYVTVYAFSIDNFR  89

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ +MDLML K+E +LK ++ +++YG+R++F+GNL+LL   ++ AA KVM+AT  
Sbjct  90   RRPEEVKIVMDLMLEKIEGILKEESVVNQYGIRVYFLGNLNLLTEPVRVAAQKVMKATAS  149

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGT----aaggaaaaaaEERVITVVDL  638
            N+   L +C+ YTS +EI+HA       K KL+  T         A    E+  I +VDL
Sbjct  150  NTKCLLFICVAYTSLDEIIHAV--HESCKDKLIKNTIFPDKPCTDAIEGEEKDSIKLVDL  207

Query  639  EKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQ  818
            EKHM+M L PE D+L+RTSGE+RLSNFLLWQTS C LYSP AL+PEIGL +LVWAVL FQ
Sbjct  208  EKHMYMALGPEPDVLIRTSGESRLSNFLLWQTSHCTLYSPDALWPEIGLWNLVWAVLNFQ  267

Query  819  RAHPYLQKRR  848
            R H YL+K++
Sbjct  268  RNHSYLEKKK  277



>ref|XP_002884068.1| undecaprenyl pyrophosphate synthetase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60327.1| undecaprenyl pyrophosphate synthetase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=296

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/255 (52%), Positives = 190/255 (75%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K  + +  G++A F AL+ ++ YCYELG+KYVTIYAFSIDNF+
Sbjct  39   IPSHLAFIMDGNRRYAKKHSLEDGSGHQAGFSALMSMLQYCYELGIKYVTIYAFSIDNFR  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+++LL+ ++ + +YG+R++F+GNL LL+ +++AAA KVM+AT K
Sbjct  99   RKPEEVQSLMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGT---------aaggaaaaaaEERVI  623
            NS   LL+C+ Y ST+EIV A ++ C      +  +         +         +E+ I
Sbjct  159  NSRVVLLICIAYNSTDEIVQAVKKSCINTSDNIEASGNYKHEDRDSDIEGTDMENQEKRI  218

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             +VD+E++M M +AP+ DILVR+SGETRLSNFLLWQT +  L+SP AL+PEIGL+HL+WA
Sbjct  219  QLVDIEENMRMSVAPDPDILVRSSGETRLSNFLLWQTGNTQLFSPAALWPEIGLKHLLWA  278

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR H YL+KR+
Sbjct  279  VLNFQRNHSYLEKRK  293



>gb|AGE89405.1| cis-prenyltransferase CPT3 [Taraxacum brevicorniculatum]
Length=301

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 187/250 (75%), Gaps = 4/250 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFILDGNRR++RK  + E  G++  FLAL+ V+ YCYE+GVKYVTIYAFS+DNF 
Sbjct  49   IPEHIAFILDGNRRFARKWNLTEGAGHKTGFLALMSVLKYCYEIGVKYVTIYAFSLDNFN  108

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++++MDLM  K+E  LK  + +++YGVR+ F+G+L  L   ++ AA K MEAT K
Sbjct  109  RRPDEVQYVMDLMQDKIEGFLKEVSIINQYGVRVLFIGDLDRLYEPVRIAAEKAMEATAK  168

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNG----TaaggaaaaaaEERVITVVDL  638
            NS   LLVC+ YTS++EI  A  E C+E  ++MNG      +G        + VI VVDL
Sbjct  169  NSTTYLLVCVAYTSSHEIPRAIHEACEESIRVMNGNGFFNGSGYTNVNHGSQAVIKVVDL  228

Query  639  EKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQ  818
            +KHM+MG+AP+ DILVR+SGETRLSNFLLWQT++CLLYSP AL+PE+G   +VW +L+FQ
Sbjct  229  DKHMYMGVAPDPDILVRSSGETRLSNFLLWQTTNCLLYSPKALWPEMGFWQVVWGILEFQ  288

Query  819  RAHPYLQKRR  848
              + YL+K++
Sbjct  289  NNYNYLEKKK  298



>ref|XP_010489390.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Camelina sativa]
Length=296

 Score =   281 bits (719),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K  + E  G++A F AL+ ++ YCYELG++YVTIYAFSIDNF+
Sbjct  39   IPNHLAFIMDGNRRYAKKCGLEEGSGHKAGFSALMLMLQYCYELGIQYVTIYAFSIDNFR  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+++LL+ ++ + +YG+R++F+GNL LL+ +++AAA KVM+AT K
Sbjct  99   RQPEEVQSLMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGT---------aaggaaaaaaEERVI  623
            NS   LL+C+ Y ST+EI+ A ++ C  K   +  +         +   A     +E+ I
Sbjct  159  NSRVVLLICIAYNSTDEILQAVKKSCINKLDNIEASGSCKHEDTDSDIEAKDMENQEKKI  218

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             +VD+E++M M +AP  DIL+R+SGETRLSNFLLWQT +  L SP AL+PEIGLRHLVWA
Sbjct  219  QLVDIEENMQMSVAPNPDILIRSSGETRLSNFLLWQTGNSQLCSPAALWPEIGLRHLVWA  278

Query  804  VLKFQRAHPYLQKRR  848
            +L FQR+H YL+KR+
Sbjct  279  ILNFQRSHSYLEKRK  293



>ref|XP_010467536.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Camelina 
sativa]
Length=294

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 190/253 (75%), Gaps = 7/253 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K  + E  G++A F AL+ ++ YCYELG+KYVTIYAFSIDNF+
Sbjct  39   IPNHLAFIMDGNRRYAKKCGLEEGSGHKAGFSALMLMLQYCYELGIKYVTIYAFSIDNFR  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+++LL+ ++ + +YG+R++F+GNL LL+ +++ AA +VM+AT K
Sbjct  99   RQPEEVQCLMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRDAAEEVMKATAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE-------ERVITV  629
            NS   LL+C+ Y ST+EI+ A ++ C  K   +  + +     +  E       E+ I +
Sbjct  159  NSRVVLLICIAYNSTDEILQAVKKSCINKLDNIEASGSYKHEDSDIEAKDMENQEKKIQL  218

Query  630  VDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVL  809
            VD+E++M M +AP  DIL+R+SGETRLSNFLLWQT +  L SP AL+PEIGLRHLVWA+L
Sbjct  219  VDIEENMQMSVAPNPDILIRSSGETRLSNFLLWQTGNSQLCSPAALWPEIGLRHLVWAIL  278

Query  810  KFQRAHPYLQKRR  848
             FQR+H YL+KR+
Sbjct  279  NFQRSHSYLEKRK  291



>ref|NP_565420.1| cis-prenyltransferase 1 [Arabidopsis thaliana]
 sp|Q8S2T1.2|DDPS6_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 6; Short=Dedol-PP 
synthase 6 [Arabidopsis thaliana]
 gb|AAD32914.2| expressed protein [Arabidopsis thaliana]
 gb|AAX55115.1| hypothetical protein At2g17570 [Arabidopsis thaliana]
 gb|AEC06654.1| cis-prenyltransferase 1 [Arabidopsis thaliana]
Length=295

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 189/254 (74%), Gaps = 8/254 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K  + +  G++A F AL+ ++ YCYELG+KYVTIYAFSIDNF+
Sbjct  39   IPCHIAFIMDGNRRYAKKCGLLDGSGHKAGFSALMSMLQYCYELGIKYVTIYAFSIDNFR  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E+E +MDLML K+++LL+ ++ + +YG+R++F+GNL LL+ +++AAA KVM+AT K
Sbjct  99   RKPEEVESVMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGT--------aaggaaaaaaEERVIT  626
            NS   LL+C+ Y ST+EIV A ++ C  K   +  +        +         +E+ I 
Sbjct  159  NSRVVLLICIAYNSTDEIVQAVKKSCINKSDNIEASNYKHEDSDSDIEGTDMENQEKKIQ  218

Query  627  VVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAV  806
            +VD+E++M M +AP  DIL+R+SGETRLSNFLLWQT +  L SP AL+PEIGLRHL+WA+
Sbjct  219  LVDIEENMQMSVAPNPDILIRSSGETRLSNFLLWQTGNTQLCSPAALWPEIGLRHLLWAI  278

Query  807  LKFQRAHPYLQKRR  848
            L FQR H YL+KR+
Sbjct  279  LNFQRNHSYLEKRK  292



>gb|KDO73216.1| hypothetical protein CISIN_1g038167mg [Citrus sinensis]
Length=292

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 178/257 (69%), Gaps = 11/257 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIP-ETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HIAFILDGNRR+++K  +  E  G+RA FL L+ ++ YC EL VKYV+IYAFSIDNF
Sbjct  33   IPNHIAFILDGNRRFAKKHNLAGEGAGHRAGFLTLMSLLKYCAELSVKYVSIYAFSIDNF  92

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR  +EI +LMDLML K+E LL+    L +YGVR+ F+GNL L+   I+  A KVM AT 
Sbjct  93   KRTQNEIRYLMDLMLEKMEFLLREDGFLSKYGVRVCFIGNLGLVSEPIRVTAEKVMRATS  152

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkL----------MNGTaaggaaaaaaEER  617
            KN+   +L+CL Y+ST EIVH  EE C   KK            N            E+ 
Sbjct  153  KNTRIVILICLAYSSTEEIVHTVEETCLVTKKTQPQAFKPRNPQNDVTEDADEHKNKEQN  212

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEKHM+MG+ P  DIL+RTSGE RLSNFLLWQ+S+C+LYSP AL+PEIGLRHL+
Sbjct  213  TIKLVDLEKHMYMGVYPNPDILIRTSGENRLSNFLLWQSSNCMLYSPAALWPEIGLRHLI  272

Query  798  WAVLKFQRAHPYLQKRR  848
            WA+L FQR H YL+K++
Sbjct  273  WAILNFQRHHAYLEKKK  289



>ref|XP_007224278.1| hypothetical protein PRUPE_ppa019993mg [Prunus persica]
 gb|EMJ25477.1| hypothetical protein PRUPE_ppa019993mg [Prunus persica]
Length=290

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 183/255 (72%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGN+RY++K K+ E  G+R  FLAL+ ++ +CYELGV+YVTIYAFSIDNFK
Sbjct  33   IPHHIAFIMDGNQRYAKKRKLKEGDGHRVGFLALMSMLKFCYELGVRYVTIYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ LMDL+  K+E L+K ++ ++ YG+++HF+GNL LL   ++ AA + MEAT  
Sbjct  93   RDPEEVQSLMDLIQEKIEGLIKEESIVNRYGIKVHFIGNLKLLSEPVRLAAERAMEATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMN------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTST+EIVHA   + E   ++  +MN      G    G +     E ++
Sbjct  153  NSRGVLSICIAYTSTDEIVHAVQESCEEKSDEISVMNASGAWYGLLQLGGSEKEERENIV  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+E HM+M +AP+ DIL+RTSGETRLSNFLLWQ++ C LYSP  L+PEIG RH  WA
Sbjct  213  KLTDIENHMYMAVAPDPDILIRTSGETRLSNFLLWQSAHCYLYSPSVLWPEIGFRHFAWA  272

Query  804  VLKFQRAHPYLQKRR  848
            +L FQR++ YL ++R
Sbjct  273  ILTFQRSYFYLDRKR  287



>ref|XP_010266352.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nelumbo 
nucifera]
Length=331

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 185/247 (75%), Gaps = 2/247 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRRY++K  + E  G+RA F+AL+ ++ YCYELGVKYVTIYAFSIDNF 
Sbjct  84   IPNHIAFILDGNRRYAKKHNLKEGDGHRAGFVALLSMLKYCYELGVKYVTIYAFSIDNFN  143

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++++M LM  K+E +LK ++ +  YGVR+HF+G+L LL   ++ AA K M  T  
Sbjct  144  RRPDEVQYIMGLMHEKIEGMLKEESFVRSYGVRVHFLGDLKLLHQSVRIAAEKAMRVTAN  203

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N+ F LL+C+ YTSTNE VH+  +C KEK++ M+            ++ +I +VDLE++M
Sbjct  204  NTKFVLLICVAYTSTNETVHSVHQCFKEKRRPMD--KFQEEEQQQQQQGLIKLVDLERNM  261

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M LAP+ DILVRTSGETRLSNFLLWQT+ C LYSP  L+PEI L +LVW+VL FQRA+P
Sbjct  262  YMALAPDPDILVRTSGETRLSNFLLWQTAFCYLYSPAKLWPEISLWNLVWSVLNFQRAYP  321

Query  831  YLQKRRI  851
            YL K ++
Sbjct  322  YLLKTKM  328



>gb|AAM19345.1|AF499435_1 hypothetical protein [Arabidopsis thaliana]
Length=295

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 188/254 (74%), Gaps = 8/254 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K  + +  G++A F AL+ ++ YCYELG+KYVTIYAFSIDNF+
Sbjct  39   IPCHIAFIMDGNRRYAKKCGLLDGSGHKAGFSALMSMLQYCYELGIKYVTIYAFSIDNFR  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E E +MDLML K+++LL+ ++ + +YG+R++F+GNL LL+ +++AAA KVM+AT K
Sbjct  99   RKPEEXESVMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGT--------aaggaaaaaaEERVIT  626
            NS   LL+C+ Y ST+EIV A ++ C  K   +  +        +         +E+ I 
Sbjct  159  NSRVVLLICIAYNSTDEIVQAVKKSCINKSDNIEASNYKHEDSDSDIEGTDMENQEKKIQ  218

Query  627  VVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAV  806
            +VD+E++M M +AP  DIL+R+SGETRLSNFLLWQT +  L SP AL+PEIGLRHL+WA+
Sbjct  219  LVDIEENMQMSVAPNPDILIRSSGETRLSNFLLWQTGNTQLCSPAALWPEIGLRHLLWAI  278

Query  807  LKFQRAHPYLQKRR  848
            L FQR H YL+KR+
Sbjct  279  LNFQRNHSYLEKRK  292



>emb|CDY54367.1| BnaC03g74550D [Brassica napus]
Length=330

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 183/246 (74%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K  + +  G++A F AL+ ++ YCYELG+KYVT+YAFSIDNF+
Sbjct  96   LPTHLAFIMDGNRRYAKKRGLEDGSGHKAGFSALMSMLQYCYELGIKYVTVYAFSIDNFR  155

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+++LL  ++ + EYG+R++F+GNL LL+ +++AAA +VM+AT K
Sbjct  156  RKPEEVQSLMDLMLEKIKSLLDKESIVHEYGIRVYFIGNLGLLNDQVRAAAEEVMKATAK  215

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   LLVC+ Y ST+EIV A                      A  +   I +VD+E++M
Sbjct  216  NSRVVLLVCVAYNSTDEIVQA--------------VKRSCVDKADRDVERIQLVDIEENM  261

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
             M +APE DIL+R+SGETRLSNFLLWQT +  L+SP AL+PEIGLRHLVWA+L FQR+H 
Sbjct  262  QMSVAPEPDILIRSSGETRLSNFLLWQTGNSQLFSPDALWPEIGLRHLVWAILNFQRSHS  321

Query  831  YLQKRR  848
            YL+K++
Sbjct  322  YLEKKK  327



>ref|XP_006298226.1| hypothetical protein CARUB_v10014285mg [Capsella rubella]
 gb|EOA31124.1| hypothetical protein CARUB_v10014285mg [Capsella rubella]
Length=296

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 186/255 (73%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K  + +  G++A F AL+ ++ YCYELG+KYVTIYAFSIDNF+
Sbjct  39   IPNHLAFIMDGNRRYAKKCGLEDGSGHKAGFSALMLMLQYCYELGIKYVTIYAFSIDNFR  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+ +LL+ ++ + +YG+R++F+GNL LL+ +++ AA KVM+AT K
Sbjct  99   RQPEEVQSLMDLMLEKINSLLEKESIVHQYGIRVYFIGNLALLNDQVRVAAEKVMKATAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGT---------aaggaaaaaaEERVI  623
            NS   LL+C+ Y ST+EIV A ++ C  K   +  +         +         +E  I
Sbjct  159  NSRVVLLICIAYNSTDEIVQAVKKSCINKSDNIKASGNYKHEDADSDVERKDMENQEERI  218

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             +VD+E++M M +AP  DIL+R+SGE RLSNFLLWQT +  L SP AL+PEIGLRHLVWA
Sbjct  219  QLVDIEENMQMSVAPNPDILIRSSGEARLSNFLLWQTGNSQLCSPAALWPEIGLRHLVWA  278

Query  804  VLKFQRAHPYLQKRR  848
            +L FQR+H YL+KR+
Sbjct  279  ILNFQRSHSYLEKRK  293



>ref|XP_009344673.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009344674.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Pyrus 
x bretschneideri]
Length=332

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 193/289 (67%), Gaps = 43/289 (15%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRRY+++  +P   G++A FL+L+ ++ YCYELGVKYVT+YAFSIDNFK
Sbjct  41   IPEHIAFIMDGNRRYAKRRNLPVGEGHKAGFLSLMSILRYCYELGVKYVTVYAFSIDNFK  100

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++ LMDL+  K+E LL+ ++ ++++G+R++F+GNL LL+  ++ AA K M+AT  
Sbjct  101  RRPDEVKTLMDLLQEKIEGLLEKESIVNQFGIRVYFIGNLKLLNESVRVAAEKAMKATAN  160

Query  471  NSNFTLLVCLVYTSTNEIVHAAeec----ckekkkLMNG----------------Taagg  590
            NS   LL+C+ YTS +EIVHA EE       E +  +NG                T+   
Sbjct  161  NSKAVLLICVAYTSCDEIVHAVEESCNVKKSEIRAQINGTKGGCNGGMDGEAGFDTSEAC  220

Query  591  aaaaaaEER-----------------------VITVVDLEKHMFMGLAPEVDILVRTSGE  701
                  EE+                       V+ VVD+EKH++M +AP+ DIL+RTSGE
Sbjct  221  NEKVEGEEKENTRVEHVEKDEGEFQESEKQLPVVKVVDVEKHLYMSVAPDPDILIRTSGE  280

Query  702  TRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            TRLSNFLLWQTS+C LYSP AL+P++G+ HLVW +L FQR H YL+K+R
Sbjct  281  TRLSNFLLWQTSNCPLYSPAALWPDLGMWHLVWVILNFQRNHYYLEKKR  329



>emb|CDY29180.1| BnaA06g25770D [Brassica napus]
Length=263

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 181/246 (74%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K  + +  G++A F  L+ ++ YCYELG+KYVTIYAFSIDNF+
Sbjct  29   LPTHLAFIMDGNRRYAKKRGLEDGSGHKAGFSTLMSMLQYCYELGIKYVTIYAFSIDNFR  88

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+++LL  ++ + EYG+R++F+GNL LL+ +++AAA +VM+AT K
Sbjct  89   RKPEEVQSLMDLMLEKIKSLLDKESIVHEYGIRVYFIGNLGLLNDQVRAAAEEVMKATAK  148

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   LLVC+ Y ST+EIV A                      A  +   I +VD+E++M
Sbjct  149  NSRVVLLVCVAYNSTDEIVQA--------------VKRSCVDKADRDTERIQLVDIEENM  194

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
             M +APE DIL+R+SGETRLSNFLLWQT +  L+S  AL+PEIGLRHLVWA+L FQR+H 
Sbjct  195  QMSVAPEPDILIRSSGETRLSNFLLWQTGNSQLFSLDALWPEIGLRHLVWAILNFQRSHS  254

Query  831  YLQKRR  848
            YL+KR+
Sbjct  255  YLEKRK  260



>ref|XP_010514797.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Camelina 
sativa]
Length=297

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 189/256 (74%), Gaps = 10/256 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K  + E  G++A F AL+ ++ YCYELG++YVTIYAFSIDNF+
Sbjct  39   IPNHLAFIMDGNRRYAKKCGLEEGSGHKAGFSALMLMLQYCYELGIQYVTIYAFSIDNFR  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+++LL+ ++ + +YG+R++F+GNL LL+ +++AAA KVM AT K
Sbjct  99   RQPEEVQSLMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRAAAEKVMNATAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkL---MNGTaaggaaaaaaE-------ERV  620
            NS   LL+C+ Y ST+EI+ A ++ C  K       +G+       +  E       E+ 
Sbjct  159  NSRVVLLICIAYNSTDEILQAVKKSCINKYTYNIEASGSYKHEDTDSEIEAKDIENQEKK  218

Query  621  ITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVW  800
            I +VD+E++M M +AP  DIL+R+SGETRLSNFLLWQT +  L  P AL+PEIGLRHLVW
Sbjct  219  IQLVDIEENMQMSVAPNPDILIRSSGETRLSNFLLWQTGNSQLCFPAALWPEIGLRHLVW  278

Query  801  AVLKFQRAHPYLQKRR  848
            A+L FQR+H YL+KR+
Sbjct  279  AILNFQRSHSYLEKRK  294



>ref|XP_009150784.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Brassica 
rapa]
Length=263

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 181/246 (74%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K  + +  G++A F  L+ ++ YCYELG+KYVTIYAFSIDNF+
Sbjct  29   LPTHLAFIMDGNRRYAKKRGLEDGSGHKAGFSTLMSMLQYCYELGIKYVTIYAFSIDNFR  88

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLML K+++LL  ++ + EYG+R++F+GNL LL+ +++AAA +VM+AT K
Sbjct  89   RKPEEVQSLMDLMLEKIKSLLDEESIVHEYGIRVYFIGNLGLLNDQVRAAAEEVMKATAK  148

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   LLVC+ Y ST+EIV A                      A  +   I +VD+E++M
Sbjct  149  NSRVVLLVCVAYNSTDEIVQA--------------VKRSCVDKADRDVERIQLVDIEENM  194

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
             M +APE DIL+R+SGETRLSNFLLWQT +  L+S  AL+PEIGLRHLVWA+L FQR+H 
Sbjct  195  QMSVAPEPDILIRSSGETRLSNFLLWQTGNSQLFSLDALWPEIGLRHLVWAILNFQRSHS  254

Query  831  YLQKRR  848
            YL+KR+
Sbjct  255  YLEKRK  260



>emb|CDY64459.1| BnaCnng43920D [Brassica napus]
Length=271

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 179/246 (73%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K  + +  G++A F AL+ ++ YCYELG+KYVT+YAFSIDNF+
Sbjct  36   LPIHLAFIMDGNRRYAKKQDLEDGSGHKAGFSALMSMLQYCYELGIKYVTVYAFSIDNFR  95

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E+  LMDLML K+++LL  ++ + EYG+R++F+GNL LL  +++AAA +VM+AT +
Sbjct  96   RKPEEVRSLMDLMLEKIKSLLDKESIVHEYGIRVYFIGNLALLSDQVRAAAEEVMQATAE  155

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   LLVC+ Y ST+EIV A                         +   I +VD+E++M
Sbjct  156  NSRVGLLVCVAYNSTDEIVQA--------------VKKSCVTKLDRDMETIQLVDIEENM  201

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
             M +AP+ DIL+R+SGETRLSNFLLWQT S  L+SP AL+PEIGLRHLVWA+L FQ++H 
Sbjct  202  QMSVAPDPDILIRSSGETRLSNFLLWQTGSSQLFSPDALWPEIGLRHLVWAILNFQKSHS  261

Query  831  YLQKRR  848
            Y +K++
Sbjct  262  YFEKKK  267



>gb|AGE89403.1| cis-prenyltransferase CPT1 [Taraxacum brevicorniculatum]
Length=308

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 183/257 (71%), Gaps = 11/257 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFILDGNRR++RK  + E  G++  FLAL+ V+ YCYE+GVKYVTIYAFS+DNF 
Sbjct  49   IPEHIAFILDGNRRFARKWNLTEGTGHKTGFLALMSVLKYCYEIGVKYVTIYAFSLDNFN  108

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++++MDLM  K+E  LK  + +++YGVR+ F+G+L  L   ++ AA K MEAT K
Sbjct  109  RRPDEVQYVMDLMQDKIEGFLKEVSIINQYGVRVLFIGDLDRLYEPVRIAAEKAMEATAK  168

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaagg-----------aaaaaaEER  617
            NS   LLVC+ YTS++EI  A  E C+EK   M  +                      + 
Sbjct  169  NSTTYLLVCVAYTSSHEIPRAIHEACEEKSGAMANSIRVMNGNGFFNGNGYTNVNHGSQA  228

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            VI VVDL+KHM+MG+AP+ DILVR+SGETRLSNFLLWQT++CLLYSP AL+PE+G   +V
Sbjct  229  VIKVVDLDKHMYMGVAPDPDILVRSSGETRLSNFLLWQTTNCLLYSPKALWPEMGFWQVV  288

Query  798  WAVLKFQRAHPYLQKRR  848
            W +L+FQ  + YL+K++
Sbjct  289  WGILEFQNNYNYLEKKK  305



>gb|AGE89404.1| cis-prenyltransferase CPT2 [Taraxacum brevicorniculatum]
Length=308

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 183/257 (71%), Gaps = 11/257 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFILDGNRR++RK  + E  G++  FLAL+ V+ YCYE+GVKYVTIYAFS+DNF 
Sbjct  49   IPEHIAFILDGNRRFARKWNLTEGAGHKTGFLALMSVLKYCYEIGVKYVTIYAFSLDNFN  108

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++++MDLM  K+E  LK  + +++YGVR+ F+G+L  L   ++ AA K MEAT K
Sbjct  109  RRPDEVQYVMDLMQDKIEGFLKEVSIINQYGVRVLFIGDLDRLYEPVRIAAEKAMEATAK  168

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaagg-----------aaaaaaEER  617
            NS   LLVC+ YTS++EI  A  E C+EK   M  +                      + 
Sbjct  169  NSTTYLLVCVAYTSSHEIPRAIHEACEEKDGAMANSIRDMKGKGVFNGDGYTNVNHGSQA  228

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            VI VVDL+KHM+MG+AP+ DILVR+SGETRLSNFLLWQT++CLLYSP AL+PE+G   +V
Sbjct  229  VIKVVDLDKHMYMGVAPDPDILVRSSGETRLSNFLLWQTTNCLLYSPKALWPEMGFWQVV  288

Query  798  WAVLKFQRAHPYLQKRR  848
            W +L+FQ  + YL+K++
Sbjct  289  WGILEFQNNYNYLEKKK  305



>ref|XP_008337297.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Malus 
domestica]
Length=362

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 191/289 (66%), Gaps = 43/289 (15%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRRY+++  +P   G++A FL+L+ ++ YCYELGVKYVT+YAFSIDNFK
Sbjct  71   IPEHIAFIMDGNRRYAKRRNLPVGEGHKAGFLSLMSILRYCYELGVKYVTVYAFSIDNFK  130

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++ LMDL+  K+E LL+ ++ ++++G+R++F+GNL LL+  ++ AA K M+AT  
Sbjct  131  RRPDEVKTLMDLLQEKIEGLLEKESIVNQFGIRVYFIGNLKLLNESVRVAAEKAMKATAN  190

Query  471  NSNFTLLVCLVYTSTNEIVHA----AeecckekkkLMNG----------------Taagg  590
            NS   LL+C+ YTS +EIVHA          E +  +NG                T+   
Sbjct  191  NSKAVLLICVAYTSCDEIVHAVEESCNMKKSEIRAQINGTKGGCNGGMDGEAGLDTSEAC  250

Query  591  aaaaaaEER-----------------------VITVVDLEKHMFMGLAPEVDILVRTSGE  701
                  EE+                       V+ VVD+EKH++M +AP+ DIL+RTSGE
Sbjct  251  NEKVEGEEKENARVKHVEKGEGEFLENEKQLPVVKVVDVEKHLYMSVAPDPDILIRTSGE  310

Query  702  TRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            TRLSNFLLWQTS+C LYSP AL+P++G+ HLVW +L FQR H YL+K+R
Sbjct  311  TRLSNFLLWQTSNCPLYSPAALWPDLGMWHLVWVILNFQRNHYYLEKKR  359



>ref|XP_006409282.1| hypothetical protein EUTSA_v10023082mg [Eutrema salsugineum]
 gb|ESQ50735.1| hypothetical protein EUTSA_v10023082mg [Eutrema salsugineum]
Length=274

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 184/246 (75%), Gaps = 13/246 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K+ +    G++A F AL+ ++ YCYELG+KYVTIYAFSIDNF 
Sbjct  39   LPIHLAFIMDGNRRYAKKLGLEVGSGHKAGFPALMSMLQYCYELGIKYVTIYAFSIDNFN  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+++LM+LML K+++LL+ ++   EYG+R++F+GNL LL  +++AAA +VM+ T K
Sbjct  99   RRPEEVQYLMELMLEKIKSLLEKESFAHEYGIRVYFIGNLALLSDQVRAAAEEVMKVTAK  158

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   LLVC+ Y ST+EI+ A       KK  MN             ER I +VD+E +M
Sbjct  159  NSKVVLLVCVAYNSTDEILQAV------KKSCMNKLGDRDV------ER-IQLVDIEGNM  205

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
             M +AP+ DIL+R+SGETRLSNFLLWQT +  L+SP AL+PEIGLRHLVWA+L FQR+H 
Sbjct  206  QMSVAPDPDILIRSSGETRLSNFLLWQTGNTQLFSPDALWPEIGLRHLVWAILNFQRSHS  265

Query  831  YLQKRR  848
            YL+K++
Sbjct  266  YLEKKK  271



>ref|XP_004289930.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=290

 Score =   273 bits (697),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 183/255 (72%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K K+ E  G+R  F+AL+ ++ YCYELGV+YVTIYAFSIDNFK
Sbjct  33   IPHHIAFIMDGNRRYAKKRKLMEGTGHRVGFVALMSMLKYCYELGVRYVTIYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLM  K+E L+K ++ ++ YGV++HF+GN+ LL   ++ AA + M AT  
Sbjct  93   RQPEEVQSLMDLMQEKIEGLIKEESIVNRYGVKVHFIGNIKLLSEPVRLAAERAMVATSN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMNGTaaggaaaaaaE------ERVI  623
            NS   L +C+ YTST+EI+HA   + E    +  ++N + AG       E      E ++
Sbjct  153  NSKGVLSICVAYTSTDEIMHAVQESCEEKWNEISVLNASGAGYDLDKFGENENEGRENIV  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+E+HM+M +AP+ DIL+RTSGETRLSNFLLWQ++ C LY+P  L+PEIG RH VWA
Sbjct  213  QLTDIERHMYMAVAPDPDILIRTSGETRLSNFLLWQSAYCCLYTPSVLWPEIGFRHFVWA  272

Query  804  VLKFQRAHPYLQKRR  848
            +L FQ    YL++++
Sbjct  273  ILNFQCNRLYLERKK  287



>gb|AIQ81190.1| cis-prenyltransferase 3 [Lactuca sativa]
Length=296

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 180/246 (73%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFILDGNRR+++K K+ E  G++A F AL+ V+ YCYE+GVKYVTIYAFS+DNF 
Sbjct  49   IPEHIAFILDGNRRFAKKWKLTEGAGHKAGFFALMAVLKYCYEIGVKYVTIYAFSLDNFN  108

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++++MDLM  K+E  L     +++YGVR+ F+G+L  L   ++ AA K MEAT K
Sbjct  109  RRPDEVQYVMDLMQEKIEGFLNELTLINQYGVRVLFIGDLDRLYEPVRIAAEKAMEATAK  168

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   LLVC+ YTS++EI  A  E C+EK +  N      +      + VI VVDLEKHM
Sbjct  169  NSRTYLLVCVAYTSSHEIPRAIHEACQEKSE-ANSIRVMNSDINHGGQSVIKVVDLEKHM  227

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +MG+AP+ DILVR+SGETRLSNFLLWQT++  LYSP AL+PE+G   +VW +L+FQ  + 
Sbjct  228  YMGVAPDPDILVRSSGETRLSNFLLWQTTNSFLYSPKALWPEMGFWQVVWGILEFQNNYQ  287

Query  831  YLQKRR  848
            Y +K++
Sbjct  288  YYEKKK  293



>gb|AIY22525.1| cis-prenyltransferase [Taraxacum kok-saghyz]
Length=308

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 182/257 (71%), Gaps = 11/257 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFILDGNRR++RK  + E  G++  FLAL+ V+ YCYE+GVKYVTIYAFS+DNF 
Sbjct  49   IPEHIAFILDGNRRFARKWNLTEGAGHKTGFLALMSVLKYCYEIGVKYVTIYAFSLDNFN  108

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++++MDLM  K+E  LK  + +++YGVR+ F+G+L  L   ++ AA K MEAT K
Sbjct  109  RRPDEVQYVMDLMQDKIEGFLKEVSIINQYGVRVLFIGDLDRLYEPVRIAAEKAMEATAK  168

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaagg-----------aaaaaaEER  617
            NS   LLVC+ YTS++ I  A  E C+EK   M  +                      + 
Sbjct  169  NSTTYLLVCVAYTSSHGIPRAIHEACEEKSGAMANSIRVMNGNGFFNGNGYTNVNHGSQA  228

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            VI VVDL+KHM+MG+AP+ DILVR+SGETRLSNFLLWQT++CLLYSP AL+PE+G   +V
Sbjct  229  VIKVVDLDKHMYMGVAPDPDILVRSSGETRLSNFLLWQTTNCLLYSPKALWPEMGFWQVV  288

Query  798  WAVLKFQRAHPYLQKRR  848
            W +L+FQ  + YL+K++
Sbjct  289  WGILEFQNNYNYLEKKK  305



>gb|AIQ81188.1| cis-prenyltransferase 1 [Lactuca sativa]
Length=269

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 174/246 (71%), Gaps = 12/246 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRYS++  + +  G+R  F +L+ ++ YCYELGVKYVTIYAFSI+NFK
Sbjct  30   IPNHIAFIMDGNRRYSKQHNLIQGAGHRLGFRSLMSMLKYCYELGVKYVTIYAFSIENFK  89

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R PDE++ LMDLM  K++ L+  ++ +++YGVR++F+GNL LL   ++ AA K MEAT K
Sbjct  90   RSPDEVQSLMDLMEEKIKGLINEESIVNQYGVRVYFIGNLKLLSKPVRLAAEKAMEATAK  149

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   LL+C+ YTST+EI HA               +         E+ +I V D+E+HM
Sbjct  150  NSRAVLLICIAYTSTDEIFHAVL------------ESCEEKRDKKGEKSMIDVTDIERHM  197

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +MG+ P+ DI++RTSGE+RLSNFLLWQ+ +CLLYSP  L+PEIG RHLV AVL FQ+   
Sbjct  198  YMGVTPDPDIIIRTSGESRLSNFLLWQSGNCLLYSPPVLWPEIGFRHLVQAVLDFQKHFC  257

Query  831  YLQKRR  848
            YL  ++
Sbjct  258  YLNNQK  263



>ref|XP_006855750.1| hypothetical protein AMTR_s00044p00169460 [Amborella trichopoda]
 gb|ERN17217.1| hypothetical protein AMTR_s00044p00169460 [Amborella trichopoda]
Length=313

 Score =   271 bits (692),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 183/251 (73%), Gaps = 2/251 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKH+A I+DGNRR++R   + E  G+R  F++L+  + YCYE+GV+YVTIYAFSIDNFK
Sbjct  63   IPKHVAVIMDGNRRFARNHHLKEGAGHRYGFVSLMSTLRYCYEMGVEYVTIYAFSIDNFK  122

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++++MDLM  KL +LLK ++ +++YGVR+ F+GNL L+ + ++  A + MEAT K
Sbjct  123  RRPDEVQYVMDLMHEKLSSLLKEESLVNQYGVRVTFIGNLKLMPAYVRETAERAMEATAK  182

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE--ERVITVVDLEK  644
            N    L +C+ YTST+EI  A  E C E++K ++G+         +     +ITV DLE+
Sbjct  183  NDKAVLSICVAYTSTDEITRAVRESCNERRKSVSGSKLIMKNGDKSNGANDLITVSDLER  242

Query  645  HMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRA  824
            HM+    PE+DIL+RTSGETRLSN+LLWQ+S   L+   AL+PE  LRH++WAVL++QRA
Sbjct  243  HMYTAGYPELDILIRTSGETRLSNYLLWQSSGSFLHISDALWPEFALRHVLWAVLEYQRA  302

Query  825  HPYLQKRRIMV  857
             PYL+K+R MV
Sbjct  303  QPYLEKKRKMV  313



>ref|XP_008369161.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Malus domestica]
 ref|XP_008369162.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Malus domestica]
 ref|XP_008369163.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Malus domestica]
Length=290

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 186/255 (73%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRRY++K K+ +  G+R  FLAL+ ++ YC+ELGV YVT+YAFSI+NFK
Sbjct  33   IPRHIAFIMDGNRRYAKKRKMMDGDGHRVGFLALMSMLKYCFELGVTYVTVYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ LMDLM  K+E L+K ++ +++YGVR+HF+GNL LL   +++AA + M AT  
Sbjct  93   RNPEEVQSLMDLMQEKIEGLIKEESIVNQYGVRVHFIGNLKLLSEPVRSAAERAMAATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMN------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTST+EIVHA   + E   ++   MN      G    G       E+++
Sbjct  153  NSRGVLSICIAYTSTDEIVHAVQESCEEKLDEISSMNAIKAGYGLTKLGGNEENEREKIV  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+EKHM+M +AP+ D+L+RTSGETRLSNFLLWQ++ C LYSP  L+PEIG RH+VWA
Sbjct  213  KLTDIEKHMYMAVAPDPDVLIRTSGETRLSNFLLWQSAFCYLYSPSVLWPEIGFRHVVWA  272

Query  804  VLKFQRAHPYLQKRR  848
            VLKFQ  + YL+++R
Sbjct  273  VLKFQSNYFYLERKR  287



>ref|XP_008455158.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Cucumis melo]
 ref|XP_008455160.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Cucumis melo]
 ref|XP_008455161.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Cucumis melo]
Length=293

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 180/253 (71%), Gaps = 7/253 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY+++ K+ E  G+R  +LAL  ++ YCYELGVKYVTIYAFSIDNFK
Sbjct  38   IPAHVAFIMDGNRRYAKRKKLAEGGGHRIGYLALTFMLKYCYELGVKYVTIYAFSIDNFK  97

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ +MDLML K+E L+K ++ +++YGVR+ F+GNL LL + ++ A  + ME T+ 
Sbjct  98   RSPEEVQGVMDLMLEKVELLIKEESLVNQYGVRLRFIGNLKLLSAPVRDAIERAMEVTRN  157

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN-------GTaaggaaaaaaEERVITV  629
            NS   L +C+ YTST+EIVHA E  C+EK   MN       G        A   +  IT+
Sbjct  158  NSKAELSICIAYTSTDEIVHAVERSCEEKWNEMNSKTSNGVGYGFSKLDVAKNGDNSITL  217

Query  630  VDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVL  809
             D+EKHM+  + P+ DIL+RTSGE RLSNFLLWQTSSC LYSP AL+PEI   + +WA+L
Sbjct  218  ADVEKHMYTAVTPDPDILIRTSGEARLSNFLLWQTSSCYLYSPSALWPEINFWYFLWAIL  277

Query  810  KFQRAHPYLQKRR  848
             FQR + +L K++
Sbjct  278  NFQRNNHHLVKKK  290



>ref|XP_004307838.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
1 [Fragaria vesca subsp. vesca]
 ref|XP_004307839.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=290

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 181/255 (71%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HI FI+DGNRRY++K K+ +  G+R  F+AL+ ++ YCYELGV+YVTIYAFSIDNFK
Sbjct  33   IPHHIVFIMDGNRRYAKKQKLMDGTGHRVGFVALMSMLKYCYELGVRYVTIYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLM  K+E L+K ++ ++ YGV++HF+GNL LL   ++ AA + M AT  
Sbjct  93   RQPEEVQSLMDLMHEKIEGLIKEESIVNRYGVKVHFIGNLKLLSEPVRLAAVRAMVATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMNGTaaggaaaaaaE------ERVI  623
            NS   L +C+ YTST+EIVHA   + E    +  ++N + AG       E      E V+
Sbjct  153  NSRGVLSICVAYTSTDEIVHAVQESCEEKWNEISILNASGAGYDLDKFGENENEERESVV  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+E+HM+M +A + DIL+RTSGETRLSNFLLWQ++ C LYSP  L+PEIG RH VWA
Sbjct  213  KLTDIERHMYMAVAHDPDILIRTSGETRLSNFLLWQSAYCCLYSPSVLWPEIGFRHFVWA  272

Query  804  VLKFQRAHPYLQKRR  848
            +L FQ    YL++++
Sbjct  273  ILNFQCNRLYLERKK  287



>gb|EPS71981.1| hypothetical protein M569_02778, partial [Genlisea aurea]
Length=271

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/245 (53%), Positives = 183/245 (75%), Gaps = 7/245 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIA I+DGNRRY++K  + E  G++A ++AL+ ++ YCYEL VKYVTIYAFSIDNFK
Sbjct  31   IPSHIALIMDGNRRYAKKQNLEEGSGHKAGYVALMNMLRYCYELEVKYVTIYAFSIDNFK  90

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++  M+L+  K+E L++ ++ ++ +GVR++FVG+L LL   ++ AA + M+AT  
Sbjct  91   RRPEEVQSTMELIQEKIEELIREESIVNHHGVRVYFVGDLELLSEPVRLAAQRAMKATAG  150

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   L +CL YTST+EIVHA +E C+EK   ++            E++ I +VD+EKHM
Sbjct  151  NSKAVLSICLAYTSTDEIVHAVQEACEEKMLDISNV-------YGCEKKFIELVDIEKHM  203

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M LAP+ DI++RTSGETRLSNFLLWQ+ S LLYSP AL+PEIG RHLV  +++FQ+ + 
Sbjct  204  YMALAPDPDIIIRTSGETRLSNFLLWQSGSSLLYSPNALWPEIGFRHLVQVIIEFQKKYA  263

Query  831  YLQKR  845
            YL+K+
Sbjct  264  YLEKK  268



>ref|XP_008223909.1| PREDICTED: LOW QUALITY PROTEIN: dehydrodolichyl diphosphate synthase 
6-like [Prunus mume]
Length=374

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 180/255 (71%), Gaps = 10/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K K+ E  G+R  FLAL+ ++ YCYELGV+YVTIYAFSIDNF+
Sbjct  118  IPHHIAFIMDGNRRYAKKRKLKEGDGHRVGFLALMSMLKYCYELGVRYVTIYAFSIDNFR  177

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ LMDL+  K+E L+K ++ ++ YG+++H +GNL LL   ++ AA + MEAT  
Sbjct  178  RDPEEVQSLMDLIQEKIEGLIKEESIVNRYGIKVH-LGNLKLLSEPVRLAAERAMEATAN  236

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMN------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTST+EIVHA   + E   ++  +MN      G    G       E ++
Sbjct  237  NSRGVLSICIAYTSTDEIVHAVQKSCEEKSDEISVMNASGAGYGQLQLGGDEKEGRENIV  296

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + ++EKHM+M + P+ DIL+RTSGETRLSNFLLWQ++ C LYSP  L+PEIG RH  WA
Sbjct  297  KLTNIEKHMYMVVTPDPDILIRTSGETRLSNFLLWQSARCYLYSPSVLWPEIGFRHFAWA  356

Query  804  VLKFQRAHPYLQKRR  848
            +L FQR + YL ++R
Sbjct  357  ILSFQRGYLYLDRKR  371



>ref|XP_004170399.1| PREDICTED: LOW QUALITY PROTEIN: dehydrodolichyl diphosphate synthase 
6-like [Cucumis sativus]
Length=293

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 180/253 (71%), Gaps = 7/253 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K  + E  G+R  +LAL  ++ YCYELGVKYVTIYAFSIDNF+
Sbjct  38   IPAHVAFIMDGNRRYAKKKXLAEGAGHRIGYLALTFMLKYCYELGVKYVTIYAFSIDNFR  97

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ +MDLML K+E L++ ++ +++YGVR+ F+GNL LL + ++ A  + MEAT+ 
Sbjct  98   RSPEEVQGVMDLMLEKVELLIREESLVNQYGVRLRFIGNLRLLSAPVRDAIERAMEATRN  157

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN-------GTaaggaaaaaaEERVITV  629
            N+   L +C+ YTST+EIVHA E  C+EK   MN       G   G    A   +  IT+
Sbjct  158  NNKAELSICIAYTSTDEIVHAVERSCEEKWNEMNSKTANGVGYGFGKLGVANNGDNSITL  217

Query  630  VDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVL  809
             D+EKHM+    P+ DIL+RTSGE RLSNFLLWQTSSC LYSP AL+PEI   + +WA+L
Sbjct  218  ADVEKHMYTAATPDPDILIRTSGEARLSNFLLWQTSSCYLYSPSALWPEINFWYFLWAIL  277

Query  810  KFQRAHPYLQKRR  848
             FQR + +L K+R
Sbjct  278  NFQRNNHHLVKKR  290



>ref|XP_006488125.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Citrus sinensis]
Length=267

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 175/247 (71%), Gaps = 16/247 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIP-ETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HIAFILDGNRR+++K  +  E  G+RA FL L+ ++ YC EL VKYV+IYAFSIDNF
Sbjct  33   IPNHIAFILDGNRRFAKKHNLAGEGAGHRAGFLTLMSLLKYCVELSVKYVSIYAFSIDNF  92

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR  +EI +LMDLML K+E LL+    L +YGVR+ F+GNL L+   I+ AA KVM AT 
Sbjct  93   KRTQNEIRYLMDLMLEKMELLLREDGFLSKYGVRVCFIGNLGLVSEPIRVAAEKVMRATS  152

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            KN+   +L+CL Y+ST EIVH               T          E+  I +VDLEKH
Sbjct  153  KNTRIVILICLAYSSTEEIVH---------------TVEETCLHKNKEKNTIKLVDLEKH  197

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+MG+ P+ DIL+RTSGE RLSNFLLWQ+S+C+LY+P AL+PEIGLRHL+WA+L FQR H
Sbjct  198  MYMGVYPDPDILIRTSGENRLSNFLLWQSSNCMLYAPEALWPEIGLRHLIWAILNFQRHH  257

Query  828  PYLQKRR  848
             YL+K++
Sbjct  258  AYLEKKK  264



>ref|XP_009339468.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009339469.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009339470.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Pyrus 
x bretschneideri]
Length=290

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 184/255 (72%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRR+++K K+ +  G+R  FLAL+ ++ YCYELGV YVT+YAFSIDNFK
Sbjct  33   IPRHIAFIMDGNRRFAKKRKMMDGDGHRVGFLALMSMLKYCYELGVTYVTVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ LMDLM  K+E L+K ++ +++YGVR+HF+GNL LL   +++AA + M AT  
Sbjct  93   RNPEEVQSLMDLMQEKIEGLIKEESIVNQYGVRVHFIGNLKLLSEPVRSAAERAMAATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMN----GTaaggaaaaaaEERV--I  623
            N    L +C+ YTST+EIVHA   + E   ++   MN    G           +ERV  +
Sbjct  153  NPRGVLSICIAYTSTDEIVHAVQESCEEKLDEISTMNASGAGYGLIKLGGNEEDERVKIV  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+EKHM+M +AP+ D+L+RTSGETRLSNFLLWQ++ C LYSP  L+PEIG RH VWA
Sbjct  213  KLTDIEKHMYMAVAPDPDVLIRTSGETRLSNFLLWQSAFCDLYSPSVLWPEIGFRHFVWA  272

Query  804  VLKFQRAHPYLQKRR  848
            VLKFQ  + YL+++R
Sbjct  273  VLKFQSNYFYLERKR  287



>dbj|BAB71776.1| cis-prenyltransferase [Hevea brasiliensis]
Length=290

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/257 (51%), Positives = 179/257 (70%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHIAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G+             
Sbjct  152  NSKCVLLIAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSGTVIQIENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPHALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            WAV+ FQR + YL+K +
Sbjct  270  WAVINFQRHYSYLEKHK  286



>gb|AAM92881.1| cis-prenyltransferase 2 [Hevea brasiliensis]
Length=290

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 180/257 (70%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHIAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G++            
Sbjct  152  NSKCVLLIAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSSTVIQTENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPYALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            W+V+ FQR + YL+K +
Sbjct  270  WSVINFQRHYSYLEKHK  286



>gb|AAM92880.1| cis-prenyltransferase 1 [Hevea brasiliensis]
 gb|AAM92889.1| cis-prenyltransferase 10 [Hevea brasiliensis]
 gb|AAM92890.1| cis-prenyltransferase 11 [Hevea brasiliensis]
Length=290

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 180/257 (70%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHIAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G++            
Sbjct  152  NSKCVLLIAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSSTVIQTENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPYALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            W+V+ FQR + YL+K +
Sbjct  270  WSVINFQRHYSYLEKHK  286



>gb|AAX31281.1| cis-prenyltransferase [Hevea brasiliensis]
Length=290

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 181/257 (70%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHLAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K++ ++K ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIDGMIKEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G++            
Sbjct  152  NSKCVLLLAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSSTVIQTENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPYALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            W+V+ FQR + YL+K +
Sbjct  270  WSVINFQRHYSYLEKHK  286



>ref|XP_002263977.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Vitis 
vinifera]
Length=290

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 178/255 (70%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRR+++K  + E  G++  +LAL+ ++ Y YELGVKYVTIYAFSI+NFK
Sbjct  33   IPNHIAFIMDGNRRFAKKQNLIEGAGHKVGYLALMSMLRYSYELGVKYVTIYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ +MDLM  K+E L+  ++ L+ +GVR+HF+GNL LL + ++ AA + M  T  
Sbjct  93   RRPEEVQSVMDLMQEKIEQLINEESILNHFGVRVHFIGNLKLLSAPVRLAAERAMLVTAC  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN---------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTSTNEI+HA EE C +K   +          G            + +I
Sbjct  153  NSKAVLSICVAYTSTNEIMHAVEESCVKKWDEIRELKASGVDCGLTKLEGYEKGEAQDLI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+EKH++M +AP+ DIL+RTSGETRLSNFLLWQ+  C LYSP  L+PEIG  HL+WA
Sbjct  213  NLTDIEKHLYMAVAPDPDILIRTSGETRLSNFLLWQSQYCYLYSPSVLWPEIGFWHLLWA  272

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR H YL+K++
Sbjct  273  VLNFQRNHFYLEKKK  287



>emb|CDP17924.1| unnamed protein product [Coffea canephora]
Length=290

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 179/254 (70%), Gaps = 9/254 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++K  + +  G+R+ +LAL+ ++ YCYELGVKYVTIYAFSIDNF+
Sbjct  33   VPDHIAFIMDGNRRYAKKRNLLDGAGHRSGYLALMNMLKYCYELGVKYVTIYAFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++  M L+L K+E L+K ++ +++YGVRI+F+G+L LL   ++ AA + M AT  
Sbjct  93   RRPEEVQSTMQLILEKIEDLIKEESMVNQYGVRIYFLGSLKLLSKPVRLAAERAMVATSG  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAee---------cckekkkLMNGTaaggaaaaaaEERVI  623
            NS   L +CL YTS++EI+HA +E            E K   NG            +  I
Sbjct  153  NSKSVLSICLAYTSSDEILHAVQECCEEKWDEGSALESKGAGNGLVFLKGNKNGKTKPSI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             V DLEKHM+  + P+ DI++RTSGETRLSNFLLWQ+++CLLY+P  L+PEIGL HLVWA
Sbjct  213  VVKDLEKHMYAAVTPDPDIIIRTSGETRLSNFLLWQSANCLLYAPAILWPEIGLWHLVWA  272

Query  804  VLKFQRAHPYLQKR  845
            VL FQR   YL+++
Sbjct  273  VLDFQRNFSYLKEK  286



>dbj|BAB71777.1| cis-prenyltransferase [Hevea brasiliensis]
Length=284

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 182/251 (73%), Gaps = 7/251 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHIAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHA----AeecckekkkLMNGTaaggaaaaaaEE-RVITVVD  635
            NS F LL+ + YTST+EIVHA    +++  K  +   +G           E    I +V+
Sbjct  152  NSKFVLLLAVCYTSTDEIVHAVEESSKDKLKSNEICNDGNGDCVIKIEEMEPYSEIKLVE  211

Query  636  LEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKF  815
            LE++ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+VW+V+ F
Sbjct  212  LERNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPHALWPEIGLRHVVWSVINF  269

Query  816  QRAHPYLQKRR  848
            QR + YL+K +
Sbjct  270  QRHYSYLEKHK  280



>ref|XP_006424601.1| hypothetical protein CICLE_v10030317mg [Citrus clementina]
 ref|XP_006488124.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Citrus sinensis]
 gb|ESR37841.1| hypothetical protein CICLE_v10030317mg [Citrus clementina]
Length=292

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 180/257 (70%), Gaps = 11/257 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIP-ETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HIAFILDGNRR+++K  +  E  G+RA FL L+ ++ YC EL VKYV+IYAFSIDNF
Sbjct  33   IPNHIAFILDGNRRFAKKHNLAGEGAGHRAGFLTLMSLLKYCVELSVKYVSIYAFSIDNF  92

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR  +EI +LMDLML K+E LL+    L +YGVR+ F+GNL L+   I+ AA KVM AT 
Sbjct  93   KRTQNEIRYLMDLMLEKMELLLREDGFLSKYGVRVCFIGNLGLVSEPIRVAAEKVMRATS  152

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkL----------MNGTaaggaaaaaaEER  617
            KN+   +L+CL Y+ST EIVH  EE C   KK            N            E+ 
Sbjct  153  KNTRIVILICLAYSSTEEIVHTVEETCLVTKKTQPQAFKPRNPQNDVTEDADEHKNKEKN  212

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEKHM+MG+ P+ DIL+RTSGE RLSNFLLWQ+S+C+LY+P AL+PEIGLRHL+
Sbjct  213  TIKLVDLEKHMYMGVYPDPDILIRTSGENRLSNFLLWQSSNCMLYAPEALWPEIGLRHLI  272

Query  798  WAVLKFQRAHPYLQKRR  848
            WA+L FQR H YL+K++
Sbjct  273  WAILNFQRHHAYLEKKK  289



>gb|KDP34988.1| hypothetical protein JCGZ_09276 [Jatropha curcas]
Length=247

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 174/244 (71%), Gaps = 6/244 (2%)
 Frame = +3

Query  135  LDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKRRPDEIEF  314
            +DGNRR+++K K     GYRA F AL+ +I YC ELGVKYVTIYAFSIDNF+R P+E++ 
Sbjct  1    MDGNRRFAKKQKQGVVTGYRAGFTALMSIIKYCSELGVKYVTIYAFSIDNFRREPEEVKI  60

Query  315  LMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFTLLV  494
            +MDLML K E +LK ++ + +YGVR++F+GNL LL   ++ AA KVM+AT  N+   L +
Sbjct  61   IMDLMLEKTEGILKEESVVHQYGVRVYFLGNLKLLCEPLRVAAEKVMKATASNTKLLLFI  120

Query  495  CLVYTSTNEIVHAAeecckekkkLM------NGTaaggaaaaaaEERVITVVDLEKHMFM  656
            C+ YTS +EI+HA  E C +K K +      +            E+  I +VD+EKHM+M
Sbjct  121  CVAYTSLDEIIHAVHESCNDKLKNIILPDKPHTDEIEVVVEEEEEKDGIKLVDIEKHMYM  180

Query  657  GLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYL  836
             L PE D+L+RTSGE+RLSNFLLWQTS C LYSP AL+PEIGL +LVWAVL FQR H YL
Sbjct  181  ALGPEPDVLIRTSGESRLSNFLLWQTSHCTLYSPDALWPEIGLWNLVWAVLNFQRNHSYL  240

Query  837  QKRR  848
            +K++
Sbjct  241  EKKK  244



>dbj|BAB92023.1| cis-prenyltransferase1 [Hevea brasiliensis]
 gb|AAM92883.1| cis-prenyltransferase 4 [Hevea brasiliensis]
 gb|AAM92884.1| cis-prenyltransferase 5 [Hevea brasiliensis]
 gb|AAM92885.1| cis-prenyltransferase 6 [Hevea brasiliensis]
 gb|AAM92887.1| cis-prenyltransferase 8 [Hevea brasiliensis]
 gb|AAM92888.1| cis-prenyltransferase 9 [Hevea brasiliensis]
Length=290

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 178/257 (69%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHIAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G+             
Sbjct  152  NSKCVLLIAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSGTVIQIENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPHALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            WAV+  QR + YL+K +
Sbjct  270  WAVINCQRHYSYLEKHK  286



>gb|ABQ65716.1| cis-prenyltransferase [Hevea brasiliensis]
Length=290

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 179/257 (70%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHLAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G+             
Sbjct  152  NSKCVLLLAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSGTVIQTENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPYALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            W+V+ FQR + YL+K +
Sbjct  270  WSVINFQRHYSYLEKHK  286



>dbj|BAF98305.1| cis-prenyl transferase [Hevea brasiliensis]
Length=296

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 182/263 (69%), Gaps = 19/263 (7%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHLAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA + M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADQSMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkL----------------MNGTaaggaaaa  602
            NS F LL+ + Y+ST+EIVHA EE  K+K                    NGT        
Sbjct  152  NSRFVLLIAVAYSSTDEIVHAVEESSKDKLNSNEVCNNGIEAEQEFKEANGTGNSVIPVQ  211

Query  603  aaEE-RVITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEI  779
              E    I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEI
Sbjct  212  KTESYSGIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPYALWPEI  269

Query  780  GLRHLVWAVLKFQRAHPYLQKRR  848
            GLRH+VW+V+ FQR + YL+K +
Sbjct  270  GLRHVVWSVINFQRHYSYLEKHK  292



>ref|XP_010696123.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Beta 
vulgaris subsp. vulgaris]
Length=265

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 170/246 (69%), Gaps = 16/246 (7%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++K  I    GYR  F+AL  +I  CYELGV+Y+TIY FSIDNF+
Sbjct  33   LPIHIAFIMDGNRRYAKKNNIEYKNGYRPGFIALTSIIKQCYELGVRYITIYGFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LM L+  K+EA ++    +  YGVRI+FVGNL LL   +Q AA K ME T K
Sbjct  93   RKPEEVKRLMKLLREKIEAFVEDDIFIKRYGVRIYFVGNLALLSEELQVAATKAMEITAK  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N+   LLVC+ YTST+EI HA      E+  L  G           + R + + D+EK +
Sbjct  153  NTTTHLLVCIAYTSTDEIAHAV-----EECYLSCG-----------KNRDVDLPDIEKKI  196

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M +APE DIL+RTSGETRLSNFLLWQT  CLLYSP AL+PE+ L HLVWA+L FQ+ + 
Sbjct  197  YMSIAPEPDILIRTSGETRLSNFLLWQTERCLLYSPAALWPELSLWHLVWAMLNFQKHYY  256

Query  831  YLQKRR  848
            YL K+R
Sbjct  257  YLHKKR  262



>emb|CDP21907.1| unnamed protein product [Coffea canephora]
Length=290

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/254 (51%), Positives = 179/254 (70%), Gaps = 9/254 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++K  + +  G+R+ +LAL+ ++ YCYELGVKY TIYAFSIDNF+
Sbjct  33   VPDHIAFIMDGNRRYAKKRNLLDGAGHRSGYLALMNMLKYCYELGVKYATIYAFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++  M L+L K+E L+K ++ +++YGVRI+F+G+L LL   ++ AA + M AT  
Sbjct  93   RRPEEVQSTMQLILEKIEDLIKEESMVNQYGVRIYFLGSLKLLSKPVRLAAERAMVATSG  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAee---------cckekkkLMNGTaaggaaaaaaEERVI  623
            NS   L +CL YTS++EI+HA +E            E K   NG            +  I
Sbjct  153  NSKSVLSICLAYTSSDEILHAVQECCGEKWDEGSALESKGAGNGLVFLKGNENGKIKPSI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             V DLEKHM+  +AP+ DI++RTSGETRLSNFLLWQ+++CLLY+P  L+PEIGL HL+WA
Sbjct  213  VVKDLEKHMYAAVAPDPDIIIRTSGETRLSNFLLWQSANCLLYAPPILWPEIGLWHLIWA  272

Query  804  VLKFQRAHPYLQKR  845
            VL FQR   YL+++
Sbjct  273  VLDFQRNFSYLKEK  286



>emb|CAN61413.1| hypothetical protein VITISV_029565 [Vitis vinifera]
Length=384

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 178/255 (70%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRR+++K  + E  G++  +LAL+ ++ Y YELGVKYVTIYAFSI+NFK
Sbjct  127  IPNHIAFIMDGNRRFAKKQNLIEGAGHKVGYLALMSMLRYSYELGVKYVTIYAFSIENFK  186

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ +MDLM  K+E L+  ++ L+ +GVR+HF+GNL LL + ++ AA + M  T  
Sbjct  187  RRPEEVQSVMDLMQEKIEQLINEESILNHFGVRVHFIGNLKLLSAPVRLAAERAMLVTAC  246

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN---------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTSTNEI+HA EE C +K   +          G            + +I
Sbjct  247  NSKAVLSICVAYTSTNEIMHAVEESCVKKWDEIRELNASGVDCGLTKLEGYEKGEAQDLI  306

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+EKH++M +AP+ DIL+RTSGETRLSNFLLWQ+  C LYSP  L+PEIG  HL+WA
Sbjct  307  NLTDIEKHLYMAVAPDPDILIRTSGETRLSNFLLWQSQYCYLYSPSVLWPEIGFWHLLWA  366

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR H YL+K++
Sbjct  367  VLNFQRNHFYLEKKK  381



>ref|XP_006443858.1| hypothetical protein CICLE_v10023380mg [Citrus clementina]
 ref|XP_006480091.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Citrus 
sinensis]
 gb|ESR57098.1| hypothetical protein CICLE_v10023380mg [Citrus clementina]
Length=290

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/254 (50%), Positives = 182/254 (72%), Gaps = 9/254 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++K  + E VG++  FLAL+ ++  C+ELGV+YVT+YAFSIDNFK
Sbjct  33   LPNHIAFIMDGNRRYAKKRGLMEGVGHKVGFLALISMLRCCHELGVRYVTVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K++ L+K ++ ++ +G+RI+F+GNL LL   ++ AA K M AT K
Sbjct  93   RSPKEVQSLMELMQEKIDDLIKEESIVNRFGLRIYFIGNLKLLSEPVRLAAEKAMLATAK  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckek---kkLMN------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTSTNEIV+A +E  +EK     ++N      G    G +     E++I
Sbjct  153  NSKAVLCICVAYTSTNEIVNAVKESIEEKWDEFCVLNASGAGYGLIKLGGSEGDEREQLI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             ++D+EKH++M +APE DI++RTSGE RLSNFLLWQ++ C LYSP  L+PE+G  H +WA
Sbjct  213  KLIDIEKHLYMAVAPEPDIIIRTSGEIRLSNFLLWQSAVCYLYSPSVLWPEVGFHHFLWA  272

Query  804  VLKFQRAHPYLQKR  845
            +L FQR H YL K+
Sbjct  273  ILNFQRNHSYLYKK  286



>sp|Q8W3U4.1|HRT2_HEVBR RecName: Full=Rubber cis-polyprenyltransferase HRT2 [Hevea brasiliensis]
 dbj|BAB83522.1| cis-prenyltransferase [Hevea brasiliensis]
Length=284

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 182/251 (73%), Gaps = 7/251 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGN R+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHIAFILDGNGRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++M+LML K+E ++  ++ ++ Y + + FVGNL LLD  ++ AA K+M AT K
Sbjct  92   RKPHEVQYVMNLMLEKIEGMIMEESIINAYDICVRFVGNLKLLDEPLKTAADKIMRATAK  151

Query  471  NSNFTLLVCLVYTSTNEIVHA----AeecckekkkLMNGTaaggaaaaaaEE-RVITVVD  635
            NS F LL+ + YTST+EIVHA    +++  K  +   +G           E    I +V+
Sbjct  152  NSKFVLLLAVCYTSTDEIVHAVEESSKDKLKSDEICNDGNGDCVIKIEEMEPYSEIKLVE  211

Query  636  LEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKF  815
            LE++ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+VWAV+  
Sbjct  212  LERNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPHALWPEIGLRHVVWAVINC  269

Query  816  QRAHPYLQKRR  848
            QR + YL+K +
Sbjct  270  QRHYSYLEKHK  280



>emb|CBI37101.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 175/246 (71%), Gaps = 12/246 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRR+++K  + E  G++  +LAL+ ++ Y YELGVKYVTIYAFSI+NFK
Sbjct  33   IPNHIAFIMDGNRRFAKKQNLIEGAGHKVGYLALMSMLRYSYELGVKYVTIYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ +MDLM  K+E L+  ++ L+ +GVR+HF+GNL LL + ++ AA + M  T  
Sbjct  93   RRPEEVQSVMDLMQEKIEQLINEESILNHFGVRVHFIGNLKLLSAPVRLAAERAMLVTAC  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   L +C+ YTSTNEI+HA EE C +K   +             E +   V  +EKH+
Sbjct  153  NSKAVLSICVAYTSTNEIMHAVEESCVKKWDEIR------------ELKASGVDYIEKHL  200

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M +AP+ DIL+RTSGETRLSNFLLWQ+  C LYSP  L+PEIG  HL+WAVL FQR H 
Sbjct  201  YMAVAPDPDILIRTSGETRLSNFLLWQSQYCYLYSPSVLWPEIGFWHLLWAVLNFQRNHF  260

Query  831  YLQKRR  848
            YL+K++
Sbjct  261  YLEKKK  266



>gb|AAR88763.1| cis-prenyltransferase [Hevea brasiliensis]
Length=290

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 179/257 (70%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHLAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++M+LML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMNLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G+             
Sbjct  152  NSKCVLLLAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSGTVIQTENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILYSPYALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            W+V+ FQR + YL+K +
Sbjct  270  WSVINFQRHYSYLEKHK  286



>gb|EYU22482.1| hypothetical protein MIMGU_mgv1a011616mg [Erythranthe guttata]
Length=276

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 175/245 (71%), Gaps = 5/245 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKHIAFI+DGNRRY++K  + E  G+R  +  L+ ++ YCYEL VKYVTIYAFSI+NFK
Sbjct  33   IPKHIAFIMDGNRRYAKKQNLEEGAGHRFGYSTLMNMLKYCYELDVKYVTIYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++  M L+  K+E L++ ++ ++ YGVR+HF+GNL LL   +Q AA + M AT  
Sbjct  93   RRPEEVQSTMQLIQEKIEGLIEKESIVNRYGVRVHFIGNLKLLSKPVQLAAERAMNATWH  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   L +C+ YTST+EIV+A EE CKEK+                E  +I V D+EKHM
Sbjct  153  NSKAVLSICIAYTSTDEIVNAVEESCKEKQ-----KGNEKLLDEIGEGPLIDVADVEKHM  207

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M +AP+ DI++RTSGETRLSNFLLWQ++  LLYSPG L+PEIG  HLV AVL FQ+ + 
Sbjct  208  YMAVAPDPDIIIRTSGETRLSNFLLWQSARSLLYSPGVLWPEIGFWHLVRAVLDFQKNYA  267

Query  831  YLQKR  845
            Y +K+
Sbjct  268  YTEKK  272



>ref|XP_008795438.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Phoenix 
dactylifera]
Length=289

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 180/250 (72%), Gaps = 4/250 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++  ++ +  G+RA F AL  V+ YCYE+GVKYVT+YAFSI+NFK
Sbjct  33   MPNHIAFIMDGNRRYAKSRRVKQGNGHRAGFTALTSVLQYCYEMGVKYVTVYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+PDE++ LMDLM  K++ LLK ++ +++Y +RI+F GNL LL   ++ AA K M +T +
Sbjct  93   RQPDEVQSLMDLMKQKIDELLKEESIVNKYRIRINFWGNLSLLSEPVRLAAEKAMASTAR  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM----NGTaaggaaaaaaEERVITVVDL  638
            N+     VC+ YTSTNEI+HA EE C EK+  +    N      +  A  ++ VI+V DL
Sbjct  153  NTGPVFSVCVAYTSTNEIMHAVEESCVEKRGRIRKGYNNGYKDESVQADNKDSVISVTDL  212

Query  639  EKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQ  818
            E+H++    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++Q
Sbjct  213  ERHLYTSDCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPVPLWPEFSFRHLVWAILEYQ  272

Query  819  RAHPYLQKRR  848
            R +PYL++RR
Sbjct  273  RIYPYLEQRR  282



>dbj|BAF98304.1| cis-prenyl transferase [Hevea brasiliensis]
Length=290

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 179/257 (70%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHLAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA ++M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADQIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G++            
Sbjct  152  NSKCVLLLAVCYTSTDEIVHAVEESSELNSNEVCNNQELEEANATGSSTVIQTENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+R SGETRLSN+LLWQT++C+LYSP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRASGETRLSNYLLWQTTNCILYSPYALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            W+V+ FQR + YL+K +
Sbjct  270  WSVINFQRHYSYLEKHK  286



>ref|XP_009610628.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 177/255 (69%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRYS+K  + +  G+RA F AL+ ++ YCYELGVKY+T+YAFSIDNF+
Sbjct  33   VPSHIAFIMDGNRRYSKKQNLLDGDGHRAGFSALINMLKYCYELGVKYITVYAFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+E LM LM  K++ L+K ++  +  GVRI+F GNL LL + ++++A + M  T  
Sbjct  93   RRPEEVESLMKLMQEKIDELIKEESIANRLGVRIYFQGNLKLLSAPVRSSAERAMVKTAG  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeec---------ckekkkLMNGTaaggaaaaaaEERVI  623
            +S   L VC+ YTST+EIVHA +E           ++                  +E +I
Sbjct  153  HSKAVLSVCVAYTSTDEIVHAVQESCEEKWDEIRKQDANNAGGNLVGREKNGKDKDEHLI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             V +++ HM+M + P+ DI++RTSGE RLSNFLLWQ+++CLLYSP AL+PEIGLRHLVW 
Sbjct  213  GVTNIDSHMYMAVVPDPDIIIRTSGEYRLSNFLLWQSANCLLYSPTALWPEIGLRHLVWV  272

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR + YL++++
Sbjct  273  VLDFQRNYLYLKEKK  287



>ref|XP_008807985.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008777172.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Phoenix dactylifera]
Length=289

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 176/250 (70%), Gaps = 4/250 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKHIAFI+DGNRRY++   + +  G+RA F AL  V+ YCYE+GVKYVT+YAFSIDNFK
Sbjct  33   IPKHIAFIMDGNRRYAKSRNVKQGTGHRAGFTALTSVLQYCYEMGVKYVTVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+PDE+  LMDLM  K++ LL  ++ +++YGV+I+F GNL LL   ++ AA K M +T +
Sbjct  93   RQPDEVHSLMDLMKEKIDELLMKESIVNKYGVKINFWGNLSLLSEPVRLAAEKAMASTAR  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN----GTaaggaaaaaaEERVITVVDL  638
            N+     VC+ YTSTNEIVHA EE   EK+  +      + A  +  A + +  I+V DL
Sbjct  153  NTGPVFSVCVAYTSTNEIVHAIEESFVEKRDRIQERYCNSYADESIWADSMDGAISVTDL  212

Query  639  EKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQ  818
            E+H +    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWAVL++Q
Sbjct  213  EQHFYTADCPDPDIVMRTSGETRLSNFLLWQTTYSHLQNPVPLWPEFSFRHLVWAVLEYQ  272

Query  819  RAHPYLQKRR  848
            R +PYL+ RR
Sbjct  273  RVYPYLEHRR  282



>ref|XP_009788451.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
sylvestris]
Length=290

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 178/255 (70%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRYS+K  + +  G++A F AL+ ++ YCYELGVKY+T+YAFSIDNF+
Sbjct  33   VPSHIAFIMDGNRRYSKKQNLLDGDGHKAGFSALINMLKYCYELGVKYITVYAFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+E LM LM  K++ L+K ++  +  G+RI+F GNL LL   +++AA + M  T  
Sbjct  93   RRPEEVESLMKLMQEKIDELIKEESIANHLGIRIYFQGNLKLLSDPVRSAAERAMVKTAG  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeec---------ckekkkLMNGTaaggaaaaaaEERVI  623
            +S   L VC+ YTST+EIVHA +E           ++                  ++ +I
Sbjct  153  HSKAVLSVCVAYTSTDEIVHAVQESCEEKWDEIRKRDANNAGGNLIGLEENGKDKDDHLI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             V ++++HM+M + P+ DI++RTSGE+RLSNFLLWQ+++CLLYSP AL+PEIGLRHLVW 
Sbjct  213  GVTNVDRHMYMAVVPDPDIIIRTSGESRLSNFLLWQSANCLLYSPTALWPEIGLRHLVWV  272

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR + YL++++
Sbjct  273  VLDFQRNYLYLKEKK  287



>dbj|BAB92024.1| cis-prenyltransferase2 [Hevea brasiliensis]
Length=290

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 177/257 (69%), Gaps = 13/257 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFILDGNRR+++K K+PE  G++A FLAL+ V+ YCYELGVKY TIYAFSIDNF+
Sbjct  32   IPTHIAFILDGNRRFAKKHKLPEGGGHKAGFLALLNVLTYCYELGVKYATIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++++MDLML K+E ++  ++ ++ Y + + FVGNL LL   ++ AA K+M AT  
Sbjct  92   RKPHEVQYVMDLMLEKIEGMIMEESIINAYDICVRFVGNLKLLSEPVKTAADKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----------NGTaaggaaaaaaEER  617
            NS   LL+ + YTST+EIVHA EE  +     +            G+             
Sbjct  152  NSKCVLLIAVCYTSTDEIVHAVEESSELNSNEVCANQELEEANATGSGTVIQIENMESYS  211

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I +VDLEK+ ++   P  D+L+RTSGETRLSN+LLWQT++C+L SP AL+PEIGLRH+V
Sbjct  212  GIKLVDLEKNTYINPYP--DVLIRTSGETRLSNYLLWQTTNCILDSPHALWPEIGLRHVV  269

Query  798  WAVLKFQRAHPYLQKRR  848
            WAV+  QR + YL+K +
Sbjct  270  WAVINCQRHYSYLEKHK  286



>ref|XP_006353865.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Solanum 
tuberosum]
Length=287

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 178/252 (71%), Gaps = 6/252 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRYS+K  + +  G+RA F AL+ ++ YCYELGVKY+T+YAFSIDNFK
Sbjct  33   VPSHIAFIMDGNRRYSKKQNLIDGNGHRAGFSALINMLKYCYELGVKYITVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+  LM LM  K++ L K ++ ++  G+RI+F GNL LL   +++AA + M  T  
Sbjct  93   RRPEEVVSLMKLMQEKIDELTKEESIVNRLGIRIYFQGNLKLLSDHVRSAAERAMVKTSG  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE------ERVITVV  632
            NS   L +C+ YTST+EIVHA +E C+EK   +     GG      E      E  I V 
Sbjct  153  NSKAILSICVAYTSTDEIVHAVQESCEEKWDEIRKNNDGGNLIRLEENVKDKDEHRIGVT  212

Query  633  DLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLK  812
            ++++HM+M + P+ DI++RTSG  RLSNFLLWQ++ CLLYSP AL+PEIGLRHL+W +L 
Sbjct  213  NVDRHMYMSVCPDPDIIIRTSGAARLSNFLLWQSAHCLLYSPAALWPEIGLRHLIWVILD  272

Query  813  FQRAHPYLQKRR  848
            FQR + YL++++
Sbjct  273  FQRNYLYLKEKK  284



>ref|XP_010317610.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 [Solanum lycopersicum]
 gb|AFW98427.1| cis-prenyltransferase 3 [Solanum lycopersicum]
Length=290

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 179/255 (70%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRYS+K  + +  G+RA F AL+ ++ YCYELGVKY+T+YAFSIDNFK
Sbjct  33   VPSHIAFIMDGNRRYSKKQNLLDGNGHRAGFSALINMLKYCYELGVKYITVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+  LM LM  K++ L K ++ ++  G+RI+F GNL LL   ++ AA + M  T  
Sbjct  93   RRPEEVVSLMKLMQEKIDELTKEESIVNRLGIRIYFQGNLKLLSDHVRLAAERAMVKTSG  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-------NGTaaggaaaaaaE--ERVI  623
            NS   L +C+ YTST+EIVHA +E C+EK   +       +G+          +  E  I
Sbjct  153  NSKAILSICVAYTSTDEIVHAVQESCEEKWDEIRKLDVNNDGSNLIRLEENVKDKNEHRI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             V ++++HM+M + P+ DI++RTSG TRLSNFLLWQ+S CLLYSP AL+PEIGLRHL+W 
Sbjct  213  GVTNVDRHMYMSVCPDPDIIIRTSGATRLSNFLLWQSSHCLLYSPAALWPEIGLRHLIWV  272

Query  804  VLKFQRAHPYLQKRR  848
            +L FQR + YL++++
Sbjct  273  ILDFQRNYLYLKEKK  287



>ref|XP_006852364.1| hypothetical protein AMTR_s00049p00221660 [Amborella trichopoda]
 gb|ERN13831.1| hypothetical protein AMTR_s00049p00221660 [Amborella trichopoda]
Length=305

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 170/250 (68%), Gaps = 9/250 (4%)
 Frame = +3

Query  114  PKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKR  293
            PKH+A I+DGNRR++RK  + E  G++   L+L+  +  CYE+GVKYVTI AFSIDNFKR
Sbjct  54   PKHVAVIMDGNRRFARKHHLKEVDGHKIVLLSLMSTLTCCYEMGVKYVTICAFSIDNFKR  113

Query  294  RPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKN  473
            R DE++FLMDL+  K+E +LK ++ ++ YG+R+ F+GN   L+  I+ AA + M AT KN
Sbjct  114  RSDEVQFLMDLLYEKIENILKEESIVNRYGIRVTFLGN---LEPNIREAAERAMNATAKN  170

Query  474  SNFTLLVCLVYTSTNEIVHAAeecckek------kkLMNGTaaggaaaaaaEERVITVVD  635
             N  L +C+ Y+STNEI  AA+  C E+        L +G           E  VI V D
Sbjct  171  DNVVLSICVAYSSTNEITRAAQGACTERFKIRLGSNLTSGAIMENVHKRDGENNVIKVSD  230

Query  636  LEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKF  815
            LE+HMF    PE D+L+RTSGETRLSN+LLWQ+S C L+   AL+PE  LRH++WAVLK+
Sbjct  231  LERHMFTAGCPEPDLLIRTSGETRLSNYLLWQSSHCYLHISNALWPEFALRHMLWAVLKY  290

Query  816  QRAHPYLQKR  845
            QR  PYL+K+
Sbjct  291  QRVKPYLEKK  300



>ref|XP_010914203.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Elaeis guineensis]
Length=291

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 174/250 (70%), Gaps = 4/250 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKHIAFI+DGNRR+++   + +  G+R  F AL  V+ YCYE+GVKYVT+YAFSIDNFK
Sbjct  33   IPKHIAFIMDGNRRFAKSRNVKKGAGHRVGFTALTSVLQYCYEMGVKYVTVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+ DE++ LMDLM  K++ LL  ++ +++YGV+I+F GNL LL   ++ AA K M +T +
Sbjct  93   RQRDEVQSLMDLMKEKIDELLMKESIVNKYGVKINFWGNLSLLSEPVRLAAEKAMASTAR  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN----GTaaggaaaaaaEERVITVVDL  638
            N+     VC+ YTSTNEIVHA EE   EK   +      + +  +  A   + VI+V DL
Sbjct  153  NTGPVFSVCVAYTSTNEIVHAIEESFVEKGDRIQERYCNSYSDESIWADNMDGVISVTDL  212

Query  639  EKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQ  818
            E+H +    P+ DI++RTSGE+RLSNFLLWQT+   L +P  L+PE   RHL+WAVL++Q
Sbjct  213  EQHFYTADCPDPDIVIRTSGESRLSNFLLWQTTFSHLQNPVPLWPEFSFRHLIWAVLQYQ  272

Query  819  RAHPYLQKRR  848
            R +PYL+ RR
Sbjct  273  RVYPYLEHRR  282



>gb|AGC94749.1| dehydrodolichyl diphosphate synthase 6 [Euphorbia lathyris]
Length=270

 Score =   251 bits (642),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 174/246 (71%), Gaps = 12/246 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++KM +    GYRA   AL+ ++ YC+ELG+KY+TIYAFSIDN K
Sbjct  34   IPNHLAFIMDGNRRYAKKMNLSPGEGYRAGSSALMNMLKYCWELGIKYITIYAFSIDNLK  93

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ +MDLM+ KLE   K    ++EYG+R++ +GNL LL   ++ AA K M+AT K
Sbjct  94   RSPEEVKLIMDLMMEKLEGFSKEDILVNEYGIRVYVIGNLKLLSEGVRVAAEKAMKATAK  153

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS F LL+C+ YTS +EI +A EECC+EK +                   I  +D+EKHM
Sbjct  154  NSRFVLLICVAYTSCDEIRYAVEECCREKVECEEFKCG------------IKPLDVEKHM  201

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
             M + P+ D+++RTSGETRLSNFLLWQTS  +LYSP AL+PEIG+  LV  VL+FQR H 
Sbjct  202  HMKVGPDPDVVIRTSGETRLSNFLLWQTSYSVLYSPVALWPEIGMWELVSTVLQFQRHHS  261

Query  831  YLQKRR  848
            YL+K++
Sbjct  262  YLEKKK  267



>gb|AFU61137.2| cis-prenyltransferase [Euphorbia characias]
Length=270

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 173/252 (69%), Gaps = 18/252 (7%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++KM +    GYRA   AL+ ++ YC+ELGVKY+TIYAFSIDN K
Sbjct  34   IPNHLAFIMDGNRRYAKKMNLSPGEGYRAGSSALMNILKYCWELGVKYITIYAFSIDNLK  93

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ ++DLM+ KL+   K    ++EYG+R+H +GNL LL   ++ AA   M+AT K
Sbjct  94   RSPEEVKLIIDLMMEKLDGFSKEDILVNEYGIRVHVIGNLKLLSEGVRVAAENAMKATAK  153

Query  471  NSNFTLLVCLVYTSTNEIVHAAee---cckekkkLMNGTaaggaaaaaaEERVITVVDLE  641
            N+   LL+C+ YTS +E+ HA EE      E ++L  G               I + D+E
Sbjct  154  NNKCVLLICVAYTSRDEMRHAVEECCREKMECEELKCG---------------IQMADVE  198

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            K+M+M +AP+ D+++RTSGETRLSNFLLWQ S  +LY+P  L+PEIGL  LV +VLKFQR
Sbjct  199  KNMYMKVAPDPDVVIRTSGETRLSNFLLWQASYSVLYAPATLWPEIGLWELVSSVLKFQR  258

Query  822  AHPYLQKRRIMV  857
             + YL K++I +
Sbjct  259  HYSYLDKKKIQL  270



>dbj|BAC16756.1| cis-prenyltransferase [Periploca sepium]
Length=331

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 179/254 (70%), Gaps = 9/254 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K  + E  G+R  +LAL+ ++  CYELG+KYVTIYAFSIDNFK
Sbjct  31   IPVHIAFIMDGNRRYAKKKNLLEGTGHRFGYLALINMLKCCYELGIKYVTIYAFSIDNFK  90

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+E  M L+  K+E L+K ++ L+ YGVR++F+GNL LL+  ++  A + M AT  
Sbjct  91   RRPEEVESTMKLIQEKIEELIKEESLLNIYGVRVYFLGNLKLLNKSVRLTAERAMAATAG  150

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN---------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTST+EIVHA +ECC+ K   +          G  + G    +  E ++
Sbjct  151  NSKAVLSICVGYTSTDEIVHAVQECCERKWDEIRELDSSGAGYGLISIGTNEESKGENIV  210

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             V D+EKHM+  + P+ DI++RTSGETRLSNFLLWQ++  LLYSP  L+PEIG RHLVWA
Sbjct  211  GVADIEKHMYAAVVPDPDIIIRTSGETRLSNFLLWQSADSLLYSPSILWPEIGFRHLVWA  270

Query  804  VLKFQRAHPYLQKR  845
            VL FQR   YL+K+
Sbjct  271  VLDFQRNFHYLKKK  284



>gb|AAM92882.1| cis-prenyltransferase 3 [Hevea brasiliensis]
 gb|AAM92886.1| cis-prenyltransferase 7 [Hevea brasiliensis]
 gb|ACF24746.1| cis-prenyl transferase II [Hevea brasiliensis]
 gb|ACF24747.1| cis-prenyl transferase II [Hevea brasiliensis]
 gb|AET42829.1| cis-prenyltransferase II [Hevea brasiliensis]
Length=296

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 179/263 (68%), Gaps = 19/263 (7%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRR+++K K+ E  GY+A +LAL+  + YCYELGV+YVTIYAFSIDNF+
Sbjct  32   IPTHLAFIMDGNRRFAKKHKMKEAEGYKAGYLALLRTLTYCYELGVRYVTIYAFSIDNFR  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++ +M+LM+ K+E ++  ++ ++ Y V +  VGNL+LLD  I+ AA K+M AT  
Sbjct  92   RQPREVQCVMNLMMEKIEEIIVEESIMNAYDVGVRIVGNLNLLDEPIRIAAEKIMRATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkL----------------MNGTaaggaaaa  602
            NS F LL+ + Y+ST+EIVHA EE  K+K                    NGT        
Sbjct  152  NSRFVLLIAVAYSSTDEIVHAVEESSKDKLNSNEVCNNGIEAEQEFKEANGTGNSVIPVQ  211

Query  603  aaEE-RVITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEI  779
              E    I + DLEK+ ++   P  D+L+RTSG +RLSN+LLWQTS+C+LYSP AL+PEI
Sbjct  212  KTESYSGINLADLEKNTYVN--PHPDVLIRTSGLSRLSNYLLWQTSNCILYSPFALWPEI  269

Query  780  GLRHLVWAVLKFQRAHPYLQKRR  848
            GLRHLVW V+ FQR H YL+K +
Sbjct  270  GLRHLVWTVMNFQRHHSYLEKHK  292



>ref|XP_010679242.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010679243.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Beta 
vulgaris subsp. vulgaris]
Length=287

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 174/254 (69%), Gaps = 9/254 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRYS+K    E  G++  F AL  ++ YCYEL VKYVT+YAFSIDNFK
Sbjct  32   IPDHIAFIMDGNRRYSKKYNFEEGTGHKLGFSALTSMLKYCYELEVKYVTVYAFSIDNFK  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ LM+L+  K+E L+K  + +++YGVR+HFVG+L LLD  ++ AA K M AT  
Sbjct  92   RRPEEVKSLMELIQEKIEWLVKEDSIVNQYGVRVHFVGDLKLLDDSVRFAAEKAMAATAG  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN---------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTSTNEIV+A ++ C+EK   +          G           ++  +
Sbjct  152  NSKAVLSICIAYTSTNEIVNAVQQSCEEKWDELKILDSCGAAYGLTNYAGDGDTKDKNFV  211

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             ++D++KHMFM +AP  DI+VRTSGE RLSNFLLWQ++  ++ SP  L+PEIGLRHLVWA
Sbjct  212  GLMDIDKHMFMKVAPSPDIVVRTSGENRLSNFLLWQSTHSIICSPSVLWPEIGLRHLVWA  271

Query  804  VLKFQRAHPYLQKR  845
            VL FQR      K+
Sbjct  272  VLNFQRKQSCSGKK  285



>ref|XP_007043050.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
[Theobroma cacao]
 gb|EOX98881.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
[Theobroma cacao]
Length=293

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 170/252 (67%), Gaps = 6/252 (2%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY  +  + E  G++A +LAL+ ++ YC ELG+KY+T YAFSIDNFK
Sbjct  38   LPIHIAFIMDGNRRYGEQRNLKEGAGHKAGYLALMLMVIYCCELGIKYITAYAFSIDNFK  97

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNAL-DEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            R PD+++++MDLML K+E  L  +++L   YGV++HF GN+ LL   I+ AA ++M AT 
Sbjct  98   RGPDKVQYIMDLMLEKIELELSKKDSLFSRYGVKVHFSGNMELLSDPIKDAAKRLMVATA  157

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN-----GTaaggaaaaaaEERVITVV  632
             NSN  L VC  YTS NEI+HA +E C+EK   +                     V+ + 
Sbjct  158  NNSNTLLTVCFAYTSRNEILHAIQETCQEKLAQIQLQESISEGRISMCNPGQGNDVLKLA  217

Query  633  DLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLK  812
            D+EKHM+M +AP+ DI++RTSGE RLSNFLLWQ+++  L S   L+P I   HLVWAVL 
Sbjct  218  DIEKHMYMAIAPDPDIIIRTSGENRLSNFLLWQSANSCLISFSQLWPGISCWHLVWAVLN  277

Query  813  FQRAHPYLQKRR  848
            FQR H YL+K++
Sbjct  278  FQRNHYYLEKKK  289



>gb|KGN43747.1| hypothetical protein Csa_7G064570 [Cucumis sativus]
Length=482

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 166/232 (72%), Gaps = 7/232 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K K+ E  G+R  +LAL  ++ YCYELGVKYVTIYAFSIDNF+
Sbjct  4    IPAHVAFIMDGNRRYAKKKKLAEGAGHRIGYLALTFMLKYCYELGVKYVTIYAFSIDNFR  63

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ +MDLML K+E L++ ++ +++YGVR+ F+GNL LL + ++ A  + MEAT+ 
Sbjct  64   RSPEEVQGVMDLMLEKVELLIREESLVNQYGVRLRFIGNLRLLSAPVRDAIERAMEATRN  123

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN-------GTaaggaaaaaaEERVITV  629
            N+   L +C+ YTST+EIVHA E  C+EK   MN       G   G    A   +  IT+
Sbjct  124  NNKAELSICIAYTSTDEIVHAVERSCEEKWNEMNSKTANGVGYGFGKLGVANNGDNSITL  183

Query  630  VDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGL  785
             D+EKHM+    P+ DIL+RTSGE RLSNFLLWQTSSC LYSP AL+PEI  
Sbjct  184  ADVEKHMYTAATPDPDILIRTSGEARLSNFLLWQTSSCYLYSPSALWPEINF  235



>gb|AAK62455.1|AF387010_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL66925.1| unknown protein [Arabidopsis thaliana]
Length=221

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 161/215 (75%), Gaps = 8/215 (4%)
 Frame = +3

Query  228  YCYELGVKYVTIYAFSIDNFKRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGN  407
            YCYELG+KYVTIYAFSIDNF+R+P+E+E +MDLML K+++LL+ ++ + +YG+R++F+GN
Sbjct  4    YCYELGIKYVTIYAFSIDNFRRKPEEVESVMDLMLEKIKSLLEKESIVHQYGIRVYFIGN  63

Query  408  LHLLDSRIQAAAGKVMEATKKNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaag  587
            L LL+ +++AAA KVM+AT KNS   LL+C+ Y ST+EIV A ++ C  K   +  +   
Sbjct  64   LALLNDQVRAAAEKVMKATAKNSRVVLLICIAYNSTDEIVQAVKKSCINKSDNIEASNYK  123

Query  588  gaaaaa--------aEERVITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSC  743
               + +         +E+ I +VD+E++M M +AP  DIL+R+SGETRLSNFLLWQT + 
Sbjct  124  HEDSDSDIEGTDMENQEKKIQLVDIEENMQMSVAPNPDILIRSSGETRLSNFLLWQTGNT  183

Query  744  LLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
             L SP AL+PEIGLRHL+WA+L FQR H YL+KR+
Sbjct  184  QLCSPAALWPEIGLRHLLWAILNFQRNHSYLEKRK  218



>ref|XP_003578517.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Brachypodium distachyon]
Length=299

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 174/250 (70%), Gaps = 3/250 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  44   MPRHIAFIMDGNRRYAKSRSIKEGAGHRVGFSALMASLLYCYEMGVKYITVYAFSIDNFK  103

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +N +++   +I+F GNL +L   ++ AA K+M +T +
Sbjct  104  RDPTEVQTLMELMEEKINELLENRNVINKVNCKINFWGNLDMLSEPVRLAAQKLMASTSR  163

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM---NGTaaggaaaaaaEERVITVVDLE  641
            N+   L VC+ Y ST+EI +A  E C E++ +M   +  ++ G A  +     I+V DL+
Sbjct  164  NAGLVLSVCMPYNSTSEIANAVNELCAERRDMMQREHAGSSNGRAVGSGAHSDISVADLD  223

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  224  RHMYTAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPEPLWPEFSWRHLVWAILQYQR  283

Query  822  AHPYLQKRRI  851
             +PY+++ RI
Sbjct  284  VYPYIEQNRI  293



>gb|ABK51403.1| LLA-66 [Lilium longiflorum]
Length=308

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 168/246 (68%), Gaps = 13/246 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIAFILDGNRRY +K K+ E   +   FL LV ++ YC E+GV+YVT+YAFSIDNF 
Sbjct  42   MPRHIAFILDGNRRYGKKWKLKEGESHNIGFLTLVRILRYCCEMGVEYVTLYAFSIDNFN  101

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++++M+L+    +AL++  + ++  GVR++F+G L LLD  ++ AA  VM+AT  
Sbjct  102  RKPNEVQYVMNLIRENTQALVRDLDTVNRLGVRVNFIGRLDLLDGPLREAARTVMKATAG  161

Query  471  NSNFTLLVCLVYTSTNEIVHA--AeecckekkkLMNGTaaggaaaaaaEERVITVVDLEK  644
            N+   L VC  YTST EIVH        +  +  M GT           +R I++ DLE 
Sbjct  162  NTRIVLWVCTAYTSTEEIVHGVQGAVEDEWARLRMEGT-----------KREISLEDLEG  210

Query  645  HMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRA  824
             M+    P+ DIL+RTSGETRLSNF+LWQTS CLLY+P  L+P++ LRHLVWAVL +QR+
Sbjct  211  KMYFERNPDPDILIRTSGETRLSNFVLWQTSFCLLYAPRCLWPDLSLRHLVWAVLLYQRS  270

Query  825  HPYLQK  842
            + YL+K
Sbjct  271  YAYLEK  276



>ref|XP_010237112.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Brachypodium distachyon]
Length=302

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 174/250 (70%), Gaps = 3/250 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  47   MPRHIAFIMDGNRRYAKSRSIKEGAGHRVGFSALMASLLYCYEMGVKYITVYAFSIDNFK  106

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +N +++   +I+F GNL +L   ++ AA K+M +T +
Sbjct  107  RDPTEVQTLMELMEEKINELLENRNVINKVNCKINFWGNLDMLSEPVRLAAQKLMASTSR  166

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM---NGTaaggaaaaaaEERVITVVDLE  641
            N+   L VC+ Y ST+EI +A  E C E++ +M   +  ++ G A  +     I+V DL+
Sbjct  167  NAGLVLSVCMPYNSTSEIANAVNELCAERRDMMQREHAGSSNGRAVGSGAHSDISVADLD  226

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  227  RHMYTAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPEPLWPEFSWRHLVWAILQYQR  286

Query  822  AHPYLQKRRI  851
             +PY+++ RI
Sbjct  287  VYPYIEQNRI  296



>ref|XP_011071080.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Sesamum 
indicum]
Length=290

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 179/255 (70%), Gaps = 9/255 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K  +    G+R  FLAL+ ++ YCYELGVKYVTIYAFSIDNFK
Sbjct  33   VPKHIAFIMDGNRRYAKKQNLEAGAGHRFGFLALMNILKYCYELGVKYVTIYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++  M L+  K+E L++ ++ ++ YGVR+HF GNL LL   ++ AA K M AT  
Sbjct  93   RRPEEVQSTMQLIQEKIEGLIEKESIINRYGVRVHFCGNLKLLSEPVKLAAEKAMNATAC  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN---------GTaaggaaaaaaEERVI  623
            NS   L +C+ YTST+EIVHA EE CKEK+             G +  G  A      +I
Sbjct  153  NSKAVLSICIAYTSTDEIVHAVEEACKEKRDEFRALDKSGAGYGLSGLGENATDRNSPLI  212

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
               D+EKHM+M +AP+ DI++RTSGETRLSNFLLWQ+SS LLYSP  L+P+IG  HLV A
Sbjct  213  DTADVEKHMYMAVAPDPDIIIRTSGETRLSNFLLWQSSSSLLYSPRVLWPDIGFWHLVRA  272

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR   Y++K+R
Sbjct  273  VLDFQRNFAYMEKKR  287



>ref|XP_010227989.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Brachypodium distachyon]
Length=299

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 174/250 (70%), Gaps = 3/250 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  44   MPRHIAFIMDGNRRYAKSRSIKEGAGHRVGFSALMASLLYCYEMGVKYITVYAFSIDNFK  103

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +N +++   +I+F GNL +L   ++ AA K+M +T  
Sbjct  104  RDPTEVQTLMELMEEKINELLENRNVINKVNCKINFWGNLGMLSEPVRLAAQKLMASTAG  163

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM---NGTaaggaaaaaaEERVITVVDLE  641
            N+   L VC+ Y ST+EI +A  E C E++ +M   +  ++ G AA +     I+V DL+
Sbjct  164  NAGLVLSVCMPYNSTSEIANAVNELCAERRDMMQREHAGSSNGRAAGSGAHSDISVADLD  223

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  224  RHMYTAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPEPLWPEFSWRHLVWAILQYQR  283

Query  822  AHPYLQKRRI  851
             +PY+++ RI
Sbjct  284  VYPYIEQNRI  293



>ref|XP_003564260.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Brachypodium distachyon]
Length=302

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 174/250 (70%), Gaps = 3/250 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  47   MPRHIAFIMDGNRRYAKSRSIKEGAGHRVGFSALMASLLYCYEMGVKYITVYAFSIDNFK  106

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +N +++   +I+F GNL +L   ++ AA K+M +T  
Sbjct  107  RDPTEVQTLMELMEEKINELLENRNVINKVNCKINFWGNLGMLSEPVRLAAQKLMASTAG  166

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM---NGTaaggaaaaaaEERVITVVDLE  641
            N+   L VC+ Y ST+EI +A  E C E++ +M   +  ++ G AA +     I+V DL+
Sbjct  167  NAGLVLSVCMPYNSTSEIANAVNELCAERRDMMQREHAGSSNGRAAGSGAHSDISVADLD  226

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  227  RHMYTAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPEPLWPEFSWRHLVWAILQYQR  286

Query  822  AHPYLQKRRI  851
             +PY+++ RI
Sbjct  287  VYPYIEQNRI  296



>ref|XP_009782358.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Nicotiana sylvestris]
Length=254

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 173/246 (70%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++K  + E  GYRA F  L+ V+ YCYELG+K +T+YAFSIDNFK
Sbjct  7    VPSHIAFIMDGNRRYAKKKNLLEKDGYRAGFSVLINVLRYCYELGMKQITVYAFSIDNFK  66

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ LM+LM  K++ L+  ++ ++  G+RI+F GNL LL   ++++    M  T  
Sbjct  67   RRPEEVQSLMELMQEKIDELIAEESIVNRLGIRIYFRGNLKLLSEPVRSSVEMAMAKTAG  126

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   L VC+ YTST+EI  A +E C+EK+  +    A      A E+ +I V D+++HM
Sbjct  127  NSKAVLSVCVAYTSTDEIARAVQESCEEKQDEIREQDASNTGNYALEQ-LIGVADIDRHM  185

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M   P+ D+++RTSG TRLSNFLLWQ++ CLLYSP AL+PEI   HLV A++ FQR + 
Sbjct  186  YMAGVPDPDVIIRTSGGTRLSNFLLWQSAHCLLYSPRALWPEISFWHLVLAIIYFQRNYF  245

Query  831  YLQKRR  848
            Y+++++
Sbjct  246  YVKEKK  251



>ref|XP_006655828.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006655829.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Oryza brachyantha]
Length=299

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 168/246 (68%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSIQEGSGHRVGFSALIASLLYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +N +D+   +I+F GNL +L   ++ AA K+M +T +
Sbjct  108  RDPAEVKSLMELMEEKINELLENRNVIDKVNCKINFWGNLDMLSEPVRVAAEKLMASTAE  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N+     VC+ Y ST EIV+A  + C E+K ++    A   A  +     I+V DL+ HM
Sbjct  168  NTGLVFSVCMPYNSTCEIVNAVNKVCAERKHMLQMDHADNVANNSVHSD-ISVEDLDHHM  226

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   +HLVWA+L++QR HP
Sbjct  227  YSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFKHLVWAILQYQRVHP  286

Query  831  YLQKRR  848
            Y+++ R
Sbjct  287  YIEQSR  292



>ref|XP_008367932.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Malus 
domestica]
Length=333

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 182/291 (63%), Gaps = 46/291 (16%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRRY+++  +P   G+RA FL+ + V+ YCYEL VK++T+YAF IDNFK
Sbjct  41   IPEHIAFIMDGNRRYAKRRNLPAGEGHRAGFLSFMSVLQYCYELLVKFMTVYAFGIDNFK  100

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  DE++ LMDL+  K+E LL+ ++ +++YG+R+ F+GNL LL+  ++ AA + M+AT  
Sbjct  101  RPSDEVQILMDLLQEKIEGLLERESIVNQYGIRVCFIGNLKLLNESVRDAAERAMKATAN  160

Query  471  NSNFTLLVCLV---------------YTSTNEIVHAAeecckekkkLMNGTaaggaaaaa  605
            NS   LL+C+                Y   NEI  A  +  +     ++G A    + A 
Sbjct  161  NSKAVLLICVAYSSRDEIVHAVQESCYEKRNEI-QAQIKRTRGGNGGLDGEAGLDTSEAC  219

Query  606  aE----ERVITVVD--------------------------LEKHMFMGLAPEVDILVRTS  695
             E    E+  T+V+                          +E+HM+M +AP+ +I++RTS
Sbjct  220  NERVEGEKENTMVNHVENVEGEVQESEKQLQNVPVVKVVDVERHMYMAVAPDPNIVIRTS  279

Query  696  GETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            GETRLSNFLLWQTS+CLLY P AL+P++GL HLVWA+L FQR H YL+K+R
Sbjct  280  GETRLSNFLLWQTSNCLLYFPAALWPDLGLWHLVWAILNFQRNHYYLEKKR  330



>ref|XP_009782357.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Nicotiana sylvestris]
Length=281

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 173/246 (70%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++K  + E  GYRA F  L+ V+ YCYELG+K +T+YAFSIDNFK
Sbjct  34   VPSHIAFIMDGNRRYAKKKNLLEKDGYRAGFSVLINVLRYCYELGMKQITVYAFSIDNFK  93

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ LM+LM  K++ L+  ++ ++  G+RI+F GNL LL   ++++    M  T  
Sbjct  94   RRPEEVQSLMELMQEKIDELIAEESIVNRLGIRIYFRGNLKLLSEPVRSSVEMAMAKTAG  153

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   L VC+ YTST+EI  A +E C+EK+  +    A      A E+ +I V D+++HM
Sbjct  154  NSKAVLSVCVAYTSTDEIARAVQESCEEKQDEIREQDASNTGNYALEQ-LIGVADIDRHM  212

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M   P+ D+++RTSG TRLSNFLLWQ++ CLLYSP AL+PEI   HLV A++ FQR + 
Sbjct  213  YMAGVPDPDVIIRTSGGTRLSNFLLWQSAHCLLYSPRALWPEISFWHLVLAIIYFQRNYF  272

Query  831  YLQKRR  848
            Y+++++
Sbjct  273  YVKEKK  278



>ref|XP_004964740.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Setaria 
italica]
Length=303

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 173/249 (69%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   I +  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSIQQGAGHRVGFSALIANLLYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM LM  K+  LL+ ++ +++   +I+F GNL LL   ++ AA K+M +T  
Sbjct  108  RDPSEVQSLMQLMEEKINELLENRSVINKINCKINFWGNLDLLSEPVRVAAQKLMASTAG  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     VC+ Y ST+EIV+A  E C E+++++    AG +   AA   V   I+V DL+
Sbjct  168  NTGLVFSVCMPYNSTSEIVNAVNEVCAERREMLLREHAGDSDDQAANNGVNSEISVADLD  227

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  228  RHMYSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFRHLVWAILQYQR  287

Query  822  AHPYLQKRR  848
            A+PYL++ R
Sbjct  288  AYPYLEQNR  296



>ref|XP_010252332.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nelumbo 
nucifera]
 ref|XP_010252333.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nelumbo 
nucifera]
Length=300

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 168/257 (65%), Gaps = 11/257 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++  K+    G+RA F +L+ ++  CY++GV+YVT+YAFSIDNFK
Sbjct  41   IPYHIAFIMDGNRRYAKSRKLAPGAGHRAGFSSLIQILECCYKIGVRYVTVYAFSIDNFK  100

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++++MDLM+ K++ LLK ++ ++ +GVRI+F G+L LL   ++ AA K M AT K
Sbjct  101  RDPSEVKYIMDLMMEKIDELLKEESIVNSHGVRINFSGDLKLLHEPVRLAAEKAMRATAK  160

Query  471  NSNFTLLVCLVYTSTNEIVHAAe-------ecckekkkLMNGTaagg----aaaaaaEER  617
            N+N  L VC+ YTS NEIVHA E          +E     NG               EE 
Sbjct  161  NTNVVLSVCVAYTSANEIVHAVEESCKEKLTQAQEANSNFNGKKVDILGGYNNPLLEEES  220

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
             I + DLE+HM++   P+ DIL+RTSGETRLSNFLLWQT+ C L+   A +PE+    L 
Sbjct  221  CIALADLERHMYLSECPDPDILIRTSGETRLSNFLLWQTTFCYLHVLNASWPEMSPWWLG  280

Query  798  WAVLKFQRAHPYLQKRR  848
            W +L +QR+  Y+ K++
Sbjct  281  WVILHYQRSKSYIDKKK  297



>gb|KCW53272.1| hypothetical protein EUGRSUZ_J02531 [Eucalyptus grandis]
Length=252

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 168/250 (67%), Gaps = 32/250 (13%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY+++  + E  G+ A F +L+ ++ Y Y+LG++YVT+YAFSIDNFK
Sbjct  29   IPSHVAFIMDGNRRYAKRKNLVEGDGHWAGFSSLITILGYGYDLGIRYVTVYAFSIDNFK  88

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R PDE++ LMDLM+ K+E LLK  + LD+YG+RI+F+GNL LL+  ++ AA K M+AT  
Sbjct  89   RWPDEVQGLMDLMVEKIEELLKTGSFLDQYGIRIYFIGNLRLLNGNVRIAAEKAMKATAS  148

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N+   LL+C+ Y S +EIV+A                       + E+++      E   
Sbjct  149  NNKTVLLICVAYASRDEIVNA--------------------IKRSCEDKLD-----EADA  183

Query  651  FMGLAPEVDI----LVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQ  818
            F G     DI    ++R+SGETRLSNFLLWQT+ C LY+P AL+P++GL HLVWAVL FQ
Sbjct  184  FEG---NEDIKGMNVIRSSGETRLSNFLLWQTAYCPLYAPDALWPDMGLWHLVWAVLSFQ  240

Query  819  RAHPYLQKRR  848
            R++ YLQK++
Sbjct  241  RSYSYLQKKK  250



>ref|NP_001056920.1| Os06g0167400 [Oryza sativa Japonica Group]
 dbj|BAA78751.1| putative cis-prenyltransferase [Oryza sativa Japonica Group]
 dbj|BAD67960.1| putative cis-prenyltransferase [Oryza sativa Japonica Group]
 dbj|BAF18834.1| Os06g0167400 [Oryza sativa Japonica Group]
 dbj|BAG95397.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65160.1| hypothetical protein OsJ_20261 [Oryza sativa Japonica Group]
Length=299

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 167/246 (68%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSIQEGSGHRVGFSALIASLLYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +N +++   +I+F GNL +L   ++ AA K+M  T +
Sbjct  108  RDPTEVKSLMELMEEKINELLENRNVINKVNCKINFWGNLDMLSKSVRVAAEKLMATTAE  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N+     VC+ Y ST+EIV+A  + C E++ ++    A   A        I+V DL++HM
Sbjct  168  NTGLVFSVCMPYNSTSEIVNAVNKVCAERRDILQREDADSVANNGVYSD-ISVADLDRHM  226

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   +HLVWA+L++QR HP
Sbjct  227  YSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFKHLVWAILQYQRVHP  286

Query  831  YLQKRR  848
             +++ R
Sbjct  287  SIEQSR  292



>ref|XP_010907458.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Elaeis 
guineensis]
 ref|XP_010907459.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Elaeis 
guineensis]
 ref|XP_010907460.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Elaeis 
guineensis]
Length=288

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 170/251 (68%), Gaps = 7/251 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY+++  + +  G++  F AL  V+ YC+E+ VKYVT+YAFSIDNFK
Sbjct  33   MPHHIAFIMDGNRRYAKR-SLKQDSGHKVGFTALTSVLQYCFEMRVKYVTVYAFSIDNFK  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++ LMDLM  K++ LLK ++ +++Y VRI+F GNL LL   ++ AA K M  T  
Sbjct  92   RQPSEVQSLMDLMKEKIDELLKEESIVNKYKVRINFWGNLCLLSEPVRLAAEKAMAITAG  151

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM-----NGTaaggaaaaaaEERVITVVD  635
            N      VC+ YTSTNEI+HA EE C E++  +     NG       A   +  VI V D
Sbjct  152  NMGPVFSVCVAYTSTNEIMHAVEESCVERRDKIRKGYSNGYKDELVRADKMDS-VILVAD  210

Query  636  LEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKF  815
            LE+H +    P  DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA++++
Sbjct  211  LEQHFYTSDCPGPDIVIRTSGETRLSNFLLWQTTFSHLQNPAPLWPEFSFRHLVWAIIEY  270

Query  816  QRAHPYLQKRR  848
            QR +PYL++RR
Sbjct  271  QRVYPYLERRR  281



>ref|XP_009397541.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 164/247 (66%), Gaps = 1/247 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY+++  + E  G+   F  L  +  YCYE+GVKYVT+YAFSIDNFK
Sbjct  33   MPNHIAFIMDGNRRYAKQRNVKEGTGHGVGFTTLTSICQYCYEMGVKYVTVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLM  K++ LL+  + + +YG RI+F G+L LL   ++ AA K M  T  
Sbjct  93   RKPEEVQSLMDLMKEKIDELLEEDSIVQKYGFRINFWGSLDLLSEPVRLAAEKAMTHTAD  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE-ERVITVVDLEKH  647
            N+   L +C+ YTSTNEI+ A ++ C  K     G       +   +    +TV DLE++
Sbjct  153  NTGPVLSICVAYTSTNEIMRAIKKSCARKSFRTQGYVNCDGESVCEDINGYVTVADLEEN  212

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +     P+ DI++RTSGE RLSNFLLWQTS   L +P  L+PE  LR+LVWA+L++Q+ +
Sbjct  213  LDTADCPDPDIVIRTSGEARLSNFLLWQTSLSHLQNPNPLWPEFSLRNLVWAILEYQKIY  272

Query  828  PYLQKRR  848
            PYL+ RR
Sbjct  273  PYLEARR  279



>ref|XP_009397540.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=309

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 164/247 (66%), Gaps = 1/247 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY+++  + E  G+   F  L  +  YCYE+GVKYVT+YAFSIDNFK
Sbjct  56   MPNHIAFIMDGNRRYAKQRNVKEGTGHGVGFTTLTSICQYCYEMGVKYVTVYAFSIDNFK  115

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LMDLM  K++ LL+  + + +YG RI+F G+L LL   ++ AA K M  T  
Sbjct  116  RKPEEVQSLMDLMKEKIDELLEEDSIVQKYGFRINFWGSLDLLSEPVRLAAEKAMTHTAD  175

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE-ERVITVVDLEKH  647
            N+   L +C+ YTSTNEI+ A ++ C  K     G       +   +    +TV DLE++
Sbjct  176  NTGPVLSICVAYTSTNEIMRAIKKSCARKSFRTQGYVNCDGESVCEDINGYVTVADLEEN  235

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +     P+ DI++RTSGE RLSNFLLWQTS   L +P  L+PE  LR+LVWA+L++Q+ +
Sbjct  236  LDTADCPDPDIVIRTSGEARLSNFLLWQTSLSHLQNPNPLWPEFSLRNLVWAILEYQKIY  295

Query  828  PYLQKRR  848
            PYL+ RR
Sbjct  296  PYLEARR  302



>gb|EEC82421.1| hypothetical protein OsI_26813 [Oryza sativa Indica Group]
Length=299

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 164/246 (67%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSIQEGSGHRMGFSALIASLLYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +N +++   +I+F G L +L   ++ AA K+M +T +
Sbjct  108  RDPTEVKSLMELMEEKINELLENRNVINKVNCKINFWGKLDMLSEPVRVAAEKLMASTAE  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N      VC+ Y ST+EIV A  + C E++ ++        A        I+V DL+ HM
Sbjct  168  NKGLVFSVCMPYNSTSEIVIAVNKVCAERRDILQREDVDSVANYGVHSD-ISVADLDHHM  226

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   +HLVWA+L++QR HP
Sbjct  227  YSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFKHLVWAILQYQRVHP  286

Query  831  YLQKRR  848
            Y+++ R
Sbjct  287  YIEQSR  292



>gb|ACG24253.1| dehydrodolichyl diphosphate synthase 6 [Zea mays]
 gb|ACG34482.1| dehydrodolichyl diphosphate synthase 6 [Zea mays]
Length=303

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 165/249 (66%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   + E  G+R  F  L+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSMQEGAGHRMGFSTLIASLMYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E+E LM LM  K+  LL+ Q+ +++   +I+F GNL LL   ++ AA K+M +T  
Sbjct  108  RDPSEVESLMQLMEEKINELLENQSVINKINCKINFWGNLDLLYEPVRLAAEKLMASTAG  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     +C+ Y ST+EIV+A  + C E+ ++      G     AA   V   I+V DL+
Sbjct  168  NTGLVFSICMPYNSTSEIVNAVSQVCAERMEMFQSEHIGECNGHAANNGVRSEISVADLD  227

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  228  RHMYSAECPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFRHLVWAILQYQR  287

Query  822  AHPYLQKRR  848
             +P L+  R
Sbjct  288  VYPALEHNR  296



>ref|XP_008807986.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008777173.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Phoenix dactylifera]
Length=248

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 162/236 (69%), Gaps = 4/236 (2%)
 Frame = +3

Query  153  YSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKRRPDEIEFLMDLML  332
            Y++   + +  G+RA F AL  V+ YCYE+GVKYVT+YAFSIDNFKR+PDE+  LMDLM 
Sbjct  6    YAKSRNVKQGTGHRAGFTALTSVLQYCYEMGVKYVTVYAFSIDNFKRQPDEVHSLMDLMK  65

Query  333  TKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFTLLVCLVYTS  512
             K++ LL  ++ +++YGV+I+F GNL LL   ++ AA K M +T +N+     VC+ YTS
Sbjct  66   EKIDELLMKESIVNKYGVKINFWGNLSLLSEPVRLAAEKAMASTARNTGPVFSVCVAYTS  125

Query  513  TNEIVHAAeecckekkkLMN----GTaaggaaaaaaEERVITVVDLEKHMFMGLAPEVDI  680
            TNEIVHA EE   EK+  +      + A  +  A + +  I+V DLE+H +    P+ DI
Sbjct  126  TNEIVHAIEESFVEKRDRIQERYCNSYADESIWADSMDGAISVTDLEQHFYTADCPDPDI  185

Query  681  LVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            ++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWAVL++QR +PYL+ RR
Sbjct  186  VMRTSGETRLSNFLLWQTTYSHLQNPVPLWPEFSFRHLVWAVLEYQRVYPYLEHRR  241



>ref|NP_001131688.1| uncharacterized protein LOC100193048 [Zea mays]
 ref|XP_008658082.1| PREDICTED: uncharacterized protein LOC100193048 isoform X1 [Zea 
mays]
 ref|XP_008658083.1| PREDICTED: uncharacterized protein LOC100193048 isoform X1 [Zea 
mays]
 ref|XP_008658084.1| PREDICTED: uncharacterized protein LOC100193048 isoform X1 [Zea 
mays]
 gb|ACF80208.1| unknown [Zea mays]
 gb|ACN34939.1| unknown [Zea mays]
 gb|AFW85618.1| dehydrodolichyl diphosphate synthase 6 isoform 1 [Zea mays]
 gb|AFW85619.1| dehydrodolichyl diphosphate synthase 6 isoform 2 [Zea mays]
Length=303

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 165/249 (66%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   + E  G+R  F  L+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSMQEGAGHRMGFSTLIASLMYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E+E LM LM  K+  LL+ ++ +++   +I+F GNL LL   ++ AA K+M +T  
Sbjct  108  RDPSEVESLMQLMEEKINELLENRSVINKINCKINFWGNLDLLYEPVRLAAEKLMASTAG  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     +C+ Y ST+EIV+A  + C E+ ++      G     AA   V   I+V DL+
Sbjct  168  NTGLVFSICMPYNSTSEIVNAVSQVCAERMEMFQSEHIGECNGHAANNGVRSEISVADLD  227

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWAVL++QR
Sbjct  228  RHMYSAECPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFRHLVWAVLQYQR  287

Query  822  AHPYLQKRR  848
             +P L+  R
Sbjct  288  VYPALEHNR  296



>ref|XP_009597269.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
tomentosiformis]
Length=235

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K  I E  GYRA FLA++C++ YCYELGVKY+TIYAFSIDNF+
Sbjct  33   IPNHIAFIMDGNRRYAKKRNIAEATGYRAGFLAVMCMLKYCYELGVKYMTIYAFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+++LMDLML K+E L+K ++ ++ YGVR+HFVGNL LL+ R++ AA K M+AT  
Sbjct  93   RRPEEVQYLMDLMLEKIEGLIKQESIVNGYGVRVHFVGNLKLLNERVRVAAEKAMQATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckek-kkLMNGTaaggaaaaaaEER-----VITVV  632
            N+N TLL+C+ YTST+EI+HA +  C EK  ++    A         EE+     +I +V
Sbjct  153  NTNSTLLICVAYTSTDEILHAVQSSCLEKWNEIQELDANQAQNGEITEEKLELNHIIKLV  212

Query  633  DLEKHMFMGLAPEVDILVRTS  695
            D+E+H +MGLAP+ D+L+RTS
Sbjct  213  DIERHAYMGLAPDPDVLIRTS  233



>ref|XP_009631075.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Nicotiana 
tomentosiformis]
Length=281

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 174/246 (71%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K  + E  GYRA F  L+ V+ YCYELG+K++T+YAFSIDNFK
Sbjct  34   VPSHLAFIMDGNRRYAKKQNLLERDGYRAGFSVLINVLRYCYELGMKHITVYAFSIDNFK  93

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ LM+LM  K+E L++ ++ ++  G+RI+F GNL LL   +++A    M  T  
Sbjct  94   RRPEEVQSLMELMQEKIEELIEEESIVNRLGIRIYFRGNLKLLSEPVRSAVEMAMSKTAG  153

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   L VC+ YTST+EI  A +E C+EK+  +    A  A   A E+  I V D+++HM
Sbjct  154  NSKVVLSVCVAYTSTDEIARAVQESCEEKQDEIRERDASNAGNYALEQ-PIEVADIDRHM  212

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M   P+ DI++RTSG TRLSNFLLWQ++ CLLYSP AL+PEI   HLV  ++ FQR + 
Sbjct  213  YMAGVPDPDIIIRTSGGTRLSNFLLWQSACCLLYSPRALWPEISFWHLVLTIIYFQRNYF  272

Query  831  YLQKRR  848
            YL++++
Sbjct  273  YLKEKK  278



>ref|XP_003576597.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010238234.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010238235.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010238236.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Brachypodium distachyon]
Length=289

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 168/249 (67%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIAFI+DGNRRY++   I +  G+R  F AL   + YCYE+GVKY+T+YAFSIDNFK
Sbjct  34   MPEHIAFIMDGNRRYAKFRTIKKGTGHRMGFSALTASLLYCYEMGVKYITVYAFSIDNFK  93

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL+ +  +++   +I+F G+L LL   ++ AA K+M +T +
Sbjct  94   RDPSEVQSLMELMEEKINELLENRGVINKVNCKINFWGDLDLLSEPVKLAAQKLMASTAQ  153

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     VC+ Y ST+EIV+A  + C E++ +     +G      A   V   ++V DL+
Sbjct  154  NTGLVFSVCMPYNSTSEIVNAVNKLCAERRNIAQREYSGNCNGQDANNGVHPDVSVADLD  213

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGE RLSNFLLWQT+   L SP  L+PE  LRHL+WA+L++QR
Sbjct  214  RHMYSDGCPDPDIVIRTSGEARLSNFLLWQTTFSHLQSPAPLWPEFSLRHLLWAILQYQR  273

Query  822  AHPYLQKRR  848
             +PY+++ R
Sbjct  274  VYPYIEQNR  282



>ref|XP_007043051.1| Dehydrodolichyl diphosphate synthase 6 [Theobroma cacao]
 gb|EOX98882.1| Dehydrodolichyl diphosphate synthase 6 [Theobroma cacao]
Length=326

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 166/255 (65%), Gaps = 12/255 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIA I+DGNRRY++  K+ +  GY A  LAL+ ++  CYELGVK++T+YAFSIDNFK
Sbjct  55   IPSHIAIIMDGNRRYAKTKKVDKGAGYEAGTLALLYMLVCCYELGVKHLTVYAFSIDNFK  114

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ +MDL+   +  L +    +    +R+HF GNL LL + I+  A ++ME+T  
Sbjct  115  RKPEEVQKVMDLVRESIPLLTRM---VKRCPMRVHFAGNLQLLGADIRIPAERLMESTAD  171

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM---------NGTaaggaaaaaaEERVI  623
            NS F   +C+ Y ST+EI+HA  E C+EK   +         NG           ++ +I
Sbjct  172  NSKFVFTICVAYNSTDEILHAVRESCREKCDHIQEISGIDGSNGLQGKNGDIHEGDQDLI  231

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+EKHM+MG+AP+ DIL+RT+GE RLSNFLLWQTS   L S   L+P+ G+ HL W 
Sbjct  232  KLEDIEKHMYMGIAPDPDILIRTAGEYRLSNFLLWQTSCSQLSSSFTLWPKFGIWHLAWV  291

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR HPY  K++
Sbjct  292  VLDFQRNHPYFGKKK  306



>gb|ACG35019.1| dehydrodolichyl diphosphate synthase 6 [Zea mays]
Length=303

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 165/249 (66%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   + E  G+R  F  L+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSMQEGAGHRMGFSTLIASLMYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E+E LM LM  K+  LL+ ++ +++   +I+F GNL LL   ++ AA K+M +T  
Sbjct  108  RDPSEVESLMQLMEEKINELLENRSVINKINCKINFWGNLDLLYEPVRLAAEKLMASTAG  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     +C+ Y ST+EIV+A  E C E+ ++      G     AA   V   I+V DL+
Sbjct  168  NTGLVFSICMPYNSTSEIVNAVSEVCAERMEMFQSEHIGDCNGHAANNGVRSEISVADLD  227

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  228  RHMYSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFRHLVWAILQYQR  287

Query  822  AHPYLQKRR  848
             +P L+  R
Sbjct  288  VYPALEHNR  296



>ref|NP_001060237.1| Os07g0607700 [Oryza sativa Japonica Group]
 dbj|BAD31153.1| putative cis-prenyltransferase [Oryza sativa Japonica Group]
 dbj|BAD32032.1| putative cis-prenyltransferase [Oryza sativa Japonica Group]
 dbj|BAF22151.1| Os07g0607700 [Oryza sativa Japonica Group]
 dbj|BAG91305.1| unnamed protein product [Oryza sativa Japonica Group]
Length=299

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 163/246 (66%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  48   MPKHIAFIMDGNRRYAKFRSIQEGSGHRMGFSALIASLLYCYEMGVKYITVYAFSIDNFK  107

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LM+LM  K+  LL+ +N +++   +I+F G L +L   ++ AA K+M +T +
Sbjct  108  RDLTEVKSLMELMEEKINELLENRNVINKVNCKINFWGKLDMLSEPVRVAAEKLMVSTAE  167

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N      VC+ Y ST+EIV A  + C E++ ++        A        I+V DL+ HM
Sbjct  168  NKGLVFSVCMPYNSTSEIVIAVNKVCAERRDILQREDVDSVANNGVHSD-ISVADLDHHM  226

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   +HLVWA+L++QR HP
Sbjct  227  YSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFKHLVWAILQYQRVHP  286

Query  831  YLQKRR  848
            Y+++ R
Sbjct  287  YIEQSR  292



>ref|XP_010456500.1| PREDICTED: dehydrodolichyl diphosphate synthase 8-like [Camelina 
sativa]
Length=272

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 172/247 (70%), Gaps = 12/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP H++FI+DGNRR+++K  +     G+RA F+++  V+ YC E+G+ YVT+YAF +DNF
Sbjct  34   IPNHVSFIMDGNRRFAKKHNLTGLDAGHRAGFISVTYVLQYCKEIGIPYVTLYAFGVDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR+P+E+E +MDLML K+E  +    + +  GVR++FVG+L+ L+ R++ AA ++ME T+
Sbjct  94   KRQPEEVECVMDLMLEKVEYTINQAVSGNLKGVRVYFVGDLNSLNERLRVAAQRLMEVTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y++++EIVHA  E C  K    +GT          +  V+ V D+E+ 
Sbjct  154  ENKDLMVVVCVAYSTSHEIVHAVRESCVRK---CDGT--------GDDPVVLQVSDVEEC  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+ D+++RT G  RLSNF+ WQTS  LL+S   L+PE+GL HLVWA+LKFQR H
Sbjct  203  MYTSVVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHSTATLWPELGLWHLVWAILKFQRMH  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>ref|XP_006400842.1| hypothetical protein EUTSA_v10014376mg [Eutrema salsugineum]
 gb|ESQ42295.1| hypothetical protein EUTSA_v10014376mg [Eutrema salsugineum]
Length=271

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 170/247 (69%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  + E   G+RA F+++  V+ YC E+GV YVT+YAF +DNF
Sbjct  34   IPNHISFIMDGNRRFAKKHNLKELDAGHRAGFVSVTYVLQYCKEIGVPYVTLYAFGVDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  ++   + +  G+R+ F G+L+ L+ R++AAA ++ME T+
Sbjct  94   KREPEEVKCVMDLMLEKVELTIEQAISGNLKGLRVIFAGDLNSLNERLRAAAQRLMEVTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
             N    ++VC+ Y++++EI+HA  E C  K    NG A            V+ V D+E+ 
Sbjct  154  DNRGLVVVVCVAYSTSHEILHAVRESCVRKCDDGNGPA------------VLEVNDIEEC  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+ D+++RT G  RLSNF+ WQTS  LL++ GAL+PE+GL HLVWA+LKFQR  
Sbjct  202  MYTSVVPDPDLVIRTGGRDRLSNFMTWQTSRSLLHTTGALWPELGLWHLVWAILKFQRMQ  261

Query  828  PYLQKRR  848
             YLQK++
Sbjct  262  DYLQKKQ  268



>gb|ACN26437.1| unknown [Zea mays]
 gb|ACR35917.1| unknown [Zea mays]
 gb|AFW85626.1| hypothetical protein ZEAMMB73_795974 [Zea mays]
Length=412

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 165/249 (66%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   + E  G+R  F  L+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  157  MPKHIAFIMDGNRRYAKFRSMQEGAGHRMGFSTLIASLMYCYEMGVKYITVYAFSIDNFK  216

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E+E LM LM  K+  LL+ Q+ +++   +I+F GNL LL   ++ AA K+M +T  
Sbjct  217  RDPSEVESLMQLMEEKINELLENQSVINKIKCKINFWGNLDLLYEPVRLAAEKLMASTAG  276

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     +C+ Y ST+EIV+A  E C E+ ++      G     AA   V   I+V +L+
Sbjct  277  NTGLVFSICMPYNSTSEIVNAVSEVCAERMEMFQSEHIGDCNGHAANNGVRSEISVAELD  336

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  337  RHMYSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFRHLVWAILQYQR  396

Query  822  AHPYLQKRR  848
             +P L+  R
Sbjct  397  VYPALEHNR  405



>gb|EAZ40603.1| hypothetical protein OsJ_25064 [Oryza sativa Japonica Group]
Length=335

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 163/246 (66%), Gaps = 1/246 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   I E  G+R  F AL+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  84   MPKHIAFIMDGNRRYAKFRSIQEGSGHRMGFSALIASLLYCYEMGVKYITVYAFSIDNFK  143

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LM+LM  K+  LL+ +N +++   +I+F G L +L   ++ AA K+M +T +
Sbjct  144  RDLTEVKSLMELMEEKINELLENRNVINKVNCKINFWGKLDMLSEPVRVAAEKLMVSTAE  203

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            N      VC+ Y ST+EIV A  + C E++ ++        A        I+V DL+ HM
Sbjct  204  NKGLVFSVCMPYNSTSEIVIAVNKVCAERRDILQREDVDSVANNGVHSD-ISVADLDHHM  262

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   +HLVWA+L++QR HP
Sbjct  263  YSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFKHLVWAILQYQRVHP  322

Query  831  YLQKRR  848
            Y+++ R
Sbjct  323  YIEQSR  328



>ref|XP_008659229.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Zea mays]
Length=454

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 165/249 (66%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++   + E  G+R  F  L+  + YCYE+GVKY+T+YAFSIDNFK
Sbjct  199  MPKHIAFIMDGNRRYAKFRSMQEGAGHRMGFSTLIASLMYCYEMGVKYITVYAFSIDNFK  258

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E+E LM LM  K+  LL+ Q+ +++   +I+F GNL LL   ++ AA K+M +T  
Sbjct  259  RDPSEVESLMQLMEEKINELLENQSVINKIKCKINFWGNLDLLYEPVRLAAEKLMASTAG  318

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     +C+ Y ST+EIV+A  E C E+ ++      G     AA   V   I+V +L+
Sbjct  319  NTGLVFSICMPYNSTSEIVNAVSEVCAERMEMFQSEHIGDCNGHAANNGVRSEISVAELD  378

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    P+ DI++RTSGETRLSNFLLWQT+   L +P  L+PE   RHLVWA+L++QR
Sbjct  379  RHMYSAGCPDPDIVIRTSGETRLSNFLLWQTTFSHLQNPDPLWPEFSFRHLVWAILQYQR  438

Query  822  AHPYLQKRR  848
             +P L+  R
Sbjct  439  VYPALEHNR  447



>ref|XP_009782359.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X3 [Nicotiana sylvestris]
Length=240

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 166/238 (70%), Gaps = 1/238 (0%)
 Frame = +3

Query  135  LDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKRRPDEIEF  314
            +DGNRRY++K  + E  GYRA F  L+ V+ YCYELG+K +T+YAFSIDNFKRRP+E++ 
Sbjct  1    MDGNRRYAKKKNLLEKDGYRAGFSVLINVLRYCYELGMKQITVYAFSIDNFKRRPEEVQS  60

Query  315  LMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFTLLV  494
            LM+LM  K++ L+  ++ ++  G+RI+F GNL LL   ++++    M  T  NS   L V
Sbjct  61   LMELMQEKIDELIAEESIVNRLGIRIYFRGNLKLLSEPVRSSVEMAMAKTAGNSKAVLSV  120

Query  495  CLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHMFMGLAPEV  674
            C+ YTST+EI  A +E C+EK+  +    A      A E+ +I V D+++HM+M   P+ 
Sbjct  121  CVAYTSTDEIARAVQESCEEKQDEIREQDASNTGNYALEQ-LIGVADIDRHMYMAGVPDP  179

Query  675  DILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            D+++RTSG TRLSNFLLWQ++ CLLYSP AL+PEI   HLV A++ FQR + Y+++++
Sbjct  180  DVIIRTSGGTRLSNFLLWQSAHCLLYSPRALWPEISFWHLVLAIIYFQRNYFYVKEKK  237



>ref|XP_004137059.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Cucumis 
sativus]
Length=304

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 155/217 (71%), Gaps = 7/217 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H+AFI+DGNRRY++K K+ E  G+R  +LAL  ++ YCYELGVKYVTIYAFSIDNF+
Sbjct  4    IPAHVAFIMDGNRRYAKKKKLAEGAGHRIGYLALTFMLKYCYELGVKYVTIYAFSIDNFR  63

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++ +MDLML K+E L++ ++ +++YGVR+ F+GNL LL + ++ A  + MEAT+ 
Sbjct  64   RSPEEVQGVMDLMLEKVELLIREESLVNQYGVRLRFIGNLRLLSAPVRDAIERAMEATRN  123

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN-------GTaaggaaaaaaEERVITV  629
            N+   L +C+ YTST+EIVHA E  C+EK   MN       G   G    A   +  IT+
Sbjct  124  NNKAELSICIAYTSTDEIVHAVERSCEEKWNEMNSKTANGVGYGFGKLGVANNGDNSITL  183

Query  630  VDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSS  740
             D+EKHM+    P+ DIL+RTSGE RLSNFLLWQTSS
Sbjct  184  ADVEKHMYTAATPDPDILIRTSGEARLSNFLLWQTSS  220



>ref|XP_010914205.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Elaeis guineensis]
Length=250

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 160/236 (68%), Gaps = 4/236 (2%)
 Frame = +3

Query  153  YSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKRRPDEIEFLMDLML  332
            +++   + +  G+R  F AL  V+ YCYE+GVKYVT+YAFSIDNFKR+ DE++ LMDLM 
Sbjct  6    FAKSRNVKKGAGHRVGFTALTSVLQYCYEMGVKYVTVYAFSIDNFKRQRDEVQSLMDLMK  65

Query  333  TKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFTLLVCLVYTS  512
             K++ LL  ++ +++YGV+I+F GNL LL   ++ AA K M +T +N+     VC+ YTS
Sbjct  66   EKIDELLMKESIVNKYGVKINFWGNLSLLSEPVRLAAEKAMASTARNTGPVFSVCVAYTS  125

Query  513  TNEIVHAAeecckekkkLMN----GTaaggaaaaaaEERVITVVDLEKHMFMGLAPEVDI  680
            TNEIVHA EE   EK   +      + +  +  A   + VI+V DLE+H +    P+ DI
Sbjct  126  TNEIVHAIEESFVEKGDRIQERYCNSYSDESIWADNMDGVISVTDLEQHFYTADCPDPDI  185

Query  681  LVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            ++RTSGE+RLSNFLLWQT+   L +P  L+PE   RHL+WAVL++QR +PYL+ RR
Sbjct  186  VIRTSGESRLSNFLLWQTTFSHLQNPVPLWPEFSFRHLIWAVLQYQRVYPYLEHRR  241



>gb|KFK27579.1| hypothetical protein AALP_AA8G402200 [Arabis alpina]
Length=271

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 167/247 (68%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPET-VGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  +     G+RA F+++  V+ YC E+GV YVT+YAF  DNF
Sbjct  34   IPNHISFIMDGNRRFAKKHNLESVHAGHRAGFISVTYVLQYCKEIGVPYVTLYAFGFDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ LMDLML K+E  ++   + +  GVR+ F G+L+ L+ R +A+A ++ME T+
Sbjct  94   KREPEEVKCLMDLMLEKVELTIEQAISGNLKGVRVIFAGDLNSLNERFRASAQRLMEITE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA  E C  K    N               V+ + D+EK+
Sbjct  154  ENRDLIIVVCVAYSTSREIVHAVRESCVRKSDDGNCNV------------VMELNDIEKY  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+ DI++RT G  RLSNF++WQTS  LL++  AL+PE+GL HLVWA+LKFQR  
Sbjct  202  MYTSVVPDPDIVIRTGGGDRLSNFMIWQTSKSLLHTTAALWPELGLWHLVWAILKFQRLQ  261

Query  828  PYLQKRR  848
             YLQK++
Sbjct  262  GYLQKKQ  268



>ref|XP_010443847.1| PREDICTED: dehydrodolichyl diphosphate synthase 8-like [Camelina 
sativa]
Length=272

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 169/247 (68%), Gaps = 12/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP H++FI+DGNRR+++K  +     G+RA F+++  V+ YC E+G+ YVT+YAF +DNF
Sbjct  34   IPNHVSFIMDGNRRFAKKHNLTGLDAGHRAGFISVTYVLQYCKEIGIPYVTLYAFGVDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR+P+E+E +MDLML K+E  +    + +  GVR+ FVG+L  L+ R++ AA ++ME T+
Sbjct  94   KRQPEEVECVMDLMLEKVEYTINQAVSGNLNGVRVFFVGDLTSLNERLRVAAQRLMEVTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y++++EIVHA  E C  K    +GT          +  V+ V D+E+ 
Sbjct  154  ENKDLMVVVCVAYSTSHEIVHAVRESCVRK---CDGT--------GDDPVVLQVSDVEEC  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+ D+++RT G  RLSNF+ WQTS  LL+S   L+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSVVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHSTATLWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YL+K++
Sbjct  263  DYLEKKK  269



>ref|XP_010483698.1| PREDICTED: dehydrodolichyl diphosphate synthase 8-like [Camelina 
sativa]
Length=272

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 169/247 (68%), Gaps = 12/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP H++FI+DGNRR+++K  +     G+RA F+++  V+ YC E+G+ YVT+YAF +DNF
Sbjct  34   IPNHVSFIMDGNRRFAKKHNLTGLDAGHRAGFISVTYVLQYCKEIGIPYVTLYAFGVDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR+P+E+E +MDLML K+E  +    + +  GVR+ FVG+L  L+ R++ AA ++ME T+
Sbjct  94   KRQPEEVECVMDLMLEKVEYTINQAVSGNLKGVRVFFVGDLTSLNERLRVAAQRLMEVTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y++++EIVHA  E C  K    +GT          +  V+ V D+E+ 
Sbjct  154  ENKDLMVVVCVAYSTSHEIVHAVRESCVRK---CDGT--------GDDPVVLQVSDVEEC  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+ D+++RT G  RLSNF+ WQTS  LL+S   L+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSVVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHSTATLWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YL+K++
Sbjct  263  DYLEKKK  269



>ref|XP_004962927.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X1 [Setaria italica]
 ref|XP_004962928.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Setaria italica]
Length=284

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 168/249 (67%), Gaps = 3/249 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+H+AFI+DGNRRY++   I +  G+R  + AL+  + +C ++GVKY+T+YAFSIDNFK
Sbjct  29   MPEHVAFIMDGNRRYAKSRSIQQGDGHRVGYSALIENLVHCNDMGVKYITVYAFSIDNFK  88

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P E++ LM+LM  K+  LL  Q+ + +   +I+F GNL L+   ++  A K+M +T  
Sbjct  89   RDPIEVQLLMELMEEKINELLDNQSVIHKMNCKINFWGNLDLMCEPVRLGAQKLMASTAG  148

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLE  641
            N+     +C+ Y ST+EIV+A  E C E+++++    AG +   AA   V   I+V DL+
Sbjct  149  NTGLVFSICMPYNSTSEIVNAVSEVCAERREVLQRDHAGDSNGQAANNGVHSEISVSDLD  208

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +HM+    PE DI++RTSGETRLSNFLLWQT+   L SP  L+PE   +HL+WA+L++QR
Sbjct  209  RHMYSAGCPEPDIVIRTSGETRLSNFLLWQTTFSHLQSPHCLWPEFSFKHLIWAILQYQR  268

Query  822  AHPYLQKRR  848
             +PYL + R
Sbjct  269  VYPYLVQNR  277



>gb|KFK27580.1| hypothetical protein AALP_AA8G402300 [Arabis alpina]
Length=271

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 168/247 (68%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  I     G+RA F+++  V+ YC E+GV YVT+YAF  DNF
Sbjct  34   IPNHISFIMDGNRRFAKKHNINSVNAGHRAGFISVTYVLQYCKEIGVPYVTLYAFGFDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ LMDLML K+E  ++   + +  GVR+ F G+L+ L+ R +AAA ++ME T+
Sbjct  94   KREPEEVKCLMDLMLEKVELTIEQAISGNLKGVRVIFAGDLNSLNERFRAAAQRLMEITE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA ++ C +K    +G            +  + + DLE+ 
Sbjct  154  ENRDLIIVVCVAYSTSREIVHAVQKSCVKKCD--DGD----------SDVALGLSDLEEC  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+    P+ D+++RT G  RLSNF++WQTS  LL++  AL+PE+GL HLVWA+LKFQR  
Sbjct  202  MYASAVPDPDLVIRTGGGDRLSNFMIWQTSKSLLHTTAALWPELGLWHLVWAILKFQRMQ  261

Query  828  PYLQKRR  848
             YLQK++
Sbjct  262  DYLQKKQ  268



>gb|EPS62793.1| cis-prenyltransferase, partial [Genlisea aurea]
Length=256

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 161/246 (65%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRR+++K+ + E  G++A ++A   ++ +CYEL V+Y+TIYAFSIDNF+
Sbjct  22   IPEHIAFIMDGNRRFAKKLNLEEGEGHKAGYVAFTNLLKFCYELRVRYLTIYAFSIDNFR  81

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E++  MDL+ +K+E LL   + +  YG+R++ VGN  LL       A K M  T+ 
Sbjct  82   RPPEEVQSTMDLIQSKIEELLLDGSIIRRYGIRVYIVGNFRLLSESFLRTAEKAMRTTEG  141

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS   L +C+ Y ST+E+  A E                  A    EE  I V D+E+HM
Sbjct  142  NSGAVLSICVAYASTDEMARAVE------------ECCEEKARGGGEE--IEVGDIERHM  187

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
             M ++P+ D+++RTSGETRLSNFLLWQ+   +LYSP  L+PE G+RH++  +++FQ+   
Sbjct  188  CMAVSPDPDLIIRTSGETRLSNFLLWQSGYAMLYSPTVLWPEFGVRHMLRIIIEFQKNFA  247

Query  831  YLQKRR  848
            YL+++R
Sbjct  248  YLERKR  253



>ref|XP_007043056.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
[Theobroma cacao]
 gb|EOX98887.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
[Theobroma cacao]
Length=277

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 160/246 (65%), Gaps = 2/246 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI++GNRRY +K+ + +  G+    L ++ ++ +C +LG++YVTIYAFSIDNFK
Sbjct  31   IPTHIAFIMNGNRRYDQKLNLAKGTGHSIGLLVMLTMLMHCCDLGIRYVTIYAFSIDNFK  90

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E+E  MDL+    E L +  +  + Y V+ HF GNL LL+  ++ AA ++M  T  
Sbjct  91   RKPEEVERGMDLLKFTFELLSEKNSIANLYSVKFHFSGNLDLLNEPVKNAAKELMANTAN  150

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            NS      C+ YTST+E+V A  E C E+++ M      G        + + VVD++KHM
Sbjct  151  NSKAFFTFCIAYTSTDEMVSAIREACDERRRAMQEQKKTGGNYGLT--KPVEVVDIKKHM  208

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +M +AP  DI+VRT+GE RLSNFLLWQT+   LYS   L+PE+   HLV AVL FQR H 
Sbjct  209  YMAIAPYPDIVVRTAGENRLSNFLLWQTACSQLYSTPTLWPEVNFWHLVLAVLNFQRNHS  268

Query  831  YLQKRR  848
            YL K++
Sbjct  269  YLDKQK  274



>dbj|BAB91250.1| cis-prenyltransferase [Hevea brasiliensis]
Length=198

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = +3

Query  126  AFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKRRPDE  305
            AFI+DGNRRY++K  I E  GYRA FLA++C++ YCYELGVKY TIYAF  DNFK RP+E
Sbjct  1    AFIMDGNRRYAKKWNIAEATGYRAVFLAVMCMLKYCYELGVKYTTIYAFGYDNFKIRPEE  60

Query  306  IEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFT  485
            +++LMDLML K+E L+K ++ ++EYGVR+HFVG+L LL+ R++ AA K M+AT  ++N T
Sbjct  61   VQYLMDLMLEKIEGLIKQESIVNEYGVRVHFVGDLKLLNERVRVAAEKAMQATVNSTNST  120

Query  486  LLVCLVYTSTNEIVHAAeecckek-kkLMNGTaaggaaaaaaEER-----VITVVDLEKH  647
            LL+C+ YTST+EI+HA +  C EK  ++    A         EE+     +I +VD+E+H
Sbjct  121  LLICVAYTSTDEILHAVQSSCLEKWNEIQELDANQAQNGEITEEKQELKHIIKLVDIERH  180

Query  648  MFMGLAPEVDILVRTSGE  701
             +MGLAP+ D+L+RTSGE
Sbjct  181  TYMGLAPDPDVLIRTSGE  198



>ref|XP_006279833.1| hypothetical protein CARUB_v10028181mg [Capsella rubella]
 gb|EOA12731.1| hypothetical protein CARUB_v10028181mg [Capsella rubella]
Length=271

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 163/247 (66%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  +     G+RA F+++  V+ YC E+GV YVT+YAF IDNF
Sbjct  34   IPTHISFIMDGNRRFAKKYNLTGLDAGHRAGFVSVTYVLQYCKEIGVPYVTLYAFGIDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +      +  GVRI F G+L+ L+ R +AA  K+ME T+
Sbjct  94   KRGPEEVKCIMDLMLEKVELTIDQALTGNLNGVRIIFAGDLNSLNERFRAATQKLMELTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVH+  E C  K K  +G              V+ V D+E+ 
Sbjct  154  ENKDLIVVVCVAYSTSQEIVHSIRESCMRKCKTGDGPV------------VLEVSDVEEC  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+    P+ D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  202  MYTSAVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQRMQ  261

Query  828  PYLQKRR  848
             YLQK++
Sbjct  262  GYLQKKK  268



>ref|XP_010443850.1| PREDICTED: dehydrodolichyl diphosphate synthase 8 [Camelina sativa]
Length=272

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 163/247 (66%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  35   IPTNISFIMDGNRRFAKKRNLEGLDAGHRAGFVSVKYILQYCKEIGVPYVTLYAFGMDNF  94

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ LMDLML K+E  ++     +  GVRI F G+L  L+ R +AA  ++M+ T+
Sbjct  95   KRGPEEVKCLMDLMLEKVELTIEQALTGNMNGVRIIFAGDLDSLNERFRAATQRLMQLTE  154

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVH+  E C  K K  +G              V+ V DLE+ 
Sbjct  155  ENRDLIVVVCVAYSTSQEIVHSVRESCMRKTKTGDGPV------------VLKVSDLEES  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+    P+ D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSAVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>ref|XP_007043052.1| Dehydrodolichyl diphosphate synthase 6 [Theobroma cacao]
 gb|EOX98883.1| Dehydrodolichyl diphosphate synthase 6 [Theobroma cacao]
Length=349

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 169/255 (66%), Gaps = 12/255 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIA I+DGNRRY++K K+ E  G+ A  LAL+C++ YCYELGVK+++ YAFSIDNF+
Sbjct  78   IPSHIAVIMDGNRRYAKKKKLEEGAGHDAGALALLCLLIYCYELGVKHLSAYAFSIDNFR  137

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ +MDL+   +  L +    +    +R+HF G+L LL + I+  A ++M+AT  
Sbjct  138  RKPEEVQKIMDLLRECIPLLTR---IVKHRPIRVHFAGSLELLSADIRIPAKRLMDATAD  194

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLM---------NGTaaggaaaaaaEERVI  623
            NS F   +C+VYTST+EI+H  +E CKEK   +         NG       +   ++ +I
Sbjct  195  NSKFIFTLCVVYTSTDEIMHVVQESCKEKCDHIPEIRANDANNGFLGENEDSHLGDQDLI  254

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             +VD+EKHM+M + P+ DIL+RT  E RLSNFLLWQTS C L S   L+PEIG+  LVW 
Sbjct  255  KLVDIEKHMYMAITPDPDILIRTGDEHRLSNFLLWQTSGCQLSSLVTLWPEIGIWQLVWV  314

Query  804  VLKFQRAHPYLQKRR  848
            VL FQR H Y  ++R
Sbjct  315  VLNFQRNHHYYGRKR  329



>ref|XP_006281674.1| hypothetical protein CARUB_v10027814mg [Capsella rubella]
 gb|EOA14572.1| hypothetical protein CARUB_v10027814mg [Capsella rubella]
Length=272

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 162/247 (66%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  35   IPTNISFIMDGNRRFAKKRNLEGIDAGHRAGFISVKYILQYCKEIGVPYVTLYAFGMDNF  94

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ LMDLML K+E  +      +  GVRI F G+L+ L+ R +AA  K+ME T+
Sbjct  95   KRGPEEVKCLMDLMLEKVELTIDQALTGNMNGVRIIFAGDLNSLNERFRAATQKLMELTE  154

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVH+  E C  K K  +            +  V+ V DLE  
Sbjct  155  ENRDLIVVVCVAYSTSQEIVHSVRESCLRKTKFRD------------DPVVLDVSDLEDC  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+    P+ D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSAVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>gb|AAM65193.1| undecaprenyl diphosphate synthase [Arabidopsis thaliana]
Length=272

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 165/247 (67%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  35   IPTNISFIMDGNRRFAKKRNLEGLDAGHRAGFISVKYILQYCKEIGVPYVTLYAFGMDNF  94

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +  GVRI F G+L+ L+ R +AA  K+ME T+
Sbjct  95   KRGPEEVKCVMDLMLEKVELTIDQAVSGNMNGVRIIFAGDLNSLNERFRAATKKLMELTE  154

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA  + C  K K  +G++             + + D+E+ 
Sbjct  155  ENRDLIVVVCVAYSTSVEIVHAVRDSCVRKSKTGDGSS------------ALELSDIEEC  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P  D++VRT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSVVPVPDLMVRTGGGDRLSNFMTWQTSRALLHRTEALWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>emb|CDX80166.1| BnaC09g35760D [Brassica napus]
Length=270

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 165/247 (67%), Gaps = 14/247 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  + +   G+RA F+++  V+ YC E+GV YVT+YAF  DNF
Sbjct  34   IPNHISFIMDGNRRFAKKHNLQDLDAGHRAGFVSVTHVLQYCQEIGVPYVTLYAFGHDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            +R P+E++ +MDLML K+E  +    + +   +++ F+G+L++L+ R++AAA ++ME T+
Sbjct  94   RREPEEVKCVMDLMLEKIELTIDQAISGNLNNLKVIFIGDLNMLNERLKAAAQRLMEVTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N    ++VC+ Y++++EIVHA                +        + +V+ V D+E+ 
Sbjct  154  ENRGLMVVVCVAYSTSHEIVHAIR-------------ESCVKKCGDGDSQVLEVSDIEEC  200

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+  +++RT G  RLSNF+ WQTS  LL++  AL+PE+GL HLVWA+LKFQR  
Sbjct  201  MYTSIVPDPALVIRTGGRDRLSNFMTWQTSKSLLHTTVALWPELGLWHLVWAILKFQRMQ  260

Query  828  PYLQKRR  848
             YLQK++
Sbjct  261  NYLQKKQ  267



>dbj|BAB08234.1| undecaprenyl pyrophosphate synthetase-like protein [Arabidopsis 
thaliana]
Length=251

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 165/247 (67%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  14   IPTNISFIMDGNRRFAKKRNLEGLDAGHRAGFISVKYILQYCKEIGVPYVTLYAFGMDNF  73

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +  GVRI F G+L+ L+ R +AA  K+ME T+
Sbjct  74   KRGPEEVKCVMDLMLEKVELTIDQAVSGNMNGVRIIFAGDLNSLNERFRAATKKLMELTE  133

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA  + C  K K  +G++             + + D+E+ 
Sbjct  134  ENRDLIVVVCVAYSTSVEIVHAVRDSCVRKSKTGDGSS------------ALELSDIEEC  181

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P  D++VRT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  182  MYTSVVPVPDLVVRTGGGDRLSNFMTWQTSRALLHRTEALWPELGLWHLVWAILKFQRMQ  241

Query  828  PYLQKRR  848
             YLQK++
Sbjct  242  DYLQKKK  248



>emb|CDY31543.1| BnaA10g13280D [Brassica napus]
Length=271

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 167/247 (68%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  + +   G+RA F+++  V+ YC E+GV YVT+YAF  DNF
Sbjct  34   IPNHISFIMDGNRRFAKKHNLQDLDAGHRAGFVSVTHVLQYCQEIGVPYVTLYAFGHDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            +R P+E++ +MDLML K+E  +    + +   +++ F+G+L++L+ R++AAA ++ME T+
Sbjct  94   RREPEEVKCVMDLMLEKIELTIDQAISGNLNNLKVIFIGDLNMLNERLKAAAQRLMEVTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N    ++VC+ Y++++EIVHA  E C  K    +              +V+ V D+E+ 
Sbjct  154  ENRGLMVVVCVAYSTSHEIVHAIRESCVRKCGDRDSP------------QVLEVSDIEEC  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+  +++RT G  RLSNF+ WQTS  LL++  AL+PE+GL HLVWA+LKFQR  
Sbjct  202  MYTSIVPDPALVIRTGGRDRLSNFMTWQTSRSLLHTTAALWPELGLWHLVWAILKFQRMQ  261

Query  828  PYLQKRR  848
             YLQK++
Sbjct  262  NYLQKKQ  268



>ref|NP_200859.1| cis-prenyltransferase 9 [Arabidopsis thaliana]
 sp|Q8LAR7.2|DDPS8_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 8; Short=Dedol-PP 
synthase 8 [Arabidopsis thaliana]
 gb|AED97338.1| cis-prenyltransferase 9 [Arabidopsis thaliana]
Length=272

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 165/247 (67%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  35   IPTNISFIMDGNRRFAKKRNLEGLDAGHRAGFISVKYILQYCKEIGVPYVTLYAFGMDNF  94

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +  GVRI F G+L+ L+ R +AA  K+ME T+
Sbjct  95   KRGPEEVKCVMDLMLEKVELTIDQAVSGNMNGVRIIFAGDLNSLNERFRAATKKLMELTE  154

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA  + C  K K  +G++             + + D+E+ 
Sbjct  155  ENRDLIVVVCVAYSTSVEIVHAVRDSCVRKSKTGDGSS------------ALELSDIEEC  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P  D++VRT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSVVPVPDLVVRTGGGDRLSNFMTWQTSRALLHRTEALWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>ref|XP_010456508.1| PREDICTED: dehydrodolichyl diphosphate synthase 8-like [Camelina 
sativa]
Length=272

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 162/247 (66%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  35   IPTNISFIMDGNRRFAKKRNLEGLDAGHRAGFVSVKYILQYCKEIGVPYVTLYAFGMDNF  94

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ LMDLML K+E  ++     +  GVRI F G+L  L+ R +AA  ++M+ T+
Sbjct  95   KRGPEEVKCLMDLMLEKVELTIEQALTGNMNGVRIIFAGDLDSLNERFRAATQRLMQLTE  154

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
             N +  ++VC+ Y+++ EIVH+  E C  K K  +            +  V+ V DLE+ 
Sbjct  155  DNRDLIVVVCVAYSTSQEIVHSVRESCIRKTKTGD------------DPVVLKVSDLEES  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+    P+ D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSAVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>ref|XP_010483699.1| PREDICTED: dehydrodolichyl diphosphate synthase 8-like [Camelina 
sativa]
Length=272

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 162/247 (66%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  35   IPTNISFIMDGNRRFAKKRNLEGLDAGHRAGFVSVKYILQYCKEIGVPYVTLYAFGMDNF  94

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ LMDLML K+E  ++     +  GVRI F G+L  L+ R +AA  ++M+ T+
Sbjct  95   KRGPEEVKCLMDLMLEKVELTIEQALTGNMNGVRIIFAGDLDSLNERFRAATQRLMQLTE  154

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVH+  E C  K K  +               V+ V DLE+ 
Sbjct  155  ENIDLIVVVCVAYSTSQEIVHSVRESCIRKTKTGDDPV------------VLKVSDLEES  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+    P+ D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSAVPDPDLVIRTGGGDRLSNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>ref|XP_002864688.1| undecaprenyl pyrophosphate synthetase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40947.1| undecaprenyl pyrophosphate synthetase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=272

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 165/247 (67%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K  +     G+RA F+++  ++ YC E+GV YVT+YAF +DNF
Sbjct  35   IPTNISFIMDGNRRFAKKRNLEGLDAGHRAGFISVKYILQYCKEIGVPYVTLYAFGMDNF  94

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +  GVRI F G+L+ L+ R +AA  K+M+ T+
Sbjct  95   KRGPEEVKCVMDLMLEKVELTIDQAVSGNMNGVRIIFAGDLNSLNERFRAATQKLMKLTE  154

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA  + C  K K+ +G+              + + D+E+ 
Sbjct  155  ENRDLIVVVCVAYSTSVEIVHAVRDSCVRKSKIGDGSV------------ALELSDIEEC  202

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P  D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  203  MYTSVVPVPDLVIRTGGGDRLSNFMTWQTSKSLLHRTEALWPELGLWHLVWAILKFQRMQ  262

Query  828  PYLQKRR  848
             YLQK++
Sbjct  263  DYLQKKK  269



>ref|XP_009120581.1| PREDICTED: dehydrodolichyl diphosphate synthase 8-like [Brassica 
rapa]
Length=271

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/247 (42%), Positives = 166/247 (67%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  + +   G+RA F+++  V+ YC E+ V YVT+YAF  DNF
Sbjct  34   IPNHISFIMDGNRRFAKKHNLQDLDAGHRAGFVSVTHVLQYCQEIEVPYVTLYAFGHDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            +R P+E++ +MDLML K+E  +    + +   +++ F+G+L++L+ R++AAA ++ME T+
Sbjct  94   RREPEEVKCVMDLMLEKIELTIDQAISGNLNKLKVIFIGDLNMLNERLKAAAQRLMEVTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N    ++VC+ Y++++EIVHA  E C  K    +              +V+ V D+E+ 
Sbjct  154  ENKGLMVVVCVAYSTSHEIVHAIRESCVRKCGDGDSP------------QVLEVSDIEEC  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+  +++RT G  RLSNF+ WQTS  LL++  AL+PE+GL HLVWA+LKFQR  
Sbjct  202  MYTSIVPDPALVIRTGGRDRLSNFMTWQTSRSLLHTTAALWPELGLWHLVWAILKFQRMQ  261

Query  828  PYLQKRR  848
             YLQK++
Sbjct  262  NYLQKKQ  268



>ref|XP_009389291.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Musa 
acuminata subsp. malaccensis]
Length=285

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 164/247 (66%), Gaps = 3/247 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIAFILDGNRRY++K  +    G+   F +LV V+ YCYELGVK VT+YAFSIDNF+
Sbjct  33   MPQHIAFILDGNRRYAKKHNLKMGAGHTVGFNSLVAVLRYCYELGVKQVTVYAFSIDNFR  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P+E++ LM LM  K++ LL     + ++G+RI+F G LH+L    +AAA + M AT  
Sbjct  93   RKPEEVKGLMALMKEKIDELLDEDTIVHKFGLRINFWGCLHMLSEPARAAAERAMAATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEE-RVITVVDLEKH  647
            N+   L VC+ YTST+EI+ A ++ C +K     G                I V DLE++
Sbjct  153  NTGPVLSVCVAYTSTDEILRAIKKSCSKKTA--EGCLRFTGDPVRDGACGAIAVADLEEN  210

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +     P+ DIL+RTSGETRLSNFLLWQ++   L +P  L+PE  LR+L+WA+L++QR +
Sbjct  211  LDSADCPDPDILIRTSGETRLSNFLLWQSTLTHLQNPLPLWPEFSLRNLIWAILEYQRVY  270

Query  828  PYLQKRR  848
            PYL+ RR
Sbjct  271  PYLEARR  277



>ref|XP_009120583.1| PREDICTED: dehydrodolichyl diphosphate synthase 8-like [Brassica 
rapa]
Length=276

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 165/247 (67%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  +     G+RA F+++  V+ YC E+GV YVT+YAF IDNF
Sbjct  39   IPNHISFIMDGNRRFAKKHNLQGLDAGHRAGFVSVTYVLQYCQEIGVPYVTLYAFGIDNF  98

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +   +++ F G+L+LL+ R++ AA ++ME T+
Sbjct  99   KREPEEVKCMMDLMLEKIELTIDQAISGNLKDLKVIFAGDLNLLNERLKVAAQRLMELTE  158

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N     +V + Y++++EIV A        +K ++G +            V+ + D+E+ 
Sbjct  159  ENRGLVAVVIVAYSTSHEIVQA--IRESCVRKCVDGDSPL----------VLEMSDVEEC  206

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+ D+++R+ G  RLSNF+ WQ+S  LL++  AL+PE+GL HLVWA+LKFQR H
Sbjct  207  MYTSIVPDPDLVIRSGGIDRLSNFMTWQSSRSLLHTTAALWPELGLWHLVWAILKFQRMH  266

Query  828  PYLQKRR  848
             YLQK++
Sbjct  267  DYLQKKQ  273



>emb|CDY31542.1| BnaA10g13290D [Brassica napus]
Length=271

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 165/247 (67%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPE-TVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP HI+FI+DGNRR+++K  +     G+RA F+++  V+ YC E+GV YVT+YAF IDNF
Sbjct  34   IPNHISFIMDGNRRFAKKHNLQGLDAGHRAGFVSVTYVLQYCQEIGVPYVTLYAFGIDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +   +++ F G+L+LL+ R++ AA ++ME T+
Sbjct  94   KREPEEVKCMMDLMLEKIELTIDQAISGNLKDLKVIFAGDLNLLNERLKVAAQRLMELTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N     +V + Y++++EIV A        +K ++G +            V+ + D+E+ 
Sbjct  154  ENRGLVAVVIVAYSTSHEIVQA--IRESCVRKCVDGDSPL----------VLEMSDVEEC  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P+ D+++R+ G  RLSNF+ WQ+S  LL++  AL+PE+GL HLVWA+LKFQR H
Sbjct  202  MYTSIVPDPDLVIRSGGIDRLSNFMTWQSSRSLLHTTAALWPELGLWHLVWAILKFQRMH  261

Query  828  PYLQKRR  848
             YLQK++
Sbjct  262  DYLQKKQ  268



>ref|XP_010238237.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X2 [Brachypodium distachyon]
Length=238

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 152/231 (66%), Gaps = 3/231 (1%)
 Frame = +3

Query  165  MKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKRRPDEIEFLMDLMLTKLE  344
            M I +  G+R  F AL   + YCYE+GVKY+T+YAFSIDNFKR P E++ LM+LM  K+ 
Sbjct  1    MTIKKGTGHRMGFSALTASLLYCYEMGVKYITVYAFSIDNFKRDPSEVQSLMELMEEKIN  60

Query  345  ALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFTLLVCLVYTSTNEI  524
             LL+ +  +++   +I+F G+L LL   ++ AA K+M +T +N+     VC+ Y ST+EI
Sbjct  61   ELLENRGVINKVNCKINFWGDLDLLSEPVKLAAQKLMASTAQNTGLVFSVCMPYNSTSEI  120

Query  525  VHAAeecckekkkLMNGTaaggaaaaaaEERV---ITVVDLEKHMFMGLAPEVDILVRTS  695
            V+A  + C E++ +     +G      A   V   ++V DL++HM+    P+ DI++RTS
Sbjct  121  VNAVNKLCAERRNIAQREYSGNCNGQDANNGVHPDVSVADLDRHMYSDGCPDPDIVIRTS  180

Query  696  GETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            GE RLSNFLLWQT+   L SP  L+PE  LRHL+WA+L++QR +PY+++ R
Sbjct  181  GEARLSNFLLWQTTFSHLQSPAPLWPEFSLRHLLWAILQYQRVYPYIEQNR  231



>ref|XP_006340955.1| PREDICTED: LOW QUALITY PROTEIN: rubber cis-polyprenyltransferase 
HRT2-like [Solanum tuberosum]
Length=234

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 143/203 (70%), Gaps = 7/203 (3%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFILDG+RRY+ +  + E       FL L+C++ YCYELGVKY+TIYAF+IDNF+
Sbjct  22   IPNHTAFILDGHRRYAIQWNVAEL-----XFLTLMCMLKYCYELGVKYMTIYAFNIDNFR  76

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R P+E+++LMDLML K+E LLK +  ++EYGV IH VGNL LLD  ++ AA KVM+ T K
Sbjct  77   RSPEEVQYLMDLMLEKIEGLLKQETVINEYGVGIHXVGNLKLLDEPVRVAAEKVMQVTAK  136

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaE-ERVITVVDLEKH  647
            N+  +LL+C+ YTST+EIVH   +  + ++  +N +          + + VI +VD+E+H
Sbjct  137  NTKSSLLICVAYTSTDEIVHTVXKWNEIQEVNVNQSQNAEITEEKMQLDHVIKLVDIERH  196

Query  648  MFMGLAPEVDILVRTSGETRLSN  716
              MGLAP+ D+L+RTSG + +SN
Sbjct  197  X-MGLAPDPDVLIRTSGASHISN  218



>ref|XP_008777175.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X3 [Phoenix dactylifera]
Length=214

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 144/207 (70%), Gaps = 4/207 (2%)
 Frame = +3

Query  240  LGVKYVTIYAFSIDNFKRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLL  419
            +GVKYVT+YAFSIDNFKR+PDE+  LMDLM  K++ LL  ++ +++YGV+I+F GNL LL
Sbjct  1    MGVKYVTVYAFSIDNFKRQPDEVHSLMDLMKEKIDELLMKESIVNKYGVKINFWGNLSLL  60

Query  420  DSRIQAAAGKVMEATKKNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN----GTaag  587
               ++ AA K M +T +N+     VC+ YTSTNEIVHA EE   EK+  +      + A 
Sbjct  61   SEPVRLAAEKAMASTARNTGPVFSVCVAYTSTNEIVHAIEESFVEKRDRIQERYCNSYAD  120

Query  588  gaaaaaaEERVITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGAL  767
             +  A + +  I+V DLE+H +    P+ DI++RTSGETRLSNFLLWQT+   L +P  L
Sbjct  121  ESIWADSMDGAISVTDLEQHFYTADCPDPDIVMRTSGETRLSNFLLWQTTYSHLQNPVPL  180

Query  768  FPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            +PE   RHLVWAVL++QR +PYL+ RR
Sbjct  181  WPEFSFRHLVWAVLEYQRVYPYLEHRR  207



>ref|XP_006386229.1| hypothetical protein POPTR_0002s04050g [Populus trichocarpa]
 gb|ERP64026.1| hypothetical protein POPTR_0002s04050g [Populus trichocarpa]
Length=252

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 147/249 (59%), Gaps = 35/249 (14%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGN                                GV+  T YAFSIDNFK
Sbjct  33   LPNHIAFIMDGN--------------------------------GVRCATFYAFSIDNFK  60

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            +RPD I+ LMD  L  +E L+K  + +  YG+R++F GNL LL   ++ AA   M AT  
Sbjct  61   QRPDGIQPLMDSFLEHVEGLMKEDSLVSRYGIRVYFQGNLELLSEPVRLAAENAMLATAH  120

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckek---kkLMNGTaaggaaaaaaEERVITVVDLE  641
            NS   L+VC+ YTSTN IVHA +E C+EK     ++N +A          E  + V D++
Sbjct  121  NSKLLLIVCIAYTSTNVIVHAVQESCREKWGGIIVLNESAEPEENEKNDGESFVKVTDVD  180

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            K+M+M +A E DIL+RTSG+TRLS FLLWQT+   LY P A +PEIG RHL+WA+L FQR
Sbjct  181  KNMYMAIAAEPDILIRTSGDTRLSYFLLWQTTCTYLYFPSAFWPEIGFRHLLWAILNFQR  240

Query  822  AHPYLQKRR  848
             H YL KR+
Sbjct  241  HHQYLNKRK  249



>dbj|BAB08233.1| undecaprenyl pyrophosphate synthetase-like protein [Arabidopsis 
thaliana]
Length=251

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 159/247 (64%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMK-IPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K   I    G+RA F+++  ++ YC E+GV YVT++AF +DNF
Sbjct  14   IPTNISFIMDGNRRFAKKHNLIGLDAGHRAGFISVKYILQYCKEIGVPYVTLHAFGMDNF  73

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +  GVRI F G+L  L+   +AA  K+ME T+
Sbjct  74   KRGPEEVKCVMDLMLEKVELAIDQAVSGNMNGVRIIFAGDLDSLNEHFRAATKKLMELTE  133

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA        +K  NG              ++ + D+E+ 
Sbjct  134  ENRDLIVVVCVAYSTSLEIVHAV--RKSCVRKCTNGDDLV----------LLELSDVEEC  181

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P  D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  182  MYTSIVPVPDLVIRTGGGDRLSNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQRMQ  241

Query  828  PYLQKRR  848
             YL K++
Sbjct  242  DYLTKKK  248



>gb|EEC80087.1| hypothetical protein OsI_21824 [Oryza sativa Indica Group]
Length=289

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 150/228 (66%), Gaps = 1/228 (0%)
 Frame = +3

Query  165  MKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFKRRPDEIEFLMDLMLTKLE  344
            ++ P  +  +    AL+  + YCYE+GVKY+T+YAFSIDNFKR P E++ LM+LM  K+ 
Sbjct  56   IEYPGRLWSQGGLPALIASLLYCYEMGVKYITVYAFSIDNFKRDPTEVKSLMELMEEKIN  115

Query  345  ALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFTLLVCLVYTSTNEI  524
             LL+ +N +++   +I+F GNL +L   ++ AA K+M  T +N+     VC+ Y ST+EI
Sbjct  116  ELLENRNVINKVNCKINFWGNLDMLSKSVRVAAEKLMATTAENTGLVFSVCMPYNSTSEI  175

Query  525  VHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHMFMGLAPEVDILVRTSGET  704
            V+A  + C E++ ++    A   A        I+V DL++HM+    P+ DI++RTSGET
Sbjct  176  VNAVNKVCAERRDILQREDADSVANNGVYSD-ISVADLDRHMYSAGCPDPDIVIRTSGET  234

Query  705  RLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            RLSNFLLWQT+   L +P  L+PE   +HLVWA+L++QR HPY+++ R
Sbjct  235  RLSNFLLWQTTFSHLQNPDPLWPEFSFKHLVWAILQYQRVHPYIEQSR  282



>ref|XP_010914206.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
X3 [Elaeis guineensis]
Length=216

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 143/207 (69%), Gaps = 4/207 (2%)
 Frame = +3

Query  240  LGVKYVTIYAFSIDNFKRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLL  419
            +GVKYVT+YAFSIDNFKR+ DE++ LMDLM  K++ LL  ++ +++YGV+I+F GNL LL
Sbjct  1    MGVKYVTVYAFSIDNFKRQRDEVQSLMDLMKEKIDELLMKESIVNKYGVKINFWGNLSLL  60

Query  420  DSRIQAAAGKVMEATKKNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMN----GTaag  587
               ++ AA K M +T +N+     VC+ YTSTNEIVHA EE   EK   +      + + 
Sbjct  61   SEPVRLAAEKAMASTARNTGPVFSVCVAYTSTNEIVHAIEESFVEKGDRIQERYCNSYSD  120

Query  588  gaaaaaaEERVITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGAL  767
             +  A   + VI+V DLE+H +    P+ DI++RTSGE+RLSNFLLWQT+   L +P  L
Sbjct  121  ESIWADNMDGVISVTDLEQHFYTADCPDPDIVIRTSGESRLSNFLLWQTTFSHLQNPVPL  180

Query  768  FPEIGLRHLVWAVLKFQRAHPYLQKRR  848
            +PE   RHL+WAVL++QR +PYL+ RR
Sbjct  181  WPEFSFRHLIWAVLQYQRVYPYLEHRR  207



>ref|NP_200858.1| dehydrodolichyl diphosphate synthase 7 [Arabidopsis thaliana]
 sp|Q8LED0.1|DDPS7_ARATH RecName: Full=Dehydrodolichyl diphosphate synthase 7; Short=Dedol-PP 
synthase 7 [Arabidopsis thaliana]
 gb|AAM62714.1| undecaprenyl diphosphate synthase [Arabidopsis thaliana]
 gb|AED97337.1| dehydrodolichyl diphosphate synthase 7 [Arabidopsis thaliana]
Length=271

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 159/247 (64%), Gaps = 13/247 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMK-IPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNF  287
            IP +I+FI+DGNRR+++K   I    G+RA F+++  ++ YC E+GV YVT++AF +DNF
Sbjct  34   IPTNISFIMDGNRRFAKKHNLIGLDAGHRAGFISVKYILQYCKEIGVPYVTLHAFGMDNF  93

Query  288  KRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATK  467
            KR P+E++ +MDLML K+E  +    + +  GVRI F G+L  L+   +AA  K+ME T+
Sbjct  94   KRGPEEVKCVMDLMLEKVELAIDQAVSGNMNGVRIIFAGDLDSLNEHFRAATKKLMELTE  153

Query  468  KNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
            +N +  ++VC+ Y+++ EIVHA        +K  NG              ++ + D+E+ 
Sbjct  154  ENRDLIVVVCVAYSTSLEIVHAV--RKSCVRKCTNGDDLV----------LLELSDVEEC  201

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            M+  + P  D+++RT G  RLSNF+ WQTS  LL+   AL+PE+GL HLVWA+LKFQR  
Sbjct  202  MYTSIVPVPDLVIRTGGGDRLSNFMTWQTSRSLLHRTEALWPELGLWHLVWAILKFQRMQ  261

Query  828  PYLQKRR  848
             YL K++
Sbjct  262  DYLTKKK  268



>emb|CDX80162.1| BnaC09g35800D [Brassica napus]
Length=271

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 162/243 (67%), Gaps = 15/243 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRK--MKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDN  284
            IP HI+FI+DGNRR+++K  ++ P+  G+RA F+++  V+ YC E+GV YVT+YAF IDN
Sbjct  32   IPNHISFIMDGNRRFAKKHNLQGPDA-GHRAGFVSVTYVLQYCQEIGVPYVTLYAFGIDN  90

Query  285  FKRRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEAT  464
            FKR P+E++ +MDLML K+E  +    + +   +++ F G+L+LL+ R++ AA  +ME T
Sbjct  91   FKREPEEVKCMMDLMLEKIELTIDQAISGNLKDLKVIFAGDLNLLNERLKVAAQSLMELT  150

Query  465  KKNSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEK  644
            ++N     +V + Y++++EIV A        +K ++G +            V+ + D+E+
Sbjct  151  EQNRGLVAVVIVAYSTSHEIVQA--IRESCVRKCVDGDSPL----------VLEMSDVEE  198

Query  645  HMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRA  824
             M+  + P+ D+++R+ G  RLSNF+ WQ+S  LL++  AL+PE+GL HLVWA+LKFQR 
Sbjct  199  CMYTSIVPDPDLVIRSGGIDRLSNFMTWQSSRSLLHTTAALWPELGLWHLVWAILKFQRM  258

Query  825  HPY  833
            H Y
Sbjct  259  HDY  261



>ref|XP_010103260.1| Dehydrodolichyl diphosphate synthase 6 [Morus notabilis]
 gb|EXB95131.1| Dehydrodolichyl diphosphate synthase 6 [Morus notabilis]
Length=347

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K    E  G++A + +L+ ++ YCYELGVKYVT+YAFSIDNFK
Sbjct  32   IPDHIAFIMDGNRRYAKKQNSAEGAGHKAGYSSLMSMLGYCYELGVKYVTVYAFSIDNFK  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+++LMDLML K++ LL+++  +++YG+R++F+GNL LL+  ++ AA K M+AT K
Sbjct  92   RRPEEVQYLMDLMLEKIDELLEHEGIINQYGIRVYFIGNLKLLNEPVRVAAEKAMKATAK  151

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N+   LLVC+ YTS +EIVHA
Sbjct  152  NNKAVLLVCVAYTSRDEIVHA  172


 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  621  ITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVW  800
            I +VD+EKHM+MG+AP  DIL+R+SGETRLSNFLLWQT++C L SP  L+PE+GLRHLVW
Sbjct  269  IKLVDVEKHMYMGVAPNPDILIRSSGETRLSNFLLWQTANCSLSSPAVLWPELGLRHLVW  328

Query  801  AVLKFQRAHPYLQKRR  848
            AVL FQR++ Y +K+R
Sbjct  329  AVLNFQRSYQYFEKKR  344



>gb|ADE76815.1| unknown [Picea sitchensis]
Length=318

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/259 (38%), Positives = 156/259 (60%), Gaps = 13/259 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKH+A I+DGNRRY+ + ++ +T G++  + +L+  +  C++LG+K V++YAFSI+NFK
Sbjct  49   IPKHVAIIMDGNRRYAARRQMEKTSGHQFGYDSLMHTLRDCFDLGIKCVSVYAFSIENFK  108

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E+  LM+LM  KLEAL++ ++ + EYG+R+  +G L LL   ++ AA K M  ++ 
Sbjct  109  RSKEEVATLMNLMQEKLEALIEKESMVTEYGIRVQVLGELSLLPESVRRAAEKAMAMSRG  168

Query  471  NSNFTLLVCLVYTSTNEIV-------HAAeecckekkkLMNGTaaggaaaaaaEERV---  620
            N    L +   YTST EIV       H       E  + ++G  +      +  E +   
Sbjct  169  NEKAVLNIFAPYTSTQEIVKAVENVRHEVLTRKIEVHEKIHGFHSQDDDDGSITEEIHGL  228

Query  621  ---ITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRH  791
               +T  ++E+H++     E  +L+RTSGE RLSNFLLWQ+S   LY    L+PE     
Sbjct  229  QSSVTEDEIERHLYTADCGEPQLLIRTSGEIRLSNFLLWQSSFTFLYVTPVLWPEFSFWQ  288

Query  792  LVWAVLKFQRAHPYLQKRR  848
            LV A+L +Q+A+P LQ+++
Sbjct  289  LVKAILDYQKAYPLLQQKK  307



>ref|XP_004289931.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=244

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 143/255 (56%), Gaps = 55/255 (22%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K K+ E  G+R                                
Sbjct  33   IPHHIAFIMDGNRRYAKKRKLMEGTGHR--------------------------------  60

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
                           K+E L+K ++ ++ YGV++HF+GN+ LL   ++ AA + M AT  
Sbjct  61   --------------EKIEGLIKEESIVNRYGVKVHFIGNIKLLSEPVRLAAERAMVATSN  106

Query  471  NSNFTLLVCLVYTSTNEIVHA---AeecckekkkLMNGTaaggaaaaaaE------ERVI  623
            NS   L +C+ YTST+EI+HA   + E    +  ++N + AG       E      E ++
Sbjct  107  NSKGVLSICVAYTSTDEIMHAVQESCEEKWNEISVLNASGAGYDLDKFGENENEGRENIV  166

Query  624  TVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWA  803
             + D+E+HM+M +AP+ DIL+RTSGETRLSNFLLWQ++ C LY+P  L+PEIG RH VWA
Sbjct  167  QLTDIERHMYMAVAPDPDILIRTSGETRLSNFLLWQSAYCCLYTPSVLWPEIGFRHFVWA  226

Query  804  VLKFQRAHPYLQKRR  848
            +L FQ    YL++++
Sbjct  227  ILNFQCNRLYLERKK  241



>ref|XP_002532224.1| undecaprenyl diphosphate synthase, putative [Ricinus communis]
 gb|EEF30155.1| undecaprenyl diphosphate synthase, putative [Ricinus communis]
Length=363

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H++FI+DGNRR+++K  +    GYRA FLAL+ ++ YCYELGVK+VTI+AF IDNFK
Sbjct  25   IPSHLSFIMDGNRRFTKKENLKPGAGYRAGFLALMSMLKYCYELGVKHVTIFAFGIDNFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE+ F+MDL+L K   LLK ++ + +YG+R+HF+GNL LLD  ++ AA KV   T  
Sbjct  85   RRPDEVRFIMDLILEKTLGLLKEESIVHQYGIRVHFIGNLKLLDEPLRVAAEKVTRTTSS  144

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N+ F LL+C+ Y+STNEI HA
Sbjct  145  NTKFVLLICVAYSSTNEITHA  165


 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            +I  VDLEKHM M +AP+ DIL+RTSGETRLSNFLLWQ   C  YSP AL+P+I LR LV
Sbjct  284  IIKQVDLEKHMPMAVAPDPDILIRTSGETRLSNFLLWQAGDCQGYSPDALWPDIVLRQLV  343

Query  798  WAVLKFQRAHPYLQKRR  848
            WAVL FQ  + YL+K++
Sbjct  344  WAVLNFQYNYAYLEKKK  360



>gb|KDP43760.1| hypothetical protein JCGZ_22387 [Jatropha curcas]
Length=339

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFI+DGNRRY++K  +    G+RA F +L+ ++ YCYELGVKYVTIYAFSIDNFK
Sbjct  4    IPSHFAFIMDGNRRYAKKGNLKLGAGHRAGFESLISILKYCYELGVKYVTIYAFSIDNFK  63

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++ LMDLML K++ LLK ++   +YG+R++F+GNL LL   ++ AA KVM AT  
Sbjct  64   RRPDEVKDLMDLMLEKIDELLKEESMAKQYGIRVYFIGNLKLLSENVRIAAEKVMRATAN  123

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N+  TLL+CL YTS +EI+HA
Sbjct  124  NTKCTLLICLAYTSRDEILHA  144


 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 96/139 (69%), Gaps = 8/139 (6%)
 Frame = +3

Query  456  EATKKNSNFTLL---VCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEE----  614
            +AT  ++N + L   V  V T  + ++HA     +++  + N T  G A    +E+    
Sbjct  198  QATAASANCSGLIREVGGVDTENSMVMHAVHTSYEDQAVMANRTGHGVAPIEESEKMQGE  257

Query  615  -RVITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRH  791
              +I +VD+EK+M+M +APE DILVR+SGETRLSNFLLWQ+S+CLLYSP AL+PEIGL H
Sbjct  258  CSMIKLVDIEKYMYMAVAPEPDILVRSSGETRLSNFLLWQSSNCLLYSPDALWPEIGLWH  317

Query  792  LVWAVLKFQRAHPYLQKRR  848
            LVWA+L FQR H YL+K++
Sbjct  318  LVWAILDFQRNHSYLEKKK  336



>ref|XP_002975000.1| hypothetical protein SELMODRAFT_102749 [Selaginella moellendorffii]
 gb|EFJ23785.1| hypothetical protein SELMODRAFT_102749 [Selaginella moellendorffii]
Length=310

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 147/250 (59%), Gaps = 3/250 (1%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+HIA I+DGNRR++ +  I    G+   + +L+  +  C +LGV+YVT+YAFSIDNF 
Sbjct  26   VPQHIAIIMDGNRRFADRAGIDRKSGHGFGYDSLIQTLELCLDLGVRYVTVYAFSIDNFA  85

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E+  LM+LM  KL+ L+  +      G+R+  +G+L LL   ++A+A + M ATK 
Sbjct  86   RSQEEVSALMELMREKLDLLVSNEGLATAKGIRVCVLGDLTLLPEDVRASANRAMAATKH  145

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaa---aEERVITVVDLE  641
            NS   L +C+ YTST EIV+A  E  KE   L +         ++     +  IT   +E
Sbjct  146  NSITVLNICVAYTSTQEIVNATREAVKEALGLSSSKVLDSYFLSSFLFTLDSQITKESIE  205

Query  642  KHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQR  821
            +H++   +P  D+L+RTSGETRLSNF+LWQ     L     L+P    RHL W + ++Q+
Sbjct  206  RHLYTAGSPWPDVLIRTSGETRLSNFMLWQACHSHLAFCNVLWPNFSFRHLFWIIFQYQK  265

Query  822  AHPYLQKRRI  851
            ++  LQ   I
Sbjct  266  SYRSLQHHWI  275



>ref|XP_008241952.1| PREDICTED: rubber cis-polyprenyltransferase HRT2 [Prunus mume]
 ref|XP_008241953.1| PREDICTED: rubber cis-polyprenyltransferase HRT2 [Prunus mume]
Length=362

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRRY+++  +P   G++A +LAL+ ++ YCYELGVKYVT+YAFSIDNFK
Sbjct  32   IPEHIAFIMDGNRRYAKRRNLPVAEGHKAGYLALMSILRYCYELGVKYVTVYAFSIDNFK  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ LMDL+  K+E LL+ ++ +++YG+R++F+GNL LL+  ++ AA K M+AT  
Sbjct  92   RRPEEVQTLMDLLQEKIEVLLEKESIVNQYGIRVYFIGNLKLLNEPVRVAAEKAMKATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            NS   LL+C+ YTS +EIVHA
Sbjct  152  NSKAVLLICVAYTSCDEIVHA  172


 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  621  ITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVW  800
            + +VD+EKH++M +AP+ DI++RTSGETRLSNFLLWQTS+C LYSP AL+PE+GL HLVW
Sbjct  284  VKLVDVEKHLYMAVAPDPDIMIRTSGETRLSNFLLWQTSNCPLYSPAALWPELGLWHLVW  343

Query  801  AVLKFQRAHPYLQKRR  848
            AVL FQR H YL+K+R
Sbjct  344  AVLNFQRNHYYLEKKR  359



>ref|XP_007522612.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Erinaceus 
europaeus]
Length=333

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLLEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   I+   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDISESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ +H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-TLWPEYTFWNLCEAILQFQMSH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  NMLQKARDM  260



>ref|XP_007202102.1| hypothetical protein PRUPE_ppa007586mg [Prunus persica]
 gb|EMJ03301.1| hypothetical protein PRUPE_ppa007586mg [Prunus persica]
Length=362

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP+HIAFI+DGNRRY+++  +P   G++A +LAL+ ++ YCYELGVKYVT+YAFSIDNFK
Sbjct  32   IPEHIAFIMDGNRRYAKRRNLPVAEGHKAGYLALMSILRYCYELGVKYVTVYAFSIDNFK  91

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E++ LMDL+  K+E LL+ ++ +++YG+R++F+GNL LL+  ++ AA K M+AT  
Sbjct  92   RRPEEVQTLMDLLQEKIEVLLEKESIVNQYGIRVYFIGNLKLLNEPVRDAAEKAMKATAN  151

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            NS   LL+C+ YTS +EIVHA
Sbjct  152  NSKAVLLICVAYTSCDEIVHA  172


 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  621  ITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVW  800
            + +VD+EKH++M +AP+ DI++RTSGETRLSNFLLWQTS+C LYSP AL+PE+GL HLVW
Sbjct  284  VKLVDVEKHLYMAVAPDPDIMIRTSGETRLSNFLLWQTSNCPLYSPAALWPELGLWHLVW  343

Query  801  AVLKFQRAHPYLQKRR  848
            AVL FQR H YL+K+R
Sbjct  344  AVLNFQRNHYYLEKKR  359



>emb|CDP18561.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 135/195 (69%), Gaps = 9/195 (5%)
 Frame = +3

Query  204  LALVCVICYCYELGVKYVTIYAFSIDNFKRRPDEIEFLMDLMLTKLEALLKYQNALDEYG  383
            LAL+ ++ YCYELGVKYVTIYAF+IDNF+RRP+E++  M L+L K+E L++ ++ +++YG
Sbjct  11   LALMNMLKYCYELGVKYVTIYAFNIDNFRRRPEEVQSTMRLILEKIEDLIEEESMVNQYG  70

Query  384  VRIHFVGNLHLLDSRIQAAAGKVMEATKKNSNFTLLVCLVYTSTNEIVHAAee-------  542
            VRI+F+G+L LL   ++ AA + + AT +NS   L +CL YTS++EI+HA +E       
Sbjct  71   VRIYFLGSLKLLSKPVRLAAERAVVATSRNSKAVLSICLAYTSSDEILHAVQECCEEKWD  130

Query  543  --cckekkkLMNGTaaggaaaaaaEERVITVVDLEKHMFMGLAPEVDILVRTSGETRLSN  716
                 E K   NG            +  I V DLEK+++  +AP+ DI+++TSGETRLSN
Sbjct  131  EGSALESKGAGNGLLFLKGNKNDKSKPSIVVKDLEKNIYAAVAPDPDIIIQTSGETRLSN  190

Query  717  FLLWQTSSCLLYSPG  761
            FLLWQ+++CLLY+ G
Sbjct  191  FLLWQSANCLLYAFG  205



>ref|XP_011022162.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 isoform X2 
[Populus euphratica]
 ref|XP_011022163.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 isoform X3 
[Populus euphratica]
Length=368

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFI+DGNRRY++K K+ E  G+RA F  L+ ++ YCYELGV YVTIYAFSI+NFK
Sbjct  33   IPNHFAFIMDGNRRYAKKEKLEEGAGHRAGFSVLMSMLKYCYELGVTYVTIYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+PDE++ LMDL+L K+E LLK ++ +++YG+R++F+GNL LL   ++ AA KVM+AT K
Sbjct  93   RKPDEVQSLMDLILEKIEGLLKEESIVNKYGIRVYFIGNLKLLSEPVRVAAEKVMKATAK  152

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N+   LL+C+ YTS +EIV A
Sbjct  153  NTKCVLLICMAYTSCDEIVQA  173


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 3/76 (4%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            ++ VVD+E HM+M +AP  DI++R+SGETRLSNFLLWQT + LLYSP AL+P++ L HLV
Sbjct  292  ILKVVDIESHMYMSVAPNPDIVIRSSGETRLSNFLLWQTRNSLLYSPNALWPDMRLWHLV  351

Query  798  WAVLKFQRAHPYLQKR  845
             AVL FQR    LQK+
Sbjct  352  RAVLDFQR---ILQKK  364



>ref|XP_006924448.1| PREDICTED: dehydrodolichyl diphosphate synthase [Pteropus alecto]
Length=333

 Score =   181 bits (458),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 148/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG++ VT+YAFSI+NFK
Sbjct  25   IPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLHWCLNLGIREVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E+E LMD+   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVEGLMDMARQKFSRLLEEQEKLQKHGVCIRVLGDLHLLPLDLQELMAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTYHSPNPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYMFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|NP_080420.2| dehydrodolichyl diphosphate syntase complex subunit Dhdds [Mus 
musculus]
 sp|Q99KU1.1|DHDDS_MOUSE RecName: Full=Dehydrodolichyl diphosphate syntase complex subunit 
Dhdds; AltName: Full=Cis-isoprenyltransferase; Short=CIT; 
Short=Cis-IPTase [Mus musculus]
 gb|AAH04011.1| Dhdds protein [Mus musculus]
 dbj|BAC34020.1| unnamed protein product [Mus musculus]
 dbj|BAE22416.1| unnamed protein product [Mus musculus]
 dbj|BAE42313.1| unnamed protein product [Mus musculus]
 dbj|BAE28748.1| unnamed protein product [Mus musculus]
 gb|EDL30042.1| dehydrodolichyl diphosphate synthase, isoform CRA_c [Mus musculus]
Length=333

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEIANAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQR H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQRNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  GALQKARDM  260



>gb|EDL30040.1| dehydrodolichyl diphosphate synthase, isoform CRA_a [Mus musculus]
Length=336

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  28   VPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  87

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  88   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQATKN  147

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  148  YNKCFLNVCFAYTSRHEIANAVREMAWGVEQGL------------LEPSDVSESLLDKCL  195

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQR H
Sbjct  196  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQRNH  254

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  255  GALQKARDM  263



>ref|XP_011022157.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 isoform X1 
[Populus euphratica]
 ref|XP_011022158.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 isoform X1 
[Populus euphratica]
 ref|XP_011022159.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 isoform X1 
[Populus euphratica]
 ref|XP_011022160.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 isoform X1 
[Populus euphratica]
 ref|XP_011022161.1| PREDICTED: dehydrodolichyl diphosphate synthase 6 isoform X1 
[Populus euphratica]
Length=371

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFI+DGNRRY++K K+ E  G+RA F  L+ ++ YCYELGV YVTIYAFSI+NFK
Sbjct  33   IPNHFAFIMDGNRRYAKKEKLEEGAGHRAGFSVLMSMLKYCYELGVTYVTIYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+PDE++ LMDL+L K+E LLK ++ +++YG+R++F+GNL LL   ++ AA KVM+AT K
Sbjct  93   RKPDEVQSLMDLILEKIEGLLKEESIVNKYGIRVYFIGNLKLLSEPVRVAAEKVMKATAK  152

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N+   LL+C+ YTS +EIV A
Sbjct  153  NTKCVLLICMAYTSCDEIVQA  173


 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            ++ VVD+E HM+M +AP  DI++R+SGETRLSNFLLWQT + LLYSP AL+P++ L HLV
Sbjct  292  ILKVVDIESHMYMSVAPNPDIVIRSSGETRLSNFLLWQTRNSLLYSPNALWPDMRLWHLV  351

Query  798  WAVLKFQRAHPYLQKRR  848
            WAVL FQR H Y +K++
Sbjct  352  WAVLDFQRNHSYFEKKK  368



>ref|XP_008146265.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Eptesicus 
fuscus]
Length=333

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 148/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKH+AFI+DGNRRY++K ++    G+   F  L   + +C  LG++ VT+YAFSI+NFK
Sbjct  25   IPKHVAFIMDGNRRYAKKCQVEHQEGHSQGFNKLAETLHWCLNLGIREVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMD+   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDMARQKFGRLLEEQEKLKKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNQCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPNPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYMFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_008517718.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X6 [Equus 
przewalskii]
Length=272

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 147/251 (59%), Gaps = 14/251 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIMVS  860
              LQ  R  VS
Sbjct  252  SMLQSSRFGVS  262



>ref|XP_005353142.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Microtus 
ochrogaster]
 ref|XP_005353143.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Microtus 
ochrogaster]
Length=334

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVKRQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L +YGV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSQSEVDGLLDLARQKFSCLMEEQEKLKKYGVCIRVLGDLHLLPLDLQEKIAQAVQATKS  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSETLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK + M
Sbjct  252  SALQKAQDM  260



>gb|EPY77518.1| dehydrodolichyl diphosphate synthase isoform 2 [Camelus ferus]
Length=317

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  9    MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  68

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  69   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  128

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  129  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  176

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  177  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  235

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  236  SVLQKARDM  244



>ref|XP_006159506.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Tupaia 
chinensis]
 ref|XP_006159507.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Tupaia 
chinensis]
 gb|ELW47657.1| Dehydrodolichyl diphosphate synthase [Tupaia chinensis]
Length=334

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E+E LMDL   K   LL+ Q  L +YGV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSESEVEGLMDLARQKFSRLLEEQEKLQKYGVCIRVLGDLHLLPLDLQQLIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPNPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNLCEAILQFQTNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|NP_001231052.1| dehydrodolichyl diphosphate synthase [Sus scrofa]
Length=333

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNRCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTSWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_003364481.1| PREDICTED: dehydrodolichyl diphosphate synthase isoformX2 [Equus 
caballus]
 ref|XP_008517716.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X4 [Equus 
przewalskii]
Length=333

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_007522611.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Erinaceus 
europaeus]
Length=334

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLLEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   I+   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDISESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ +H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-TLWPEYTFWNLCEAILQFQMSH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  NMLQQK  257



>ref|XP_004671262.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Jaculus 
jaculus]
Length=333

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 146/247 (59%), Gaps = 14/247 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   LPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L+K Q  L++YGV I  +G+LHLL   +Q A  + ++ TK 
Sbjct  85   RSKSEVDGLLDLAREKFSNLMKEQEKLEKYGVCIRVLGDLHLLPLDLQQAIAQAIQTTKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI  A        K++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITSAV-------KEMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  D+L+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YSNHSPNPDVLIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILRYQMNH  251

Query  828  PYLQKRR  848
              LQK R
Sbjct  252  SALQKAR  258



>ref|XP_002750512.2| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Callithrix 
jacchus]
 ref|XP_008998951.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Callithrix 
jacchus]
Length=333

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_004741156.1| PREDICTED: non-histone chromosomal protein HMG-17-like isoform 
X2 [Mustela putorius furo]
 ref|XP_004783423.1| PREDICTED: non-histone chromosomal protein HMG-17-like isoform 
X2 [Mustela putorius furo]
Length=333

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFGRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYAFWNLCEAILQYQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_006189546.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Camelus 
ferus]
Length=333

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|NP_001011978.1| dehydrodolichyl diphosphate synthase [Rattus norvegicus]
 gb|AAH85875.1| Dehydrodolichyl diphosphate synthase [Rattus norvegicus]
 gb|EDL80695.1| rCG31494 [Rattus norvegicus]
Length=333

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLKKHGVCIRVLGDLHLLPLDLQKKIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L++ +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSESLLDQCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P+ DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPQPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SALQKARDM  260



>ref|XP_006196879.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Vicugna 
pacos]
Length=333

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKGEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_010378712.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS isoform X2 [Rhinopithecus roxellana]
Length=333

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_006862321.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Chrysochloris 
asiatica]
Length=333

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKNEVDGLMDLARQKFNRLMEEQEKLQKHGVCIRVLGDLHLLPVDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        K++  G   G    +   E +I     +K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------KEMAWGVEQGLLEPSDISESLI-----DKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +   A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNFCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>dbj|BAC29643.1| unnamed protein product [Mus musculus]
Length=333

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 145/249 (58%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHI FI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHILFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEIANAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQR H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQRNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  GALQKARDM  260



>ref|XP_003271703.2| PREDICTED: dehydrodolichyl diphosphate synthase isoform 1 [Nomascus 
leucogenys]
 ref|XP_005544387.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X3 [Macaca 
fascicularis]
 ref|XP_005544388.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X4 [Macaca 
fascicularis]
 ref|XP_008959913.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Pan 
paniscus]
Length=333

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_004425831.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform 1 [Ceratotherium 
simum simum]
Length=333

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFGRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_004592278.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Ochotona 
princeps]
Length=333

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L+++GV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLEKHGVCIRVLGDLHLLPLDLQELIAQAVRATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTSHSPPPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_006102018.1| PREDICTED: dehydrodolichyl diphosphate synthase [Myotis lucifugus]
Length=333

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 148/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKH+AFI+DGNRRY++K ++    G+   F  L   + +C  LG++ VT+YAFSI+NFK
Sbjct  25   IPKHVAFIMDGNRRYAKKCQVEHNEGHSQGFNKLAETLHWCLALGIREVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LM++   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMEMARQKFGRLLEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNQCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPNPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYMFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_009449602.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Pan 
troglodytes]
 ref|XP_009449609.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Pan 
troglodytes]
Length=333

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_005079629.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Mesocricetus 
auratus]
Length=333

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 146/247 (59%), Gaps = 14/247 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFTCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIARAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A +E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVKEMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRR  848
              LQK R
Sbjct  252  SALQKAR  258



>gb|ELK02098.1| Dehydrodolichyl diphosphate synthase [Pteropus alecto]
Length=334

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 147/246 (60%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG++ VT+YAFSI+NFK
Sbjct  25   IPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLHWCLNLGIREVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E+E LMD+   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVEGLMDMARQKFSRLLEEQEKLQKHGVCIRVLGDLHLLPLDLQELMAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTYHSPNPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYMFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_006975699.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Peromyscus 
maniculatus bairdii]
Length=333

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 145/249 (58%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKH+AFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHVAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SALQKARDM  260



>ref|XP_004678707.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Condylura 
cristata]
Length=333

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 145/247 (59%), Gaps = 14/247 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q+ L ++GV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKSEVDGLMDLARQKFTRLMEEQDKLQKHGVCIRVLGDLHLLPLDLQELIAQAVRATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRR  848
              LQK R
Sbjct  252  SMLQKAR  258



>dbj|BAC28657.1| unnamed protein product [Mus musculus]
Length=334

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 145/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEIANAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQR H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQRNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  GALQQK  257



>ref|XP_007648553.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X3 [Cricetulus 
griseus]
 ref|XP_007625407.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X3 [Cricetulus 
griseus]
 gb|ERE84166.1| dehydrodolichyl diphosphate synthase isoform 2 [Cricetulus griseus]
Length=333

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 145/249 (58%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  GALQKARDM  260



>gb|KDO71463.1| hypothetical protein CISIN_1g017611mg [Citrus sinensis]
Length=368

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFI+DGNRRY++K+ + E  G++  F +L+ V+ YCYELGVKYVTIYAFSIDNF+
Sbjct  39   IPHHFAFIMDGNRRYAKKLNVEEGAGHKEGFSSLISVLKYCYELGVKYVTIYAFSIDNFQ  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++ LMDL+L K+  LLK Q+ ++ YG+R++F+GNL  L   ++ AA +VM AT +
Sbjct  99   RKPAEVQNLMDLLLEKINELLKEQSIVNLYGIRVYFIGNLKFLSEPVRVAAEEVMMATAR  158

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            NS   LLVCL YTS +EIVHA
Sbjct  159  NSKVVLLVCLAYTSADEIVHA  179


 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            +I +VD+EKHM+M +AP+ DIL+R+SGETRLSNFLLWQTS+CLL SP AL+PEIGL HLV
Sbjct  289  IINLVDVEKHMYMAVAPDPDILMRSSGETRLSNFLLWQTSNCLLDSPAALWPEIGLWHLV  348

Query  798  WAVLKFQRAHPYLQKRR  848
            WAVLKFQR H +L+K++
Sbjct  349  WAVLKFQRNHSFLEKKK  365



>ref|XP_005875214.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Myotis 
brandtii]
 ref|XP_006777564.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X3 [Myotis 
davidii]
Length=333

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 148/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKH+AFI+DGNRRY++K ++    G+   F  L   + +C  LG++ VT+YAFSI+NFK
Sbjct  25   IPKHVAFIMDGNRRYAKKCQVEHHEGHSQGFNKLAETLHWCLALGIREVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LM++   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMEMARQKFGRLLEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNQCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPNPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYMFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_004603526.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Sorex 
araneus]
Length=333

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/247 (42%), Positives = 146/247 (59%), Gaps = 14/247 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E+E LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVEGLMDLARQKFTRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQKLIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRR  848
              LQK R
Sbjct  252  SMLQKAR  258



>ref|XP_006382994.1| hypothetical protein POPTR_0005s10380g [Populus trichocarpa]
 ref|XP_006382995.1| hypothetical protein POPTR_0005s10380g [Populus trichocarpa]
 gb|ERP60791.1| hypothetical protein POPTR_0005s10380g [Populus trichocarpa]
 gb|ERP60792.1| hypothetical protein POPTR_0005s10380g [Populus trichocarpa]
Length=371

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFI+DGNRRY++K K+ E  G+RA F  L+ ++ YCYELGV YVTIYAFSI+NFK
Sbjct  33   IPNHFAFIMDGNRRYAKKEKLEEGAGHRAGFSVLMSMLKYCYELGVTYVTIYAFSIENFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+PDE++ LMDL+L K+E LLK ++ +++YG+R++F+GNL LL   ++ AA KVM+AT  
Sbjct  93   RKPDEVQNLMDLILEKIEGLLKEESLVNKYGIRVYFIGNLKLLSKPVRVAAEKVMKATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N+   LL+C+ YTS +EIV A
Sbjct  153  NTKCVLLICIAYTSCDEIVQA  173


 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            ++ VVD+E HM+M +AP  DI++R+SGETRLSNFLLWQTS+CLLYSP AL+P++ L HLV
Sbjct  292  ILKVVDIESHMYMSVAPNPDIVIRSSGETRLSNFLLWQTSNCLLYSPNALWPDMRLWHLV  351

Query  798  WAVLKFQRAHPYLQKRR  848
            WAVL FQR H Y +K++
Sbjct  352  WAVLDFQRNHSYFEKKK  368



>ref|XP_006467074.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Citrus 
sinensis]
Length=368

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFI+DGNRRY++K+ + E  G++  F +L+ V+ YCYELGVKYVTIYAFSIDNF+
Sbjct  39   IPHHFAFIMDGNRRYAKKLNVEEGAGHKEGFSSLISVLKYCYELGVKYVTIYAFSIDNFQ  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++ LMDL+L K+  LLK Q+ ++ YG+R++F+GNL  L   ++ AA +VM AT +
Sbjct  99   RKPAEVQNLMDLLLEKINELLKEQSIVNLYGIRVYFIGNLKFLSEPVRVAAEEVMMATAR  158

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            NS   LLVCL YTS +EIVHA
Sbjct  159  NSKVVLLVCLAYTSADEIVHA  179


 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            +I +VD+EKHM+M +AP+ DIL+R+SGETRLSNFLLWQTS+CLL SP AL+PEIGL  LV
Sbjct  289  IINLVDVEKHMYMAVAPDPDILMRSSGETRLSNFLLWQTSNCLLDSPAALWPEIGLWDLV  348

Query  798  WAVLKFQRAHPYLQKRR  848
            W VL FQR H +L+K++
Sbjct  349  WTVLNFQRNHSFLEKKK  365



>ref|XP_006425294.1| hypothetical protein CICLE_v10025904mg [Citrus clementina]
 gb|ESR38534.1| hypothetical protein CICLE_v10025904mg [Citrus clementina]
Length=368

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP H AFI+DGNRRY++K+ + E  G++  F +L+ V+ YCYELGVKYVTIYAFSIDNF+
Sbjct  39   IPHHFAFIMDGNRRYAKKLNVEEGAGHKEGFSSLISVLKYCYELGVKYVTIYAFSIDNFQ  98

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E++ LMDL+L K+  LLK Q+ ++ YG+R++F+GNL  L   ++ AA +VM AT +
Sbjct  99   RKPAEVQNLMDLLLEKINELLKEQSIVNLYGIRVYFIGNLKFLSEPVRVAAEEVMMATAR  158

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            NS   LLVCL YTS +EIVHA
Sbjct  159  NSKVVLLVCLAYTSADEIVHA  179


 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            +I +VD+EKHM+M +AP+ DIL+R+SGETRLSNFLLWQTS+CLL SP AL+PEIGL HLV
Sbjct  289  IINLVDVEKHMYMAVAPDPDILMRSSGETRLSNFLLWQTSNCLLDSPAALWPEIGLWHLV  348

Query  798  WAVLKFQRAHPYLQKRR  848
            W VL FQR H +L+K++
Sbjct  349  WTVLNFQRNHSFLEKKK  365



>ref|XP_007111387.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X3 [Physeter 
catodon]
Length=333

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ +  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_004266689.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform 1 [Orcinus 
orca]
Length=333

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ +  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_007178720.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X4 [Balaenoptera 
acutorostrata scammoni]
Length=333

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ +  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_004705138.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Echinops 
telfairi]
Length=333

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 145/249 (58%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ TK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPIDLQQLIAQAVQTTKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             S   L VC  YTS +EI +A        +++  G   G    +   E +     LEK +
Sbjct  145  YSKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LEKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +   A+L+FQ  H
Sbjct  193  YTCRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNFCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>gb|EDL30041.1| dehydrodolichyl diphosphate synthase, isoform CRA_b [Mus musculus]
Length=355

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 145/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  46   VPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  105

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  106  RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQATKN  165

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  166  YNKCFLNVCFAYTSRHEIANAVREMAWGVEQGL------------LEPSDVSESLLDKCL  213

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQR H
Sbjct  214  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQRNH  272

Query  828  PYLQKR  845
              LQ++
Sbjct  273  GALQQK  278



>ref|XP_005004328.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X5 [Cavia 
porcellus]
Length=333

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 147/251 (59%), Gaps = 14/251 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E++ ++DL   K   L+K Q  L +YGV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKNEVDGILDLAREKFSYLMKEQEKLQKYGVCIRVLGDLHLLPLDLQELIAQAVRATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSECLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YTHHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNLCEAILQYQMNH  251

Query  828  PYLQKRRIMVS  860
              LQK R M +
Sbjct  252  SMLQKARDMYA  262



>ref|XP_004377136.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform 1 [Trichechus 
manatus latirostris]
Length=333

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++AT+ 
Sbjct  85   RSKSEVDGLMDLARQKFTRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATRN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_004642897.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Octodon 
degus]
Length=333

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/252 (41%), Positives = 149/252 (59%), Gaps = 16/252 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E++ ++DL   K   L+K Q  L +YGV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKNEVDGILDLAREKFSYLMKEQEKLQKYGVCIRVLGDLHLLPLDLQELIAQAVRATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecc-kekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
             +   L VC  YTS +EI +A  E     ++ L++ +              I+   L+K 
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGLLDPSD-------------ISECLLDKC  191

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRA  824
            ++   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  AVL++Q  
Sbjct  192  LYTHHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNLCEAVLQYQMN  250

Query  825  HPYLQKRRIMVS  860
            H  LQK R M +
Sbjct  251  HSVLQKARDMYA  262



>ref|XP_010343684.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS isoform X2 [Saimiri boliviensis boliviensis]
Length=333

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI  A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISSAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              L+K R M
Sbjct  252  SVLEKARDM  260



>ref|XP_007459177.1| PREDICTED: LOW QUALITY PROTEIN: dehydrodolichyl diphosphate synthase 
[Lipotes vexillifer]
Length=340

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ +  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_010593406.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS isoform X2 [Loxodonta africana]
Length=368

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  60   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  119

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + +EAT+ 
Sbjct  120  RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVEATRN  179

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             +   I+   L+K +
Sbjct  180  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LDPSDISESLLDKCL  227

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  228  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  286

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  287  SALQKARDM  295



>ref|XP_005203239.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS isoform X2 [Bos taurus]
Length=333

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ TK 
Sbjct  85   RSKSEVDGLMDLAREKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELVAQAVQTTKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>dbj|BAE90366.1| unnamed protein product [Macaca fascicularis]
Length=279

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>ref|XP_004478838.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform 4 [Dasypus 
novemcinctus]
Length=333

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 145/254 (57%), Gaps = 24/254 (9%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGIMEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++AT+ 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATRN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVD-----  635
             +   L VC  YTS +EI +A                     A   EE ++   D     
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-----------------REMAWGVEEGLLDPSDVSESL  187

Query  636  LEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLK  812
            L+K ++   +P  DIL+RTSGE RLS+FLLWQTS +CL++ P  L+PE    +L  A+L+
Sbjct  188  LDKCLYTNHSPHPDILIRTSGEVRLSDFLLWQTSHTCLVFQP-VLWPEYTFWNLCEAILQ  246

Query  813  FQRAHPYLQKRRIM  854
            FQ  H  LQK R M
Sbjct  247  FQMNHSMLQKARDM  260



>ref|XP_008146264.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Eptesicus 
fuscus]
Length=334

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 147/246 (60%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IPKH+AFI+DGNRRY++K ++    G+   F  L   + +C  LG++ VT+YAFSI+NFK
Sbjct  25   IPKHVAFIMDGNRRYAKKCQVEHQEGHSQGFNKLAETLHWCLNLGIREVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMD+   K   LL+ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDMARQKFGRLLEEQEKLKKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNQCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPNPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYMFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>gb|EFB27183.1| hypothetical protein PANDA_001151 [Ailuropoda melanoleuca]
Length=320

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 147/246 (60%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  11   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  70

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  71   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  130

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  131  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  178

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P+ DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  179  YTNHSPQPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQYQMNH  237

Query  828  PYLQKR  845
              LQ++
Sbjct  238  SMLQQK  243



>ref|XP_008835042.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Nannospalax 
galili]
Length=333

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 146/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFTCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAVQATKH  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A +E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVKEMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSSHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYIFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SALQKARDM  260



>gb|AAH03643.1| Dehydrodolichyl diphosphate synthase [Homo sapiens]
 gb|ADU87642.1| epididymis secretory sperm binding protein Li 189m [Homo sapiens]
 gb|ADZ15897.1| dehydrodolichyl diphosphate synthase [synthetic construct]
 gb|AIC57145.1| DHDDS, partial [synthetic construct]
Length=333

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ +  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_002521712.1| undecaprenyl diphosphate synthase, putative [Ricinus communis]
 gb|EEF40699.1| undecaprenyl diphosphate synthase, putative [Ricinus communis]
Length=381

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            IP HIAFI+DGNRRY++K  + E  G+RA F AL+ ++ YCYELGVKYVT+YAFSIDNFK
Sbjct  33   IPNHIAFIMDGNRRYAKKENMKEGAGHRAGFSALISILKYCYELGVKYVTVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRPDE++ LMDLML K+E LLK ++ +++YG+R++F+GNL LL+  ++ AA KVM AT  
Sbjct  93   RRPDEVQDLMDLMLEKIEELLKEESIVNQYGIRVYFIGNLTLLNEPVRIAAEKVMRATAN  152

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N+  T L+C+ YTS +EIVHA
Sbjct  153  NTKCTFLICIAYTSCDEIVHA  173


 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  618  VITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLV  797
            +I +VD+E++M+M +APE DIL+R+SGETRLSNFLLWQ S C+LYSP AL+PEIG +HLV
Sbjct  278  LIKLVDIERNMYMAVAPEPDILIRSSGETRLSNFLLWQASDCMLYSPDALWPEIGFQHLV  337

Query  798  WAVLKFQR  821
            W V+ FQ+
Sbjct  338  WVVINFQQ  345



>ref|NP_995583.1| dehydrodolichyl diphosphate syntase complex subunit DHDDS isoform 
1 [Homo sapiens]
 sp|Q86SQ9.3|DHDDS_HUMAN RecName: Full=Dehydrodolichyl diphosphate syntase complex subunit 
DHDDS; AltName: Full=Cis-isoprenyltransferase; Short=CIT; 
Short=Cis-IPTase; AltName: Full=Epididymis tissue protein 
Li 189m [Homo sapiens]
 dbj|BAC57588.1| dehydrodolichyl diphosphate synthase [Homo sapiens]
 gb|EAX07810.1| dehydrodolichyl diphosphate synthase, isoform CRA_d [Homo sapiens]
 gb|EAX07812.1| dehydrodolichyl diphosphate synthase, isoform CRA_d [Homo sapiens]
Length=333

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ +  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_006055514.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Bubalus 
bubalis]
Length=333

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 145/249 (58%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L +YGV I  +G+LHLL   +Q    + ++ T+ 
Sbjct  85   RSKSEVDGLMDLAREKFSRLMEEQEKLQKYGVCIRVLGDLHLLPLDLQELVAQAVQTTRN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L +C  YTS +EI  A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNICFAYTSRHEISSAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SMLQKARDM  260



>ref|XP_004671263.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Jaculus 
jaculus]
Length=334

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 145/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   LPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L+K Q  L++YGV I  +G+LHLL   +Q A  + ++ TK 
Sbjct  85   RSKSEVDGLLDLAREKFSNLMKEQEKLEKYGVCIRVLGDLHLLPLDLQQAIAQAIQTTKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI  A        K++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITSAV-------KEMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  D+L+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YSNHSPNPDVLIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILRYQMNH  251

Query  828  PYLQKR  845
              LQ R
Sbjct  252  SALQVR  257



>ref|XP_002913352.1| PREDICTED: dehydrodolichyl diphosphate synthase-like [Ailuropoda 
melanoleuca]
Length=334

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 147/246 (60%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P+ DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YTNHSPQPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQYQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_007933962.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Orycteropus 
afer afer]
Length=333

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 145/249 (58%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE        A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWKFCEAILQFQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  SVLQKARDM  260



>ref|XP_005079628.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Mesocricetus 
auratus]
Length=334

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFTCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIARAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A +E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVKEMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SALQQK  257



>ref|XP_005607366.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X4 [Equus 
caballus]
 ref|XP_008517715.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X3 [Equus 
przewalskii]
Length=334

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_006189547.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Camelus 
ferus]
 ref|XP_010946317.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS [Camelus bactrianus]
Length=334

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>ref|XP_008998948.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Callithrix 
jacchus]
 ref|XP_008998949.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Callithrix 
jacchus]
 ref|XP_008998950.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Callithrix 
jacchus]
Length=334

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>ref|XP_004881152.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Heterocephalus 
glaber]
Length=333

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 147/249 (59%), Gaps = 14/249 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E++ ++DL   K   L+K Q  L +YGV +  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKNEVDGILDLAREKFSYLMKEQEKLQKYGVCVRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI  A +E     ++ +             +   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITSAVKEMAWGVEQGL------------LDPSDVSECLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YTHHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQYQMNH  251

Query  828  PYLQKRRIM  854
              LQK R M
Sbjct  252  NVLQKARDM  260



>ref|XP_004741155.1| PREDICTED: non-histone chromosomal protein HMG-17-like isoform 
X1 [Mustela putorius furo]
 ref|XP_004783422.1| PREDICTED: non-histone chromosomal protein HMG-17-like isoform 
X1 [Mustela putorius furo]
Length=334

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 145/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFGRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYAFWNLCEAILQYQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_004603527.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Sorex 
araneus]
Length=334

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E+E LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVEGLMDLARQKFTRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQKLIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_007046514.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
[Theobroma cacao]
 gb|EOX90671.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
[Theobroma cacao]
Length=371

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY++K  + E  G++A + AL+ ++ YCYELG+KYVT+YAFSI+NFK
Sbjct  37   LPAHLAFIMDGNRRYAKKNNLDEGDGHKAGYQALMSLLHYCYELGIKYVTVYAFSIENFK  96

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+PDE+  LMDLML K+E LL  ++ +++YG+R++F+GNL LL   ++AAA  VM+ T  
Sbjct  97   RQPDEVRSLMDLMLEKIEGLLMEESIVNQYGIRVYFIGNLQLLSEPVRAAAENVMQVTAN  156

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N    LLVC+ YTS++EIVHA
Sbjct  157  NDKAVLLVCVAYTSSDEIVHA  177


 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  609  EERVITVVDLEKHMFMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLR  788
            E   I +VD+EKHM+M +AP+ DIL+R+SGETRLSNFLLWQTS C LYSP  L+PEIGL 
Sbjct  289  EHPAIKLVDVEKHMYMAVAPDPDILIRSSGETRLSNFLLWQTSHCPLYSPAVLWPEIGLW  348

Query  789  HLVWAVLKFQRAHPYLQKRR  848
             LVWA+L FQR H YL+K++
Sbjct  349  QLVWAILNFQRTHSYLEKKK  368



>ref|XP_010992037.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS, partial [Camelus dromedarius]
Length=326

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  GVLQQK  257



>ref|XP_007043053.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007043054.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX98884.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX98885.1| Undecaprenyl pyrophosphate synthetase family protein, putative 
isoform 1 [Theobroma cacao]
Length=213

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 121/191 (63%), Gaps = 15/191 (8%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P H+AFI+DGNRRY+R+  + E  G+ A F AL+ ++ Y  ELG+KY T+YAFSIDNFK
Sbjct  34   VPAHVAFIMDGNRRYARQHNLKEGAGHDAGFSALMSMVTYGCELGIKYFTVYAFSIDNFK  93

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            RRP+E+E++M+LML K+E + +  + ++ YGVRIHF GNL LL   I+ AA K+M  T  
Sbjct  94   RRPEEVEYIMNLMLEKIELMRRKDSIVNRYGVRIHFSGNLQLLREPIRDAAKKLMAVTAN  153

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERV----ITVVDL  638
            NSN  L +C+ YTSTNEI+ A           +  +            R     I +V++
Sbjct  154  NSNALLTLCVAYTSTNEIIQA-----------IQKSCEEKWVENQEPGRAGCGPINLVEI  202

Query  639  EKHMFMGLAPE  671
            EK M MG+AP+
Sbjct  203  EKQMDMGIAPD  213



>ref|XP_006196878.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Vicugna 
pacos]
Length=334

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKGEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>ref|XP_006239076.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Rattus 
norvegicus]
Length=334

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLKKHGVCIRVLGDLHLLPLDLQKKIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L++ +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSESLLDQCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P+ DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPQPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SALQQK  257



>ref|XP_010378711.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS isoform X1 [Rhinopithecus roxellana]
Length=334

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>ref|XP_006862322.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Chrysochloris 
asiatica]
Length=334

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKNEVDGLMDLARQKFNRLMEEQEKLQKHGVCIRVLGDLHLLPVDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        K++  G   G    +   E +I     +K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------KEMAWGVEQGLLEPSDISESLI-----DKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +   A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNFCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>gb|AFK37712.1| unknown [Lotus japonicus]
Length=196

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P HIAFI+DGNRRY++K  + E  G+RA F AL+ ++ YCYEL V+YVT+YAFSIDNFK
Sbjct  33   VPNHIAFIMDGNRRYAKKRNLGEGDGHRAGFAALLSILRYCYELRVRYVTVYAFSIDNFK  92

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R+P E+E  M+LM  K+E LL+ ++ ++EYGVR+HF+GNL LL   ++ A  K M  T  
Sbjct  93   RKPKEVETFMELMREKIEELLQQESIINEYGVRLHFIGNLQLLADPVRHAVEKAMRVTAH  152

Query  471  NSNFTLLVCLVYTSTNEIVHA  533
            N    LL+C+ YTS +EIVHA
Sbjct  153  NKERVLLICVAYTSRDEIVHA  173



>ref|XP_001109252.1| PREDICTED: dehydrodolichyl diphosphate synthase-like isoform 
2 [Macaca mulatta]
 ref|XP_001109408.1| PREDICTED: dehydrodolichyl diphosphate synthase-like isoform 
3 [Macaca mulatta]
 ref|XP_003809486.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Pan 
paniscus]
 ref|XP_004025283.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_005544385.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Macaca 
fascicularis]
 ref|XP_005544386.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Macaca 
fascicularis]
 ref|XP_008959911.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Pan 
paniscus]
 ref|XP_008959912.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Pan 
paniscus]
 gb|EHH14488.1| hypothetical protein EGK_00421 [Macaca mulatta]
 gb|EHH49677.1| hypothetical protein EGM_00378 [Macaca fascicularis]
Length=334

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>ref|XP_004592279.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Ochotona 
princeps]
Length=334

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 145/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L+++GV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLEKHGVCIRVLGDLHLLPLDLQELIAQAVRATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTSHSPPPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_008693072.1| PREDICTED: dehydrodolichyl diphosphate synthase [Ursus maritimus]
Length=318

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++AT  
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATTN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P+ DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  H
Sbjct  193  YTNHSPQPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQYQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_854980.2| PREDICTED: dehydrodolichyl diphosphate synthase isoformX3 [Canis 
lupus familiaris]
Length=333

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 142/248 (57%), Gaps = 12/248 (5%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVRATKH  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +   +P  DIL+RTSGE RLS+FLLWQTS C L     L+PE    +L  A+L++Q  H 
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHCCLVFQPVLWPEYTFWNLCEAILQYQMNHS  252

Query  831  YLQKRRIM  854
             LQK R M
Sbjct  253  MLQKARDM  260



>ref|XP_513233.2| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Pan 
troglodytes]
 ref|XP_009449584.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Pan 
troglodytes]
 ref|XP_009449597.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Pan 
troglodytes]
Length=334

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 146/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDISESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLFEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SVLQQK  257



>ref|XP_004678708.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Condylura 
cristata]
Length=334

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 143/244 (59%), Gaps = 14/244 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY+RK ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYARKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q+ L ++GV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKSEVDGLMDLARQKFTRLMEEQDKLQKHGVCIRVLGDLHLLPLDLQELIAQAVRATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-ILWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQ  839
              LQ
Sbjct  252  SMLQ  255



>ref|XP_006975698.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Peromyscus 
maniculatus bairdii]
Length=334

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 144/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKH+AFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHVAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SALQQK  257



>ref|XP_005848062.1| hypothetical protein CHLNCDRAFT_10741, partial [Chlorella variabilis]
 gb|EFN55960.1| hypothetical protein CHLNCDRAFT_10741, partial [Chlorella variabilis]
Length=254

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 148/246 (60%), Gaps = 11/246 (4%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +P+H+A  +DGNRRY++   + +  G+   +  L+  + +C ELGV+YV++YAFSIDN++
Sbjct  20   VPRHVALCMDGNRRYAQARHMRQVEGHTFGYRRLIDALEWCLELGVRYVSVYAFSIDNYR  79

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E++ LM L   KL  +L+  + L  +GV++  VG+L L  + +Q AA ++MEAT +
Sbjct  80   RCGEEVDTLMALAEEKLAHMLQEYDVLVRHGVQVRVVGDLSLAPAAVQVAATRIMEATAQ  139

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
            +    L +C  YT++ E+  A           ++  AA  A ++++    +T   L+  +
Sbjct  140  HDRAVLNLCFSYTASEELQRA-----------LDDLAAHPAPSSSSGSGSLTAAGLDGQL  188

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTSSCLLYSPGALFPEIGLRHLVWAVLKFQRAHP  830
            +    P VD+LVRTSGETRLS+FLLWQ    LL     L+P+ G   LV AVL+FQR  P
Sbjct  189  YTRGCPPVDLLVRTSGETRLSDFLLWQCRHALLVFTPVLWPDFGFLDLVAAVLEFQRHAP  248

Query  831  YLQKRR  848
             LQ+ R
Sbjct  249  RLQRLR  254



>ref|XP_007625406.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Cricetulus 
griseus]
 gb|ERE84164.1| dehydrodolichyl diphosphate synthase isoform 2 [Cricetulus griseus]
Length=334

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 144/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   VPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ L+DL   K   L++ Q  L ++GV I  +G+LHLL   +Q      ++ATK 
Sbjct  85   RSKSEVDGLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A  E     ++ +             E   ++   L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGL------------LEPSDVSESLLDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YSNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  GALQQK  257



>ref|XP_002716147.1| PREDICTED: dehydrodolichyl diphosphate synthase [Oryctolagus 
cuniculus]
Length=334

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 145/246 (59%), Gaps = 14/246 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + + ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVRATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        K++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------KEMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTSHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQKR  845
              LQ++
Sbjct  252  SMLQQK  257



>ref|XP_008517713.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X2 [Equus 
przewalskii]
Length=349

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 144/244 (59%), Gaps = 14/244 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQ  839
              LQ
Sbjct  252  SMLQ  255



>ref|XP_008517711.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Equus 
przewalskii]
 ref|XP_008517712.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X1 [Equus 
przewalskii]
Length=350

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 144/244 (59%), Gaps = 14/244 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LGV  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGVLEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ATK 
Sbjct  85   RSKSEVDGLMDLARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L VC  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNVCFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQFQMNH  251

Query  828  PYLQ  839
              LQ
Sbjct  252  SMLQ  255



>ref|XP_005676872.1| PREDICTED: dehydrodolichyl diphosphate synthase isoform X4 [Capra 
hircus]
Length=333

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 145/247 (59%), Gaps = 14/247 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R   E++ LMDL   K   L++ Q  L ++GV I  +G+LHLL   +Q    + ++ T+ 
Sbjct  85   RSKSEVDGLMDLAREKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELVAQAVQTTRN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecckekkkLMNGTaaggaaaaaaEERVITVVDLEKHM  650
             +   L +C  YTS +EI +A        +++  G   G    +   E +     L+K +
Sbjct  145  YNKCFLNICFAYTSRHEISNAV-------REMAWGVEQGLLDPSDVSESL-----LDKCL  192

Query  651  FMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRAH  827
            +   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  AVL+FQ  H
Sbjct  193  YTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAVLQFQMNH  251

Query  828  PYLQKRR  848
              LQK R
Sbjct  252  SMLQKAR  258



>ref|XP_010631415.1| PREDICTED: dehydrodolichyl diphosphate syntase complex subunit 
DHDDS isoform X2 [Fukomys damarensis]
Length=333

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 149/250 (60%), Gaps = 16/250 (6%)
 Frame = +3

Query  111  IPKHIAFILDGNRRYSRKMKIPETVGYRAAFLALVCVICYCYELGVKYVTIYAFSIDNFK  290
            +PKHIAFI+DGNRRY++K ++    G+   F  L   + +C  LG+  VT+YAFSI+NFK
Sbjct  25   MPKHIAFIMDGNRRYAKKCQVERQEGHSKGFNKLAETLRWCLNLGILEVTVYAFSIENFK  84

Query  291  RRPDEIEFLMDLMLTKLEALLKYQNALDEYGVRIHFVGNLHLLDSRIQAAAGKVMEATKK  470
            R  +E++ ++DL   K   L+K Q  L +YGV I  +G+L+LL   +Q    + ++ATK 
Sbjct  85   RSKNEVDGILDLAREKFSYLMKEQEKLQKYGVCIRVLGDLYLLPLDLQELIAQAVQATKN  144

Query  471  NSNFTLLVCLVYTSTNEIVHAAeecc-kekkkLMNGTaaggaaaaaaEERVITVVDLEKH  647
             +   L VC  YTS +EI +A  E     ++ L++ +              ++   L+K 
Sbjct  145  YNKCFLNVCFAYTSRHEITNAVREMAWGVEQGLLDPSD-------------VSECLLDKC  191

Query  648  MFMGLAPEVDILVRTSGETRLSNFLLWQTS-SCLLYSPGALFPEIGLRHLVWAVLKFQRA  824
            ++   +P  DIL+RTSGE RLS+FLLWQTS SCL++ P  L+PE    +L  A+L++Q  
Sbjct  192  LYTHHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQP-VLWPEYTFWNLCEAILQYQMN  250

Query  825  HPYLQKRRIM  854
            H  LQK R M
Sbjct  251  HSVLQKARDM  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2400407646816