BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3490_g1_i2 len=116 path=[269:0-79 172:80-115]

Length=116
                                                                      Score     E

gb|EJO15818.1|  hypothetical protein RSSL_02251                       58.2    8e-10   
ref|WP_004849050.1|  hypothetical protein                             55.1    2e-08   
ref|WP_004843963.1|  hypothetical protein [                           53.9    4e-08   
ref|WP_004849486.1|  hypothetical protein                             50.8    6e-07   
gb|EFG00477.1|  conserved hypothetical protein                        50.1    1e-06   
ref|WP_004846359.1|  hypothetical protein, partial [                  49.7    2e-06   
ref|WP_004852911.1|  hypothetical protein                             48.9    3e-06   
ref|WP_004853487.1|  hypothetical protein                             48.1    6e-06   
emb|CDN41089.1|  Uncharacterized protein BN871_AB_00870               44.3    1e-04   
ref|WP_008400663.1|  hypothetical protein                             44.3    2e-04   
ref|WP_008400641.1|  hypothetical protein                             43.5    2e-04   
emb|CAN73774.1|  hypothetical protein VITISV_008784                   42.7    7e-04   Vitis vinifera
emb|CAR86199.1|  Conserved protein                                    42.0    8e-04   Lactobacillus rhamnosus GG



>gb|EJO15818.1| hypothetical protein RSSL_02251 [Streptococcus salivarius K12]
Length=64

 Score = 58.2 bits (139),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   MHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            MHHLSP++R   LSLE + GCQDLVRFFALLRIKP
Sbjct  1    MHHLSPMYRSNFLSLEIASGCQDLVRFFALLRIKP  35



>ref|WP_004849050.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP26599.1| hypothetical protein COPEUT_01255 [Coprococcus eutactus ATCC 
27759]
Length=76

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   MHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            MHHLS +FRRK    E+S GCQDLVRFFALLRIKP
Sbjct  1    MHHLSLMFRRKVPVKERSSGCQDLVRFFALLRIKP  35



>ref|WP_004843963.1| hypothetical protein [[Ruminococcus] gnavus]
 gb|EDN76676.1| hypothetical protein RUMGNA_02973 [Ruminococcus gnavus ATCC 29149]
Length=76

 Score = 53.9 bits (128),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   MHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            MHHLSP+ RRK    E+S GCQD VRFFALLRIKP
Sbjct  1    MHHLSPLSRRKAPIKERSEGCQDQVRFFALLRIKP  35



>ref|WP_004849486.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP25890.1| hypothetical protein COPEUT_02268 [Coprococcus eutactus ATCC 
27759]
 gb|EDP26289.1| hypothetical protein COPEUT_01585 [Coprococcus eutactus ATCC 
27759]
 gb|EDP26508.1| hypothetical protein COPEUT_01359 [Coprococcus eutactus ATCC 
27759]
Length=76

 Score = 50.8 bits (120),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   MHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            MHHLS + RR+    E S GCQDLVRFFALLRIKP
Sbjct  1    MHHLSLMLRREVPVKEPSSGCQDLVRFFALLRIKP  35



>gb|EFG00477.1| conserved hypothetical protein [Listeria monocytogenes J2818]
Length=68

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    TTTMHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            TTTMHHLS   RR++       GCQDLVRFFALLRIKP
Sbjct  2    TTTMHHLSLCPRRESSVSRVVKGCQDLVRFFALLRIKP  39



>ref|WP_004846359.1| hypothetical protein, partial [[Ruminococcus] torques]
 gb|EDK22934.1| hypothetical protein RUMTOR_02905, partial [Ruminococcus torques 
ATCC 27756]
Length=79

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    DNHAPPVTSVPKKNSISRAVTGMSRPGKVLRVASN  107
            DNHAPPV++ PK  +  R V+GMSR GKVLRVASN
Sbjct  45   DNHAPPVSAAPKGRTHYRPVSGMSRAGKVLRVASN  79



>ref|WP_004852911.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP26613.1| hypothetical protein COPEUT_01244 [Coprococcus eutactus ATCC 
27759]
Length=76

 Score = 48.9 bits (115),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   MHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            MHHLS + RR+    + S GCQDLVRFFALLRIKP
Sbjct  1    MHHLSLMLRREVSVKKPSSGCQDLVRFFALLRIKP  35



>ref|WP_004853487.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP25402.1| hypothetical protein COPEUT_02396 [Coprococcus eutactus ATCC 
27759]
Length=76

 Score = 48.1 bits (113),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   MHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            MHHLS + RR+    + S GCQDLVRFFALLRIKP
Sbjct  1    MHHLSLMLRREVPVKKLSSGCQDLVRFFALLRIKP  35



>emb|CDN41089.1| Uncharacterized protein BN871_AB_00870 [Paenibacillus sp. P22]
Length=58

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  34   RRKTLSLEQSLGCQDLVRFFALLRIKP  114
            RR  LSL  S GCQDLVRFFALLRIKP
Sbjct  3    RRPHLSLGDSGGCQDLVRFFALLRIKP  29



>ref|WP_008400663.1| hypothetical protein [Clostridium sp. L2-50]
 gb|EDO56336.1| hypothetical protein CLOL250_03003 [Clostridium sp. L2-50]
Length=70

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  34   RRKTLSLEQSLGCQDLVRFFALLRIKP  114
            RRK    E+S GCQDLVRFFALLRIKP
Sbjct  3    RRKIPVKERSAGCQDLVRFFALLRIKP  29



>ref|WP_008400641.1| hypothetical protein [Clostridium sp. L2-50]
 gb|EDO57886.1| hypothetical protein CLOL250_01433 [Clostridium sp. L2-50]
Length=70

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  34   RRKTLSLEQSLGCQDLVRFFALLRIKP  114
            RRK    E S GCQDLVRFFALLRIKP
Sbjct  3    RRKVPIKEWSAGCQDLVRFFALLRIKP  29



>emb|CAN73774.1| hypothetical protein VITISV_008784 [Vitis vinifera]
Length=124

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  FEATRRTLPGLDIPVTALEIEFFFGTLVTGGAWLS  2
            F+A RRTLPG+D+P   L+    FG   TGGAWLS
Sbjct  20   FDAKRRTLPGIDMPRILLKERGAFGNADTGGAWLS  54



>emb|CAR86199.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR87785.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR88400.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR89129.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89648.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89667.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR90712.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR91349.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=64

 Score = 42.0 bits (97),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  10   MHHLSPVFRRKTLSLEQSLGCQDLVRFFALLRIKP  114
            MHHLS   RR  L  +    CQDLVRFFALLRIKP
Sbjct  1    MHHLSFCPRRGNLISQVIKRCQDLVRFFALLRIKP  35



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521190666984