BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34903_g1_i1 len=600 path=[578:0-599]

Length=600
                                                                      Score     E

ref|XP_009628222.1|  PREDICTED: uncharacterized protein LOC104118639  65.1    2e-10   
ref|XP_009594911.1|  PREDICTED: uncharacterized protein LOC104091306  63.9    5e-10   
ref|XP_009790360.1|  PREDICTED: uncharacterized protein LOC104237829  63.2    1e-09   



>ref|XP_009628222.1| PREDICTED: uncharacterized protein LOC104118639 [Nicotiana tomentosiformis]
Length=108

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (51%), Gaps = 7/106 (7%)
 Frame = +2

Query  68   FAMFSPTFRALIILVLATGAYSCGNIA--PSSFEGVGSNATIPYGVMG--DYQCVGNFGP  235
              + SPT    + L+  +G  +  N+A  P+  +  G    I     G   YQC+   GP
Sbjct  1    MTVISPTLFIFLFLIFPSGKVAATNMAKAPTRVDEEGEVRKILPESHGKPQYQCLAQLGP  60

Query  236  CDDGHCSVDCCKRLCLSSYSGLNPCFLCQGFP---IKFCICYHDCY  364
            C+  +C+ DCC + CL+ Y+GL+P    +  P   ++ C CYHDC+
Sbjct  61   CNYKYCNKDCCWKQCLNDYNGLHPFAFSEKIPGSALRLCACYHDCF  106



>ref|XP_009594911.1| PREDICTED: uncharacterized protein LOC104091306 [Nicotiana tomentosiformis]
Length=104

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 51/105 (49%), Gaps = 12/105 (11%)
 Frame = +2

Query  74   MFSPTFRALIILVLATGAYSCGNIAPSSF-----EGVGSNATIPYGVMGDYQCVGNFGPC  238
            +F  T    ++ +  +      N+AP         G+ S     Y     Y+C GN GPC
Sbjct  4    LFPSTTVCFLLHIFLSVGMGNSNLAPMEMTRVLARGINSTKVDDY----HYRCAGNLGPC  59

Query  239  DDGHCSVDCCKRLCLSSYSGLNP---CFLCQGFPIKFCICYHDCY  364
            +  +C  +CC   CL+ Y+ LNP   C    GFP KFCIC+HDCY
Sbjct  60   NYEYCDENCCITQCLNDYNELNPEPQCNEYHGFPYKFCICWHDCY  104



>ref|XP_009790360.1| PREDICTED: uncharacterized protein LOC104237829 [Nicotiana sylvestris]
Length=105

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 13/106 (12%)
 Frame = +2

Query  74   MFSPTFRALIIL-VLATGAYSCGNIAPSSFEGV---GSNATIPYGVMGDY--QCVGNFGP  235
            +F  T    ++L +  +      N+AP+    V   G N+T     + DY  +C GN GP
Sbjct  4    LFPSTMLCFVLLHIFVSVGMGNSNLAPTEMTRVLAGGINST----KLDDYHYRCAGNLGP  59

Query  236  CDDGHCSVDCCKRLCLSSYSGLNPCFLCQ---GFPIKFCICYHDCY  364
            C+  +C  +CC   CL+ Y+ LNP   C    GFP KFCIC+HDCY
Sbjct  60   CNYEYCDENCCITQCLNDYNELNPEPQCNEYYGFPYKFCICWHDCY  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 760021576229