BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3490_g1_i1 len=115 path=[93:0-78 172:79-114]

Length=115
                                                                      Score     E

gb|EYA21976.1|  putative oRF58e                                       66.6    3e-13   
gb|AAU91203.1|  hypothetical protein MCA2723                          63.2    6e-12   Methylococcus capsulatus
gb|EGU94740.1|  hypothetical protein HMPREF9349_05396                 57.4    1e-09   
ref|YP_001152205.1|  ORF58e                                           55.5    7e-09   Pinus koraiensis [channamu]
ref|YP_001152204.1|  ORF64d                                           52.4    1e-07   Pinus koraiensis [channamu]
emb|CAN73774.1|  hypothetical protein VITISV_008784                   50.8    1e-06   Vitis vinifera
emb|CDY19671.1|  BnaC09g29270D                                        50.4    3e-06   
emb|CDM82334.1|  unnamed protein product                              47.0    1e-05   
gb|EYU34372.1|  hypothetical protein MIMGU_mgv1a021698mg              47.0    2e-05   
emb|CDW93817.1|  conserved hypothetical protein                       45.8    5e-05   
gb|EFG00477.1|  conserved hypothetical protein                        44.7    9e-05   
gb|EDL71205.1|  conserved hypothetical protein                        42.7    3e-04   Vibrio cholerae 623-39
ref|WP_004843963.1|  hypothetical protein [                           43.1    4e-04   
ref|WP_004852911.1|  hypothetical protein                             42.0    0.001   
ref|WP_004846359.1|  hypothetical protein, partial [                  42.0    0.001   



>gb|EYA21976.1| putative oRF58e [Bacteroides fragilis str. 1007-1-F #3]
Length=43

 Score = 66.6 bits (161),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  113  WFNSKQREEPYLALTC*ELSRDGLVPSGTQTQVLHGC  3
            WFNS QREEPYL LT  ELSRDGLVPSGT  QVLHGC
Sbjct  2    WFNSMQREEPYLVLTSTELSRDGLVPSGTVRQVLHGC  38



>gb|AAU91203.1| hypothetical protein MCA2723 [Methylococcus capsulatus str. Bath]
 gb|AAU92996.1| hypothetical protein MCA0750 [Methylococcus capsulatus str. Bath]
Length=43

 Score = 63.2 bits (152),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  113  WFNSKQREEPYLALTC*ELSRDGLVPSGTQTQVLHGC  3
            WFNS QREEPYLALTC E  RD  VPSG +TQVLHGC
Sbjct  2    WFNSMQREEPYLALTCLESCRDAGVPSGAKTQVLHGC  38



>gb|EGU94740.1| hypothetical protein HMPREF9349_05396 [Escherichia coli MS 79-10]
Length=43

 Score = 57.4 bits (137),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  113  WFNSKQREEPYLALTC*ELSRDGLVPSGTQTQVLHGC  3
            WFNS QREEPYL LT  E+ RD  VPSGT  QVLHGC
Sbjct  2    WFNSMQREEPYLVLTSTEVFRDENVPSGTVRQVLHGC  38



>ref|YP_001152205.1| ORF58e [Pinus koraiensis]
 gb|ABP35448.1| ORF58e [Pinus koraiensis]
Length=58

 Score = 55.5 bits (132),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  113  WFNSKQREEPYLALTC*ELSRDGLVPSGTQTQVLHGC  3
            WFNS Q EEPY  LTC E SR   VPSGT+TQV+HGC
Sbjct  17   WFNSMQSEEPYQGLTCRESSRKRGVPSGTRTQVVHGC  53



>ref|YP_001152204.1| ORF64d [Pinus koraiensis]
 gb|ABP35447.1| ORF64d [Pinus koraiensis]
Length=64

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  9    MQHLCLSSRRHQSISGKFSACQGQVRFFALLRIKP  113
            M HLC  SRRH S+SG F+ACQ  VRFFAL RI+P
Sbjct  1    MHHLCPRSRRHSSLSGGFTACQALVRFFALHRIEP  35



>emb|CAN73774.1| hypothetical protein VITISV_008784 [Vitis vinifera]
Length=124

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  105  FEATRRTLPGLDMLRTFQRWIGAFGNSDTGAAWLS  1
            F+A RRTLPG+DM R   +  GAFGN+DTG AWLS
Sbjct  20   FDAKRRTLPGIDMPRILLKERGAFGNADTGGAWLS  54



>emb|CDY19671.1| BnaC09g29270D [Brassica napus]
Length=244

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  9    MQHLCLSSRRHQSISGKFSACQGQVRFFALLRIKP  113
            M HLC  SRRH S+S  F+ACQ  VRFFAL RIKP
Sbjct  1    MHHLCPRSRRHPSLSRGFAACQALVRFFALHRIKP  35



>emb|CDM82334.1| unnamed protein product [Triticum aestivum]
Length=64

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  9    MQHLCLSSRRHQSISGKFSACQGQVRFFALLRIKP  113
            M HLC  SR H S+S  F+ACQ  VRFFAL RIKP
Sbjct  1    MHHLCPRSRGHPSLSRGFAACQALVRFFALHRIKP  35



>gb|EYU34372.1| hypothetical protein MIMGU_mgv1a021698mg, partial [Erythranthe 
guttata]
Length=90

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    DSHAAPVSEFPKAPIHLWKVLSMSRPGKVLRVASN  106
            DSHA PVS FPK P+   ++  MS P KVLR ASN
Sbjct  56   DSHAQPVSAFPKTPLSFQRIGGMSSPAKVLRFASN  90



>emb|CDW93817.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=91

 Score = 45.8 bits (107),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  113  WFNSKQREEPYLALTC*ELSRDGLV  39
            WFNS QRE+PYL LTC EL+RDGLV
Sbjct  45   WFNSMQREKPYLPLTCQELTRDGLV  69



>gb|EFG00477.1| conserved hypothetical protein [Listeria monocytogenes J2818]
Length=68

 Score = 44.7 bits (104),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    TAMQHLCLSSRRHQSISGKFSACQGQVRFFALLRIKP  113
            T M HL L  RR  S+S     CQ  VRFFALLRIKP
Sbjct  3    TTMHHLSLCPRRESSVSRVVKGCQDLVRFFALLRIKP  39



>gb|EDL71205.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gb|EDL71239.1| conserved hypothetical protein [Vibrio cholerae 623-39]
Length=38

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -3

Query  98  QREEPYLALTC*ELSRDGLVPSGTQTQVLHGC  3
           QREEPYL LT  E S D  VPSG   QVLHGC
Sbjct  2   QREEPYLLLTSRESSGDAGVPSGALRQVLHGC  33



>ref|WP_004843963.1| hypothetical protein [[Ruminococcus] gnavus]
 gb|EDN76676.1| hypothetical protein RUMGNA_02973 [Ruminococcus gnavus ATCC 29149]
Length=76

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +3

Query  9    MQHLCLSSRRHQSISGKFSACQGQVRFFALLRIKP  113
            M HL   SRR   I  +   CQ QVRFFALLRIKP
Sbjct  1    MHHLSPLSRRKAPIKERSEGCQDQVRFFALLRIKP  35



>ref|WP_004852911.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP26613.1| hypothetical protein COPEUT_01244 [Coprococcus eutactus ATCC 
27759]
Length=76

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +3

Query  9    MQHLCLSSRRHQSISGKFSACQGQVRFFALLRIKP  113
            M HL L  RR  S+    S CQ  VRFFALLRIKP
Sbjct  1    MHHLSLMLRREVSVKKPSSGCQDLVRFFALLRIKP  35



>ref|WP_004846359.1| hypothetical protein, partial [[Ruminococcus] torques]
 gb|EDK22934.1| hypothetical protein RUMTOR_02905, partial [Ruminococcus torques 
ATCC 27756]
Length=79

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    DSHAAPVSEFPKAPIHLWKVLSMSRPGKVLRVASN  106
            D+HA PVS  PK   H   V  MSR GKVLRVASN
Sbjct  45   DNHAPPVSAAPKGRTHYRPVSGMSRAGKVLRVASN  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521190666984