BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34812_g1_i1 len=1086 path=[1:0-1085]

Length=1086
                                                                      Score     E

dbj|BAO02510.1|  predicted pollen-specific protein ortholog             498   3e-170   
gb|AAQ90182.1|  ntp101                                                  487   9e-166   Nicotiana tabacum [American tobacco]
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             487   1e-165   
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             486   3e-165   
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             484   2e-164   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             483   3e-164   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             480   4e-163   
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    479   7e-163   Nicotiana tabacum [American tobacco]
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             479   3e-162   
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           472   9e-160   Petunia x hybrida [garden petunia]
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             471   1e-159   
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             471   3e-159   
gb|AAQ90185.1|  ntp805                                                  471   3e-159   Nicotiana tabacum [American tobacco]
emb|CDP18567.1|  unnamed protein product                                470   5e-159   
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             469   1e-158   
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             462   4e-156   
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                461   2e-155   
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             460   3e-155   
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                458   2e-154   
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                457   4e-154   
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             455   3e-153   
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             454   5e-153   
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             451   1e-151   
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             450   4e-151   
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             449   6e-151   
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             444   8e-149   
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             443   2e-148   
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             442   3e-148   
gb|ABI52585.1|  pollen-specific protein                                 442   4e-148   Camellia sinensis [black tea]
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             436   1e-145   
emb|CDP04133.1|  unnamed protein product                                434   4e-145   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             434   6e-145   
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             433   2e-144   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             432   3e-144   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             431   9e-144   
gb|AFK33666.1|  unknown                                                 427   1e-143   
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             431   1e-143   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    430   1e-143   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             430   1e-143   
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                429   4e-143   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             428   8e-143   
gb|EPS72881.1|  pollen-specific protein                                 429   2e-142   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             427   2e-142   
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             427   2e-142   
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             427   3e-142   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    425   1e-141   
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             425   2e-141   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             424   2e-141   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    424   2e-141   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    424   3e-141   
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             423   7e-141   
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             423   8e-141   
gb|AFC88081.1|  skewed-like protein                                     423   9e-141   
emb|CDY23596.1|  BnaC05g39980D                                          423   1e-140   
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    423   1e-140   Brassica napus [oilseed rape]
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    423   1e-140   
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             422   2e-140   
ref|NP_175953.1|  protein SKU5 similar 12                               422   2e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             422   3e-140   
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             421   5e-140   
emb|CAA47176.1|  Bplo                                                   421   8e-140   Brassica napus [oilseed rape]
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             421   1e-139   
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             420   1e-139   
emb|CDY24189.1|  BnaC01g37690D                                          420   2e-139   
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             418   6e-139   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             418   8e-139   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       415   1e-138   
gb|EPS68478.1|  hypothetical protein M569_06286                         417   1e-138   
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             417   1e-138   
emb|CDY43353.1|  BnaA01g29840D                                          417   1e-138   
emb|CDY50029.1|  BnaA06g00300D                                          417   1e-138   
emb|CDY10549.1|  BnaC03g70650D                                          417   2e-138   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             417   2e-138   
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             417   3e-138   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             417   3e-138   
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             417   3e-138   
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             416   4e-138   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             416   4e-138   
emb|CAA47177.1|  Bplo                                                   416   4e-138   Brassica napus [oilseed rape]
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             416   4e-138   
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    416   4e-138   
emb|CDY54363.1|  BnaC06g07290D                                          416   4e-138   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             416   5e-138   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             416   8e-138   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    416   8e-138   
ref|NP_564697.1|  SKU5 similar 14                                       415   1e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75707.1|  BnaC03g37900D                                          415   1e-137   
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    415   1e-137   
emb|CAA47178.1|  Bplo                                                   415   1e-137   Brassica napus [oilseed rape]
emb|CDY56013.1|  BnaA08g29220D                                          415   1e-137   
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             414   2e-137   
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             415   2e-137   
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             414   2e-137   
emb|CDX82541.1|  BnaA03g32800D                                          415   2e-137   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         414   3e-137   Populus trichocarpa [western balsam poplar]
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             414   3e-137   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             414   3e-137   
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         414   3e-137   Populus trichocarpa [western balsam poplar]
emb|CAN69061.1|  hypothetical protein VITISV_032605                     414   4e-137   Vitis vinifera
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             414   4e-137   
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             414   4e-137   
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             414   4e-137   
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             414   4e-137   
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             414   5e-137   
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             414   5e-137   
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             413   6e-137   
gb|KHN44494.1|  L-ascorbate oxidase like                                413   7e-137   
ref|XP_002523382.1|  multicopper oxidase, putative                      413   7e-137   Ricinus communis
ref|XP_002523381.1|  multicopper oxidase, putative                      412   1e-136   Ricinus communis
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   412   2e-136   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       409   2e-136   
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   412   2e-136   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             412   2e-136   
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   412   3e-136   
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             411   3e-136   
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             411   4e-136   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             411   4e-136   
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   411   5e-136   
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             411   5e-136   
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             410   7e-136   
ref|XP_008359469.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    407   1e-135   
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             410   1e-135   
ref|XP_007014661.1|  SKU5 similar 12                                    409   2e-135   
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    409   2e-135   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             409   3e-135   
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             409   3e-135   
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             409   4e-135   
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         409   5e-135   
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             408   5e-135   
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             408   5e-135   
ref|NP_187947.1|  protein SKU5-like 11                                  408   6e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             408   6e-135   
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             408   6e-135   
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             408   9e-135   
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   407   9e-135   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             407   1e-134   
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             407   1e-134   
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             407   1e-134   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             407   1e-134   
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             407   2e-134   
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             407   2e-134   
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             407   2e-134   
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             406   3e-134   
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             406   3e-134   
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    406   3e-134   
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             406   4e-134   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             406   4e-134   
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             406   4e-134   
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    406   4e-134   
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    406   4e-134   
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             406   5e-134   
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    406   5e-134   
emb|CDY49392.1|  BnaC09g53590D                                          402   6e-134   
emb|CDY43994.1|  BnaA05g25890D                                          405   6e-134   
dbj|BAL41449.1|  SKU5 similar 1                                         405   8e-134   
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    405   9e-134   
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      405   1e-133   Zea mays [maize]
gb|ACN34077.1|  unknown                                                 405   1e-133   Zea mays [maize]
emb|CDY23597.1|  BnaC05g39970D                                          404   2e-133   
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             404   2e-133   
emb|CDX82540.1|  BnaA03g32810D                                          404   2e-133   
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    404   2e-133   
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         404   3e-133   Populus trichocarpa [western balsam poplar]
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             404   4e-133   
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                404   4e-133   
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             404   5e-133   
ref|XP_007014658.1|  SKU5 similar 13                                    403   5e-133   
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             403   6e-133   
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             403   6e-133   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             403   7e-133   
emb|CDX75708.1|  BnaC03g37910D                                          403   7e-133   
dbj|BAK07214.1|  predicted protein                                      403   8e-133   
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    402   8e-133   
emb|CDY24188.1|  BnaC01g37680D                                          402   8e-133   
ref|XP_004296148.1|  PREDICTED: L-ascorbate oxidase homolog             402   8e-133   
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   402   1e-132   
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             402   2e-132   
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             402   2e-132   
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             400   5e-132   
ref|NP_187948.1|  protein SKU5-like 13                                  400   9e-132   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    400   1e-131   
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             399   2e-131   
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             399   2e-131   
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   399   3e-131   
gb|KHG03555.1|  L-ascorbate oxidase                                     398   5e-131   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   397   6e-131   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             397   7e-131   
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             402   8e-131   
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             397   1e-130   
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             397   2e-130   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             396   2e-130   
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             395   4e-130   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    394   7e-130   
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             395   8e-130   
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             395   1e-129   
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        393   5e-129   
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             393   7e-129   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          392   8e-129   
gb|ACF86554.2|  unknown                                                 392   1e-128   Zea mays [maize]
gb|AGW80453.1|  pollen-specific protein                                 392   1e-128   
ref|NP_001044620.1|  Os01g0816700                                       392   2e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             392   2e-128   
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           392   2e-128   Zea mays [maize]
gb|EEE55579.1|  hypothetical protein OsJ_03867                          391   2e-128   Oryza sativa Japonica Group [Japonica rice]
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        392   2e-128   
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          390   7e-128   Sorghum bicolor [broomcorn]
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   390   7e-128   
gb|EEC71702.1|  hypothetical protein OsI_04207                          390   7e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             390   7e-128   
emb|CDM84722.1|  unnamed protein product                                390   8e-128   
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             389   1e-127   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             389   2e-127   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          388   3e-127   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        388   5e-127   
gb|EEE64155.1|  hypothetical protein OsJ_18987                          386   9e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    387   1e-126   
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             387   1e-126   
gb|AAT01329.1|  putative L-ascorbate oxidase                            386   3e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             385   5e-126   
gb|ACN26659.1|  unknown                                                 385   5e-126   Zea mays [maize]
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             385   6e-126   
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           385   7e-126   Zea mays [maize]
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             384   8e-126   
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             387   1e-125   
dbj|BAK05994.1|  predicted protein                                      384   1e-125   
gb|KHG05644.1|  L-ascorbate oxidase                                     384   1e-125   
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             384   2e-125   
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             382   7e-125   
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             381   3e-124   
gb|KGN54013.1|  hypothetical protein Csa_4G267480                       376   2e-123   
gb|AES71848.2|  L-ascorbate oxidase-like protein                        376   4e-123   
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             377   5e-123   
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   377   1e-122   
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          373   4e-121   Sorghum bicolor [broomcorn]
emb|CDY68850.1|  BnaA10g29650D                                          362   2e-120   
gb|KDP30646.1|  hypothetical protein JCGZ_16211                         365   2e-119   
gb|KHN20513.1|  L-ascorbate oxidase like                                364   3e-118   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             358   1e-115   
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             358   2e-115   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                357   3e-115   
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             357   3e-115   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             357   5e-115   
gb|AGJ03718.1|  multicopper oxidase                                     357   5e-115   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             356   6e-115   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             356   6e-115   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             355   2e-114   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    355   2e-114   
emb|CDP19581.1|  unnamed protein product                                355   2e-114   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             354   5e-114   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             354   6e-114   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             353   8e-114   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    353   9e-114   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             353   9e-114   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             353   1e-113   Vitis vinifera
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             353   1e-113   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             353   1e-113   
emb|CBI18560.3|  unnamed protein product                                353   2e-113   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             353   2e-113   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             353   2e-113   
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    353   2e-113   
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    353   2e-113   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             352   2e-113   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             352   3e-113   
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    352   5e-113   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  349   5e-113   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             351   5e-113   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             351   6e-113   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             351   6e-113   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             351   6e-113   
gb|KHN42054.1|  L-ascorbate oxidase like                                351   7e-113   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             351   7e-113   
gb|AGE09595.1|  SKU5-like protein                                       350   9e-113   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    351   1e-112   
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           347   1e-112   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             350   1e-112   
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             351   1e-112   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             350   2e-112   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     352   2e-112   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               350   2e-112   
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             350   2e-112   
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         350   2e-112   
gb|ABK25092.1|  unknown                                                 350   3e-112   
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             350   3e-112   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             349   4e-112   
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             349   4e-112   
ref|XP_002866726.1|  predicted protein                                  349   5e-112   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    349   5e-112   
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             349   5e-112   
ref|NP_173604.1|  SKU5 similar 7 protein                                348   8e-112   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    348   9e-112   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   348   1e-111   
emb|CDY18626.1|  BnaA09g07690D                                          348   1e-111   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             348   2e-111   
ref|XP_010417106.1|  PREDICTED: L-ascorbate oxidase homolog             348   2e-111   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             348   2e-111   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             348   2e-111   
emb|CDX81353.1|  BnaC09g07640D                                          347   2e-111   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                347   2e-111   
dbj|BAB08634.1|  pectinesterase like protein                            347   2e-111   
gb|AAM61328.1|  pectinesterase-like protein                             347   3e-111   
ref|NP_569041.1|  protein SKU5 similar 17                               347   3e-111   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         347   3e-111   
ref|XP_010472357.1|  PREDICTED: L-ascorbate oxidase homolog             347   3e-111   
gb|KHN36198.1|  L-ascorbate oxidase like                                347   4e-111   
emb|CDX97352.1|  BnaA02g21430D                                          345   5e-111   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             347   5e-111   
gb|AAD10639.1|  putative pollen specific protein                        347   5e-111   
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             346   5e-111   
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   346   6e-111   
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             346   7e-111   
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                345   7e-111   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             346   8e-111   
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             346   8e-111   
gb|ABR18324.1|  unknown                                                 346   9e-111   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           346   9e-111   
gb|AFK33407.1|  unknown                                                 340   1e-110   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             345   1e-110   
emb|CDY43557.1|  BnaC02g16540D                                          345   1e-110   
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             345   1e-110   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             345   1e-110   
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         345   2e-110   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             345   2e-110   
ref|XP_006296162.1|  hypothetical protein CARUB_v10025315mg             345   2e-110   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             345   2e-110   
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    345   2e-110   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             345   2e-110   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             345   2e-110   
gb|KHG04142.1|  L-ascorbate oxidase                                     345   3e-110   
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         344   3e-110   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             344   3e-110   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             344   3e-110   
emb|CDY01453.1|  BnaA07g12260D                                          344   3e-110   
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             343   3e-110   
emb|CDP10787.1|  unnamed protein product                                344   4e-110   
emb|CDY12788.1|  BnaC07g16450D                                          344   4e-110   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             343   5e-110   
gb|KEH20500.1|  multi-copper oxidase-like protein                       343   6e-110   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             343   8e-110   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             343   8e-110   
gb|KEH29685.1|  multi-copper oxidase-like protein                       343   8e-110   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             343   9e-110   
ref|XP_010429313.1|  PREDICTED: L-ascorbate oxidase homolog             343   1e-109   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             343   1e-109   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             343   1e-109   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             342   1e-109   
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             342   2e-109   
emb|CDP07321.1|  unnamed protein product                                342   2e-109   
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg             341   2e-109   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             342   2e-109   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             342   2e-109   
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             342   2e-109   
gb|ABK25324.1|  unknown                                                 342   3e-109   
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             342   3e-109   
ref|XP_008365718.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    336   3e-109   
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             342   4e-109   
dbj|BAJ91397.1|  predicted protein                                      342   4e-109   
ref|XP_007041705.1|  SKU5 similar 5                                     342   4e-109   
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     338   4e-109   
dbj|BAK00459.1|  predicted protein                                      342   4e-109   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             341   4e-109   
ref|XP_002524823.1|  multicopper oxidase, putative                      341   4e-109   
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             341   4e-109   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         341   4e-109   
gb|KHG11003.1|  L-ascorbate oxidase                                     341   5e-109   
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             341   5e-109   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         341   6e-109   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             341   6e-109   
gb|KEH40258.1|  multi-copper oxidase-like protein                       341   7e-109   
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             341   8e-109   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             341   8e-109   
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             341   8e-109   
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             340   9e-109   
gb|EPS74059.1|  hypothetical protein M569_00695                         340   1e-108   
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             340   1e-108   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   340   1e-108   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             340   1e-108   
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             340   1e-108   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             340   2e-108   
gb|AAL09733.1|  At1g76160/T23E18_10                                     340   2e-108   
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             340   2e-108   
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             339   3e-108   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   339   4e-108   
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             339   5e-108   
gb|KEH30610.1|  multi-copper oxidase-like protein                       335   5e-108   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         338   6e-108   
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             338   6e-108   
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             338   7e-108   
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             338   8e-108   
ref|XP_002522337.1|  multicopper oxidase, putative                      338   9e-108   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             338   1e-107   
gb|KHG25743.1|  L-ascorbate oxidase                                     338   1e-107   
ref|NP_565554.1|  protein SKU5 similar 16                               338   1e-107   
ref|NP_177743.1|  SKU5-like 5 protein                                   337   2e-107   
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             337   2e-107   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             337   2e-107   
gb|AAM97070.1|  pectinesterase, putative                                337   2e-107   
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          337   2e-107   
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             337   2e-107   
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          337   2e-107   
gb|KHG07318.1|  L-ascorbate oxidase                                     337   2e-107   
ref|XP_002880518.1|  hypothetical protein ARALYDRAFT_320180             337   2e-107   
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             334   2e-107   
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         337   2e-107   
ref|XP_002510630.1|  multicopper oxidase, putative                      337   2e-107   
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             337   3e-107   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             337   4e-107   
gb|KHG21949.1|  L-ascorbate oxidase                                     336   4e-107   
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             336   5e-107   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             336   5e-107   
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         336   5e-107   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             336   6e-107   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     337   6e-107   
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             335   8e-107   
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             335   8e-107   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             335   9e-107   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             335   9e-107   
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             335   1e-106   
emb|CDP02462.1|  unnamed protein product                                335   1e-106   
emb|CDX73238.1|  BnaC06g36860D                                          335   1e-106   
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             335   1e-106   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             335   1e-106   
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             335   2e-106   
ref|XP_002528421.1|  multicopper oxidase, putative                      335   2e-106   
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                     333   2e-106   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             335   2e-106   
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             335   2e-106   
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             335   2e-106   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             334   2e-106   
ref|NP_173603.1|  SKU5 similar 8 protein                                335   2e-106   
gb|KEH30611.1|  multi-copper oxidase-like protein                       334   2e-106   
emb|CDY67479.1|  BnaCnng55180D                                          334   3e-106   
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             334   3e-106   
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             331   3e-106   
emb|CAA65634.1|  PS60                                                   334   3e-106   
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             334   3e-106   
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             334   3e-106   
gb|KHG02352.1|  L-ascorbate oxidase                                     334   3e-106   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             334   4e-106   
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             334   4e-106   
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             334   4e-106   
gb|KHM99211.1|  L-ascorbate oxidase like                                333   4e-106   
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    334   4e-106   
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             333   5e-106   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             333   5e-106   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             333   6e-106   
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             333   7e-106   
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             333   8e-106   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   333   8e-106   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             333   8e-106   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             333   9e-106   
emb|CDY35790.1|  BnaA08g04510D                                          333   9e-106   
gb|KHG27164.1|  L-ascorbate oxidase                                     330   1e-105   
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             333   1e-105   
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   332   1e-105   
emb|CDX87633.1|  BnaA07g32400D                                          332   1e-105   
ref|XP_010548381.1|  PREDICTED: L-ascorbate oxidase homolog             332   1e-105   
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             332   1e-105   
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             332   1e-105   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             332   1e-105   
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             332   1e-105   
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         332   1e-105   
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             332   2e-105   
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             332   2e-105   
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             332   2e-105   
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             332   2e-105   
ref|XP_009769792.1|  PREDICTED: L-ascorbate oxidase homolog             332   3e-105   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             332   3e-105   
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             331   3e-105   
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             332   3e-105   
ref|XP_002522339.1|  multicopper oxidase, putative                      331   3e-105   
ref|NP_001147597.1|  LOC100281206 precursor                             332   4e-105   
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             331   4e-105   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             331   4e-105   
dbj|BAC83966.1|  putative PS60                                          332   4e-105   
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          331   4e-105   
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             331   5e-105   
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             331   5e-105   
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                331   5e-105   
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          331   6e-105   
ref|NP_193932.1|  protein SKU5 similar 4                                331   6e-105   
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           331   6e-105   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             330   6e-105   
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             330   7e-105   
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             330   7e-105   
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           330   7e-105   
emb|CDY68834.1|  BnaCnng60730D                                          330   9e-105   
gb|ABV89619.1|  Sku5-like 11                                            330   9e-105   
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             332   9e-105   
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             330   1e-104   
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             330   1e-104   
emb|CDY55201.1|  BnaCnng28410D                                          330   1e-104   
gb|EAZ02087.1|  hypothetical protein OsI_24168                          330   1e-104   
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             330   1e-104   
ref|NP_001058365.1|  Os06g0678800                                       330   1e-104   
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             330   1e-104   
gb|KHN05478.1|  L-ascorbate oxidase like                                330   1e-104   
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             330   1e-104   
gb|ABK95805.1|  unknown                                                 330   1e-104   
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         330   1e-104   
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             330   1e-104   



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   498 bits (1283),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 246/342 (72%), Positives = 286/342 (84%), Gaps = 0/342 (0%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             + N++  V  + L    F V  EDPYLFHEWKVTYG LSPLGV + VILIN +FPGP IN
Sbjct  1     MNNRLRFVLAILLAIPCFFVNGEDPYLFHEWKVTYGTLSPLGVPQKVILINDQFPGPRIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
             GTSNNN+VVNVFN+LDEPLLF WNG+Q RKNSWQDG PGT CPI+PG N+TY FQVKDQI
Sbjct  61    GTSNNNIVVNVFNQLDEPLLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+++YFP+T+LHR+AGGYGAL VHSR LIPVPFD PADE+ +F+ DWYNKGH+ LKK LD
Sbjct  121   GSYYYFPTTALHRAAGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILD  180

Query  486   DGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
              G TI RP+G++IN K  +VG+  EPL T+EAGKTYR+R CN+GMR+S+N RFQGH M L
Sbjct  181   GGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKL  240

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VE+EGSH VQN YDSLDLH GQC SVLVTADQ+PKDYYLV +SRFLK  LS+V +I+YAN
Sbjct  241   VELEGSHTVQNIYDSLDLHVGQCFSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYAN  300

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             GKG A+ ELP PPP+ TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  301   GKGPASPELPTPPPENTEGIAWSMNQFRSFRWNLTASAARPN  342



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   487 bits (1254),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 283/337 (84%), Gaps = 1/337 (0%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  LL L   A VV+ EDPYLF EW VTYG ++PLGV +  ILING+ PGP IN TSNNN
Sbjct  9     VALLLCLSVGALVVKGEDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCTSNNN  68

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNV+N LDEPLL  WNGIQQRKNSWQDG PGT CPI+PGTN+TYHFQVKDQIG+ FYF
Sbjct  69    IVVNVYNNLDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYF  128

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T LHR+AGG+GAL VHSR LIP+PFD PADE+ +FL DWYNKGH+ LKK LD G TI 
Sbjct  129   PTTGLHRAAGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIG  188

Query  468   RPNGLVINAKHGEVGDKM-EPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
             RP+G+ IN K  +VGDK+ E L T+EAGKTYR+R+CNVGMRTS+N R QGH+M LVE+EG
Sbjct  189   RPDGIHINGKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEG  248

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SH VQN YDSLDLH GQCLSVLVTADQ+PKDYY+V +SRFLK  LS+V +++YANGKG A
Sbjct  249   SHTVQNVYDSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKGPA  308

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             ++ELP PPPD TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  309   SSELPTPPPDNTEGIAWSMNQFRSFRWNLTASAARPN  345



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   487 bits (1253),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 283/337 (84%), Gaps = 1/337 (0%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  LL L   A VV+ EDPYLF EW VTYG ++PLGV +  ILING+ PGP IN TSNNN
Sbjct  9     VALLLCLSVGALVVKGEDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCTSNNN  68

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNV+N LDEPLL  WNGIQQRKNSWQDG PGT CPI+PGTN+TYHFQVKDQIG+ FYF
Sbjct  69    IVVNVYNNLDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYF  128

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T LHR+AGG+GAL VHSR LIP+PFD PADE+ +FL DWYNKGH+ LKK LD G TI 
Sbjct  129   PTTGLHRAAGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIG  188

Query  468   RPNGLVINAKHGEVGDKM-EPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
             RP+G+ IN K  +VGDK+ E L T+EAGKTYR+R+CNVGMRTS+N R QGH+M LVE+EG
Sbjct  189   RPDGIHINGKSSKVGDKVAEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEG  248

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SH VQN YDSLDLH GQCLSVLVTADQ+PKDYY+V +SRFLK  LS+V +++YANGKG A
Sbjct  249   SHTVQNVYDSLDLHVGQCLSVLVTADQEPKDYYMVVSSRFLKQALSSVAILRYANGKGPA  308

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             ++ELP PPPD TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  309   SSELPTPPPDNTEGIAWSMNQFRSFRWNLTASAARPN  345



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   486 bits (1251),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 244/337 (72%), Positives = 284/337 (84%), Gaps = 1/337 (0%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  LL L   A VV+AEDPYLF EW VTYG ++PLGV +  ILING+ PGP IN TSNNN
Sbjct  9     VALLLCLSVGALVVKAEDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCTSNNN  68

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNV+N LDEPLL  W+GIQQRKNSWQDG PGT CPI+PGTN+TYHFQVKDQIG+ FYF
Sbjct  69    IVVNVYNNLDEPLLLTWSGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYF  128

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PST LHR+AGG+GA+ VHSR LIP+PFD PA+E+ +FL DWYNKGHR LKK LD G TI 
Sbjct  129   PSTGLHRAAGGFGAVDVHSRNLIPIPFDKPAEEYNVFLGDWYNKGHRTLKKILDGGRTIG  188

Query  468   RPNGLVINAKHGEVGDK-MEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
             RP+G+ IN K  +VGDK  E L T+EAGKTYR+R+CNVGMRTS+N R QGH+M LVE+EG
Sbjct  189   RPDGIHINGKSSKVGDKATEALFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEG  248

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SH VQN YDSLD+H GQCLSVLVTADQ+PKDYY+V +SRFLK +LS+V +++YANGKG A
Sbjct  249   SHTVQNVYDSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQELSSVAILRYANGKGPA  308

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             ++ELP PPPD TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  309   SSELPAPPPDNTEGIAWSMNQFRSFRWNLTASAARPN  345



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   484 bits (1247),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 238/350 (68%), Positives = 287/350 (82%), Gaps = 4/350 (1%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             ME A   K+  + ++ L   A +V+AEDPYLF EW VTYG ++PLGV +  ILING+ PG
Sbjct  1     MEEANNVKIVALLIICLSVGALLVKAEDPYLFFEWNVTYGTIAPLGVPQQGILINGQLPG  60

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNN+VVNV+N+LDEPLL  WNGIQQRKNSWQDG PGT CPI+PGTN+TYHFQV
Sbjct  61    PRINCTSNNNIVVNVYNKLDEPLLLTWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQV  120

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG+ FYFP+TSLHR++GG+GAL VHSR LIP+PFD PADE+ +FL DWYNKGH+ LK
Sbjct  121   KDQIGSFFYFPTTSLHRASGGFGALDVHSRNLIPIPFDKPADEYNVFLGDWYNKGHKALK  180

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             KTLD G TI RP+G+ IN K  ++GDK EPL ++EAGK YR+R+CNVGMRTS+N R QGH
Sbjct  181   KTLDGGRTIGRPDGIHINGKSNKLGDKAEPLFSMEAGKIYRYRMCNVGMRTSVNVRIQGH  240

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
             +M LVE+EGSH VQN YDSLD+H GQCLSVLVTADQ+PKDYY+V +SRFLK  +S+V ++
Sbjct  241   AMKLVEMEGSHTVQNMYDSLDIHVGQCLSVLVTADQEPKDYYMVVSSRFLKQAISSVAIL  300

Query  138   KYANGKGaaaaelp----pppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +YANGKG  +  +      PPP+ T+GIAWS+NQFRSFRWNLTASAARPN
Sbjct  301   RYANGKGVGSTSISDHLPTPPPNNTQGIAWSMNQFRSFRWNLTASAARPN  350



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   483 bits (1244),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 239/341 (70%), Positives = 283/341 (83%), Gaps = 2/341 (1%)
 Frame = -1

Query  1023  TNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             + K+ +V LL   A+  +  AEDPYL+  W VTYG +SPLGV +  ILING+FPGP IN 
Sbjct  3     SGKVTVVALLLCLAVGVI--AEDPYLYFNWNVTYGTVSPLGVPQQGILINGQFPGPRINC  60

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             TSNNN+VVNVFN LDEP LF WNG+Q RKNSWQDG PGT CPI+PG N+TY FQVKDQIG
Sbjct  61    TSNNNIVVNVFNNLDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIG  120

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             +++YFP+T+LHR+AGGYG + VHSR LIPVPFD PADE+ +F+ DWYNKGH+ LKK LD 
Sbjct  121   SYYYFPTTALHRAAGGYGPINVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDG  180

Query  483   GHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
             GHT+ RP+G++IN K  +VG+  EPL T+EAGKTYR+R CN+GMR+S+N RFQGH M LV
Sbjct  181   GHTVGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLV  240

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANG  124
             E+EGSH VQN YDSLDLH GQCLSVLVTADQ+PKDYYLV +SRFLK +LS+V +I+YANG
Sbjct  241   ELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQELSSVAIIRYANG  300

Query  123   KGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             KG A+ ELP  PPD TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  301   KGPASPELPASPPDNTEGIAWSMNQFRSFRWNLTASAARPN  341



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   480 bits (1236),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 236/341 (69%), Positives = 283/341 (83%), Gaps = 2/341 (1%)
 Frame = -1

Query  1023  TNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             + K+ +V LL   ++  +  AEDPYL+  W VTYG +SPLGV +  ILING+FPGP IN 
Sbjct  3     SGKVTVVALLLCLSVGVI--AEDPYLYFNWNVTYGTVSPLGVPQQGILINGQFPGPRINC  60

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             TSNNN+VVNVFN LDEP LF WNG+Q RKNSWQDG PGT CPI+PG N+TY FQVKDQIG
Sbjct  61    TSNNNIVVNVFNNLDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIG  120

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             +++YFP+T+LHR+AGGYGA+ VHSR LIPVPFD PADE+ +F+ DWYNKGH+ LKK LD 
Sbjct  121   SYYYFPTTALHRAAGGYGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKVLDG  180

Query  483   GHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
             GHT+ RP+G++IN K  +VG+  EPL T+EAGKTYR+R CN+GMR+S+N R QGH M LV
Sbjct  181   GHTVGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNVRLQGHPMKLV  240

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANG  124
             E+EGSH VQN YDSLD+H GQCLSVLVTA+Q+PKDYYLV +SRFLK +LS+V +I+YANG
Sbjct  241   ELEGSHTVQNIYDSLDIHVGQCLSVLVTANQEPKDYYLVVSSRFLKQELSSVAIIRYANG  300

Query  123   KGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             KG A+ ELP  PPD TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  301   KGPASPELPASPPDNTEGIAWSMNQFRSFRWNLTASAARPN  341



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   479 bits (1234),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 238/336 (71%), Positives = 279/336 (83%), Gaps = 0/336 (0%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             + F+  L  ++  V AEDPYL+  W VTYG ++PLGV +  ILING+FPGP IN TSNNN
Sbjct  6     VTFVALLLCLSVGVIAEDPYLYFNWNVTYGTIAPLGVPQQGILINGQFPGPRINCTSNNN  65

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFN LDEP LF WNG+Q RKNSWQDG PGT CPI+PG N+TY FQVKDQIG++ YF
Sbjct  66    IVVNVFNNLDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYRFQVKDQIGSYSYF  125

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T+LHR+AGGYGAL VHSR LIPVPFD PADE+ +F+ DWYNKGH+ LKK LD G TI 
Sbjct  126   PTTALHRAAGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIG  185

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+G++IN K  +VG+  EPL T+EAGKTYR+R CN+GMR+S+N RFQGH M LVE+EGS
Sbjct  186   RPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGS  245

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN YDSLDLH GQCLSVLVTADQ+PKDYYLV +SRFLK  LS+V +I+YANGKG A+
Sbjct  246   HTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKGPAS  305

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              ELP PPP+ TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  306   PELPTPPPENTEGIAWSMNQFRSFRWNLTASAARPN  341



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   479 bits (1234),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 241/349 (69%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = -1

Query  1038  MEGALTNKMG---MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGK  868
             ++    N MG   + F+  L  ++  V AEDPYL+  W VTYG ++PLGV +  ILING+
Sbjct  28    LKNKKNNVMGSGKVTFVALLLCLSVGVIAEDPYLYFNWNVTYGTIAPLGVPQQGILINGQ  87

Query  867   FPGPTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYH  688
             FPGP IN TSNNN+VVNVFN LDEP LF WNG+Q RKNSWQDG PGT CPI+PG N+TY 
Sbjct  88    FPGPRINCTSNNNIVVNVFNNLDEPFLFTWNGVQHRKNSWQDGTPGTMCPIMPGQNFTYR  147

Query  687   FQVKDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHR  508
             FQVKDQIG++ YFP+T+LHR+AGGYGAL VHSR LIPVPFD PADE+ +F+ DWYNKGH+
Sbjct  148   FQVKDQIGSYSYFPTTALHRAAGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHK  207

Query  507   DLKKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRF  328
              LKK LD G TI RP+G++IN K  +VG+  EPL T+EAGKTYR+R CN+GMR+S+N RF
Sbjct  208   TLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFTMEAGKTYRYRFCNLGMRSSVNIRF  267

Query  327   QGHSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTV  148
             QGH M LVE+EGSH VQN YDSLDLH GQCLSVLVTADQ+PKDYYLV +SRFLK  LS+V
Sbjct  268   QGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSV  327

Query  147   GLIKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              +I+YANGKG A+ ELP PPP+ TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  328   AIIRYANGKGPASPELPTPPPENTEGIAWSMNQFRSFRWNLTASAARPN  376



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   472 bits (1214),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 240/338 (71%), Positives = 281/338 (83%), Gaps = 2/338 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  LL L     VV+AEDPYL  +W VTYG +SPLGV +  ILING+ PGPTIN TSNNN
Sbjct  9     VALLLCLSIGNVVVKAEDPYLPFDWNVTYGTISPLGVPQQGILINGQLPGPTINCTSNNN  68

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFN LDEPLL  WNGIQQRKNSWQDG PGT CPI+PGTN+TYHFQVKDQIG+ FYF
Sbjct  69    IVVNVFNHLDEPLLITWNGIQQRKNSWQDGTPGTMCPIMPGTNFTYHFQVKDQIGSFFYF  128

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T LHR+AGG+G + VHSR LIP+PFD PA E+ +F+ DWYNKG++ LKK LD G TI 
Sbjct  129   PTTDLHRAAGGFGPINVHSRNLIPIPFDSPAAEYNVFVGDWYNKGYKSLKKILDGGRTIG  188

Query  468   RPNGLVINAKHGEVGDK-MEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
             RP+G+ IN K G+VGD   EPL T+EAGKTYR+R+CNVGMRTS+N R QGH+M LVE+EG
Sbjct  189   RPDGIHINGKSGKVGDNAAEPLFTMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEG  248

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKN-QLSTVGLIKYANGKGa  115
             SH VQN Y+SLDLH GQCLSVLVTADQ+PK YY+V +SRFLK  +LS+V +++YANGKG 
Sbjct  249   SHTVQNVYESLDLHVGQCLSVLVTADQEPKGYYMVVSSRFLKQAELSSVAIVRYANGKGP  308

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             A+++LP PPPD TEGIAWSINQFRSFRWNLTASAARPN
Sbjct  309   ASSDLPAPPPDNTEGIAWSINQFRSFRWNLTASAARPN  346



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   471 bits (1213),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 277/336 (82%), Gaps = 0/336 (0%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             + F+  L  ++  V AEDPYL+  W VTYG ++PLGV +  ILING+FPGP IN TSNNN
Sbjct  6     VTFVALLLCLSVGVIAEDPYLYFTWNVTYGTIAPLGVPQQGILINGQFPGPRINCTSNNN  65

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFN LDEP LF WNG+Q RKNSWQDG  GT CPI+PG N+TY FQVKDQIG+++YF
Sbjct  66    IVVNVFNNLDEPFLFTWNGVQHRKNSWQDGTSGTMCPIMPGQNFTYRFQVKDQIGSYYYF  125

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T+LHR+AGGYGAL VHSR LIPVPFD PADE+ +F+ DWYNKGH+ LKK LD G TI 
Sbjct  126   PTTALHRAAGGYGALNVHSRALIPVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIG  185

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             R +G++IN K  +VG+  E L T+EAGKTYR+R CN+GMR+S+N RFQGH M LVE+EGS
Sbjct  186   RADGIIINGKSAKVGEAKESLFTMEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGS  245

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN YDSLDLH GQCLSVLVTADQ+PKDYYLV +SRFLK  LS+V +I+YANGKG A+
Sbjct  246   HTVQNIYDSLDLHVGQCLSVLVTADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKGPAS  305

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              ELP PPP+ TEGIAWS+NQFRSFRWNLTASAARPN
Sbjct  306   PELPTPPPENTEGIAWSMNQFRSFRWNLTASAARPN  341



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   471 bits (1211),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 237/324 (73%), Positives = 276/324 (85%), Gaps = 2/324 (1%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            +AEDPYLF EW VTYG ++PLGV    ILING+ PGP IN TSNNN+VVNVFN LDEPLL
Sbjct  21   KAEDPYLFFEWNVTYGTIAPLGVPLQGILINGQLPGPRINCTSNNNIVVNVFNNLDEPLL  80

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
              WNG+QQRKNSWQDG PGT CPI+PGTN+TY FQVKDQIG+ FYFP+T LHR+AGG+GA
Sbjct  81   LTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRAAGGFGA  140

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            + VHSR LIPVPFD PADE+ +F+ DWYNKG++ LKK LD G TI RP+G+ IN K  +V
Sbjct  141  INVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKV  200

Query  426  GDKM-EPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
            GDK+ EPL T+EAGKTYR+RVCN GMRTS+NFR QGH M LVE+EGSH VQN Y+SLDLH
Sbjct  201  GDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLH  260

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKN-QLSTVGLIKYANGKGaaaaelppppPDGTE  73
             GQCLSVLVTADQ+PKDYY++ +SRFLK  QLS+V +I+YANGKG A+++LP PPP+ T+
Sbjct  261  VGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKGPASSDLPAPPPENTQ  320

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            GIAWSINQFRSFRWNLTASAARPN
Sbjct  321  GIAWSINQFRSFRWNLTASAARPN  344



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   471 bits (1211),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 237/324 (73%), Positives = 276/324 (85%), Gaps = 2/324 (1%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            +AEDPYLF EW VTYG ++PLGV    ILING+ PGP IN TSNNN+VVNVFN LDEPLL
Sbjct  21   KAEDPYLFFEWNVTYGTIAPLGVPLQGILINGQLPGPRINCTSNNNIVVNVFNNLDEPLL  80

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
              WNG+QQRKNSWQDG PGT CPI+PGTN+TY FQVKDQIG+ FYFP+T LHR+AGG+GA
Sbjct  81   LTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFPTTDLHRAAGGFGA  140

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            + VHSR LIPVPFD PADE+ +F+ DWYNKG++ LKK LD G TI RP+G+ IN K  +V
Sbjct  141  INVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKV  200

Query  426  GDKM-EPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
            GDK+ EPL T+EAGKTYR+RVCN GMRTS+NFR QGH M LVE+EGSH VQN Y+SLDLH
Sbjct  201  GDKVAEPLFTMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLH  260

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKN-QLSTVGLIKYANGKGaaaaelppppPDGTE  73
             GQCLSVLVTADQ+PKDYY++ +SRFLK  QLS+V +I+YANGKG A+++LP PPP+ T+
Sbjct  261  VGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKGPASSDLPAPPPENTQ  320

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            GIAWSINQFRSFRWNLTASAARPN
Sbjct  321  GIAWSINQFRSFRWNLTASAARPN  344



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   470 bits (1209),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 278/336 (83%), Gaps = 0/336 (0%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  LL L A A +VQAEDPYLF +WKVTYG ++PLGV +  ILING+FPGP IN TSNNN
Sbjct  7     VALLLCLSAGALLVQAEDPYLFFDWKVTYGTIAPLGVPQQGILINGQFPGPRINCTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFN+LDEPLL  W G+QQRKNSWQDG  GT CPILPG NYTYHFQVKDQIG++FY+
Sbjct  67    IVVNVFNQLDEPLLLTWAGVQQRKNSWQDGTLGTMCPILPGQNYTYHFQVKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+  L ++AGG G L VHSR+LIPVPFDWPADE+ + + DWY KGH+ LK  LD G ++ 
Sbjct  127   PTVGLQKAAGGMGPLNVHSRDLIPVPFDWPADEYNVLVGDWYTKGHKALKNMLDSGRSLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+G+ IN K  +VGD +EPL T+E GKTYR+RVCNVG++TS+NFR QGH + LVE+EGS
Sbjct  187   RPDGIQINGKSAKVGDNVEPLFTMEPGKTYRYRVCNVGLKTSINFRIQGHPLKLVEIEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQ D+DSLD+H GQCLSVLVTAD++PKDYY VA+SRF++  LS+VG+I+Y NGKG A+
Sbjct  247   HTVQYDFDSLDVHVGQCLSVLVTADKEPKDYYFVASSRFIQAPLSSVGIIRYTNGKGPAS  306

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              ELPP PP G+ GIAWS+NQFRSFRWNLTASAARPN
Sbjct  307   PELPPSPPVGSAGIAWSMNQFRSFRWNLTASAARPN  342



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   469 bits (1207),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 238/337 (71%), Positives = 279/337 (83%), Gaps = 2/337 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
             V  L +      V+AEDPYLF EW VTYG ++PLGV    ILINGK PGP IN TSNNN+
Sbjct  8     VVALLVCLCVVAVKAEDPYLFFEWNVTYGTIAPLGVPLQGILINGKLPGPRINCTSNNNI  67

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             VVNVFN LD+PLL  WNG+QQRKNSWQDG PGT CPI+PGTN+TY FQVKDQIG+ FYFP
Sbjct  68    VVNVFNNLDDPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGSFFYFP  127

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             +T LHR+AGG+GA+ VHSR LIPVPFD PADE+ +F+ DWYNKG++ LKK LD G TI R
Sbjct  128   TTDLHRAAGGFGAINVHSRALIPVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGR  187

Query  465   PNGLVINAKHGEVGDKM-EPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             P+G+ IN K  +VGDK+ EPL T+EAGKTYR+R+CN GMRTS+N R QGH M LVE+EGS
Sbjct  188   PDGIHINGKSLKVGDKVAEPLFTMEAGKTYRYRMCNAGMRTSVNVRIQGHPMKLVEMEGS  247

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKN-QLSTVGLIKYANGKGaa  112
             H VQN Y+SLDLH GQCLSVLVTADQ+PKDYY++ +SRFLK  QLS+V +I+YANGKG A
Sbjct  248   HTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKGPA  307

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +++LP PPP+ T+GIAWSINQFRSFRWNLTASAARPN
Sbjct  308   SSDLPAPPPENTQGIAWSINQFRSFRWNLTASAARPN  344



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   462 bits (1190),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 233/342 (68%), Positives = 281/342 (82%), Gaps = 3/342 (1%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             +  M  +  L  ++FV V+ EDPYL  EW VTYG ++PLGV +  ILING+ PGP IN T
Sbjct  3     RTSMTVVCLLVCLSFVLVKGEDPYLRFEWNVTYGTIAPLGVPQQGILINGQLPGPRINCT  62

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             SNNN+VVNVFN LDEPLL  WNG+QQRKNSWQDG PGT CPI+PGTN+TY FQVKDQIG+
Sbjct  63    SNNNIVVNVFNHLDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGS  122

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
              FYFP+T LHR+AGG+GA+ VHSR LIPVPFD PAD++ +F+ DWYNKG++ LKK LD G
Sbjct  123   FFYFPTTDLHRAAGGFGAINVHSRALIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGG  182

Query  480   HTIARPNGLVINAKHGEVGDKM-EPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
              TI RP+G+ IN K  +VG+K+ EPL  +EAGKTYR+R CNVGMRTS+N R QGH M LV
Sbjct  183   RTIGRPDGIHINGKSEKVGEKVAEPLYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLV  242

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKN-QLSTVGLIKYAN  127
             E+EGSH VQN Y+SLDLH GQCLSVLVTADQ+PKDYY++ +SRFLK  +LS+V +I+Y N
Sbjct  243   EIEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYVN  302

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             GKG A+++LP PPP+ T+GIAWS+NQFRSFRWNLTASAARPN
Sbjct  303   GKGPASSDLPAPPPENTQGIAWSMNQFRSFRWNLTASAARPN  344



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   461 bits (1185),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 269/337 (80%), Gaps = 7/337 (2%)
 Frame = -1

Query  990  LFAMAFVVQ------AEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
            LFA A  V       AEDPYLF +WKVTYG ++PLGV +  ILING+FPGP IN TSNNN
Sbjct  7    LFAAALFVCMLAGALAEDPYLFFDWKVTYGTIAPLGVPQQGILINGEFPGPVINCTSNNN  66

Query  828  vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
            +VVNVFN LDEPLL  W GIQQRKNSWQDG PGT CPILPGTNYTY FQVKDQIG++ YF
Sbjct  67   IVVNVFNYLDEPLLLTWAGIQQRKNSWQDGTPGTMCPILPGTNYTYKFQVKDQIGSYIYF  126

Query  648  PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
            P+T L R++GG G L VHSRELIPVPFD PADEF + L DWYNKGH+ LK+ LD G +I 
Sbjct  127  PTTGLQRASGGMGMLKVHSRELIPVPFDMPADEFAVLLGDWYNKGHKTLKRILDSGRSIG  186

Query  468  RPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
            +P+G+ IN K   VGD   +PLA +E GKTYR+RVCNVGM+ S+NFRFQGH+M LVE+EG
Sbjct  187  KPDGIQINGKSSSVGDAAAQPLAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEG  246

Query  291  SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
            SH VQN YDSLDLH GQCLSVLVTADQ PKDYYLV +SRF K  +STV +I+Y NG GAA
Sbjct  247  SHTVQNVYDSLDLHVGQCLSVLVTADQAPKDYYLVVSSRFSKKVMSTVAVIRYKNGNGAA  306

Query  111  aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
            +  +PPPP +   GIAWS+NQFRSFRWNLTASAARPN
Sbjct  307  SLSIPPPPAENRAGIAWSMNQFRSFRWNLTASAARPN  343



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   460 bits (1184),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/342 (68%), Positives = 279/342 (82%), Gaps = 3/342 (1%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             +  +  +  L  + FV V+AEDPYL  EW VTYG ++PLGV    ILING+ PGP IN T
Sbjct  3     RTSITVVSLLVCLTFVLVKAEDPYLRFEWNVTYGTIAPLGVPLQGILINGQLPGPRINCT  62

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             SNNN+VVNVFN LDEPLL  WNG+QQRKNSWQDG PGT CPI+PGTN+TY FQVKDQIG+
Sbjct  63    SNNNIVVNVFNHLDEPLLLTWNGVQQRKNSWQDGTPGTMCPIMPGTNFTYRFQVKDQIGS  122

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
              FYFP+T LHR+AGG+GA+ VHSR LIPVPFD PAD++ +F+ DWYNKG++ LKK LD G
Sbjct  123   FFYFPTTDLHRAAGGFGAINVHSRALIPVPFDNPADDYSVFVGDWYNKGYKSLKKILDGG  182

Query  480   HTIARPNGLVINAKHGEVGDK-MEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
              TI RP+G+ IN K  +VGDK  EPL  +EAGKTYR+R CNVGMRTS+N R QGH M LV
Sbjct  183   RTIGRPDGIHINGKSVKVGDKAAEPLYKMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLV  242

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKN-QLSTVGLIKYAN  127
             E+EGSH VQN Y+SLDLH GQCLSVLVTADQ+PKDYY++ +SRFLK  +LS+V +I+Y N
Sbjct  243   EIEGSHTVQNVYESLDLHVGQCLSVLVTADQEPKDYYMIVSSRFLKQAELSSVSIIRYTN  302

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             GKG A+++LP PPP+ T+GIAWS+NQFRSFRWNLTASAARPN
Sbjct  303   GKGPASSDLPAPPPENTKGIAWSMNQFRSFRWNLTASAARPN  344



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   458 bits (1179),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 242/347 (70%), Positives = 279/347 (80%), Gaps = 5/347 (1%)
 Frame = -1

Query  1026  LTNKMGMVFL---LWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGP  856
             + +K  M+F+   L +   A  V AEDPY+F EWKVTYG +SPLGV +  ILING+FPGP
Sbjct  1     MGSKKMMIFVVGALLVCLSATGVLAEDPYVFLEWKVTYGTISPLGVPQQGILINGQFPGP  60

Query  855   TINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVK  676
              IN TSNNN+VVNVFN LDEPLLF W GIQQRKNSW DG  GT CPILPG N+TY FQVK
Sbjct  61    KINCTSNNNIVVNVFNHLDEPLLFTWTGIQQRKNSWMDGTLGTMCPILPGQNFTYKFQVK  120

Query  675   DQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKK  496
             DQIG++FYFP+T+ HR+AGG G L +HSR+LIPVPFD PADEF + L DWYNKGH+ LKK
Sbjct  121   DQIGSYFYFPTTAFHRAAGGMGMLQIHSRDLIPVPFDTPADEFAVLLGDWYNKGHKTLKK  180

Query  495   TLDDGHTIARPNGLVINAKHGEVGDK-MEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
              LD G TI  PNG+ IN + G+VG   + PLA +E GKTYR+RVCNVG+RTS+NFRFQ H
Sbjct  181   ILDSGATIGLPNGIHINGQSGKVGSAPLTPLAIVEPGKTYRYRVCNVGLRTSINFRFQSH  240

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVEVEGSH VQN YDSLDLH GQC+SVLVTADQ PKDYYLVA+SRF K  LS+V +I
Sbjct  241   IMKLVEVEGSHTVQNVYDSLDLHAGQCVSVLVTADQAPKDYYLVASSRFSKKPLSSVAII  300

Query  138   KYANGKG-aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +YANGKG  A+ ELPPPPP+ T GIAWS+NQFRS+RWNLTASAARPN
Sbjct  301   RYANGKGAPASPELPPPPPENTAGIAWSVNQFRSYRWNLTASAARPN  347



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   457 bits (1177),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 234/337 (69%), Positives = 270/337 (80%), Gaps = 7/337 (2%)
 Frame = -1

Query  990  LFAMAFVV------QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
            LF++A  V       AEDPYLF +WKVTYG ++PLGV +  ILING+FPGP IN TSNNN
Sbjct  7    LFSVALFVCMLAGAVAEDPYLFFDWKVTYGTIAPLGVPQQGILINGEFPGPIINCTSNNN  66

Query  828  vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
            +VVNVFN LDEPLL  W GIQQRKNSWQDG PGT CPILPGTNYTY FQVKDQIG++ YF
Sbjct  67   IVVNVFNYLDEPLLLTWGGIQQRKNSWQDGTPGTMCPILPGTNYTYKFQVKDQIGSYIYF  126

Query  648  PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
            P+T L R++GG G L VHSRELIPVPFD PADEF + L DWYNKGH+ LKK LD G +I 
Sbjct  127  PTTGLQRASGGMGMLQVHSRELIPVPFDMPADEFAVLLGDWYNKGHKTLKKILDSGRSIG  186

Query  468  RPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
            +P+G+ IN K  +VGD   +PLA +E GKTYR+RVCNVGM+ S+NFRFQGH+M LVE+EG
Sbjct  187  KPDGIQINGKSSKVGDVAAQPLAVMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEG  246

Query  291  SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
            SH VQN YDSLDLH GQCLSVLVTA+Q PKDYYLV +SRF K  +S+V +IKY N  GAA
Sbjct  247  SHTVQNVYDSLDLHVGQCLSVLVTANQAPKDYYLVVSSRFSKQVMSSVAVIKYKNANGAA  306

Query  111  aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
            +  +PPPP +   GIAWS+NQFRSFRWNLTASAARPN
Sbjct  307  STVIPPPPAENRVGIAWSMNQFRSFRWNLTASAARPN  343



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   455 bits (1170),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/338 (69%), Positives = 274/338 (81%), Gaps = 2/338 (1%)
 Frame = -1

Query  1008  MVFL-LWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             M+F+ L+LF     V A DP L HEWKVTYG ++PLGV +  ILING+FPGP IN TSNN
Sbjct  7     MIFVVLFLFVSVTCVNAGDPTLEHEWKVTYGTIAPLGVPQQGILINGQFPGPAINCTSNN  66

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             N+VVNVFN+LDEP L  W GIQQRKNSWQDG PG  CPILPG NYTY FQVKDQIGT+FY
Sbjct  67    NIVVNVFNQLDEPFLLTWVGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFY  126

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             FP+T+LHR++GG G L VHSR LIP+P+D PA+E+ + L DWYNKGH+ LK  LD G +I
Sbjct  127   FPTTALHRASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSI  186

Query  471   ARPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
              RP+G+ IN +  +VGD   +PL T EAGKTY+ RVCNVG+R S+NFR QGH+M +VEVE
Sbjct  187   GRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVE  246

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSH VQN YDSLDLH GQC+SVLVTADQ PKDYY VA+SRF ++ LSTV +I+YANG G 
Sbjct  247   GSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGP  306

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             A+ ELPPPPPD T+GIAWSI+QFRSFRWNLT++AARPN
Sbjct  307   ASPELPPPPPDSTKGIAWSISQFRSFRWNLTSNAARPN  344



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   454 bits (1169),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 233/338 (69%), Positives = 275/338 (81%), Gaps = 2/338 (1%)
 Frame = -1

Query  1008  MVF-LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             M+F +L+L   A  V A DP L HEWKVTYG ++PLGV +  ILING+FPGP IN TSNN
Sbjct  7     MIFAVLFLCVSATCVIAGDPTLEHEWKVTYGTIAPLGVPQQGILINGQFPGPAINCTSNN  66

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             N+VVNVFN+LDEP L  W GIQQRKNSWQDG PG  CPILPG NYTY FQVKDQIGT+FY
Sbjct  67    NIVVNVFNQLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFY  126

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             FP+T+LHR++GG G L VHSR LIP+P+D PA+E+ + L DWYNKGH+ LK  LD G +I
Sbjct  127   FPTTALHRASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSI  186

Query  471   ARPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
              RP+G+ IN +  +VGD   +PL T EAGKTY+ RVCNVG+R S+NFR QGH+M +VEVE
Sbjct  187   GRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVE  246

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSH VQN YDSLDLH GQC+SVLVTADQ PKDYY VA+SRF ++ LSTV +I+YANG GA
Sbjct  247   GSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGA  306

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             A+ ELPPPPPD T+GIAWSI+QFRSFRWNLT++AARPN
Sbjct  307   ASPELPPPPPDSTKGIAWSISQFRSFRWNLTSNAARPN  344



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   451 bits (1159),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 229/337 (68%), Positives = 266/337 (79%), Gaps = 1/337 (0%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             M+  +     +  V A DP L  EWKVTYG ++PLGV +  ILING+FPGP IN TSNNN
Sbjct  7     MISAVLFLCFSTCVIAGDPTLEFEWKVTYGTIAPLGVPQQGILINGQFPGPKINCTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFN+LDEP L  W G+QQRKNSWQDG PG  CPILPG NYTY FQVKDQIGT+FYF
Sbjct  67    IVVNVFNQLDEPFLLTWAGVQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFYF  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T LHR++GG G + +HSR LIP+PFD PADE+ + L DWYNKGH+ LK  LD G +I 
Sbjct  127   PTTGLHRASGGMGMIQIHSRNLIPIPFDKPADEYPVLLGDWYNKGHKSLKNILDSGRSIG  186

Query  468   RPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
             RP+G+ IN +  +VGD   +PL T EAGKTYRFRVCNVG+R S+NFR Q HSM +VEVEG
Sbjct  187   RPDGIQINGQSSKVGDANAKPLFTFEAGKTYRFRVCNVGLRLSVNFRIQAHSMTVVEVEG  246

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SH VQN YDSLDLH GQC+SVLVTADQ PKDYY VA+SRF ++ LSTV +I+YANG G A
Sbjct  247   SHTVQNVYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGPA  306

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             + ELPPPPP  T GIAWSI+QFRSFRWNLTASAARPN
Sbjct  307   SPELPPPPPQNTMGIAWSISQFRSFRWNLTASAARPN  343



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   450 bits (1157),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 220/342 (64%), Positives = 264/342 (77%), Gaps = 4/342 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             + N++  V  + L    F V  EDPYLFHEWKVTYG LSPLGV + +ILING+FPGP IN
Sbjct  1     MNNRLRFVLAILLAIPCFFVNGEDPYLFHEWKVTYGTLSPLGVPQKIILINGQFPGPRIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
             GTSNNN+VVNVFN+LDEPLLF WNG+QQRKNSWQ+G PGT CPI PG N TY FQVKDQI
Sbjct  61    GTSNNNIVVNVFNQLDEPLLFTWNGVQQRKNSWQEGTPGTNCPIPPGANITYRFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+++Y+PST+LHR+AGG+G ++V SR LIPVPFD P D+F + ++DWY K H +LK  LD
Sbjct  121   GSYYYYPSTALHRAAGGFGGISVLSRALIPVPFDTPEDDFMVLVADWYTKSHTELKNLLD  180

Query  486   DGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
             +G  + RP G++IN K G+   K EP+ TL  GKTYRFR CNVGM+ S+N RFQGH+M L
Sbjct  181   NGRALGRPQGVIINGKSGKGDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKL  240

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VE+EGSH VQN Y+SLD+H GQC+SVL+TADQDPKDY+LVA++RF K        I+YAN
Sbjct  241   VEIEGSHTVQNVYESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKEPHVATATIRYAN  300

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             GKG       P  P   EG AWS+NQFRSFRWNLTASAARPN
Sbjct  301   GKG----PASPELPKAPEGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   449 bits (1156),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 230/342 (67%), Positives = 275/342 (80%), Gaps = 2/342 (1%)
 Frame = -1

Query  1023  TNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             +N   +   L+L+   F + A DP L HEWKVTYG ++PLGV +  ILING+FPGP IN 
Sbjct  3     SNSQIIFVALFLYLSTFAI-AGDPTLEHEWKVTYGTIAPLGVPQQGILINGQFPGPAINC  61

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             TSNNN+VVNVFN+LDEP L  W GIQQRKNSWQDG PG  CPILPG NYTY FQVKDQIG
Sbjct  62    TSNNNIVVNVFNQLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIG  121

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             T+FYFP+T+LHR++GG G L VHSR LIP+P+D PA+E+ + L DWYNKGH+ LK  LD 
Sbjct  122   TYFYFPTTALHRASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDS  181

Query  483   GHTIARPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
             G +I RP+G+ IN +  +VGD   +PL T EAGKTY+ RVCNVG+R S+NFR QGH+M +
Sbjct  182   GRSIGRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKV  241

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VEVEGSH VQN YDSLDLH GQC+SVLVTADQ PKDYY VA+SRF ++ LSTV +I+YAN
Sbjct  242   VEVEGSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYAN  301

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G GAA+ ELPPPPP+ T+GIAWSI+QFRSFRWNLT++AARPN
Sbjct  302   GNGAASPELPPPPPENTKGIAWSISQFRSFRWNLTSNAARPN  343



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   444 bits (1141),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 217/342 (63%), Positives = 263/342 (77%), Gaps = 4/342 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             + N +  V  + L     +V  EDPYLFHEWKVTYG LSPLGV + VILING+FPGP IN
Sbjct  1     MNNMLRFVLAILLVIPCILVNGEDPYLFHEWKVTYGTLSPLGVPQKVILINGQFPGPRIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
             GTSNNN++VNVFN+LDEPLLF WNG+QQRKNSWQ+G  GT CPI PG N+TY FQVKDQI
Sbjct  61    GTSNNNIIVNVFNQLDEPLLFTWNGVQQRKNSWQEGTHGTNCPIPPGANFTYRFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+++Y+P+T+LHR+AGG+G ++V SR LIPVPFD P D+F + ++DWY K H +LK  LD
Sbjct  121   GSYYYYPTTTLHRAAGGFGGISVLSRALIPVPFDTPEDDFMVLVADWYTKSHTELKNLLD  180

Query  486   DGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
             +G  + RP G++IN K G+   K EP+ TL  GKTYRFR CNVGM+ S+N RFQGH+M L
Sbjct  181   NGRALGRPQGVIINGKSGKGDGKDEPMYTLTPGKTYRFRFCNVGMKDSINVRFQGHTMKL  240

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VE+EGSH VQN Y+SLD+H GQC+SVL+TADQDPKDY+LVA++RF K        I+YAN
Sbjct  241   VEIEGSHTVQNVYESLDVHLGQCMSVLITADQDPKDYFLVASTRFTKEPHVATATIRYAN  300

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             GKG       P  P   EG AWS+NQFRSFRWNLTASAARPN
Sbjct  301   GKG----PASPQLPKAPEGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   443 bits (1139),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 229/338 (68%), Positives = 273/338 (81%), Gaps = 2/338 (1%)
 Frame = -1

Query  1008  MVF-LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             M+F +L+L   A  V A DP L  EWKVTYG ++PLGV +  ILING+FPGP IN TSNN
Sbjct  7     MIFAVLFLCFSATCVIAGDPTLEFEWKVTYGTIAPLGVPQQGILINGQFPGPAINCTSNN  66

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             N+VVNVFN+LDEP L  W GIQQRKNSWQDG PG  CPILPG NYTY FQVKDQIGT+FY
Sbjct  67    NIVVNVFNQLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFY  126

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             FP+T+LHR++GG G L VHSR LIP+P+D PA+E+ + L DWYNKGH+ LK  LD G +I
Sbjct  127   FPTTALHRASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSI  186

Query  471   ARPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
              RP+G+ IN +  +VGD   +PL T EAGKTY+ RVCNVG+R S+NFR QGH++ +VEVE
Sbjct  187   GRPDGIQINGQSSKVGDANAKPLFTFEAGKTYKLRVCNVGLRLSVNFRVQGHTLKVVEVE  246

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSH VQN YDSLDLH GQC+SVLVTADQ PKDYY VA+SRF ++ LSTV +I+Y NG GA
Sbjct  247   GSHNVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPLSTVAVIRYVNGNGA  306

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             A+ ELPPPPP+ T+GIAWSI+QFRSFRWNLT++AARPN
Sbjct  307   ASPELPPPPPENTKGIAWSISQFRSFRWNLTSNAARPN  344



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   442 bits (1137),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 229/338 (68%), Positives = 272/338 (80%), Gaps = 2/338 (1%)
 Frame = -1

Query  1008  MVF-LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             M+F +L+L   A  V A DP L  EWKVTYG ++PLGV +  ILING+FPGP IN TSNN
Sbjct  7     MIFAVLFLCFSATCVIAGDPTLEFEWKVTYGTIAPLGVPQQGILINGQFPGPAINCTSNN  66

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             N+VVNVFN+LDEP L  W GIQQRKNSWQDG PG  CPILPG NYTY FQVKDQIGT+FY
Sbjct  67    NIVVNVFNQLDEPFLLTWAGIQQRKNSWQDGTPGAMCPILPGKNYTYRFQVKDQIGTYFY  126

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             FP+T+LHR++GG G L VHSR LIP+P+D PA+E+ + L DWYNKGH+ LK  LD G +I
Sbjct  127   FPTTALHRASGGIGMLKVHSRPLIPIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSI  186

Query  471   ARPNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
              RP+G+ IN +  +VGD   +PL T EAG TY+ RVCNVG+R S+NFR QGH+M +VEVE
Sbjct  187   GRPDGIQINGQSSKVGDANAKPLFTFEAGNTYKLRVCNVGLRLSVNFRVQGHTMKVVEVE  246

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSH VQN YDSLDLH GQC+SVLVTADQ PKDYY VA+SRF ++  STV +I+YANG GA
Sbjct  247   GSHTVQNLYDSLDLHVGQCMSVLVTADQTPKDYYFVASSRFAQHPHSTVAVIRYANGNGA  306

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             A+ ELPPPPP+ T+GIAWSI+QFRSFRWNLT++AARPN
Sbjct  307   ASPELPPPPPENTKGIAWSISQFRSFRWNLTSNAARPN  344



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   442 bits (1138),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/324 (68%), Positives = 263/324 (81%), Gaps = 0/324 (0%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV+AEDPYLF EW VTYG +SP+GV    ILING+FPGP IN TSNNN+VVNVFN+LDEP
Sbjct  23   VVRAEDPYLFFEWTVTYGTISPVGVPVQAILINGQFPGPKINCTSNNNIVVNVFNKLDEP  82

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W GIQQRKNSWQDG  GT CPI PGTNYT+ FQVKDQIG+++YFP+T L R++GG 
Sbjct  83   FLLTWYGIQQRKNSWQDGTLGTMCPIQPGTNYTFKFQVKDQIGSYYYFPTTGLQRASGGI  142

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L VHSR LIPVPFD PADE+++   DWYNKGH+ ++K LD G ++ RP+G+ IN K G
Sbjct  143  GGLQVHSRLLIPVPFDAPADEYFVIAGDWYNKGHKSIQKQLDTGRSLGRPDGIQINGKSG  202

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +VG   EP+  +EAGK YR+RVCNVGM+TS+NFR QGHS+ LVE+EGSH VQN YDSLD+
Sbjct  203  KVGGSNEPMFNMEAGKIYRYRVCNVGMKTSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDV  262

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SVLV A+Q+P DYY+V +SRF K  L++V +I+YANGK + ++ELP PPP+   
Sbjct  263  HIGQCFSVLVEANQEPNDYYMVFSSRFTKQPLTSVAVIRYANGKNSPSSELPAPPPETAT  322

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            GIAWSINQFRSFRWNLTASAARPN
Sbjct  323  GIAWSINQFRSFRWNLTASAARPN  346



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   436 bits (1121),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 264/340 (78%), Gaps = 7/340 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAF---VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             + F+L L A+     +V+  DP+LF EWKVTYG +SPLGV + VIL+NG+FPGP INGTS
Sbjct  4     LRFVLVLLALCLSTSLVKGGDPFLFFEWKVTYGTISPLGVPQQVILVNGQFPGPIINGTS  63

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNN+VVNVFN+LDEP LF WNG+QQRKNSWQ+G  GT CPI PG+N+TY FQVKDQIG+ 
Sbjct  64    NNNIVVNVFNQLDEPFLFTWNGVQQRKNSWQEGTLGTNCPIPPGSNFTYQFQVKDQIGSF  123

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDW-PADEFYIFLSDWYNKGHRDLKKTLDDG  481
             +Y+P+T+LHR+AGGYG ++VHSR LIPVPFD  PADEF++ +SDWY K H  ++K LD G
Sbjct  124   YYYPTTALHRAAGGYGGISVHSRALIPVPFDVNPADEFFVLVSDWYTKSHSQMRKLLDSG  183

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
               + RPNG++IN K G+  +K EP+ T+  GKTYR+R CNVGM+ S+N R QGH M LVE
Sbjct  184   RALGRPNGVIINGKSGKGDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQGHVMKLVE  243

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSH VQN YDSLD+H GQC+SVLVTAD+DPKDY+LVA++RF K   +    I+YANGK
Sbjct  244   IEGSHTVQNMYDSLDVHLGQCMSVLVTADKDPKDYFLVASTRFTKEPHTATATIRYANGK  303

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G   A      P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   G---APASLELPKAPIGWAWSLNQFRSFRWNLTASAARPN  340



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   434 bits (1117),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 214/336 (64%), Positives = 261/336 (78%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +   L+  + + +V AEDPYLF+EW V+YG ++PLGV + VILING+FPGP INGTSNNN
Sbjct  9     VAVFLFCLSTSLIVNAEDPYLFYEWNVSYGTIAPLGVPQQVILINGEFPGPRINGTSNNN  68

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             V VNVFN LDEPLLF WNG+QQRKNSWQ+G+ GT+CPI PGTN+T+ FQVKDQIG+++Y+
Sbjct  69    VNVNVFNNLDEPLLFTWNGVQQRKNSWQEGLLGTSCPIPPGTNHTFRFQVKDQIGSYYYY  128

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PST+LHR+AGGYG LTV SR+LIPVPFD P  ++ I   DWY+K H  L+K LD G T+ 
Sbjct  129   PSTALHRAAGGYGPLTVVSRDLIPVPFDAPEADYTIMAGDWYSKSHVALRKLLDSGRTLG  188

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+G++IN K G+   K EP+ T+  GKTYR+RVCNVGM+ S+NFRFQGH+M LVE+EGS
Sbjct  189   RPDGVLINGKSGKADGKDEPMFTMIPGKTYRYRVCNVGMKNSLNFRFQGHTMKLVEMEGS  248

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H +Q  YDSLDLH GQC SVLVTAD++PKDYY VA++RF K  LS    I+Y  GKG   
Sbjct  249   HTMQYLYDSLDLHLGQCASVLVTADKEPKDYYFVASTRFTKQILSATATIRYTTGKG---  305

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P  P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  306   -PASPELPPAPVGWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   434 bits (1115),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 258/327 (79%), Gaps = 4/327 (1%)
 Frame = -1

Query  981  MAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNEL  802
            M   V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN TSNNN+V+NVFN L
Sbjct  17   MTATVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNLVINVFNNL  76

Query  801  DEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSA  622
            DEP L HW+GIQ RKNSWQDG+ GT CPILPGTNYTYHFQVKDQIG+ FY+PST++HR+A
Sbjct  77   DEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQVKDQIGSFFYYPSTAMHRAA  136

Query  621  GGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINA  442
            GG+G L V+SR LIPVP+  P D++ + + DWY K H  LK+ LD G +IARP+G++IN 
Sbjct  137  GGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQLLDSGRSIARPDGVLING  196

Query  441  KHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDS  262
            K  +     EPL T++ GKTY++RVCNVG+++S+NFRFQGH+M LVE+EGSH VQNDY+S
Sbjct  197  KSAKGDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYES  256

Query  261  LDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPD  82
            LD+H GQC SVLVTA+Q+PKDYY+VA++RF+KN L   G+++Y +GKG       P  P+
Sbjct  257  LDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKG----PASPEIPE  312

Query  81   GTEGIAWSINQFRSFRWNLTASAARPN  1
               G AWS+NQFR+FRWNLTASAARPN
Sbjct  313  APMGWAWSLNQFRTFRWNLTASAARPN  339



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   433 bits (1113),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/343 (62%), Positives = 262/343 (76%), Gaps = 5/343 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTI  850
             + N++G V  + L     + V  EDPYLFHEWKVTYG LSPLGV + +ILING+FPGP I
Sbjct  1     MNNRLGCVLAILLAITCNISVNGEDPYLFHEWKVTYGTLSPLGVPQKIILINGQFPGPRI  60

Query  849   NGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQ  670
             NGTSNNNVVVNVFN+LDEPLLF W+GIQQRKNSWQ+G  G  CPI PGTN+TY FQVKDQ
Sbjct  61    NGTSNNNVVVNVFNQLDEPLLFTWSGIQQRKNSWQEGTLGNNCPIPPGTNFTYRFQVKDQ  120

Query  669   IGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTL  490
             IG+++Y+P+TS+HR+AGG+G ++V SR LIPVPF+ P  +  + + DWY K H +LK+ L
Sbjct  121   IGSYYYYPTTSMHRAAGGFGGISVLSRALIPVPFETPEADHMVLVGDWYTKSHTELKRLL  180

Query  489   DDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             D G  + RP G+VIN K G+   K EP+ T+  GKTYRFR+CNVG++ S+N R QGH++ 
Sbjct  181   DSGRALGRPQGVVINGKSGKGDGKDEPMFTVTPGKTYRFRICNVGLKDSINVRMQGHTLK  240

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQN Y+SLD+H GQC SVLVTA+Q+PKDY+LVA++RF K+       I+YA
Sbjct  241   LVEIEGSHTVQNVYESLDIHLGQCFSVLVTANQEPKDYFLVASTRFTKDSHVATTTIRYA  300

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             NGKG       P  P   EG AWS+NQFRSFRWNLTASAARPN
Sbjct  301   NGKG----PASPELPKAPEGWAWSLNQFRSFRWNLTASAARPN  339



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   432 bits (1111),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 257/327 (79%), Gaps = 4/327 (1%)
 Frame = -1

Query  981  MAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNEL  802
            M   V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN TSNNN+V+NVFN L
Sbjct  17   MTATVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNLVINVFNNL  76

Query  801  DEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSA  622
            DEP L HW+GIQ RKNSWQDG+ GT CPILPGTNYTYHFQVKDQIG+ FY+PST++HR+A
Sbjct  77   DEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQVKDQIGSFFYYPSTAMHRAA  136

Query  621  GGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINA  442
            GG+G L V+SR LIPVP+  P D++ + + DWY K H  LK+ LD G +IARP+G++IN 
Sbjct  137  GGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIARPDGVLING  196

Query  441  KHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDS  262
            K  +     EPL T++ GKTY++RVCNVG+++S+NFRFQGH+M LVE+EGSH VQNDY S
Sbjct  197  KTAKGDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQS  256

Query  261  LDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPD  82
            LD+H GQC SVLVTA+Q+PKDYY+VA++RF+KN L   G+++Y +GKG       P  P+
Sbjct  257  LDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKG----PASPEIPE  312

Query  81   GTEGIAWSINQFRSFRWNLTASAARPN  1
               G AWS+NQFR+FRWNLTASAARPN
Sbjct  313  APMGWAWSLNQFRTFRWNLTASAARPN  339



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   431 bits (1108),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 263/336 (78%), Gaps = 4/336 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
             + LL L A A  V+ EDPYLF  W VTYG +SPLGV ++ ILING+FPGP IN T+NNN+
Sbjct  6     ILLLCLLAGAVAVRGEDPYLFFTWNVTYGTISPLGVPQEGILINGQFPGPNINSTTNNNL  65

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             V+NVFN +DEPLLF WNGIQQRKNSWQDG+ GT CPI PG N+TY FQVKDQIG++FY+P
Sbjct  66    VINVFNNIDEPLLFTWNGIQQRKNSWQDGVLGTNCPIPPGKNFTYRFQVKDQIGSYFYYP  125

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             +T++HR+AGG+G L V+SR LIPVP+  P D++ + + DWY+K H  L++ LD G  +AR
Sbjct  126   TTAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKSHTVLRQKLDAGRPLAR  185

Query  465   PNGLVINAKHGE-VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             P+G++IN + G+  G  ++PL T++ GKTY++R+CNVG++ S+NFR QGH M LVE+EGS
Sbjct  186   PDGVLINGQTGKGKGKDVKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGS  245

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN YDSLD+H GQC SVL+TAD+DP+DYY+VA++RF K+ L+  G+I+Y NG G   
Sbjct  246   HTVQNTYDSLDVHVGQCFSVLITADKDPRDYYMVASTRFTKSVLTATGIIRYTNGNG---  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             A      P   EG AWS+NQFRSFRWNLTASAARPN
Sbjct  303   APASSILPKAPEGWAWSLNQFRSFRWNLTASAARPN  338



>gb|AFK33666.1| unknown [Lotus japonicus]
Length=467

 Score =   427 bits (1099),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/337 (63%), Positives = 260/337 (77%), Gaps = 4/337 (1%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G++F+L L  +   V  EDPY+F+ W VTYG +SPLGV +  ILING+FPGP IN TSNN
Sbjct  4     GVMFMLMLCILGVAVMGEDPYIFYTWNVTYGTISPLGVPQQGILINGQFPGPEINSTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             NVVVNVFN LDEPL F W+G+QQRKNSWQDG+ GT+C ILPGTNYTYHFQVKDQIG++FY
Sbjct  64    NVVVNVFNNLDEPLQFTWHGVQQRKNSWQDGVAGTSCHILPGTNYTYHFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T+LHR+AGG+G L + SR LIPVP+  P DE+++ + DWY K H+ LK  LD G +I
Sbjct  124   YPTTALHRAAGGFGGLRIFSRLLIPVPYPDPEDEYWVIIGDWYAKSHKTLKSLLDSGRSI  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RPNG++IN K  +     +PL T++ GKTY++R+CNVG++ S+NFR QGH M LVE EG
Sbjct  184   GRPNGVLINGKTAKGDGSDQPLYTMKPGKTYKYRICNVGLKDSLNFRIQGHPMKLVETEG  243

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SHVVQN YDSLD+H GQC +VLVTAD+DPKDYYLVA++RF K  L+  G+I+Y NG G  
Sbjct  244   SHVVQNTYDSLDVHVGQCYTVLVTADKDPKDYYLVASTRFTKYSLTGKGIIRYTNGVG--  301

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                  P  P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  302   --PASPELPPAPVGWAWSLNQFRSFRWNLTASAARPN  336



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   431 bits (1107),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 213/343 (62%), Positives = 256/343 (75%), Gaps = 5/343 (1%)
 Frame = -1

Query  1026  LTNKMGMVF-LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTI  850
             +  K+G V  +L    +   V  EDPYLFHEWKVTYG LSPLGV + VILING+FPGP I
Sbjct  1     MNKKLGCVLSILLAITLTISVNGEDPYLFHEWKVTYGTLSPLGVPQKVILINGQFPGPRI  60

Query  849   NGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQ  670
             NGTSNNNVVVNVFN+LDEPLL  W+GIQQRKNSWQ+G  G  CPI PG N+TY FQVKDQ
Sbjct  61    NGTSNNNVVVNVFNQLDEPLLLTWSGIQQRKNSWQEGTLGNNCPIPPGANFTYRFQVKDQ  120

Query  669   IGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTL  490
             IG+++Y+P+TS HR+AGGYG ++V SR LIPVPF+ P  +  +   DWY K H +LK+ L
Sbjct  121   IGSYYYYPTTSTHRAAGGYGGISVLSRALIPVPFETPEADHMVLAGDWYTKSHVELKRML  180

Query  489   DDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             D G  + RP G++IN K G+   K EP+ T+ AGKTYRFR CNVGM+ S+N R QGH+M 
Sbjct  181   DSGRALGRPTGVLINGKSGKGDGKDEPMFTVIAGKTYRFRFCNVGMKDSINVRMQGHTMK  240

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQN Y+S+D+H GQC SVLVTA+Q+PKDYYLV ++RF K+       I+YA
Sbjct  241   LVEIEGSHTVQNVYESIDIHLGQCFSVLVTANQEPKDYYLVVSTRFTKDSHVATATIRYA  300

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             NGKG       P  P   EG AWS+NQFRSFRWNLTASAARPN
Sbjct  301   NGKG----PASPELPKAPEGWAWSLNQFRSFRWNLTASAARPN  339



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/340 (62%), Positives = 261/340 (77%), Gaps = 7/340 (2%)
 Frame = -1

Query  1020  NKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             +++  V LL LF+    V  EDPYLF +W VTYG +SPLGV + VILING+FPGP IN T
Sbjct  2     DRLNFVLLL-LFSCLVKVHGEDPYLFFDWNVTYGTISPLGVPQQVILINGQFPGPKINCT  60

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             SNNN+VVNVFN+LDEP L  WNGIQQRKNSWQ+G  GT CPILPG N+TYHFQVKDQIG+
Sbjct  61    SNNNIVVNVFNQLDEPFLLTWNGIQQRKNSWQEGTLGTNCPILPGKNFTYHFQVKDQIGS  120

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
             ++Y+P+T+LHR+ GGYG +++HSR LIPVPFD P +EF +F+SDWY K H+ L+  LD+G
Sbjct  121   YYYYPTTALHRATGGYGPISIHSRLLIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEG  180

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
              +I RP G++IN K+G+   K EP+ ++ +GKTYR+R CNVGM+ S+N RFQGH+M LVE
Sbjct  181   RSIGRPEGIIINGKNGKGDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVE  240

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSH VQN Y+SLD+H GQCLSVLVTADQ+PKDY+LVA+SRF K        I+Y N  
Sbjct  241   MEGSHTVQNMYESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKEPHIATATIRYTNDP  300

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                     P  P   EG  WS+NQFRSFRWNLTASAARPN
Sbjct  301   A------SPELPKAPEGWEWSLNQFRSFRWNLTASAARPN  334



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 262/341 (77%), Gaps = 8/341 (2%)
 Frame = -1

Query  1011  GMVFLLWLF----AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             GM+F + L      M   V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP +N 
Sbjct  3     GMMFTMLLCLSAAGMMATVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNVNS  62

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             T+NNN+V+NVFN LDEP L HW+GIQ RKNSWQDG+ GT CPI PGTN+TYHFQVKDQIG
Sbjct  63    TTNNNLVINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIG  122

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             + FY+PST++HR+AGG+G + V+SR LIPVP+  P D++ + + DWY K H  LK+ LD 
Sbjct  123   SFFYYPSTAMHRAAGGFGGIRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDS  182

Query  483   GHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
             G +IARP+G++IN K  +     EPL T++ GKTY++RVCNVG++TS+NFRFQGH+M LV
Sbjct  183   GRSIARPDGVLINGKTSKDDGIDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLV  242

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANG  124
             E+EGSH VQNDY SLD+H GQC SVLVTADQ+PKDYY+VA++RF+K+ L   G+++Y NG
Sbjct  243   EMEGSHTVQNDYKSLDVHVGQCFSVLVTADQEPKDYYMVASTRFIKSALVGKGIVRYTNG  302

Query  123   KGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             KG       P  P+   G AWS+NQFR+FRWNLTASAARPN
Sbjct  303   KG----PASPEIPNAPMGWAWSLNQFRTFRWNLTASAARPN  339



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   429 bits (1103),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 210/328 (64%), Positives = 252/328 (77%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNE  805
             +  +VQ+EDPYLF+ W V+Y  LSPLGV + VI ING+FPGP INGTSNNNV++NVFN 
Sbjct  14   TLVVLVQSEDPYLFYTWDVSYSTLSPLGVPQQVITINGQFPGPRINGTSNNNVIINVFNN  73

Query  804  LDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRS  625
            LDEPLLF WNGIQQRKNSWQ+G+ GT CPI PGTN+TY FQVKDQIG++FY+P+TSLHR+
Sbjct  74   LDEPLLFTWNGIQQRKNSWQEGVLGTNCPIQPGTNFTYKFQVKDQIGSYFYYPTTSLHRA  133

Query  624  AGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVIN  445
            AGGYG LTVHSRELIPVPFDWP +E+ +   DWY K H +LK+ +D+G TI R +G++IN
Sbjct  134  AGGYGPLTVHSRELIPVPFDWPEEEYIVLTGDWYRKSHTELKRHMDNGKTIGRTDGVIIN  193

Query  444  AKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYD  265
             K G+      P+ T+  GKTYR+R CNVGM+ S+N R QGH+M LVE+EGSH VQN YD
Sbjct  194  GKQGKGDGSDPPMFTMIPGKTYRYRFCNVGMKNSLNVRIQGHTMKLVEIEGSHTVQNVYD  253

Query  264  SLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppP  85
            SLD+H GQC SVLVTADQ PKDYYLV+++RF K  L T   I+Y            P  P
Sbjct  254  SLDVHMGQCYSVLVTADQKPKDYYLVSSTRFTKTVLMTTATIRYTGSN----EPASPVLP  309

Query  84   DGTEGIAWSINQFRSFRWNLTASAARPN  1
            +   G AWS+NQFRSFRWNLTASAARPN
Sbjct  310  EAPTGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   428 bits (1101),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 214/339 (63%), Positives = 262/339 (77%), Gaps = 5/339 (1%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M ++ LL   +   VV+AEDPY+F  W VTYG +SPLGV++  ILING+FPGP IN T+N
Sbjct  4     MKLLVLLCCISAMVVVRAEDPYIFFTWNVTYGTISPLGVSQQGILINGQFPGPNINSTTN  63

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NNVVVNVFN LDEP L  W+GIQ RKNSWQDGMPGT CPI PGTN+TYHFQVKDQIG+ F
Sbjct  64    NNVVVNVFNNLDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFF  123

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             YFP+  +HR+AGG+G L V+SR LIPVPF  P D++ + + DWY+KGH  LKK LD G +
Sbjct  124   YFPTIGMHRAAGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRS  183

Query  474   IARPNGLVINAKHGEV-GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             + +P+G++IN K G+V GDK EPL T++  K YR+RVCNVG++ S+NFR QGHS+ LVE+
Sbjct  184   LGKPDGVLINGKSGKVEGDKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEM  243

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSH VQN YDSLD+H GQC SVLVTA+Q PKDYY+VA++RF K  +S   +I+Y NGKG
Sbjct  244   EGSHTVQNVYDSLDVHVGQCYSVLVTANQTPKDYYMVASTRFTKYMISATRIIRYTNGKG  303

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                    P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   ----PASPVLPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   429 bits (1102),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 269/369 (73%), Gaps = 32/369 (9%)
 Frame = -1

Query  1020  NKMGMVFL-LWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             NK+  V L L LFA   VV AEDPYLF++WKVTYG +SPLGVA   ILING+FPGP IN 
Sbjct  5     NKIFTVLLQLCLFA---VVIAEDPYLFYDWKVTYGDVSPLGVATKGILINGEFPGPKINC  61

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV-----  679
             TSNNN+ VNVFNELDEPLLF WNGIQQRKNSWQDG+P T CPI PG N+TY FQV     
Sbjct  62    TSNNNIYVNVFNELDEPLLFTWNGIQQRKNSWQDGLPATNCPIPPGKNWTYKFQVCAFHD  121

Query  678   ----------------------KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFD  565
                                   KDQIG+ FYFP+T L R+ GG G + VHSR+LIPVPFD
Sbjct  122   PWRVGECKIHGGWVIFGWVSQVKDQIGSFFYFPTTGLQRAGGGMGMMQVHSRDLIPVPFD  181

Query  564   WPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGK  385
              PADEF + + DWYNKGH+ LK  LD G +I  P+G+ IN K G+VG    P+ T+E GK
Sbjct  182   RPADEFAVLVGDWYNKGHKTLKSILDSGRSIGFPDGVHINGKFGKVGGGSPPMFTVEKGK  241

Query  384   TYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDP  205
             TYR+RVCNVGMR S+NFR QGH + LVE+EGSH VQN YDSLDLH GQC+SVL+TADQ P
Sbjct  242   TYRYRVCNVGMRLSVNFRIQGHDLKLVEMEGSHTVQNVYDSLDLHVGQCMSVLITADQAP  301

Query  204   KDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelp-pppPDGTEGIAWSINQFRSFRWN  28
              DY+ V +SRF K  LSTV +I+Y+  KG++ +    PPPP+ + GIAWSINQFRSFRWN
Sbjct  302   ADYHFVVSSRFTKKALSTVAVIRYSGSKGSSDSGAIPPPPPENSRGIAWSINQFRSFRWN  361

Query  27    LTASAARPN  1
             LTASAARPN
Sbjct  362   LTASAARPN  370



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/341 (60%), Positives = 262/341 (77%), Gaps = 8/341 (2%)
 Frame = -1

Query  1011  GMVFLLWLF----AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             GM+F + L      M   V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP +N 
Sbjct  3     GMMFTMLLCLSAAGMMATVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNVNS  62

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             T+NNN+V+NVFN LDEP L HW+GIQ RKNSWQDG+ GT CPI PGTN+TYHFQVKDQIG
Sbjct  63    TTNNNLVINVFNNLDEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIG  122

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             + FY+PST++HR+AGG+G + V+SR LIPVP+  P D++ + + DWY K H  LK+ LD 
Sbjct  123   SFFYYPSTAMHRAAGGFGGIRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQFLDS  182

Query  483   GHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
             G +IARP+G++IN K  +     EPL T++ GKTY++RVCNVG+++S+NFRFQGH+M LV
Sbjct  183   GRSIARPDGVLINGKTSKDDGIDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLV  242

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANG  124
             E+EGSH VQNDY SLD+H GQC SVLVTA+Q+PKDYY+VA++RF+K+ L   G+++Y NG
Sbjct  243   EMEGSHTVQNDYKSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKSALVGKGIVRYTNG  302

Query  123   KGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             KG       P  P+   G AWS+NQFR+FRWNLTASAARPN
Sbjct  303   KG----PASPEIPNAPMGWAWSLNQFRTFRWNLTASAARPN  339



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 264/336 (79%), Gaps = 6/336 (2%)
 Frame = -1

Query  1002  FLLWLFAMA-FVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
              + WL +M   +V+AEDPYLF EWKVTYG LSPLGV + +ILING+FPGP +N T+NNNV
Sbjct  11    LIPWLLSMVVMMVRAEDPYLFFEWKVTYGTLSPLGVPQQIILINGQFPGPNLNTTTNNNV  70

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             VVNVFN+LDEPLLF W+GIQQRKNSWQDG PGT CPI PGTNYTY FQVKDQIG++FYFP
Sbjct  71    VVNVFNQLDEPLLFTWSGIQQRKNSWQDGTPGTMCPIQPGTNYTYRFQVKDQIGSYFYFP  130

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             +T   R+AGG+G L V+SR LIPVPF  P D++ I + DWY + H  L+K L++G ++AR
Sbjct  131   TTGFMRAAGGFGGLRVNSRLLIPVPFADPEDDYTIMVGDWYKESHAVLRKHLENGKSLAR  190

Query  465   PNGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             P+ +++N K G+VGD K EPL T++ GKTYR+R+CNVGM+ S+NFR QGH+M LVEVEGS
Sbjct  191   PDAVLMNGKQGKVGDPKEEPLFTMKPGKTYRYRICNVGMKNSINFRMQGHTMKLVEVEGS  250

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN YDSLD+H GQC SVLVTAD++PKDYY+VA++RF K  L   G+++Y  GKG   
Sbjct  251   HTVQNMYDSLDIHLGQCYSVLVTADKEPKDYYMVASTRFTKYHLQATGIVRYEGGKG---  307

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                    P+   G AWS+NQFRS RWNLTASAARPN
Sbjct  308   -APSTVLPEAPVGWAWSLNQFRSLRWNLTASAARPN  342



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   427 bits (1098),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 254/324 (78%), Gaps = 4/324 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+  DP+LF EWKVTYG +S LGV + VILING+FPGP INGTSNNN+VVNVFN+LDEP 
Sbjct  20   VKGGDPFLFFEWKVTYGTISTLGVPQQVILINGQFPGPIINGTSNNNIVVNVFNQLDEPF  79

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            LF WNG+QQRKNSWQ+G  GT CPI PG+N+TY FQVKDQIG+ +Y+P+T+LHR+AGGYG
Sbjct  80   LFTWNGVQQRKNSWQEGTLGTNCPIPPGSNFTYQFQVKDQIGSFYYYPTTALHRAAGGYG  139

Query  609  ALTVHSRELIPVPFDW-PADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
             ++VHSR LIP+PFD  PADEF++ +SDWY K H  L+K LD G +  RPNG++IN K G
Sbjct  140  GISVHSRALIPIPFDVNPADEFFVLVSDWYTKSHSQLRKLLDSGRSAGRPNGVIINGKSG  199

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +  +K EP+ T+  GKTYR+R CNVGM+ S+N R QGH M LVE+EGSH VQN YDSLD+
Sbjct  200  KGDNKDEPMFTMTPGKTYRYRFCNVGMKDSINVRIQGHIMKLVEIEGSHTVQNMYDSLDV  259

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC+SVLVTAD+DPKDY+LVA++RF K   +    I+Y NGKG   A      P    
Sbjct  260  HLGQCMSVLVTADKDPKDYFLVASTRFTKEPHTATATIRYGNGKG---APASLELPKAPI  316

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  317  GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   425 bits (1093),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/339 (63%), Positives = 260/339 (77%), Gaps = 5/339 (1%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M ++ LL   +   VV+AEDPYLF  W VTYG +SPLGV +  ILING+FPGP IN T+N
Sbjct  4     MKLLVLLCCISAMVVVRAEDPYLFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTN  63

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NNVVVNVFN LDEP L  W+GIQ RKNSWQDGMPGT CPI PGTN+TYHFQVKDQIG+ F
Sbjct  64    NNVVVNVFNNLDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSFF  123

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             YFP+  +HR+AGG+G L V+SR LIPVPF  P D++ + + DWY+KGH  LKK LD G +
Sbjct  124   YFPTIGMHRAAGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRS  183

Query  474   IARPNGLVINAKHGEV-GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             + +P+G++IN K G+V G K EPL T++  K YR+RVCNVG++ S+NFR QGHS+ LVE+
Sbjct  184   LGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEM  243

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSH VQN YDSLD+H GQC SVLVTA+Q PKDYY+VA++RF K  +S   +I+Y NGKG
Sbjct  244   EGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGKG  303

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                    P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   ----PASPVLPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   425 bits (1093),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 258/335 (77%), Gaps = 7/335 (2%)
 Frame = -1

Query  1002  FLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvv  823
             FL+ +  M  V QAEDPYLF++WKVTYG  SPLG  + VILING+FPGP +N T+NNN+V
Sbjct  13    FLICMIVM--VAQAEDPYLFYDWKVTYGTQSPLGAPQQVILINGQFPGPNLNTTTNNNIV  70

Query  822   vnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPS  643
             +NVFN+LDEPLLF W GIQQRKNSWQDG PGT CPI PGTNYTY FQVKDQIG+ FY+P+
Sbjct  71    LNVFNQLDEPLLFTWVGIQQRKNSWQDGTPGTMCPIPPGTNYTYRFQVKDQIGSFFYYPT  130

Query  642   TSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARP  463
             T   ++AGG+G L V+SR LIPVP+  P D++ + + DWY + H  L+K LD G ++ RP
Sbjct  131   TGFLKAAGGFGGLRVNSRLLIPVPYPDPEDDYTVLIGDWYKQSHTALRKVLDSGKSLGRP  190

Query  462   NGLVINAKHGEVGD-KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSH  286
             +G+++N K G+VGD K EPL T++ GKTY++R+CNVG++ ++NFR QGH + LVEVEGSH
Sbjct  191   DGVLMNGKQGKVGDAKEEPLFTMKPGKTYKYRICNVGLKNTLNFRIQGHKIKLVEVEGSH  250

Query  285   VVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaa  106
              VQN YDSLD+H GQC +VLVTADQDPKDYY+VA+ RF K  L   G I+Y NGKG    
Sbjct  251   SVQNSYDSLDVHLGQCYAVLVTADQDPKDYYMVASVRFTKYHLQATGKIRYENGKG----  306

Query  105   elppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                   P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  307   PASNILPEAPTGWAWSLNQFRSFRWNLTASAARPN  341



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/334 (61%), Positives = 256/334 (77%), Gaps = 7/334 (2%)
 Frame = -1

Query  1002  FLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvv  823
              LLWL +   VV+ EDPY+F  W VTYG +SPLGV +  ILINGKFPGP IN TSNNN+V
Sbjct  10    LLLWLVS---VVRGEDPYIFFTWNVTYGIISPLGVPQQGILINGKFPGPNINSTSNNNLV  66

Query  822   vnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPS  643
              N+FN LDEPLLF WNG+Q RKNSWQDG+PGT CPI PGTNYTY  QVKDQIG+ FY+PS
Sbjct  67    FNIFNNLDEPLLFTWNGVQHRKNSWQDGVPGTNCPITPGTNYTYRLQVKDQIGSFFYYPS  126

Query  642   TSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARP  463
             T+LHR+AGG+G L ++SR LIPVP+  P D++ + +SDWY K H  LKK LD G +I RP
Sbjct  127   TALHRAAGGFGGLRINSRLLIPVPYHDPEDDYTVLISDWYTKSHTTLKKFLDSGRSIGRP  186

Query  462   NGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHV  283
              G++IN K  +     +P+ T++ GKTY++R+CNVGM+ S+N RFQGH M LVE+EGSHV
Sbjct  187   EGVLINGKTAKGDGSDKPMFTMKPGKTYKYRICNVGMKNSLNLRFQGHLMKLVEMEGSHV  246

Query  282   VQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaae  103
             VQN+YDSLD+H G C SVL+TAD+DPKDYY+VA++RF K  L+   +++Y NGKG     
Sbjct  247   VQNNYDSLDVHVGGCFSVLITADKDPKDYYIVASTRFSKTVLTGKAIMRYTNGKG----A  302

Query  102   lppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
               P  P+   G AWS+NQF++FRWNL+ASAARPN
Sbjct  303   PSPDIPESPLGWAWSLNQFKTFRWNLSASAARPN  336



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/340 (64%), Positives = 261/340 (77%), Gaps = 6/340 (2%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             KM  V L  + AM  VV+AEDPYLF  W VTYG +SPLGV +  ILING+FPGP IN T+
Sbjct  5     KMLTVLLCCISAMV-VVRAEDPYLFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTT  63

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNNVVVNVFN LDEP L  W+GIQ RKNSWQDGMPGT CPI PGTN+TYHFQVKDQIG+ 
Sbjct  64    NNNVVVNVFNNLDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQVKDQIGSF  123

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             FYFP+  +HR+AGG+G L V+SR LIPVPF  P D++ + + DWY+KGH  LKK LD G 
Sbjct  124   FYFPTIGMHRAAGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGR  183

Query  477   TIARPNGLVINAKHGEV-GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
             ++ +P+G++IN K G+V G K EPL T++  K YR+RVCNVG++ S+NFR QGHS+ LVE
Sbjct  184   SLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVE  243

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSH VQN YDSLD+H GQC SVLVTA+Q PKDYY+VA++RF K  +S   +I+Y NGK
Sbjct  244   MEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRIIRYTNGK  303

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G       P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   G----PASPVLPEAPVGWAWSLNQFRSFRWNLTASAARPN  339



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   424 bits (1091),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 264/347 (76%), Gaps = 11/347 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +V L  + AM  VV+AEDPYLF  W VTYG +SPLGV +  ILING+FPG
Sbjct  1     MEGLL-----LVLLCCISAMV-VVRAEDPYLFFTWNVTYGTISPLGVPQQGILINGQFPG  54

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN T+NNNVVVNVFN LDEP L  W+GIQ RKNSWQDGMPGT CPI PGTN+TYHFQV
Sbjct  55    PNINSTTNNNVVVNVFNNLDEPFLLTWSGIQHRKNSWQDGMPGTNCPIEPGTNFTYHFQV  114

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG+ FYFP+  +HR+AGG+G L V+SR LIPVPF  P D++ + + DWY+KGH  LK
Sbjct  115   KDQIGSFFYFPTIGMHRAAGGFGGLRVNSRXLIPVPFADPEDDYTVLIGDWYSKGHSSLK  174

Query  498   KTLDDGHTIARPNGLVINAKHGEV-GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQG  322
             K LD G ++ +P+G++IN K G+V G K EPL T++  K YR+RVCNVG++ S+NFR QG
Sbjct  175   KLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLFTMKPHKXYRYRVCNVGLKXSLNFRIQG  234

Query  321   HSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGL  142
             HS+ LVE+EGSH VQN YDSLD+H GQC SVLVTA+Q PKDYY+VA++RF K  +S   +
Sbjct  235   HSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLVTANQXPKDYYMVASTRFTKYMISATRI  294

Query  141   IKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             I+Y NGKG       P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  295   IRYTNGKG----PASPVLPEAPVGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   423 bits (1088),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 212/328 (65%), Positives = 256/328 (78%), Gaps = 7/328 (2%)
 Frame = -1

Query  984  AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNE  805
            A +F+V+ EDPY F+ W VTYG +SPLGV +  ILING+FPGP IN +SNNN+V+NVFN 
Sbjct  16   AGSFLVRGEDPYFFYTWNVTYGTISPLGVPQQGILINGEFPGPRINCSSNNNIVINVFNN  75

Query  804  LDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRS  625
            LDEPLLF WNGIQQRKNSWQDG+PGT CPI PGTN+TY FQVKDQIGT+FYFPS  + R+
Sbjct  76   LDEPLLFTWNGIQQRKNSWQDGLPGTNCPIQPGTNFTYRFQVKDQIGTYFYFPSLGMQRA  135

Query  624  AGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVIN  445
            AGG G L V+SR LIPVPFD P D++ + + DWY K H  LKK LD GH+I RP+G+ IN
Sbjct  136  AGGIGGLRVNSRLLIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQIN  195

Query  444  AKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYD  265
               G+  DK EPL T++ G TYR+R+CNVG+++S+NFR QGH+M LVE+EGSH VQN YD
Sbjct  196  ---GKSEDKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVYD  252

Query  264  SLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppP  85
            SLD+H GQC SVLVTA+QDPKDYY+VA++RFLK   +   +I+Y NGKG       P  P
Sbjct  253  SLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKG----PASPELP  308

Query  84   DGTEGIAWSINQFRSFRWNLTASAARPN  1
            +   G  WS+NQFRSFRWNLTASAARPN
Sbjct  309  EPPSGWIWSLNQFRSFRWNLTASAARPN  336



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   423 bits (1088),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 210/340 (62%), Positives = 255/340 (75%), Gaps = 4/340 (1%)
 Frame = -1

Query  1020  NKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             NK  + F+L L   + +V  EDPYL  EWKVTYG +SPLGV + VILING+FPGP IN T
Sbjct  2     NKQIISFVL-LLLFSCLVHGEDPYLTFEWKVTYGTISPLGVPQQVILINGQFPGPKINCT  60

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             SNNN+VVNV N+LDEP L  W GIQQRKNSWQDG  GT CPI PG N+TYHFQVKDQIG+
Sbjct  61    SNNNIVVNVINQLDEPFLITWKGIQQRKNSWQDGTLGTNCPIPPGKNFTYHFQVKDQIGS  120

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
             ++Y P+T+LHR+ GGYG +T++SR LIPVPFD PAD+F + +SDWY   H+ LK  LD G
Sbjct  121   YYYHPTTALHRAVGGYGPITIYSRALIPVPFDTPADDFTVLVSDWYTNSHKSLKGLLDTG  180

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
              ++ RP+G+VIN K G+   K EP+ T+  GKTYRFR CNVGM+ ++N R QGH+M LVE
Sbjct  181   RSLGRPDGIVINGKSGKGDGKDEPMFTMVKGKTYRFRFCNVGMKDTINVRIQGHTMKLVE  240

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSH VQN Y+ LD+H GQCLSVL+TADQ+PKDY++VATSRF K        I+YANGK
Sbjct  241   MEGSHTVQNLYELLDIHLGQCLSVLITADQNPKDYFIVATSRFTKESRVATATIRYANGK  300

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G      P    +  EG  WS+NQF SFRWNLTAS+ARPN
Sbjct  301   G---PASPLEKKEAPEGWEWSLNQFNSFRWNLTASSARPN  337



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   423 bits (1088),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +VTA+Q+PKDYY+VA+SRFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   423 bits (1087),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +VTA+Q+PKDYY+VA+SRFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   423 bits (1087),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGVKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +VTA+Q+PKDYY+VA+SRFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CFGTIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   423 bits (1087),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/346 (62%), Positives = 263/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  + L    A   +V+AEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLLAMCLCLATATVVMVRAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNNV++NVFN LDEP L  WNGIQ RKN WQDG  GT CPI PG N+TYHFQ 
Sbjct  59    PNINSTSNNNVIINVFNNLDEPFLLTWNGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T +HR+AGG+G L V+SR LIPVP+  P D++ + ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTGMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G TI RP+G++IN K G+     +PL TL+ GKTYR R+CNVG+++S+NFR Q H
Sbjct  179   KFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRVRICNVGLKSSLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V+VTADQ+PKDYY+ A++RFLKN LST GL+
Sbjct  239   KMRLVEMEGSHVLQNDYDSLDVHVGQCYGVIVTADQEPKDYYMAASTRFLKNALSTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   RYEGGKGPASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   422 bits (1084),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 256/337 (76%), Gaps = 8/337 (2%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G++  L L      V  EDPY+++ W VTYG +SPLG  +  ILING+FPGP IN TSNN
Sbjct  4     GVILALTLCLFGVSVYGEDPYIYYTWNVTYGTISPLGAPQQGILINGQFPGPEINSTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             NVV+NVFN LDEPLLF W+G+QQRKNSWQ+G PGT CPILPGTNYTYHFQVKDQIG++FY
Sbjct  64    NVVINVFNHLDEPLLFTWHGVQQRKNSWQEGTPGTACPILPGTNYTYHFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T L R+AGG+G L + SR LIPVP+  P DE+++ + DWYNKGH+ LK  LD G +I
Sbjct  124   YPTTGLQRAAGGFGGLRIFSRLLIPVPYPDPEDEYWVIIGDWYNKGHKTLKMMLDSGRSI  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP+G+++N K        EPL T++ GKTY++R+CNVG++ ++NFRFQGH+M LVE EG
Sbjct  184   GRPDGVIMNGK----ATNEEPLYTMKPGKTYKYRICNVGLKDALNFRFQGHAMKLVETEG  239

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SHVVQ+ YDSLD+H GQC +VLVTAD+DPKDYY+VA++RF K   +  G+I+Y NG G  
Sbjct  240   SHVVQSFYDSLDVHVGQCYTVLVTADKDPKDYYMVASTRFTKYTHTATGIIRYTNGAG--  297

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  298   --PASNVLPPAPVGWAWSLNQFRSFRWNLTASAARPN  332



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 213/346 (62%), Positives = 262/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  V L    A   +VQAEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLLAVCLCVATATVMMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNNV+VNVFN LDEP L  W GIQ RKN WQDG  GT CPI PG N+TYHFQ 
Sbjct  59    PNINSTSNNNVIVNVFNNLDEPFLITWAGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AGG+G L V+SR LIPVP+  P D++ I ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTILINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G TI RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H
Sbjct  179   KFLDSGRTIGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V+VTADQ+PKDYY++A++RFLK  L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQEPKDYYMIASTRFLKKPLTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQ+RSFRWNLTASAARPN
Sbjct  299   RYEGGKGPASSQLPAAPV----GWAWSLNQYRSFRWNLTASAARPN  340



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   422 bits (1084),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 214/346 (62%), Positives = 262/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  V L    A   +VQAEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLLAVCLCVATATVMMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNNV+VNVFN LDEP L  WNGIQ RKN WQDG  GT CPI PG N+TYHFQ 
Sbjct  59    PNINSTSNNNVIVNVFNNLDEPFLITWNGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AGG+G L V+SR LIPVP+  P D++ + ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G TI RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H
Sbjct  179   KFLDSGRTIGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V+VTADQ+ KDYY+VA++RFLK  L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQELKDYYMVASTRFLKKPLTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   RYEGGKGPASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   421 bits (1083),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 266/340 (78%), Gaps = 6/340 (2%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             + G+V ++   + + +V+  DP L  EWKVTYG +SPLGV + VILIN KFPGP INGTS
Sbjct  5     RFGLVLIVLCLSTS-LVKGGDPILTFEWKVTYGTISPLGVPQQVILINDKFPGPIINGTS  63

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNN+VVNVFN+LDEP LF WNGIQQRKNSWQ+G  GT CPI PG+N+TYHFQVKDQIG+ 
Sbjct  64    NNNIVVNVFNQLDEPFLFTWNGIQQRKNSWQEGTLGTNCPIPPGSNFTYHFQVKDQIGSF  123

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDW-PADEFYIFLSDWYNKGHRDLKKTLDDG  481
             FY+P+T+LHR+AGGYG ++VHSR LIP+PFD  PADEF++ +SDWY K H  L+K LD G
Sbjct  124   FYYPTTALHRAAGGYGGISVHSRALIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSG  183

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
              ++ RP+G++IN K G+   K EPL ++  GKTYR+R CN GM+ S+N R QGH+M LVE
Sbjct  184   RSMGRPDGIIINGKGGKGDGKDEPLFSMTPGKTYRYRFCNAGMKDSINVRIQGHTMKLVE  243

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSHVVQN YDSLD+H GQC+SVLVTAD+DPKDY LVA++RF K   +   +I+Y NG 
Sbjct  244   MEGSHVVQNMYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGN  303

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G A+ ELP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   GPASPELPKAPI----GWAWSLNQFRSFRWNLTASAARPN  339



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   421 bits (1082),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 205/324 (63%), Positives = 255/324 (79%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VVQAEDPY  H W VTYG  SPLGV + VILING+FPGP +N TSNNNV++NVFN LDEP
Sbjct  20   VVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNLNSTSNNNVIINVFNNLDEP  79

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKN WQDG PGT CPI  GTNYTYHFQ KDQIG++FY+P+T++HR+AGG+
Sbjct  80   FLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRAAGGF  139

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIP+P+D P D++ + + DWY K H  LKK LD G T+ RPNG++IN K G
Sbjct  140  GGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAG  199

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +      PL TL+ GK+YR R+CNVG++TS+NFR Q H M LVE+EGSHV+QND+DSLD+
Sbjct  200  KGDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDV  259

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC   +VTA+Q+PKDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  
Sbjct  260  HVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPV  315

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLT++AARPN
Sbjct  316  GWAWSLNQFRSFRWNLTSNAARPN  339



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   421 bits (1081),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/324 (63%), Positives = 255/324 (79%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VVQAEDPY  H W VTYG  SPLGV + VILING+FPGP +N TSNNNV++NVFN LDEP
Sbjct  20   VVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNLNSTSNNNVIINVFNNLDEP  79

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKN WQDG PGT CPI  GTNYTYHFQ KDQIG++FY+P+T++HR+AGG+
Sbjct  80   FLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRAAGGF  139

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIP+P+D P D++ + + DWY K H  LKK LD G T+ RPNG++IN K G
Sbjct  140  GGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAG  199

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +      PL TL+ GK+YR R+CNVG++TS+NFR Q H M LVE+EGSHV+QND+DSLD+
Sbjct  200  KGDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDV  259

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC   +VTA+Q+PKDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  
Sbjct  260  HVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPV  315

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLT++AARPN
Sbjct  316  GWAWSLNQFRSFRWNLTSNAARPN  339



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 257/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY FH W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFHTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVV+NVFN LDEP L  W+GIQ RKN WQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVINVFNNLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTTGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G T+  PNG++IN K G+VG K EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   KLLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTADQ  KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYEGSN----VQASTELPKTPVGWAWSLNQFRSFRWNLTASAARPN  337



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   420 bits (1079),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 255/324 (79%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VVQAEDPY  H W VTYG  SPLGV + VILING+FPGP +N TSNNN+++NVFN LDEP
Sbjct  20   VVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNLNSTSNNNIIINVFNNLDEP  79

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKN WQDG PGT CPI  GTNYTYHFQ KDQIG++FY+P+T++HR+AGG+
Sbjct  80   FLLTWNGIQHRKNCWQDGTPGTMCPIPVGTNYTYHFQPKDQIGSYFYYPTTAMHRAAGGF  139

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIP+P+D P D++ + + DWY K H  LKK LD G T+ RPNG++IN K G
Sbjct  140  GGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAG  199

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +      PL TL+ GK++R R+CNVG++TS+NFR Q H M LVE+EGSHV+QND+DSLD+
Sbjct  200  KGDGSDAPLFTLKPGKSHRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDV  259

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC   +VTA+Q+PKDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  
Sbjct  260  HVGQCFGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPV  315

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLT+SAARPN
Sbjct  316  GWAWSLNQFRSFRWNLTSSAARPN  339



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   418 bits (1075),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 254/327 (78%), Gaps = 8/327 (2%)
 Frame = -1

Query  981  MAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNEL  802
            MA  V+ EDPY+++ W VTYG ++PLGV +  ILING+FPGP IN TSNNNVV+NVFN L
Sbjct  16   MAASVRGEDPYIYYTWNVTYGTVAPLGVEQQGILINGQFPGPEINSTSNNNVVINVFNFL  75

Query  801  DEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSA  622
            DEPLLF WNGIQ RKNSWQDG  GT CPI PGTNYTYHFQVKDQIG++FY+P+  + R+ 
Sbjct  76   DEPLLFTWNGIQHRKNSWQDGTLGTQCPIQPGTNYTYHFQVKDQIGSYFYYPTIGMQRAV  135

Query  621  GGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINA  442
            GG+G L ++SR LIPVP+  PADEF++ + DW+ K H+ LK+ LD G +I RP+G+ IN 
Sbjct  136  GGFGGLRIYSRLLIPVPYADPADEFWVLIGDWFGKSHQTLKQFLDSGRSIGRPSGVHING  195

Query  441  KHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDS  262
            K+G     +EP  T+E GKTY++R+CNVG++ S+NFR QGHS+ LVE+EGSHVVQN YDS
Sbjct  196  KNG----GLEPAYTMEPGKTYKYRICNVGLKDSLNFRIQGHSLKLVEMEGSHVVQNQYDS  251

Query  261  LDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPD  82
            LD+H GQC SVLVTADQ+PKDYY+VA++RF K  L    +I+Y+NG G       P  P 
Sbjct  252  LDVHVGQCFSVLVTADQEPKDYYMVASTRFAKKTLGATRIIRYSNGVG----PASPELPP  307

Query  81   GTEGIAWSINQFRSFRWNLTASAARPN  1
              EG AWS+NQFRSFRWNLTASAARPN
Sbjct  308  APEGWAWSLNQFRSFRWNLTASAARPN  334



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   418 bits (1075),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 253/332 (76%), Gaps = 4/332 (1%)
 Frame = -1

Query  996  LWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvn  817
            LW+ ++  VV+ EDPYL+  W VTYG +SPLG+ +  I ING+FPGP IN TSNNN+V+N
Sbjct  12   LWIESLLTVVRGEDPYLYFTWNVTYGTISPLGIPQQGIFINGQFPGPNINSTSNNNLVIN  71

Query  816  VFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTS  637
            VFN LDEP LF WNGIQ RKNSWQDG+ GT CPI PGTN+TY  QVKDQIG++FY+PST+
Sbjct  72   VFNNLDEPFLFTWNGIQHRKNSWQDGVAGTNCPIPPGTNFTYRIQVKDQIGSYFYYPSTA  131

Query  636  LHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNG  457
            +HR+AGG+G L V+SR LIPVP+  P DE+ + + DWY K H  L+K LD G ++ RP G
Sbjct  132  MHRAAGGFGGLRVNSRLLIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGRPEG  191

Query  456  LVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQ  277
            ++IN K  +   K EPL T++  KTY++R+CNVG++ S+N+R QGHSM LVE+EGSHVVQ
Sbjct  192  VLINGKTAKGDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQ  251

Query  276  NDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelp  97
            N YDSLD+H G+C SVLVTAD++PKDYY+VA++RF K  L   G+I+Y NGKG       
Sbjct  252  NMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG----PAS  307

Query  96   pppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
            P  P    G AWS+NQF +FRWNLTASAARPN
Sbjct  308  PDIPPAPVGWAWSLNQFHTFRWNLTASAARPN  339



>gb|KGN63948.1| hypothetical protein Csa_1G031720 [Cucumis sativus]
Length=480

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 248/323 (77%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  21   VRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPF  80

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L HW+GIQ RKNSWQDG+ GT CPI PGTN+TYHFQVKDQIG+ FY+PST++H++ G +G
Sbjct  81   LLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYPSTAMHKAVGAFG  140

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L V+SR LIPVP+  P D++ + + DWY K H  LKK LD G +IARP+G++IN +  +
Sbjct  141  GLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAK  200

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 EPL T++  KTY++R+CNVG++TS+NFR QGH+M LVE+EGSH VQN Y SLD+H
Sbjct  201  GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVH  260

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC SVLVTAD+DPKDYY+VA++RF KN L   G+I+Y NGK        P  P+   G
Sbjct  261  VGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA----PASPEIPEAPRG  316

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFR+FRWNLTASAARPN
Sbjct  317  WAWSLNQFRTFRWNLTASAARPN  339



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   417 bits (1072),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 247/324 (76%), Gaps = 8/324 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            +V+ EDPY F+ W V Y  LSPLG  + VI ING+FPGP IN TSNNN+VVNVFN LDEP
Sbjct  4    LVRCEDPYWFYTWDVKYNTLSPLGAPQQVITINGQFPGPWINCTSNNNIVVNVFNNLDEP  63

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
            LLF WNGIQQRKNSWQ+G   T CPI PGTNYTY FQVKDQIGT+FY+P+TS HR+AGGY
Sbjct  64   LLFTWNGIQQRKNSWQEGTLATNCPIPPGTNYTYKFQVKDQIGTYFYYPTTSTHRAAGGY  123

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L++HSR+LIPVPF WP  E+ + + DWY KG   LKK LD G T+ RP+G++IN KH 
Sbjct  124  GPLSIHSRDLIPVPFPWPHAEYNVLVGDWYKKGQGSLKKLLDTGRTLGRPDGVIINGKH-  182

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
               D  EP+ + EAGKT+RFRVCNVG++ S+NFR Q H++ LVE+EGSH VQN YDSLDL
Sbjct  183  ---DSNEPMFSFEAGKTHRFRVCNVGLKNSINFRIQAHTLTLVEIEGSHTVQNVYDSLDL  239

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SVLVTADQ PKDYY VA++RF K  L+T  +I+Y NG         P  P+   
Sbjct  240  HLGQCASVLVTADQTPKDYYFVASTRFTKTVLTTKAIIRY-NGSS---TPASPELPEAPV  295

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  296  GWAWSVNQFRSFRWNLTASAARPN  319



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 256/324 (79%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV+AEDPY  H W VTYG +SPLGV + VILING+FPGP IN TSNNN+++NVFN LDEP
Sbjct  20   VVRAEDPYFHHVWNVTYGTVSPLGVPQQVILINGQFPGPNINSTSNNNIIINVFNNLDEP  79

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+PST+LHRSAGG+
Sbjct  80   FLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRSAGGF  139

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+  P D++ + + DWY K H  LKK LD G T+ RP+G++IN K G
Sbjct  140  GGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSG  199

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +      PL TL+ GKTYR R+CNVGM+TS+NFR Q H + LVE+EGSHV+QNDYDSLD+
Sbjct  200  KGDGSDAPLFTLKPGKTYRVRICNVGMKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDV  259

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC   ++TADQ+ KDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  
Sbjct  260  HVGQCYGTILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPV  315

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  316  GWAWSLNQFRSFRWNLTASAARPN  339



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 254/324 (78%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VVQAEDPY  H W VTYG  SPLGV + VILING+FPGP +N TSNNNV++NVFN LDEP
Sbjct  20   VVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNLNSTSNNNVIINVFNNLDEP  79

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKN WQDG PGT CPI  GTNYTYHFQ KDQIG++FY+P+T++HR+AGG+
Sbjct  80   FLLTWNGIQHRKNCWQDGTPGTMCPIPAGTNYTYHFQPKDQIGSYFYYPTTAMHRAAGGF  139

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIP+P+D P D++ + + DWY K H  LKK LD G T+ RPNG++IN K G
Sbjct  140  GGLRVNSRLLIPIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAG  199

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +      PL TL+ GK+YR R+CNVG++TS+NFR Q H M LVE+EGSHV+QND+DSLD+
Sbjct  200  KGDGSDAPLFTLKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDV  259

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC   +VTA+Q+ KDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  
Sbjct  260  HVGQCFGTIVTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPV  315

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLT++AARPN
Sbjct  316  GWAWSLNQFRSFRWNLTSNAARPN  339



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   417 bits (1072),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 262/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  + L        +VQAEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLWALCLCLAMTTVVMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNN++VNVFN LDEP L  WNGIQ RKNSWQ G  GT CPI PGTN+TYHFQ 
Sbjct  59    PNLNSTSNNNIIVNVFNNLDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AG +G L V+SR LIPVP+  P D++ + ++DWY + H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTESHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G TI RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H
Sbjct  179   NFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V++TA+Q+PKDYY+VA++RFLKN L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILTANQEPKDYYIVASTRFLKNALTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   RYEGGKGLASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 259/346 (75%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVVVNVFN LDEP L  W+GIQ RKN WQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVVNVFNNLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + ++DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG K EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTA+Q+ KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +YA        +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYAGSN----VQASTELPKTPVGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   417 bits (1072),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/324 (62%), Positives = 248/324 (77%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   +PYLF  W VTYG LSPLGV + VILING+FPGP IN T+N+N+V+NVFN LDEP
Sbjct  19   VVHCGNPYLFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNDNIVLNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQQRKNSWQDG  GT CPI PGTNYTY FQVKDQIG++ Y+P T++H++ G +
Sbjct  79   FLVTWNGIQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGSYMYYPITAMHKAGGAF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+  P D++ + + DWY K H  LKK LD G ++ARP+G++IN K  
Sbjct  139  GGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKLLDSGRSMARPDGVLINGKSS  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL  ++ GKTY++R+CNVG++ S+NFR QGHSM LVE+EGSH VQN YDS+D+
Sbjct  199  KGDGKDEPLFVMKPGKTYKYRICNVGLKNSLNFRIQGHSMKLVELEGSHTVQNTYDSMDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SVLVTAD+DPKDYY+VA++RF K+ L+  G+I+Y NGKG       P  P    
Sbjct  259  HLGQCFSVLVTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKG----PASPELPKAPV  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  315  GWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 256/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNN+V+NVFN LDEP L  W+GIQ RKN WQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNIVINVFNNLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTSGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG   EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NFLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTADQ  KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +YA        +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYAGSN----VQASAELPKAPVGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 247/323 (76%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  21   VRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPF  80

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L HW+GIQ RKNSWQDG+ GT CPI PGTN+TYHFQVKDQIG+ FY+PST++HR+ G +G
Sbjct  81   LLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYPSTAMHRAGGAFG  140

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L V+SR LIPVP+  P D++ + + DWY K H  LKK LD G +IARP+G++IN K  +
Sbjct  141  GLRVNSRLLIPVPYVDPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGKIAK  200

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 EPL T+  GKTY++R+CNVG++ S+NFR QGH+M LVE+EGSH VQN Y SLD+H
Sbjct  201  GDGTDEPLFTMNPGKTYKYRICNVGLKISLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVH  260

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC SVLVTADQDP+DYY+VA+SRF KN L   G+++Y NGK        P  P+   G
Sbjct  261  VGQCFSVLVTADQDPRDYYMVASSRFTKNILVGKGIVRYTNGKA----PASPEIPEAPRG  316

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFR+FRWNLTA+AARPN
Sbjct  317  WAWSLNQFRTFRWNLTANAARPN  339



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 264/340 (78%), Gaps = 6/340 (2%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             + G+V ++   + + +V+  DP +  EWKVTYG +SPLGV + VILIN KFPGP INGTS
Sbjct  5     RFGLVLMVLCLSTS-LVKGGDPTVTFEWKVTYGTISPLGVPQQVILINDKFPGPVINGTS  63

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNN+VVNVFN+LDEP LF WNGIQQRKNSWQ+G  GT CPI PG N+TYHFQVKDQIGT 
Sbjct  64    NNNIVVNVFNQLDEPFLFTWNGIQQRKNSWQEGTLGTNCPIPPGGNFTYHFQVKDQIGTF  123

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDW-PADEFYIFLSDWYNKGHRDLKKTLDDG  481
             FY+P+T+LHR+AGGYG L+VHSR LIP+PFD  PADEF++ +SDWY K H  L+K LD G
Sbjct  124   FYYPTTALHRAAGGYGGLSVHSRALIPIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSG  183

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
              ++ RP+G++IN K G    K EP+ ++  GKTYR+R CN G + S+N R QGH+M LVE
Sbjct  184   RSMGRPDGVIINGKGGNGDGKDEPMFSMTPGKTYRYRFCNAGNKDSINVRIQGHTMKLVE  243

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSHVVQN YDSLD+H GQC+SVLVTAD+DPKDY LVA++RF K   +   +I+Y NGK
Sbjct  244   IEGSHVVQNMYDSLDIHLGQCVSVLVTADKDPKDYLLVASTRFTKEPHTATSIIRYTNGK  303

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G A+ ELP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   GPASPELPKAPI----GWAWSLNQFRSFRWNLTASAARPN  339



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   416 bits (1070),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 256/324 (79%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV+AEDPY  H W VTYG +SPLGV + VILING+FPGP IN TSNNN+++NVFN LDEP
Sbjct  20   VVRAEDPYFHHVWNVTYGTVSPLGVPQQVILINGQFPGPNINSTSNNNIIINVFNNLDEP  79

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+PST+LHRSAGG+
Sbjct  80   FLLTWNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRSAGGF  139

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+  P D++ + + DWY K H  LKK LD G T+ RP+G++IN K G
Sbjct  140  GGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSG  199

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +      PL TL+ GKTYR R+CNVG++TS+NFR Q H + LVE+EGSHV+QNDYDSLD+
Sbjct  200  KGDGSDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDV  259

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC   ++TADQ+ KDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  
Sbjct  260  HVGQCYGTILTADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPV  315

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  316  GWAWSLNQFRSFRWNLTASAARPN  339



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   416 bits (1070),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 250/324 (77%), Gaps = 7/324 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             V AEDPYLF  W VTYG +SPLGV + VILING+FPGP IN TSNNN+V+NVFN LDEP
Sbjct  20   AVLAEDPYLFFTWNVTYGTVSPLGVPQQVILINGEFPGPNINSTSNNNLVINVFNNLDEP  79

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             LF WNGIQQRKNSWQDG+ GT+CPI PG N+TYHFQVKDQIG+ +Y+PS ++H++AGG+
Sbjct  80   FLFSWNGIQQRKNSWQDGVSGTSCPIAPGQNFTYHFQVKDQIGSFYYYPSLAMHKAAGGF  139

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L ++SR LIPVPFD PAD++ + + DWY K H+ L + LD G +I  P G++IN   G
Sbjct  140  GGLRINSRLLIPVPFDPPADDYTVMIGDWYTKDHKTLARILDTGRSIGLPAGVLIN---G  196

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            + G   EPL  +EAGK YR+RVCN+G +TS+NFR QGHSM+LVE++GSH +QN Y+SLD+
Sbjct  197  KAGKDDEPLFVMEAGKVYRYRVCNIGTKTSLNFRIQGHSMLLVEMDGSHTMQNTYESLDI  256

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SVLVTA+Q P DYY+VA++RFL+ +L+  G+I+Y+           P  P    
Sbjct  257  HVGQCFSVLVTANQAPGDYYMVASTRFLRKELTATGVIRYSGSH----TLPSPVLPKAPS  312

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQ+RSFRWNLTASAARPN
Sbjct  313  GWAWSLNQWRSFRWNLTASAARPN  336



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   416 bits (1070),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 249/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG  GT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DW+ K H  LKK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +VTA+Q+PKDYY+VA++RFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CYGTIVTANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   416 bits (1069),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 256/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVV+NVFN LDEP L  W+GIQ RKN WQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVINVFNHLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTAGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG K EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTADQ  KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTADQAAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYEGSN----VQASAELPKAPIGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   416 bits (1069),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 256/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSSVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVV+NVFN LDEP L  W+GIQ RKNSWQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVINVFNNLDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P DE+ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDEYTVLLGDWYTTGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG   EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   SLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTA+Q  KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYEGSN----VQASAELPKAPVGWAWSLNQFRSFRWNLTASAARPN  337



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score =   416 bits (1069),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 254/328 (77%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNE  805
            A   +VQAEDPY  H W VTYG  SPLGV + VILING+FPGP +N TSNNN++VNVFN 
Sbjct  19   ATIVMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNLNSTSNNNIIVNVFNN  78

Query  804  LDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRS  625
            LDEP L  WNGIQ RKNSWQ G  GT CPI PGTN+TYHFQ KDQIG++FY+P+T++HR+
Sbjct  79   LDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQPKDQIGSYFYYPTTAMHRA  138

Query  624  AGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVIN  445
            AG +G L V+SR LIPVP+  P D++ + ++DWY K H  LK  LD G TI RP+G++IN
Sbjct  139  AGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKTHTQLKNFLDSGRTIGRPDGILIN  198

Query  444  AKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYD  265
             K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H M LVE+EGSHV+QNDYD
Sbjct  199  GKAGKGDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYD  258

Query  264  SLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppP  85
            SLD+H GQC  V +TA+Q+PKDYY+VA++RFLKN L+T GL++Y  GKG A+++LP  P 
Sbjct  259  SLDVHVGQCFGVTLTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKGLASSQLPAAPV  318

Query  84   DGTEGIAWSINQFRSFRWNLTASAARPN  1
                G AWS+NQFRSFRWNLTASAARPN
Sbjct  319  ----GWAWSLNQFRSFRWNLTASAARPN  342



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   416 bits (1069),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 207/342 (61%), Positives = 260/342 (76%), Gaps = 8/342 (2%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAF----VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             M  V  + LF ++     VVQ EDPYL+  W VTYG +SPLGV +  ILING+FPGP IN
Sbjct  1     MSSVMYMLLFCLSAGVISVVQGEDPYLYFTWNVTYGTISPLGVPQQGILINGQFPGPNIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              TSNNN+V+NVFN LDEPLLF W+G+QQRKNSWQDG  GT CPI PG NYTY FQVKDQI
Sbjct  61    STSNNNIVLNVFNNLDEPLLFTWSGVQQRKNSWQDGTLGTMCPIPPGQNYTYRFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G++FY+P T++HR++GG+G L ++SR LIPVP+  P D++ + + DWY KGH  LKK LD
Sbjct  121   GSYFYYPITAMHRASGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYAKGHTALKKHLD  180

Query  486   DGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
              G ++ARP+G++IN K  +   K EPL T++ GKTY++R+CNVG++ S+NFR QGH M L
Sbjct  181   SGRSMARPDGVIINGKSAKGDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKL  240

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VE+EGSH VQN Y+SLD+H GQC SVLVTAD+DPKDYY+VA++RF K  L+  G+++Y N
Sbjct  241   VEMEGSHTVQNTYESLDVHVGQCFSVLVTADKDPKDYYMVASTRFTKKVLTGKGIMRYEN  300

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G G       P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  301   GNG----PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   416 bits (1068),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 248/323 (77%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  21   VRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPF  80

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L HW+GIQ RKNSWQDG+ GT CPI PGTN+TYHFQVKDQIG+ FY+PST++H++ G +G
Sbjct  81   LLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYPSTAMHKAVGAFG  140

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L V+SR LIPVP+  P D++ + + DWY K H  LKK LD G +IARP+G++IN +  +
Sbjct  141  GLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAK  200

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 EPL T++  KTY++R+CNVG++TS+NFR QGH+M LVE+EGSH VQN Y SLD+H
Sbjct  201  GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVH  260

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC SVLVTAD+DPKDYY+VA++RF KN L   G+I+Y NGK        P  P+   G
Sbjct  261  VGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA----PASPEIPEAPRG  316

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFR+FRWNLTASAARPN
Sbjct  317  WAWSLNQFRTFRWNLTASAARPN  339



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   416 bits (1068),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 248/323 (77%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  21   VRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNLVINVFNNLDEPF  80

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L HW+GIQ RKNSWQDG+ GT CPI PGTN+TYHFQVKDQIG+ FY+PST++H++ G +G
Sbjct  81   LLHWSGIQHRKNSWQDGLLGTNCPIPPGTNFTYHFQVKDQIGSFFYYPSTAMHKAVGAFG  140

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L V+SR LIPVP+  P D++ + + DWY K H  LKK LD G +IARP+G++IN +  +
Sbjct  141  GLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAK  200

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 EPL T++  KTY++R+CNVG++TS+NFR QGH+M LVE+EGSH VQN Y SLD+H
Sbjct  201  GDGTDEPLFTMKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVH  260

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC SVLVTAD+DPKDYY+VA++RF KN L   G+I+Y NGK        P  P+   G
Sbjct  261  VGQCFSVLVTADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA----PASPEIPEAPRG  316

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFR+FRWNLTASAARPN
Sbjct  317  WAWSLNQFRTFRWNLTASAARPN  339



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/346 (60%), Positives = 256/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY FH W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFHTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVV+NVFN LDEP L  W+GIQ RKN WQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVINVFNHLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLLGDWYTAGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG K EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTA+Q  KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y         +     P    G AWS+NQFRSFRWNLT++AARPN
Sbjct  296   RYEGSN----VQASTELPKAPVGWAWSLNQFRSFRWNLTSNAARPN  337



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 249/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG  GT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DW+ K H  +KK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +V+A+Q+PKDYY+VA+SRFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CYGTIVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 255/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  LL L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGKL-----LTVLLCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVV+NVFN LDEP L  W+G+Q RKN WQDG+ GTTCPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVINVFNHLDEPFLLTWSGLQHRKNCWQDGVAGTTCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVILGDWYTSGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG   EPL T+  GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMNPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC +VLVTA+Q  KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTANQAAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +YA        +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYAGSN----VQASSELPKTPIGWAWSLNQFRSFRWNLTASAARPN  337



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 249/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG  GT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DW+ K H  +KK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKAGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +V+A+Q+PKDYY+VA+SRFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CYGTIVSANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/346 (60%), Positives = 259/346 (75%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVVVNVFN LDEP L  W+GIQ RKN WQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVVNVFNNLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + ++DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG K EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTA+Q+ KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +YA        +     P    G AWS+NQFRSFRWNLT++AARPN
Sbjct  296   RYAGSN----VQASAELPKTPVGWAWSLNQFRSFRWNLTSNAARPN  337



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 260/337 (77%), Gaps = 8/337 (2%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G +  L +  MA  V  EDPY+++ W VTYG ++PLG  +  ILING+FPGP INGTSNN
Sbjct  4     GAILGLMVCLMATAVMGEDPYVYYTWNVTYGTIAPLGTPQQGILINGQFPGPEINGTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             N+VVNVFN LDEPLLF W+GIQQRKNSWQDG  GT CPI PG+NYTY FQVKDQIG++FY
Sbjct  64    NIVVNVFNNLDEPLLFTWSGIQQRKNSWQDGTLGTQCPIAPGSNYTYKFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T L R+AGG G + V+SR LIPVP+  PADE+++ + DW+ K H  LKK LD G ++
Sbjct  124   YPTTGLQRAAGGIGGIRVYSRLLIPVPYADPADEYWVLIGDWFGKSHTTLKKFLDSGRSM  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP+G+ I  K   V    EPL T+E+GKTY++R+CNVG++ ++NFR QGHSM LVE+EG
Sbjct  184   GRPDGVHIMGKSNSV----EPLYTMESGKTYKYRICNVGLKDTLNFRIQGHSMKLVEMEG  239

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SH VQN YDSLD+H GQC SVLVTAD++PKDYYLVA++RF KN L+T  +I+Y+NG G A
Sbjct  240   SHTVQNMYDSLDVHVGQCYSVLVTADKEPKDYYLVASTRFTKNVLTTTAVIRYSNGVGPA  299

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +  +PP P     G AWS+NQ RSFRWNLTASAARPN
Sbjct  300   SPIIPPAPV----GWAWSLNQLRSFRWNLTASAARPN  332



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 248/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG  GT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DW+ K H  LKK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +V A+Q+PKDYY+VA++RFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CYGTIVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 207/346 (60%), Positives = 259/346 (75%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVVVNVFN LDEP L  W+GIQ RKN WQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVVNVFNNLDEPFLLTWSGIQHRKNCWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P D++ + ++DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTSGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG K EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTA+Q+ KDYY+VA++RFLK +LSTVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +YA        +     P    G AWS+NQFRSFRWNLT++AARPN
Sbjct  296   RYAGSN----VQASAELPKTPVGWAWSLNQFRSFRWNLTSNAARPN  337



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 248/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG  GT CPI+PGTNYTYHFQ KDQIG++FY+P+T +HR+AGGYG L 
Sbjct  84   WNGIQHRKNCWQDGTQGTMCPIMPGTNYTYHFQPKDQIGSYFYYPTTGMHRAAGGYGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DW+ K H  LKK LD G TI RP+G+VIN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +V A+Q+PKDYY+VA++RFLK  ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CYGTIVAANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   414 bits (1065),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/338 (61%), Positives = 256/338 (76%), Gaps = 4/338 (1%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M MV L         VQ EDPYLF  W VTYG  SPLGV + VILIN +FPGP IN TSN
Sbjct  5     MIMVLLCLSAGTMLGVQGEDPYLFFTWNVTYGTRSPLGVPQQVILINDQFPGPNINSTSN  64

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+V+NVFN LDEP L  W+G+QQRKNSWQDG+ GT CPILPGTN+TYHFQVKDQIG++ 
Sbjct  65    NNIVLNVFNNLDEPFLLTWSGVQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYI  124

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             Y+P+T +HR+AGG+G L ++SR LIPVP+  P D++ + L+DWY   H  L+K LDDG +
Sbjct  125   YYPTTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRS  184

Query  474   IARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             +ARP G++IN K+ +   K EPL T++ GKTY++R+CN G++ ++NFR QGH+M LVE+E
Sbjct  185   LARPTGVLINGKNAKGDGKDEPLFTMKPGKTYKYRICNAGIKNTLNFRIQGHTMKLVEME  244

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSHVVQN Y++LD+H GQC SVLVTA+Q PKDYY+V T+RF K  L+  G+I+Y NGKG 
Sbjct  245   GSHVVQNVYEALDVHVGQCFSVLVTANQAPKDYYMVTTTRFNKQILTAKGIIRYTNGKG-  303

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                   P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   ---PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   414 bits (1065),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 260/346 (75%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  V L        +VQAEDPY  H W VTYG  SPLGV + VILING+ PG
Sbjct  1     MKGGV--KLWAVCLCLALTTVVIVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQCPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNN++VNVFN LDEP L  WNGIQ RKNSWQ G  GT CPI PGTN+TYHFQ 
Sbjct  59    PNLNSTSNNNIIVNVFNNLDEPFLLTWNGIQHRKNSWQAGTAGTMCPIPPGTNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AG +G L V+SR LIPVP+  P D++ + ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G TI RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q  
Sbjct  179   NFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTYRIRICNVGLKASLNFRIQNL  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V++TA+Q+PKDYY+VA++RFLKN L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILTANQEPKDYYIVASTRFLKNALTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   RYEGGKGLASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   414 bits (1064),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/325 (63%), Positives = 251/325 (77%), Gaps = 6/325 (2%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+AEDPYLF  W VTYG ++PLGVA+  ILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  19   VRAEDPYLFFTWNVTYGTIAPLGVAQQAILINGQFPGPNINSTTNNNIVLNVFNNLDEPF  78

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            LF WNGIQQRKNSWQDGMPGT CPI PGTNYTYHFQVKDQIG+ FYFPS  +HR+AGG+G
Sbjct  79   LFTWNGIQQRKNSWQDGMPGTNCPIPPGTNYTYHFQVKDQIGSFFYFPSLGMHRAAGGFG  138

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L ++SR LIPVPFD PAD++ + + DWY K H+ L   LD G +I  P G+++N   G+
Sbjct  139  GLRINSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAGILDAGRSIGNPAGVLMNGLSGK  198

Query  429  --VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLD  256
               G    PL T+EAGKTYR+R+CNVG++ S+NFR QGH M LVE++GSH VQNDY+SLD
Sbjct  199  DATGKDDPPLFTMEAGKTYRYRICNVGLKLSLNFRIQGHLMKLVEMDGSHTVQNDYESLD  258

Query  255  LHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGT  76
            +H GQCLSVLVTA+Q+PKDYY+VA++RF K   +  G+++YA  K        P  P G 
Sbjct  259  VHVGQCLSVLVTANQEPKDYYMVASTRFTKYMRTATGVVRYAGSK----VPPSPELPAGP  314

Query  75   EGIAWSINQFRSFRWNLTASAARPN  1
             G AWS+NQ+RS RWNLTASAARPN
Sbjct  315  VGWAWSLNQWRSLRWNLTASAARPN  339



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   414 bits (1064),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 264/340 (78%), Gaps = 7/340 (2%)
 Frame = -1

Query  1011  GMVFLLWLFAMA---FVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             G++FL+ L   A     V+ EDPYLF  W VTYG LSPLGV + VILIN +FPGP IN T
Sbjct  3     GVMFLVLLCISAGTMLGVRGEDPYLFFTWNVTYGTLSPLGVPQQVILINNQFPGPNINST  62

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             SNNN+V+NVFN LDEP L  W+GIQQRKNSWQDG+ GT CPILPGTNYTYHFQVKDQIG+
Sbjct  63    SNNNIVINVFNNLDEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNYTYHFQVKDQIGS  122

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
             + Y+P+T +HR+ GG+G L ++SR LIPVP+  P D++ + L+DWY+K H  L+K LD G
Sbjct  123   YIYYPTTGMHRATGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSG  182

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
              T+ARP+G+++N K+ +   K EPL T++ GKTY++R+CN G++ ++NFR QGH+M LVE
Sbjct  183   RTLARPDGVLVNGKNAKGDGKDEPLFTMKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVE  242

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSHVVQN Y+SLD+H GQC SVLVTA+QDPKDYY+VA++RF K  L+  G+I+Y NGK
Sbjct  243   MEGSHVVQNVYESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQVLTGKGIIRYTNGK  302

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G       P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   G----PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   414 bits (1065),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/340 (62%), Positives = 256/340 (75%), Gaps = 19/340 (6%)
 Frame = -1

Query  984  AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNE  805
            A +F+V+ EDPY F+ W VTYG +SPLGV +  ILING+FPGP IN +SNNN+V+NVFN 
Sbjct  16   AGSFLVRGEDPYFFYTWNVTYGTISPLGVPQQGILINGEFPGPRINCSSNNNIVINVFNN  75

Query  804  LDEPLLFHW------------NGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
            LDEPLLF W            NGIQQRKNSWQDG+PGT CPI PGTN+TY FQVKDQIGT
Sbjct  76   LDEPLLFTWYCIFHVLVRXGRNGIQQRKNSWQDGLPGTNCPIQPGTNFTYRFQVKDQIGT  135

Query  660  HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
            +FYFPS  + R+AGG G L V+SR LIPVPFD P D++ + + DWY K H  LKK LD G
Sbjct  136  YFYFPSLGMQRAAGGIGGLRVNSRLLIPVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSG  195

Query  480  HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
            H+I RP+G+ IN   G+  DK EPL T++ G TYR+R+CNVG+++S+NFR QGH+M LVE
Sbjct  196  HSIGRPDGVQIN---GKSEDKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVE  252

Query  300  VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
            +EGSH VQN YDSLD+H GQC SVLVTA+QDPKDYY+VA++RFLK   +   +I+Y NGK
Sbjct  253  LEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGK  312

Query  120  GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
            G       P  P+   G  WS+NQFRSFRWNLTASAARPN
Sbjct  313  G----PASPELPEPPSGWIWSLNQFRSFRWNLTASAARPN  348



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 253/320 (79%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG +SPLGV + VILING+FPGP IN TSNNN+++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTVSPLGVPQQVILINGQFPGPNINSTSNNNIIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+PST+LHRSAGG+G L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRSAGGFGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G T+ RP+G++IN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +VTA+Q+PKDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CYGTIVTANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 255/332 (77%), Gaps = 8/332 (2%)
 Frame = -1

Query  996  LWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvn  817
            L L  MA  V++EDPY+++ WKVTYG ++P+GV +  ILING+FPGP IN TSNNNVV+N
Sbjct  21   LMLCLMAASVRSEDPYIYYTWKVTYGTIAPMGVPQQGILINGQFPGPEINSTSNNNVVIN  80

Query  816  VFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTS  637
            VFN LDEPLLF W+G+Q RKNSWQDG  G  CPI PGTNYTYHFQVKDQIGT+FY+P+T 
Sbjct  81   VFNNLDEPLLFTWHGVQHRKNSWQDGTLGVQCPIAPGTNYTYHFQVKDQIGTYFYYPTTG  140

Query  636  LHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNG  457
            L R+ GG+G L + SR LIPVP+  PADE+++ + DW+ K H  LK+ LD G +I RP G
Sbjct  141  LQRAIGGFGGLRIFSRLLIPVPYADPADEYWVLIGDWFGKSHTALKQKLDSGRSIGRPVG  200

Query  456  LVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQ  277
            + IN K+G     +EPL T+E GKTY++R+CNVG++ S+NFR QGH + LVE EGSHVVQ
Sbjct  201  VHINGKNG----GLEPLYTMEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVVQ  256

Query  276  NDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelp  97
            N+YDSLD+H GQC +VLVTADQ+PKDY++VA++RF K  L+   +I+Y+NG G       
Sbjct  257  NNYDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVG----PAS  312

Query  96   pppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
               P   +G AWSINQFRSFRWNLTASAARPN
Sbjct  313  GGLPPAPQGWAWSINQFRSFRWNLTASAARPN  344



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 263/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  V L    A   +VQAEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLLTVCLCVATATVMMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNN+++NVFN LDEP L  WNGIQ RKNSWQDG  GT CPI PG N+TYHFQ 
Sbjct  59    PNINSTSNNNIIINVFNNLDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AG +G L V+SR LIPVP+  P D++ + ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G T+ RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H
Sbjct  179   KFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V+VTA+Q+PKDYY+VA++RFLK  L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   RYEGGKGPASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   414 bits (1063),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 263/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  V L    A   +VQAEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLLAVCLCVATATVMMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNN+++NVFN LDEP L  WNGIQ RKNSWQDG  GT CPI PG N+TYHFQ 
Sbjct  59    PNINSTSNNNIIINVFNNLDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AG +G L V+SR LIPVP+  P D++ + ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G T+ RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H
Sbjct  179   KFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V+VTA+Q+PKDYY+VA++RFLK  L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   RYEGGKGPASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   414 bits (1063),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 255/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILING+FPG
Sbjct  1     MEGKL-----LTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVV+NVFN LDEP L  W+GIQ RKNSWQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVINVFNNLDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P DE+ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDEYTVLLGDWYTTGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG   EPL T++  KTY++R+CNVG ++++NFR Q H
Sbjct  176   NLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPRKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTA+Q  KDYY+VA++RFLK +LSTVG+I
Sbjct  236   MMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELSTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYEGSN----VQASTELPKAPVGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   414 bits (1063),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 207/346 (60%), Positives = 254/346 (73%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG L     +  L+ L +   +V A DPY F+ W VTYG  SPLGV + VILIN +FPG
Sbjct  1     MEGRL-----LTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQKVILINSQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P +N TSNNNVV+NVFN LDEP L  W+GIQ RKNSWQDG+ GT+CPI  G N+TYHFQ 
Sbjct  56    PNLNSTSNNNVVINVFNNLDEPFLLTWSGIQHRKNSWQDGVAGTSCPIPAGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+TSLHR AGG+G L V+SR LIPVP+  P DE+ + L DWY  GH  LK
Sbjct  116   KDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYAAPEDEYTVLLGDWYTTGHTALK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G T+  PNG++IN K G+VG   EPL T++ GKTY++R+CNVG ++++NFR Q H
Sbjct  176   NLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFTMKPGKTYKYRLCNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC SVLVTA+Q  KDYY+VA++RFLK +L TVG+I
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQAAKDYYMVASTRFLKKELGTVGVI  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYEGSN----VQASTKLPKAPVGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   413 bits (1062),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 211/336 (63%), Positives = 260/336 (77%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             ++ +    A+A VV AEDPY  + W VTYG  SPLGV + VILING+FPGP IN TSNNN
Sbjct  7     LLAVCLCLAVATVVVAEDPYFHYVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             ++VNVFN LDEP L  WNGIQ RKNSWQDG  GT CPI PG N+TYHFQ KDQIG++FY+
Sbjct  67    IIVNVFNNLDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGKNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T++HR+AG +G L V+SR LIPVP+  P D++ I ++DWY K H  LKK LD G TI 
Sbjct  127   PTTAMHRAAGAFGGLRVNSRLLIPVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H M LVE+EGS
Sbjct  187   RPDGILINGKAGKGDGSDQPLFTLKQGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC  VLVTA+Q+PKDYY+VA++RFLKN L+T GL++Y  GKG A+
Sbjct  247   HVLQNDYDSLDVHVGQCFGVLVTANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKGPAS  306

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             ++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  307   SQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  338



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   413 bits (1062),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 252/332 (76%), Gaps = 5/332 (2%)
 Frame = -1

Query  996  LWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvn  817
            LW+ ++  VV+ EDPYL+  W VTYG +SPLG+ +  I ING+FPGP IN TSNNN+V+N
Sbjct  12   LWIESLLTVVRGEDPYLYFTWNVTYGTISPLGIPQQGIFINGQFPGPNINSTSNNNLVIN  71

Query  816  VFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTS  637
            VFN LDEP LF WNGIQ RKNSWQDG+ GT CPI PGTN+TY  QVKDQIG +FY+PST+
Sbjct  72   VFNNLDEPFLFTWNGIQHRKNSWQDGVAGTNCPIPPGTNFTYRIQVKDQIG-YFYYPSTA  130

Query  636  LHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNG  457
            +HR+AGG+G L V+SR LIPVP+  P DE+ + + DWY K H  L+K LD G ++ RP G
Sbjct  131  MHRAAGGFGGLRVNSRLLIPVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGRPEG  190

Query  456  LVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQ  277
            ++IN K  +   K EPL T++  KTY++R+CNVG++ S+N+R QGHSM LVE+EGSHVVQ
Sbjct  191  VLINGKTAKGDGKDEPLFTMKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQ  250

Query  276  NDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelp  97
            N YDSLD+H G+C SVLVTAD++PKDYY+VA++RF K  L   G+I+Y NGKG       
Sbjct  251  NMYDSLDVHVGECFSVLVTADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG----PAS  306

Query  96   pppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
            P  P    G AWS+NQF +FRWNLTASAARPN
Sbjct  307  PDIPPAPVGWAWSLNQFHTFRWNLTASAARPN  338



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   413 bits (1062),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 205/338 (61%), Positives = 257/338 (76%), Gaps = 4/338 (1%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M M+FL         V  EDPYLF  W VTYG LSPLGV + VILIN +FPGP IN TSN
Sbjct  5     MLMLFLCLSAGSLLQVHGEDPYLFFTWNVTYGTLSPLGVPQQVILINNQFPGPVINSTSN  64

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NNVV+NVFN +DEP L  W+G+QQRKNSWQ+G+ GT CPI PGTN+TYHFQVKDQIG+  
Sbjct  65    NNVVINVFNNIDEPFLLTWSGVQQRKNSWQEGVLGTNCPIPPGTNHTYHFQVKDQIGSFI  124

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             Y+PST++HR+AGG+G L ++SR LIPVP+  P D++ + ++DWY K H  L+K+LD G +
Sbjct  125   YYPSTAMHRAAGGFGGLHINSRLLIPVPYPDPEDDYTVIVNDWYTKSHTSLRKSLDSGVS  184

Query  474   IARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             I RP G++IN K  +   K +PL T++ GKTY++R+CN G++TS+NFR QGH+M LVE+E
Sbjct  185   IGRPEGVLINGKTAKGNGKDKPLFTMKPGKTYKYRICNAGLKTSINFRIQGHTMKLVEME  244

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSHVVQN Y+SLD+H GQC SVLVTA+Q PKDYY+VA++RFLK  L   G+++Y NGKG 
Sbjct  245   GSHVVQNIYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFLKTVLVGKGIVRYTNGKG-  303

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                +  P  P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   ---QASPVLPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   412 bits (1060),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 262/347 (76%), Gaps = 10/347 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFP  862
             MEG +     ++ LL L   A + V  EDPYLF  W +TYG LSPLGV + VILIN +FP
Sbjct  1     MEGVM-----LILLLCLTTGAMLGVHGEDPYLFFTWNITYGTLSPLGVPQQVILINDQFP  55

Query  861   GPTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQ  682
             GP IN TSNNNVV+NVFN +DEP L  W+GIQQRKNSWQ+G+PGT CPI PG+NYTYHFQ
Sbjct  56    GPVINSTSNNNVVINVFNNIDEPFLLTWSGIQQRKNSWQEGVPGTNCPIPPGSNYTYHFQ  115

Query  681   VKDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDL  502
             VKDQIG+  Y+PST+LHR++G +G L ++SR LIPVP+  P D++ + L+DWY K H+ L
Sbjct  116   VKDQIGSFIYYPSTALHRASGAFGGLHINSRLLIPVPYPDPEDDYTVVLNDWYTKSHKSL  175

Query  501   KKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQG  322
             +  LD G ++ RP+G++IN K+ +   K EPL T++  KTY++RVCN G++TS+NFR QG
Sbjct  176   RTFLDSGRSLGRPDGVLINGKNAKGDGKDEPLFTMKPDKTYKYRVCNAGIKTSLNFRIQG  235

Query  321   HSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGL  142
             H M LVE+EGSHVVQN Y+SLD+H GQCLSVLV A+Q PKDYY+VA++RF+K   +  G+
Sbjct  236   HEMKLVEMEGSHVVQNVYESLDVHVGQCLSVLVRANQAPKDYYMVASTRFMKTVQTAKGI  295

Query  141   IKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             I+Y NGKG       P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   IRYTNGKG----PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/337 (61%), Positives = 255/337 (76%), Gaps = 4/337 (1%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G V    L  +   V  EDPY+++ WKVTYG +SPLG  +  ILING+FPGP IN TSNN
Sbjct  4     GAVLAFMLCLLGVTVYGEDPYIYYTWKVTYGTISPLGTPQQGILINGQFPGPEINSTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             NVVVNVFN LDEPLLF W+G+QQRKNSWQDG  G  CPILPGTNYTY FQVKDQIG++FY
Sbjct  64    NVVVNVFNNLDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T L R+ GG+G L + SR LIPVP+  P DE+++ + DWY K H+ LK  LD G +I
Sbjct  124   YPTTGLQRAVGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSI  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP G++IN K+ +   + EPL T++ GKTY++R+CN G++ ++NFRFQGH M LVE EG
Sbjct  184   GRPAGVIINGKNAKGDGRDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEG  243

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SHVVQN YDSLD+H GQC +VLVTAD++P+DYY++A++R  K  L   G+++Y NGKG A
Sbjct  244   SHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKGPA  303

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +  LPP P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   SPVLPPAPV----GWAWSLNQFRSFRWNLTASAARPN  336



>gb|KGN54012.1| hypothetical protein Csa_4G267470 [Cucumis sativus]
Length=480

 Score =   409 bits (1052),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 259/343 (76%), Gaps = 5/343 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             +   M  V L    A   +V+ EDPY F  W +TYG +SPLGV +  ILING+FPGP IN
Sbjct  1     MATMMFTVLLCLSAATMSMVRGEDPYFFFTWNITYGTISPLGVPQQGILINGQFPGPNIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              TSNNN+V+NVFN L+EP L HW+GIQ RKNSWQDG+ GT CPILPGTN+TYHFQVKDQI
Sbjct  61    STSNNNIVINVFNNLNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+ FY+P  ++HR+AGG+G L V+SR LIPVP+  P D++ + + DWY K H  LK+ LD
Sbjct  121   GSFFYYPPIAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILD  180

Query  486   DGH-TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             +GH +IARP G++IN K  +     EPL T++  KTY++RVCNVG++TS+NFRFQGH+M 
Sbjct  181   NGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMK  240

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQNDY SLD+H GQC SVLVTA+Q+PKDYY+VA++RF+KN L   G+I+Y 
Sbjct  241   LVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYT  300

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             NGKG       P  P    G AWS+NQFR+FRWNLTASAARPN
Sbjct  301   NGKG----PASPEIPKAPMGWAWSLNQFRTFRWNLTASAARPN  339



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 254/337 (75%), Gaps = 4/337 (1%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G V    L  +   V  EDPY+++ WKVTYG +SPLG  +  ILING+FPGP IN TSNN
Sbjct  4     GAVLAFMLCLLGVTVYGEDPYIYYTWKVTYGTISPLGTPQQGILINGQFPGPEINSTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             NVVVNVFN LDEPLLF W+G+QQRKNSWQDG  G  CPILPGTNYTY FQVKDQIG++FY
Sbjct  64    NVVVNVFNNLDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T L R+ GG+G L + SR LIPVP+  P DE+++ + DWY K H+ LK  LD G +I
Sbjct  124   YPTTGLQRAVGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSI  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP G++IN K+ +     EPL T++ GKTY++R+CN G++ ++NFRFQGH M LVE EG
Sbjct  184   GRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEG  243

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SHVVQN YDSLD+H GQC +VLVTAD++P+DYY++A++R  K  L   G+I+Y NGKG A
Sbjct  244   SHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKGPA  303

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +  LPP P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   SPVLPPAPV----GWAWSLNQFRSFRWNLTASAARPN  336



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/338 (60%), Positives = 255/338 (75%), Gaps = 4/338 (1%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M MV L         VQ EDPYLF  W VTYG  SPLGV + VILIN +FPGP IN TSN
Sbjct  5     MIMVLLCLSVGTMLGVQGEDPYLFFTWNVTYGTRSPLGVPQQVILINNQFPGPNINSTSN  64

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+V+NVFN LDEP L  W+G+QQRKNSWQDG+ GT CPILPGTN+TYHFQVKDQIG++ 
Sbjct  65    NNIVLNVFNNLDEPFLLTWSGVQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYI  124

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             Y+P+T +HR+AGG+G L ++SR LIPVP+  P D++ + L+DWY   H  L+K LDDG +
Sbjct  125   YYPTTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRS  184

Query  474   IARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             +ARP G++IN K+ +   K EPL  ++  KTY++R+CN G++ ++NFR QGH+M LVE+E
Sbjct  185   LARPTGVLINGKNAKGDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEME  244

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSHVVQN Y+SLD+H GQC SVLVTA+Q PKDYY+VA++RF K  L+  G+I+Y NGKG 
Sbjct  245   GSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-  303

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                   P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   ---PASPEFPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   412 bits (1058),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/337 (60%), Positives = 250/337 (74%), Gaps = 4/337 (1%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G V    L  +   V  EDPY+++ WKVTYG +SPLG  +  ILING+FPGP IN TSNN
Sbjct  4     GAVLAFMLCLLGVTVYGEDPYIYYTWKVTYGTISPLGTPQQGILINGQFPGPEINSTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             NVVVNVFN LDEPLLF W+G+QQRKNSWQDG  G  CPILPGTNYTY FQVKDQIG++FY
Sbjct  64    NVVVNVFNNLDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T L R+ GG+G L + SR LIPVP+  P DE+++ + DWY K H+ LK  LD G +I
Sbjct  124   YPTTGLQRAVGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSI  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP G++IN K+ +     EPL T++ GKTY++R+CN G++ ++NFRFQGH M LVE EG
Sbjct  184   GRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEG  243

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SHVVQN YDSLD+H GQC +VLVTAD++P+DYY++A++R  K  L   G+++Y NGKG  
Sbjct  244   SHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLVGKGIVRYTNGKG--  301

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                  P  P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  302   --PASPLLPSAPVGWAWSLNQFRSFRWNLTASAARPN  336



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   411 bits (1057),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 262/340 (77%), Gaps = 7/340 (2%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFV---VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             G++FL+ L   A     V+ EDPYLF  W VTYG LSPLGV + VILIN +FPGP IN T
Sbjct  3     GVMFLVLLCISAGTMVGVRGEDPYLFFTWNVTYGTLSPLGVPQQVILINNQFPGPNINST  62

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             SNNN+VVNVFN LDEP L  W+GIQQRKNSWQDGM GT CPILPGTNYTYHFQVKDQIG+
Sbjct  63    SNNNIVVNVFNNLDEPFLLTWSGIQQRKNSWQDGMLGTNCPILPGTNYTYHFQVKDQIGS  122

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
             + Y+P+T +HR+ GG+G L ++SR LIPVP+  P D++ + L+DWY+K H  L+K LD G
Sbjct  123   YIYYPTTGMHRATGGFGGLRINSRLLIPVPYADPEDDYTVILNDWYSKSHTALQKLLDSG  182

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
              T+ARP+G+++N K+ +   K EPL  ++  KTY++R+CN G++ ++NFR QGH+M LVE
Sbjct  183   RTLARPDGVLVNGKNAKGDGKDEPLFKMKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVE  242

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSHVVQN Y+SLD+H GQC SVLVTA+QDPKDYY+VA++RF K  L+  G+I+Y NGK
Sbjct  243   MEGSHVVQNVYESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQVLTAKGIIRYTNGK  302

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G       P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   G----PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   411 bits (1057),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 210/346 (61%), Positives = 262/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  V L    A   +VQAEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLLTVCLCVATATVMMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN T+NNN+++NVFN LDEP L  WNGIQ RKNSWQDG  GT CPI PG N+TYHFQ 
Sbjct  59    PNINSTTNNNIIINVFNNLDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AG +G L V+SR LIPVP+  P D++ + ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G T+ RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++ S+NFR Q H
Sbjct  179   KFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V+VTA+Q+PKDYY+VA++RFLK  L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVTANQEPKDYYMVASTRFLKKPLTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   LYEGGKGPASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   411 bits (1057),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 254/336 (76%), Gaps = 5/336 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAF-VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
               LL L A A  VVQ EDPYLF  W VTYG +SPLGV +  ILING+FPGP IN TSNNN
Sbjct  7     ALLLCLSAGALSVVQGEDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +V+NVFN LDEP L  WNG+QQRKNSWQDG  GT CPI PGTN+TY FQVKDQIG++ Y+
Sbjct  67    IVLNVFNNLDEPFLLTWNGVQQRKNSWQDGTLGTMCPIAPGTNFTYRFQVKDQIGSYMYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P T++H++AGG+G L ++SR LIPVP+  P DE+ + + DWY K H  LKK LD G ++ 
Sbjct  127   PVTAMHKAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKILDSGRSMG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP G++IN K+ +   K EPL T++ GKTY++RVCNVG++ S+NFR QGH + LVE+EGS
Sbjct  187   RPAGVLINGKNAKGDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN Y+SLD+H GQC S+LVTAD++PKDYY+VA++RF K  L+  G+I+Y NG G   
Sbjct  247   HTVQNTYESLDVHVGQCFSLLVTADKEPKDYYMVASTRFTKTVLTGKGIIRYENGNG---  303

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   -PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   411 bits (1056),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 204/337 (61%), Positives = 254/337 (75%), Gaps = 4/337 (1%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G V    L  +   V  EDPY+++ WKVTYG +SPLG  +  ILING+FPGP IN TSNN
Sbjct  4     GAVLAFMLCLLGVTVYGEDPYIYYTWKVTYGTISPLGTPQQGILINGQFPGPEINSTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             NVVVNVFN LDEPLLF W+G+QQRKNSWQDG  G  CPILPGTNYTY FQVKDQIG++FY
Sbjct  64    NVVVNVFNNLDEPLLFTWHGVQQRKNSWQDGTAGVQCPILPGTNYTYKFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T L R+ GG+G L + SR LIPVP+  P DE+++ + DWY K H+ LK  LD G +I
Sbjct  124   YPTTGLQRAVGGFGGLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSI  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP G++IN K+ +     EPL T++ GKTY++R+CN G++ ++NFRFQGH M LVE EG
Sbjct  184   GRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEG  243

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SHVVQN YDSLD+H GQC +VLVTAD++P+DYY++A++R  K  L   G+++Y NGKG A
Sbjct  244   SHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKGPA  303

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +  LPP P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   SPVLPPAPV----GWAWSLNQFRSFRWNLTASAARPN  336



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   411 bits (1056),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 252/336 (75%), Gaps = 5/336 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             V L  L A AF  ++AEDPYL+  W VTYG L+P GV + VILING+FPGP IN TSNNN
Sbjct  9     VMLFCLLAGAFYPIRAEDPYLYFTWNVTYGTLAPAGVPQQVILINGEFPGPNINSTSNNN  68

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP LFHW GIQQRKNSWQDG+ GT CPILPGTN+TYH+QVKDQIG++FY+
Sbjct  69    VVINVFNNLDEPFLFHWAGIQQRKNSWQDGVAGTNCPILPGTNFTYHYQVKDQIGSYFYY  128

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PS  +HR+AGG+G L ++SR LIPVP+  P D++ +   DWY K H  L K LD G  + 
Sbjct  129   PSLGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVLAGDWYTKSHSTLAKLLDSGRALG  188

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP  L++N ++ +     +PL T+  GKTY++R+CNVG++ S+NFR Q H M LVE+EGS
Sbjct  189   RPQALLVNGQNAKGDGTDKPLFTMLPGKTYKYRLCNVGLKNSINFRIQNHQMKLVEMEGS  248

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN YDSLD+H GQC  VLVTADQ+ KDYY+VA++RF K  L+  G+I+YANGKG   
Sbjct  249   HTVQNVYDSLDVHLGQCFGVLVTADQEAKDYYIVASTRFTKTVLTGKGIIRYANGKG---  305

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  306   -PASPEIPEAPVGWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   410 bits (1055),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 263/346 (76%), Gaps = 6/346 (2%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M+G +  K+  V L    A   +VQAEDPY  H W VTYG  SPLGV + VILING+FPG
Sbjct  1     MKGGV--KLLAVCLYVATATFMMVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPG  58

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNN+++NVFN LDEP L  WNGIQ RKNSWQDG  GT CPI PG N+TYHFQ 
Sbjct  59    PNINSTSNNNIIINVFNNLDEPFLLTWNGIQHRKNSWQDGTAGTMCPIPPGQNFTYHFQP  118

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+P+T++HR+AG +G L V+SR LIPVP+  P D++ + ++DWY K H  LK
Sbjct  119   KDQIGSYFYYPTTAMHRAAGAFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTQLK  178

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G T+ RP+G++IN K G+     +PL TL+ GKTYR R+CNVG++TS+NFR Q H
Sbjct  179   KFLDSGRTLGRPDGILINGKSGKTDGSDKPLFTLKPGKTYRVRICNVGLKTSLNFRIQNH  238

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC  V+VTA+Q+ KDYY+VA++RFLK  L+T GL+
Sbjct  239   KMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTANQEAKDYYMVASTRFLKKPLTTTGLL  298

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  GKG A+++LP  P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   RYEGGKGPASSQLPAAPV----GWAWSLNQFRSFRWNLTASAARPN  340



>ref|XP_008359469.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=487

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/324 (63%), Positives = 250/324 (77%), Gaps = 5/324 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   DP +F  W VTYG LSPLGV + VILING+FPGP IN T+NNNV+VNVFN LDEP
Sbjct  19   VVHCGDPTIFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNNNVIVNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W G+QQRKNSWQDG+ GT CPI PGTNYTY FQVKDQIG+  Y+P T++HR+AGG+
Sbjct  79   FLITWVGVQQRKNSWQDGVLGTMCPIPPGTNYTYKFQVKDQIGSFMYYPVTAMHRAAGGF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L ++SR LIPVP+  P D++ + + DWY+K H  LKK LD G  +ARP+G++IN K  
Sbjct  139  GGLRINSRNLIPVPYAAPEDDYTVMIGDWYSKSHSQLKKFLDSGRAMARPDGVLINGKSA  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL T++AGKTY++R+CNVG++ S+NFR QGH M LVE EGSH VQN YDSLD+
Sbjct  199  KGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVETEGSHTVQNTYDSLDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC +VLVTAD++PKDYY+VA++RF K+ L+  G+I+Y NGKG A+ E P  P DG  
Sbjct  259  HIGQCFAVLVTADKEPKDYYMVASTRFSKSVLTGKGIIRYENGKGPASPEXPQAPVDGL-  317

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
                S+NQFRSFRWNLTASAARPN
Sbjct  318  ----SLNQFRSFRWNLTASAARPN  337



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   410 bits (1053),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 259/343 (76%), Gaps = 5/343 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             +   M  V L    A   +V+ EDPY F  W +TYG +SPLGV +  ILING+FPGP IN
Sbjct  1     MATMMFTVLLCLSAATMSMVRGEDPYFFFTWNITYGTISPLGVPQQGILINGQFPGPNIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              TSNNN+V+NVFN L+EP L HW+GIQ RKNSWQDG+ GT CPILPGTN+TYHFQVKDQI
Sbjct  61    STSNNNIVINVFNNLNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+ FY+P  ++HR+AGG+G L V+SR LIPVP+  P D++ + + DWY K H  LK+ LD
Sbjct  121   GSFFYYPPIAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILD  180

Query  486   DGH-TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             +GH +IARP G++IN K  +     EPL T++  KTY++RVCNVG++TS+NFRFQGH+M 
Sbjct  181   NGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMK  240

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQNDY SLD+H GQC SVLVTA+Q+PKDYY+VA++RF+KN L   G+I+Y 
Sbjct  241   LVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYT  300

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             NGKG       P  P    G AWS+NQFR+FRWNLTASAARPN
Sbjct  301   NGKG----PASPEIPKAPMGWAWSLNQFRTFRWNLTASAARPN  339



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   409 bits (1052),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 262/341 (77%), Gaps = 5/341 (1%)
 Frame = -1

Query  1020  NKMGMVFLLWLFAMAF-VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             N + ++ LL L+A +   V+ EDPYLF  W VTYG +SP GV +  ILING+FPGP IN 
Sbjct  2     NGVMLILLLCLWAASMSAVRGEDPYLFFTWNVTYGTISPTGVPQQGILINGQFPGPNINS  61

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             TSNNNVVVNVFN LDEP L  W G+QQRKNSWQDG+ GT CPI PG NYTYHFQVKDQIG
Sbjct  62    TSNNNVVVNVFNNLDEPFLLTWTGVQQRKNSWQDGVLGTNCPIPPGKNYTYHFQVKDQIG  121

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             ++ Y+PST++H++AGG+G L ++SR LIPVP+  P D++ I   DW++KGH  LKK LD 
Sbjct  122   SYMYYPSTAMHKAAGGFGGLRINSRLLIPVPYPDPEDDYTILAGDWFSKGHTTLKKMLDS  181

Query  483   GHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
             G  + R +G+ IN K  +   K EPL T+E GKTY++R+CNVG++TS+N RFQGH+M LV
Sbjct  182   GRNLGRCDGVHINGKVAKGDGKDEPLFTMEPGKTYKYRICNVGIKTSLNVRFQGHNMKLV  241

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANG  124
             E+EGSH VQN Y+SLD+H GQC  VLVTADQ+P+DYY+VA++RF K  ++  G+I+Y NG
Sbjct  242   EMEGSHTVQNTYESLDVHVGQCFGVLVTADQEPRDYYVVASTRFTKRVITATGIIRYTNG  301

Query  123   KGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             KG A+ ELPP P     G AWS+NQFR+FRWNLTASAARPN
Sbjct  302   KGPASPELPPAPI----GWAWSLNQFRTFRWNLTASAARPN  338



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   409 bits (1052),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 256/336 (76%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ L     +V A DPY ++ W VTYG ++PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCLATTVAMVNAGDPYFYYTWNVTYGTIAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTN+TYHFQ KDQIG++FY+
Sbjct  67    VVINVFNNLDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T+LHR +GG+G L V+SR LIPVP+  P ++  I ++DWY K H  LK  LD G T+ 
Sbjct  127   PTTALHRYSGGFGGLRVNSRLLIPVPYADPEEDHTILINDWYTKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G+VG K EPL TL+ GKTY+FR+CNVG ++++NFR QGH M LVE+EGS
Sbjct  187   LPDGVLINGKSGKVGGKNEPLFTLKPGKTYKFRICNVGFKSTLNFRVQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++ST+G++ YA  K    
Sbjct  247   HVLQNDYDSLDIHVGQCFAVLVTADQTAKNYYMVASTRFLKKEVSTIGVMSYAGSK----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              E     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VEASAVIPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   409 bits (1051),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 206/336 (61%), Positives = 254/336 (76%), Gaps = 5/336 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAF-VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
               LL L A A  VVQ EDPYLF  W VTYG +SPLGV +  ILING+FPGP IN TSNNN
Sbjct  7     ALLLCLSAGALSVVQGEDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +V+NVFN LDEP L  W+GIQQRKNSWQDG  GT CPI PGTN+TY FQVKDQIG++ Y+
Sbjct  67    IVLNVFNNLDEPFLLTWSGIQQRKNSWQDGTLGTMCPIAPGTNFTYRFQVKDQIGSYMYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P T++HR+AGG+G L ++SR LIPVP+  P DE+ + + DWY K H  LKK LD G T+ 
Sbjct  127   PVTAMHRAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+G++IN K+ +   K EPL T++ GKTY++RVCNVG++ S+NFR QGH + LVE+EGS
Sbjct  187   RPDGILINGKNAKGDGKDEPLFTMKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN Y+SLD+H GQC S+LVTAD++ KDYY+VA++RF K  L+  G+I+Y NG G   
Sbjct  247   HTVQNTYESLDVHVGQCFSLLVTADKERKDYYMVASTRFTKTVLTGKGIIRYENGNG---  303

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   -PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   409 bits (1051),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 207/340 (61%), Positives = 254/340 (75%), Gaps = 7/340 (2%)
 Frame = -1

Query  1011  GMVFLLWLFAMAF-VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             G+ FL+++  +    V+AEDPYLF  W VTYG +SPLGV +  ILING+FPGP IN T+N
Sbjct  3     GVAFLVFVSLLGLSAVRAEDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINSTTN  62

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+V+NVFN LDEP LF WNGIQQRKNSWQDGM GT CPI PGTNYTYHFQVKDQIG+ F
Sbjct  63    NNIVINVFNNLDEPFLFTWNGIQQRKNSWQDGMLGTNCPIPPGTNYTYHFQVKDQIGSFF  122

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             YFPS  +HR+AGG+G L V+SR LIPVPFD PAD++ + + DWY K H+ L   LD G +
Sbjct  123   YFPSVGMHRAAGGFGGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKALAGILDAGRS  182

Query  474   IARPNGLVINAKHGE--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
             I  P G+++N   G+   G    PL  +EAGKTYR+R+CNVG++ S+NFR Q H M LVE
Sbjct  183   IGNPTGILMNGSPGKNAAGKDDAPLFAMEAGKTYRYRICNVGLKVSLNFRIQNHLMKLVE  242

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             ++GSH VQNDY+SLD+H GQCLSVLVTA+Q+PKDYY+VA++RF K  L+  G+++YA   
Sbjct  243   MDGSHTVQNDYESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMLTATGIVRYAGSN  302

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                        P G  G AWS NQ+RSFRWNLTASAARPN
Sbjct  303   ----VPPSSELPAGPVGWAWSFNQWRSFRWNLTASAARPN  338



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   409 bits (1050),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/324 (62%), Positives = 247/324 (76%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   DP +F  W VTYG LSPLGV + VILING+FPGP IN T+NNNV+VNVFN LDEP
Sbjct  19   VVHCGDPTIFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNNNVIVNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W G+QQRKNSWQDG+ GT CPI PGTNYTY FQVKDQIG+  Y+P T++HR+AG +
Sbjct  79   FLITWVGVQQRKNSWQDGVLGTMCPIPPGTNYTYKFQVKDQIGSFMYYPVTAMHRAAGAF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L ++SR LIPVP+  P D++ + + DWY+K H  LKK LD G  +ARP+G++IN K  
Sbjct  139  GGLRINSRNLIPVPYAAPEDDYTVMIGDWYSKSHSQLKKFLDSGRAMARPDGVLINGKSA  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL T++AGKTY++R+CNVG++ S+NFR QGH M LVE EGSH VQN YDSLD+
Sbjct  199  KGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVETEGSHTVQNTYDSLDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC +VLVTAD++PKDYY+VA++RF K+ L+  G+I+Y NGKG       P  P    
Sbjct  259  HIGQCFAVLVTADKEPKDYYMVASTRFSKSVLTGKGIIRYENGKG----PASPEVPKAPV  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  315  GWAWSLNQFRSFRWNLTASAARPN  338



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   409 bits (1050),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 258/336 (77%), Gaps = 5/336 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             V L+ L A A + V+ EDPYLF EW +TYG +SPLGV +  ILIN +FPGP IN T+NNN
Sbjct  7     VLLVCLVAGAMLGVEGEDPYLFFEWNITYGTISPLGVPQQAILINNEFPGPNINSTTNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VVVNVFN +DEP L  W+GIQQRKNSWQ+GM GT CPI PGTN+TYHFQVKDQIG+  Y+
Sbjct  67    VVVNVFNNIDEPFLLTWSGIQQRKNSWQEGMLGTNCPIQPGTNHTYHFQVKDQIGSFIYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PST++HR++G +G L ++SR LIPVP+  P D++ + ++DWY K H+ L+  LD+G  + 
Sbjct  127   PSTAMHRASGAFGGLRINSRLLIPVPYAPPEDDYTVIINDWYTKDHKALRSFLDEGRVLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+G++IN K+ +   K EPL  ++  K Y++R+CN G++ S+NFR QGH+M+LVE+EGS
Sbjct  187   RPDGVLINGKNAKGDGKDEPLFEMKPEKVYKYRICNAGLKASLNFRIQGHTMMLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN Y+SLD+H GQC SVLVTAD++PKDYY+VA++RFLK  L+  G+I+Y NGKG   
Sbjct  247   HTVQNVYESLDVHVGQCFSVLVTADKEPKDYYMVASTRFLKTVLTAKGIIRYTNGKG---  303

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   -PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   408 bits (1049),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 206/336 (61%), Positives = 260/336 (77%), Gaps = 8/336 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             M+ LL L  M   V+ EDPY+++ W VTYG ++PLGV +  ILING+FPGP IN TSNNN
Sbjct  8     MIALL-LCLMTSSVRGEDPYIYYTWNVTYGTIAPLGVPQQGILINGQFPGPEINSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEPLLF W+G+QQRKNSWQDG  G  CPI PGTNYTY FQVKDQIGT+FY+
Sbjct  67    VVINVFNNLDEPLLFTWHGVQQRKNSWQDGTLGAQCPIAPGTNYTYRFQVKDQIGTYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P+T L R+ GG+G L + SR LIPVP+  PADE+++ + DW+ K H  LK+TLD G +I 
Sbjct  127   PTTGLQRAVGGFGGLRIFSRLLIPVPYADPADEYWVLIGDWFGKSHTALKQTLDSGRSIG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+G+ IN K+G     +E L T+E GKTY++R+CNVG++ ++NFR QGH M LVE EGS
Sbjct  187   RPSGVHINGKNG----GLEALYTMEPGKTYKYRICNVGLKEALNFRIQGHPMKLVETEGS  242

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HVVQN YDSLD+H GQC +VLVTADQ+P+DY++VA++RF K  ++   +I+Y+NG G A+
Sbjct  243   HVVQNTYDSLDVHVGQCFTVLVTADQEPRDYFMVASTRFTKKVITATRVIRYSNGVGPAS  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
               LPP P    +G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   PLLPPAPH---QGWAWSLNQFRSFRWNLTASAARPN  335



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   408 bits (1049),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 201/324 (62%), Positives = 250/324 (77%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   +PYLF  W VTYG LSPLGV + VILING+FPGP IN T+NNN+V+NVFN LDEP
Sbjct  19   VVHCGNPYLFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNNNIVLNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W+G+QQRKNSWQDG  GT CPI PGTNYTY FQVKDQIGT+ Y+P+T++H++AG +
Sbjct  79   FLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYPTTAMHKAAGAF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+  P DE+ + + DW+ K H  LKK LD G ++ARP+G++IN K  
Sbjct  139  GGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSS  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL  ++ GKTY++R+CNVG++ ++NFR QGHSM LVE+EGSH VQN YDS+D+
Sbjct  199  KGDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SVLVTAD+DPKDYY+VA++RF K+ L+  G+I+Y NGKG       P  P    
Sbjct  259  HLGQCFSVLVTADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKG----PASPELPKAPV  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  315  GWAWSLNQFRSFRWNLTASAARPN  338



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   408 bits (1049),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 247/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG +SPLGV + VILING+FPGP +N TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTVSPLGVPQQVILINGQFPGPNVNSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+PST++HRSAGG+G L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTAMHRSAGGFGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G T+ RP+G++IN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H + LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   ++TA+Q+ KDYY+VA+SRFLK+ ++T GL++Y  GKG          P G  G AW
Sbjct  264  CYGTILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG----PASSQLPPGPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   408 bits (1049),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 202/340 (59%), Positives = 254/340 (75%), Gaps = 7/340 (2%)
 Frame = -1

Query  1011  GMVFLLWL---FAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             GM+ +L L        VV   DP +F  W VTYG LSPLGV + VILING+FPGP IN T
Sbjct  3     GMIVMLLLCLSVGTISVVNCGDPTIFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINST  62

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             +NNNV+VNVFN LDEP L  W G+QQRKN WQDG+ GT CPI PGTNYTY FQVKDQIG+
Sbjct  63    TNNNVIVNVFNNLDEPFLITWVGVQQRKNPWQDGVXGTMCPIPPGTNYTYKFQVKDQIGS  122

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
               Y+P+T++HR+AG +G L ++SR LIPVP+  P D++ + + DWY K H  L+K LD G
Sbjct  123   FMYYPATAMHRAAGAFGGLRINSRNLIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSG  182

Query  480   HTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
              ++ARP+G++IN K  +   K EPL T++AGKTY++R+CNVG++ S+NFR QGH M LVE
Sbjct  183   RSMARPDGVLINGKSAKGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVE  242

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             +EGSH VQN YDSLD+H GQC S+LVTAD++PKDYY+VA++RF K+ L+  G+I+Y NG 
Sbjct  243   MEGSHTVQNTYDSLDVHIGQCFSMLVTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGX  302

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G     + P  P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   G----PVSPEVPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   408 bits (1048),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 257/346 (74%), Gaps = 9/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             MEG +     M+  L   A   VV A DPY F+ W V+YG  +PLGV + VILING+FPG
Sbjct  1     MEGKM-----MLTALLCIATVAVVNAGDPYFFYTWNVSYGNAAPLGVPQKVILINGQFPG  55

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             P IN TSNNN+V+NVFN LDEP L HW+GIQ RKN WQDG+PGTTCPI+PG N+TYHFQ 
Sbjct  56    PNINSTSNNNIVINVFNNLDEPFLLHWSGIQHRKNCWQDGLPGTTCPIMPGQNFTYHFQP  115

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIG++FY+PSTSLHR AGG+G L V+SR LIPVP+  P D++ + ++DWY K H  +K
Sbjct  116   KDQIGSYFYYPSTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTSIK  175

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
               LD G  +  P+G++IN K  ++  K +PL T++ GKTY+FR+CNVG ++++NFR Q H
Sbjct  176   NLLDSGRALGSPDGVLINGKSAKMDGKDQPLFTMKPGKTYKFRICNVGFKSTLNFRIQNH  235

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              M LVE+EGSHV+QNDYDSLD+H GQC +VLVTADQ  KDYY+VA++RFLK ++++ G++
Sbjct  236   KMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKDYYMVASTRFLKKEMTSTGVL  295

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y  G      +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  296   RYVGGSA----QASTVLPKAPVGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   408 bits (1048),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 254/336 (76%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ L +   +V A DPY ++ W VTYG  +PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCLASTVAIVSAGDPYFYYTWNVTYGTAAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPIL GTN+TYHFQ KDQIG++FY+
Sbjct  67    VVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPILAGTNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PSTSLHR  GG+G L V+SR LIPVP+  P D+  I ++DW+ K H  LK  LD G T+ 
Sbjct  127   PSTSLHRFTGGFGGLRVNSRLLIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G+VG+K E L T++ GKTY+FR+CNVG ++++NFR QGH M LVE+EGS
Sbjct  187   SPDGVLINGKSGKVGEKNEALFTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y        
Sbjct  247   HVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              E     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VEASAELPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   407 bits (1047),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 204/323 (63%), Positives = 250/323 (77%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V  EDPY+++ WKVTYG +SPLG  +  ILING+FPGP IN TSNNNVVVNVFN LDEPL
Sbjct  19   VYGEDPYIYYTWKVTYGTISPLGTPQQGILINGQFPGPEINSTSNNNVVVNVFNNLDEPL  78

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            LF W+G+QQRKNSWQDG  G  CPILPGTNYTY FQVKDQIG++FY+P+T L R+ GG+G
Sbjct  79   LFTWHGVQQRKNSWQDGTLGVQCPILPGTNYTYKFQVKDQIGSYFYYPTTGLQRAVGGFG  138

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L + SR LIPVP+  P DE+++ + DWY K H+ LK  LD G +I RP G++IN K+ +
Sbjct  139  GLRIFSRLLIPVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAK  198

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 EPL T++ GKTY++R+CN G++ ++NFRFQGH M LVE EGSHVVQN YDSLD+H
Sbjct  199  GDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVH  258

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC +VLVTAD++PKDYY+VA++R  K  L   G+I+Y NGKG A+  LPP P     G
Sbjct  259  VGQCYTVLVTADKEPKDYYMVASTRMTKYNLLGKGIIRYTNGKGPASPMLPPAPV----G  314

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFRSFRWNLTASAARPN
Sbjct  315  WAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   407 bits (1047),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/342 (59%), Positives = 258/342 (75%), Gaps = 4/342 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             +++ M M+ L     +  VV+ EDPYL+  W VTYG +SPLGV +  ILING+FPGP IN
Sbjct  1     MSSVMHMLLLCLSAGVISVVRGEDPYLYFTWNVTYGTISPLGVPQQGILINGQFPGPNIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              TSNNN+V+NVFN LDEPLLF W+G+QQRKNSWQDG  GT CPI PG NYTY FQVKDQI
Sbjct  61    STSNNNIVLNVFNNLDEPLLFTWSGVQQRKNSWQDGTLGTMCPIPPGQNYTYRFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G++FY+P T++HR++GG+G L ++SR LIPVP+  P D++ + + DWY K H  LKK LD
Sbjct  121   GSYFYYPITAMHRASGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYAKSHTALKKHLD  180

Query  486   DGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
              G ++ RP+G++IN K  +   K EPL T++ GKTY++R+CNVG++ S+NFR QGH M L
Sbjct  181   SGRSMGRPDGVIINGKSAKGDGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKL  240

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VE+EGSH +QN Y+SLD+H GQC SVLVTAD+DP DYY+VA++RF K  L+  G+++Y N
Sbjct  241   VEMEGSHTMQNTYESLDVHLGQCFSVLVTADKDPMDYYMVASTRFTKKVLTGKGIMRYEN  300

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G G       P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  301   GNG----PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   407 bits (1047),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 255/336 (76%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ + +   +V A DPY ++ W VTYG ++PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCIVSTVAMVNAGDPYFYYTWNVTYGTIAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +V+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTN+TYHFQ KDQIG++FY+
Sbjct  67    IVINVFNNLDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PSTSLHR +GG+G L V+SR LIPVP+  P D++ + ++DWY K H  LK  LD G T+ 
Sbjct  127   PSTSLHRFSGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G+VG   EPL T++ GKTY++R+CNVG ++++NFR QGH M LVE+EGS
Sbjct  187   SPDGVLINGKSGKVGGNNEPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y        
Sbjct  247   HVIQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VQASNELPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   407 bits (1047),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 200/328 (61%), Positives = 252/328 (77%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNE  805
            A A +V+AEDPYLF  W VTYG +SPLG+ +  ILING+FPGP IN T+NNN+V+NVFN 
Sbjct  14   AGAMMVRAEDPYLFFTWNVTYGTISPLGIPQQGILINGQFPGPNINSTTNNNIVINVFNN  73

Query  804  LDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRS  625
            LDEP L  WNGIQQRKNSWQDG  GT+CPI PG NYTYHFQVKDQIG++ Y+P T++HR+
Sbjct  74   LDEPFLLTWNGIQQRKNSWQDGTLGTSCPIPPGQNYTYHFQVKDQIGSYIYYPITAMHRA  133

Query  624  AGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVIN  445
            AGG+G L V+SR LIPVP+  P D++ + + DWY+K H  L K LD G  + RP+G++IN
Sbjct  134  AGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKSHTTLHKFLDSGRALGRPDGVLIN  193

Query  444  AKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYD  265
             K  +   K EPL T++ GKTY++R+CNVG++ S+NFR QGH M LVE+EGSH +QN YD
Sbjct  194  GKSSKSKGKEEPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTIQNSYD  253

Query  264  SLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppP  85
            SLD+H GQC +VLVTAD++PKDYY+VA++R+ K  L+T  +I Y NGKG       P  P
Sbjct  254  SLDVHVGQCFAVLVTADKEPKDYYMVASTRYTKTVLTTTAVISYTNGKG----PASPVLP  309

Query  84   DGTEGIAWSINQFRSFRWNLTASAARPN  1
            +   G AW++NQFRSFRWNLTASAARPN
Sbjct  310  EAPVGWAWTLNQFRSFRWNLTASAARPN  337



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   407 bits (1046),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 259/341 (76%), Gaps = 5/341 (1%)
 Frame = -1

Query  1020  NKMGMVFLLWLFA-MAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             N + +  LL L A  A V +AEDPY +  W VTYG +SPLGV +  ILING+FPGP IN 
Sbjct  2     NTVTLASLLCLLAGAATVARAEDPYFYFTWNVTYGTISPLGVPQQGILINGQFPGPNINS  61

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             TSNNN+VVNVFN LDEP L  W+G+Q RKNSWQDG  GT CPILPG N+TYHFQVKDQIG
Sbjct  62    TSNNNIVVNVFNHLDEPFLLTWSGVQHRKNSWQDGTLGTNCPILPGQNFTYHFQVKDQIG  121

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             ++FY+P+TS HR+AGG+G L V+SR LIPVP+  P D++ + + DWY+K H+ LK  LD 
Sbjct  122   SYFYYPTTSTHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYSKTHKQLKTFLDS  181

Query  483   GHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
             G ++ARP+G+VIN K G+     +P+ T++ GKTY++R+CNVG++ S+NFR QGH M LV
Sbjct  182   GRSLARPDGVVINGKSGKGPGGDKPVFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLV  241

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANG  124
             E+EGSHVVQN Y+SLD+H GQC SVLVTADQ+P+DYY+VA++RF K  ++   +++Y NG
Sbjct  242   EMEGSHVVQNVYESLDVHVGQCFSVLVTADQEPRDYYMVASTRFTKEVITATRILRYTNG  301

Query  123   KGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             KG          P   EG AWS+NQFRSFRWNLTASAARPN
Sbjct  302   KG----PASTVLPKAPEGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 247/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG +SPLGV + VILING+FPGP IN TSNNN+++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTVSPLGVPQQVILINGQFPGPNINSTSNNNIIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTNYTYHFQ KDQIG++FY+PST+LHRSAGG+G L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNYTYHFQPKDQIGSYFYYPSTALHRSAGGFGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G T+ RP+G++IN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR RVCNVG++TS+NFR Q H + LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRVRVCNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +++A+Q+ KDYY+VA+SRFLK+ ++T GL++Y  GKG          P G  G AW
Sbjct  264  CYGTILSANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG----PASSQLPPGPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 263/347 (76%), Gaps = 8/347 (2%)
 Frame = -1

Query  1041  VMEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFP  862
             +M+G    K+  VF+  + ++A +V A DPY ++ W VTYG ++PLG+ + VILING+FP
Sbjct  1     MMQGG---KLLTVFVCLVSSVA-LVNAGDPYFYYTWNVTYGTVAPLGIPQQVILINGQFP  56

Query  861   GPTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQ  682
             GP +N TSNNNVV+NVFN LDEP L  W+G+Q RKNSWQDG+ GTTCPI  GTNYTYHFQ
Sbjct  57    GPNLNSTSNNNVVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTTCPIPAGTNYTYHFQ  116

Query  681   VKDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDL  502
              KDQIG++FY+PST+LHR +GG+G L V+SR LIPVP+  P D++ + ++DWY K H  L
Sbjct  117   PKDQIGSYFYYPSTALHRFSGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTAL  176

Query  501   KKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQG  322
             K  LD G T+  P+G++IN K G+VG    PL T++ GKTY++R+CNVG ++++NFR QG
Sbjct  177   KTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYRICNVGFKSTLNFRIQG  236

Query  321   HSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGL  142
             H M LVE+EGSHV+QNDYDSLD+H GQC +VLVTADQ+ K+YY+VA++RFLK ++STVG+
Sbjct  237   HKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGV  296

Query  141   IKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             + Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  297   MSYEGSN----VQASSELPKAPVGWAWSLNQFRSFRWNLTASAARPN  339



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/342 (61%), Positives = 258/342 (75%), Gaps = 6/342 (2%)
 Frame = -1

Query  1020  NKMGMVFLLWLFAMAF--VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             + M M  LL   ++    VV  EDPYLF  W V+YG +SPLGV +  ILIN +FPGP IN
Sbjct  2     DSMAMKLLLLCLSIGAISVVHGEDPYLFFTWNVSYGTISPLGVPQQGILINNEFPGPNIN  61

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              T+NNN+V+NVFN LDEPL+F WNGIQQRKNSWQDG PGT CPI PG NYTYHFQVKDQI
Sbjct  62    STTNNNIVINVFNNLDEPLMFTWNGIQQRKNSWQDGTPGTMCPIPPGKNYTYHFQVKDQI  121

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G++FY+P T++HR+ G +G L V+SR LIPVP+  P D++ + + DWY K H  L+K LD
Sbjct  122   GSYFYYPITAMHRAGGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHNSLRKQLD  181

Query  486   DGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
              G ++ RP G++IN K+       EPL T++ GKTY+FRVCNVG++ S+NFR QGH+M L
Sbjct  182   MGRSLGRPEGVLINGKNARGDGTDEPLFTMKPGKTYKFRVCNVGLKNSLNFRIQGHTMKL  241

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VE+EGSHVVQN Y+SLD+H GQC S LVTAD++PKDY++VA +RF K  L+ +GLI+Y N
Sbjct  242   VEMEGSHVVQNTYESLDVHLGQCFSALVTADKEPKDYWMVADTRFTKTMLTGLGLIRYTN  301

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             G G A  ELP P     EG+AWS+NQ RSFRWNLTASAARPN
Sbjct  302   GNGPANPELPLP----PEGLAWSLNQARSFRWNLTASAARPN  339



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   406 bits (1044),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 249/324 (77%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   +PYLF  W VTYG LSPLGV + VILING+FPGP IN T+NNN+V+NVFN LDEP
Sbjct  19   VVHCGNPYLFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNNNIVLNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W+G+QQRKNSWQDG  GT CPI PGTNYTY FQVKDQIGT+ Y+P+T++H++AG +
Sbjct  79   FLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYPTTAMHKAAGAF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+  P DE+ + + DW+ K H  LKK LD G ++ARP+G++IN K  
Sbjct  139  GGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSS  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL  ++ GKTY++R+CNVG++ ++NFR QGHSM LVE+EGSH VQN YDS+D+
Sbjct  199  KGDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SVLVTAD+DPKDYY+VA++RF  + L+  G+I+Y NGKG       P  P    
Sbjct  259  HLGQCFSVLVTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKG----PASPELPKAPV  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  315  GWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   406 bits (1044),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 254/336 (76%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ L +   +V A DPY ++ W VTYG  +PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCLASTVAIVSAGDPYFYYTWNVTYGTAAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTN+TYHFQ KDQIG++FY+
Sbjct  67    VVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PSTSLHR AGG+G L V+SR LIPVP+  P D+  I ++DW+ K H  LK  LD G T+ 
Sbjct  127   PSTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDRTILINDWFTKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G+VG+K E L T++ GKTY+FR+CNVG ++++NFR QGH M LVE+EGS
Sbjct  187   SPDGVLINGKSGKVGEKNEALFTMKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y        
Sbjct  247   HVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              E     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VEASAELPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   406 bits (1044),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 206/325 (63%), Positives = 246/325 (76%), Gaps = 6/325 (2%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+AEDPYLF  W VTYG  SPLGV + VILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  18   VKAEDPYLFFTWNVTYGTASPLGVPQQVILINGQFPGPNINSTTNNNIVINVFNHLDEPF  77

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            LF WNGIQ RKNSWQDGMPGT CPI  GTNYTYHFQVKDQIG++FYFPS  +HR+AGG+G
Sbjct  78   LFTWNGIQHRKNSWQDGMPGTNCPIAAGTNYTYHFQVKDQIGSYFYFPSVGMHRAAGGFG  137

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L V+SR LIPVPFD PAD++ + + DWY K H+ L + LD G +I  P G++IN   G+
Sbjct  138  GLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGK  197

Query  429  --VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLD  256
               G    PL T+EAGKTYR+R+CNVG++ S+NFR Q H M LVE++GSH VQNDY SLD
Sbjct  198  DAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLD  257

Query  255  LHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGT  76
            +H GQC SVLVTA+Q+PKDYY+VA++RF K   +  G+I+YA           P  P G 
Sbjct  258  IHVGQCFSVLVTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS----VPPSPELPAGP  313

Query  75   EGIAWSINQFRSFRWNLTASAARPN  1
             G AWS NQ+RSFRWNLTASAARPN
Sbjct  314  VGWAWSFNQWRSFRWNLTASAARPN  338



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   406 bits (1044),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 249/324 (77%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   +PYLF  W VTYG LSPLGV + VILING+FPGP IN T+NNN+V+NVFN LDEP
Sbjct  19   VVHCGNPYLFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNNNIVLNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W+G+QQRKNSWQDG  GT CPI PGTNYTY FQVKDQIGT+ Y+P+T++H++AG +
Sbjct  79   FLVTWHGLQQRKNSWQDGTLGTMCPIPPGTNYTYQFQVKDQIGTYMYYPTTAMHKAAGAF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+  P DE+ + + DW+ K H  LKK LD G ++ARP+G++IN K  
Sbjct  139  GGLRVNSRLLIPVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSS  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL  ++ GKTY++R+CNVG++ ++NFR QGHSM LVE+EGSH VQN YDS+D+
Sbjct  199  KGDGKDEPLFVMKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SVLVTAD+DPKDYY+VA++RF  + L+  G+I+Y NGKG       P  P    
Sbjct  259  HLGQCFSVLVTADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKG----PASPELPKAPV  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  315  GWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   406 bits (1043),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 205/323 (63%), Positives = 248/323 (77%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            VQ EDPYL++ W VTYG ++PLGV +  ILING+FPGP IN TSNNNVVVN+FN LDEP 
Sbjct  19   VQGEDPYLYYTWNVTYGTIAPLGVPQQGILINGQFPGPEINSTSNNNVVVNIFNNLDEPF  78

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L  W+GIQ RKNSWQ+G PGT CPI PGTNYTYHFQVKDQIG+ FY+PST L R+AGG+G
Sbjct  79   LMTWHGIQHRKNSWQEGTPGTLCPIAPGTNYTYHFQVKDQIGSFFYYPSTGLQRAAGGFG  138

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L + SR LIPVP+  P DE+++ + DWY K H  L+K LD G +I RPNG++IN K  +
Sbjct  139  GLRIFSRLLIPVPYADPEDEYWVIMGDWYTKSHTSLQKLLDSGRSIGRPNGVLINGKTAK  198

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 +PL T+  GKTY++R+CNVG++ ++NFR QGHS+ LVE EGSHVVQN YDSLD+H
Sbjct  199  GDGSDQPLYTMIPGKTYKYRLCNVGLKDALNFRIQGHSLKLVETEGSHVVQNVYDSLDVH  258

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC +VLVTAD+DPKDYY+VA++RF K  LS   +I Y N    A+ ELPP P     G
Sbjct  259  VGQCFTVLVTADKDPKDYYMVASTRFTKYDLSAKAIIHYTNSAAPASPELPPSPV----G  314

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFRSFRWNLTASAARPN
Sbjct  315  WAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   406 bits (1043),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 254/336 (76%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ L +   +V A DPY ++ W VTYG  +PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCLASTVAIVSAGDPYFYYTWNVTYGTAAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTN+TYHFQ KDQIG++FY+
Sbjct  67    VVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PSTSLHR AGG+G L V+SR LIPVP+  P D+  I ++DW+ K H  LK  LD G T+ 
Sbjct  127   PSTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G+VG+K E L T++ GKTY++R+CNVG ++S+NFR QGH M LVE+EGS
Sbjct  187   SPDGVLINGKFGKVGEKNEALFTMKPGKTYKYRICNVGFKSSLNFRIQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y        
Sbjct  247   HVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              E     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VEASAELPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   406 bits (1043),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 259/343 (76%), Gaps = 5/343 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             +   M  V L    A   +V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN
Sbjct  2     MATMMFTVLLCLSAATMSMVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNIN  61

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              TSNNN+VVNVFN L+EP L HW+GIQ RKNSWQDG+ GT CPI PG N+TYHFQVKDQI
Sbjct  62    STSNNNIVVNVFNNLNEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGANFTYHFQVKDQI  121

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+ FY+PS ++HR+AGG+G L ++SR LIPVP+  P D++ + + DWY K H  LK+ LD
Sbjct  122   GSFFYYPSIAMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILD  181

Query  486   DGH-TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             +GH +IARP G++IN K  +     EPL T++ GKTY++RVCNVG++TS+NFRFQGH+M 
Sbjct  182   NGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMK  241

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQNDY SLD+H GQC SVLVTA+Q+PKDYY+VA++RF+KN +   G+I+Y 
Sbjct  242   LVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVIIGKGIIRYT  301

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             NGKG       P  P    G AWS+NQFR+FRWNLTASAARPN
Sbjct  302   NGKG----PASPEIPKAPMGWAWSLNQFRTFRWNLTASAARPN  340



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   406 bits (1043),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 259/343 (76%), Gaps = 5/343 (1%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             +   M  V L    A   +V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN
Sbjct  2     MATMMFTVLLCLSAATMSMVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNIN  61

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              TSNNN+VVNVFN L+EP L HW+GIQ RKNSWQDG+ GT CPI PG N+TYHFQVKDQI
Sbjct  62    STSNNNIVVNVFNNLNEPFLLHWSGIQHRKNSWQDGLLGTNCPIPPGANFTYHFQVKDQI  121

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+ FY+PS ++HR+AGG+G L ++SR LIPVP+  P D++ + + DWY K H  LK+ LD
Sbjct  122   GSFFYYPSIAMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILD  181

Query  486   DGH-TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             +GH +IARP G++IN K  +     EPL T++ GKTY++RVCNVG++TS+NFRFQGH+M 
Sbjct  182   NGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMK  241

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQNDY SLD+H GQC SVLVTA+Q+PKDYY+VA++RF+KN +   G+I+Y 
Sbjct  242   LVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVIIGKGIIRYT  301

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             NGKG       P  P    G AWS+NQFR+FRWNLTASAARPN
Sbjct  302   NGKG----PASPEIPKAPMGWAWSLNQFRTFRWNLTASAARPN  340



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   406 bits (1043),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 201/336 (60%), Positives = 253/336 (75%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ L +   +V A DPY ++ W VTYG  +PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCLASTVAMVSAGDPYFYYTWNVTYGTAAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTNYTYHFQ KDQIG++FY+
Sbjct  67    VVINVFNNLDEPFLLTWSGLQHRKNSWQDGVSGTSCPIPAGTNYTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PSTSLHR AGG+G L V+SR LIPVP+  P ++  I ++DW+ K H  LK  LD G T+ 
Sbjct  127   PSTSLHRFAGGFGGLRVNSRLLIPVPYADPEEDNTILINDWFTKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G+VG K EPL T+  GKTY+FR+CNVG ++++NFR QGH M LVE+EGS
Sbjct  187   SPDGVLINGKSGKVGHKNEPLFTMNPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y        
Sbjct  247   HVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              E     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VEPSTELPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   406 bits (1043),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 206/325 (63%), Positives = 246/325 (76%), Gaps = 6/325 (2%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+AEDPYLF  W VTYG  SPLGV + VILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  24   VKAEDPYLFFTWNVTYGTASPLGVPQQVILINGQFPGPNINSTTNNNIVINVFNHLDEPF  83

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            LF WNGIQ RKNSWQDGMPGT CPI  GTNYTYHFQVKDQIG++FYFPS  +HR+AGG+G
Sbjct  84   LFTWNGIQHRKNSWQDGMPGTNCPIAAGTNYTYHFQVKDQIGSYFYFPSVGMHRAAGGFG  143

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L V+SR LIPVPFD PAD++ + + DWY K H+ L + LD G +I  P G++IN   G+
Sbjct  144  GLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGK  203

Query  429  --VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLD  256
               G    PL T+EAGKTYR+R+CNVG++ S+NFR Q H M LVE++GSH VQNDY SLD
Sbjct  204  DAAGKDDAPLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLD  263

Query  255  LHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGT  76
            +H GQC SVLVTA+Q+PKDYY+VA++RF K   +  G+I+YA           P  P G 
Sbjct  264  IHVGQCFSVLVTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS----VPPSPELPAGP  319

Query  75   EGIAWSINQFRSFRWNLTASAARPN  1
             G AWS NQ+RSFRWNLTASAARPN
Sbjct  320  VGWAWSFNQWRSFRWNLTASAARPN  344



>emb|CDY49392.1| BnaC09g53590D [Brassica napus]
Length=446

 Score =   402 bits (1033),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 201/339 (59%), Positives = 257/339 (76%), Gaps = 4/339 (1%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             +  ++    L  +  V++AEDPYLF  WKVTYG +SPLG+ +  I+IN KFPGP +N T+
Sbjct  3     RKSVILGFLLTVLTTVIKAEDPYLFFTWKVTYGTISPLGIPQKAIMINDKFPGPNLNTTT  62

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNN+V+NV N LDEP LF W+G+Q RKNSWQDGMPGTTCPI PG N+TYHFQ KDQIG++
Sbjct  63    NNNIVINVINNLDEPFLFTWSGMQHRKNSWQDGMPGTTCPIPPGKNFTYHFQAKDQIGSY  122

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             FY+PS  L R+AGG+G L ++SR LIPVP+  P D++ + + DWY K H  LK  LD G 
Sbjct  123   FYYPSLGLQRAAGGFGGLRINSRALIPVPYADPEDDYTVLIGDWYTKTHVALKDNLDSGR  182

Query  477   TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             +I RP G++IN K G+     EP+ T++ GKTY++R+CNVG++ ++NFR Q H + LVE+
Sbjct  183   SIGRPEGVLINGKAGKPDGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQNHKIKLVEL  242

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSH +QN YDSLDLH GQC  VLVTADQ+PKDYY+VA++RFLK  L++  L++Y  GKG
Sbjct  243   EGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKG  302

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             AA+ ELP PP     G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   AASPELPKPPV----GWAWSLNQFRSFRWNLTASAARPN  337



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   405 bits (1042),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 263/347 (76%), Gaps = 8/347 (2%)
 Frame = -1

Query  1041  VMEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFP  862
             +M+G    K+  VF+  + ++A +V A DPY ++ W VTYG ++PLG+ + VILING+FP
Sbjct  1     MMQGG---KLLTVFVCLVSSVA-LVNAGDPYFYYTWNVTYGTVAPLGIPQQVILINGQFP  56

Query  861   GPTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQ  682
             GP +N TSNNNVV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTNYTYHFQ
Sbjct  57    GPNLNSTSNNNVVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQ  116

Query  681   VKDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDL  502
              KDQIG++FY+PST+LHR +GG+G L V+SR LIPVP+  P D++ + ++DWY K H  L
Sbjct  117   PKDQIGSYFYYPSTALHRFSGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTAL  176

Query  501   KKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQG  322
             K  LD G T+  P+G++IN K G+VG    PL T++ GKTY++R+CNVG ++++NFR QG
Sbjct  177   KTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYRICNVGFKSTLNFRIQG  236

Query  321   HSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGL  142
             H M LVE+EGSHV+QNDYDSLD+H GQC +VLVTADQ+ K+YY+VA++RFLK ++STVG+
Sbjct  237   HKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGV  296

Query  141   IKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             + Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  297   MSYEGSN----VQASSELPKAPVGWAWSLNQFRSFRWNLTASAARPN  339



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   405 bits (1041),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 254/324 (78%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             V  EDPYLF  WKVTYG  SPLG  + VILIN +FPGP +N T+NNNVVVNVFN LDEP
Sbjct  19   AVSGEDPYLFFTWKVTYGTRSPLGKPEQVILINDEFPGPALNTTTNNNVVVNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W+GIQQRKNSWQDGMPGT CPI PGTNYTYHFQVKDQIG+  YFPST++H+SAGG+
Sbjct  79   FLVTWSGIQQRKNSWQDGMPGTQCPIPPGTNYTYHFQVKDQIGSFMYFPSTAMHKSAGGF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G + ++SR LIPVP+  P  ++ + ++DW++K H  L+  LD G T+ARP G+++N K+ 
Sbjct  139  GGIHINSRLLIPVPYADPEADYTVIINDWFSKTHSALRTMLDSGRTLARPEGVLLNGKNA  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL T++AGKTY++R+CN G++TS+NFR QGH+M LVE+EGSHVVQN YDSLD+
Sbjct  199  KGDGKDEPLFTMKAGKTYKYRICNAGLKTSLNFRIQGHTMKLVEMEGSHVVQNMYDSLDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H G C++VLVTADQDPKDYY++A++RF K   +  G+I+Y  GKG A  E+P  P     
Sbjct  259  HVGGCMAVLVTADQDPKDYYMIASTRFTKTVTTGKGIIRYEGGKGPADTEIPAAPV----  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  315  GWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   405 bits (1041),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 205/338 (61%), Positives = 257/338 (76%), Gaps = 4/338 (1%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M MV L         VQ EDPYLF  W VTYG LSPLGV + VILIN +FPGP IN TSN
Sbjct  5     MFMVLLCLSAGAMLGVQGEDPYLFFTWNVTYGTLSPLGVPQQVILINDQFPGPNINSTSN  64

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+V+NVFN +DEP L  W+GIQQRKNSWQDG+ GT CPILPGTN+TYHFQVKDQIG++ 
Sbjct  65    NNIVINVFNNIDEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYI  124

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             Y+P+T +HR+AGG+G L ++SR LIPVP+  P D++ + L+DWY K H  L+K LD G +
Sbjct  125   YYPTTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRS  184

Query  474   IARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             +ARP+G++IN K+     K EPL T++  KTY++R+CN G++ ++NFR QGH+M LVE+E
Sbjct  185   LARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEME  244

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSHVVQN Y+SLD+H GQC SVLVTA+Q PKDYY++A++RF K  L+  G+I+Y NGKG 
Sbjct  245   GSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMMASTRFNKQVLTAKGIIRYTNGKG-  303

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                   P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   ---PASPEFPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   405 bits (1041),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 239/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY F EWKVTYG  + +G A+ VILIN  FPGPTIN +SNNN++VNVFN LD+PLLF 
Sbjct  31   EDPYHFFEWKVTYGTRTIMGTAQQVILINDMFPGPTINCSSNNNILVNVFNMLDQPLLFT  90

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRKNSWQDGMPGT CPI P TN+TYH+Q KDQIG+ FY+PST + R+AG YG ++
Sbjct  91   WHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFFYYPSTGMQRAAGAYGLIS  150

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            VHSR+LIPVPFD PAD+F + + DWY K H  L K LD G  I RP GLVIN K+ E   
Sbjct  151  VHSRDLIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKN-EKDA  209

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+  +EAGKTYRFRVCNVG++ S N R Q H M LVE+EGSH +QNDYDSLDLH GQ
Sbjct  210  SNPPMYNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQ  269

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            CLS LVTADQ P DY LVA++RF+K + ST  +I+Y           P   P+G  G AW
Sbjct  270  CLSFLVTADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSA----PPPAKLPEGPSGWAW  325

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ RSFRWNLTASAARPN
Sbjct  326  SINQCRSFRWNLTASAARPN  345



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   405 bits (1041),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 239/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY F EWKVTYG  + +G A+ VILIN  FPGPTIN +SNNN++VNVFN LD+PLLF 
Sbjct  31   EDPYHFFEWKVTYGTRTIMGTAQKVILINDMFPGPTINCSSNNNILVNVFNMLDQPLLFT  90

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRKNSWQDGMPGT CPI P TN+TYH+Q KDQIG+ FY+PST + R+AG YG ++
Sbjct  91   WHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFFYYPSTGMQRAAGAYGLIS  150

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            VHSR+LIPVPFD PAD+F + + DWY K H  L K LD G  I RP GLVIN K+ E   
Sbjct  151  VHSRDLIPVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKN-EKDA  209

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+  +EAGKTYRFRVCNVG++ S N R Q H M LVE+EGSH +QNDYDSLDLH GQ
Sbjct  210  SNPPMYNVEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQ  269

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            CLS LVTADQ P DY LVA++RF+K + ST  +I+Y           P   P+G  G AW
Sbjct  270  CLSFLVTADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSA----PPPAKLPEGPSGWAW  325

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ RSFRWNLTASAARPN
Sbjct  326  SINQCRSFRWNLTASAARPN  345



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   404 bits (1039),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/347 (58%), Positives = 261/347 (75%), Gaps = 8/347 (2%)
 Frame = -1

Query  1041  VMEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFP  862
             +M+G    K+  VF+  +  +A +V A DPY ++ W VTYG ++PLG+ + VILING+FP
Sbjct  1     MMQGG---KLLTVFVCLVSTVA-LVNAGDPYFYYTWNVTYGTVAPLGIPQQVILINGQFP  56

Query  861   GPTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQ  682
             GP +N TSNNNVV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTNYTYHFQ
Sbjct  57    GPNLNSTSNNNVVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQ  116

Query  681   VKDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDL  502
              KDQIG++FY+PST+LHR +GG+G L V+SR LIPVP+  P D++ + ++DWY K H  L
Sbjct  117   PKDQIGSYFYYPSTALHRFSGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTAL  176

Query  501   KKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQG  322
             K  LD G T+  P+G++IN K G+VG    PL T++ GKTY++R+CNVG ++++NFR QG
Sbjct  177   KTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYRICNVGFKSTLNFRIQG  236

Query  321   HSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGL  142
             H M LVE+EGSHV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG+
Sbjct  237   HKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQTAKNYYMVASTRFLKKEVSTVGV  296

Query  141   IKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             + Y         +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  297   MSYEGSN----VQASSELPKAPVGWAWSLNQFRSFRWNLTASAARPN  339



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   404 bits (1039),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/339 (58%), Positives = 258/339 (76%), Gaps = 5/339 (1%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             K+  VF+  +  +A +V A DPY ++ W VTYG  SPLG+ + VILING+FPGP +N TS
Sbjct  5     KLLTVFVCLVSTVA-LVNAGDPYFYYTWNVTYGTASPLGIPQQVILINGQFPGPNLNSTS  63

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNNVV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTNYTYHFQ KDQIG++
Sbjct  64    NNNVVINVFNNLDEPFLLTWSGLQHRKNSWQDGVAGTSCPIPAGTNYTYHFQPKDQIGSY  123

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             FY+PST+LHR +GG+G L V+SR LIPVP+  P D++ + ++DWY K H  LK  LD G 
Sbjct  124   FYYPSTALHRFSGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGR  183

Query  477   TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             T+  P+G++IN K G+VG + +PL T++ GKTY++R+CNVG ++++NFR QGH M LVE+
Sbjct  184   TLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEM  243

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSHV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y     
Sbjct  244   EGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVMSYEGS--  301

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 +     P    G AWS+NQ+RSFRWNLTASAARPN
Sbjct  302   --TVQPSSELPKAPVGWAWSLNQYRSFRWNLTASAARPN  338



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   404 bits (1039),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/339 (58%), Positives = 258/339 (76%), Gaps = 5/339 (1%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             K+  VF+  +  +A +V A DPY ++ W VTYG  SPLG+ + VILING+FPGP +N TS
Sbjct  5     KLLTVFVCLVSTVA-LVNAGDPYFYYTWNVTYGTASPLGIPQQVILINGQFPGPNLNSTS  63

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNNVV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTNYTYHFQ KDQIG++
Sbjct  64    NNNVVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSY  123

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             FY+PST+LHR +GG+G L V+SR LIPVP+  P D++ + ++DWY K H  LK  LD G 
Sbjct  124   FYYPSTALHRFSGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGR  183

Query  477   TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             T+  P+G++IN K G+VG + +PL T++ GKTY++R+CNVG ++++NFR QGH M LVE+
Sbjct  184   TLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEM  243

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSHV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y     
Sbjct  244   EGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVMSYEGS--  301

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 +     P    G AWS+NQ+RSFRWNLTASAARPN
Sbjct  302   --TVQPSSELPKAPVGWAWSLNQYRSFRWNLTASAARPN  338



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   404 bits (1038),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG +SPLGV + VILING+FPGP +N TSNNNV++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTVSPLGVPQQVILINGQFPGPNVNSTSNNNVIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTN+TYHFQ KDQIG++FY+PST++HR+AGG+G L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNFTYHFQPKDQIGSYFYYPSTAMHRAAGGFGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G T+ RP+G++IN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL TL+ GKTYR R+CNVG++TS+NFR Q H + LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFTLKPGKTYRLRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   +++ADQ  KDYY+VA+SRFLK+ ++T GL++Y  GKG          P G  G AW
Sbjct  264  CYGTILSADQQAKDYYMVASSRFLKSVITTTGLLRYEGGKG----PASSQLPPGPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRS+RWNLTASAARPN
Sbjct  320  SLNQFRSYRWNLTASAARPN  339



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   404 bits (1038),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 205/338 (61%), Positives = 256/338 (76%), Gaps = 4/338 (1%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M MV L         VQ EDPYLF  W VTYG LSPLGV + VILIN +FPGP IN TSN
Sbjct  5     MFMVLLCLSAGAMLGVQGEDPYLFFTWNVTYGTLSPLGVPQQVILINDQFPGPNINSTSN  64

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+V+NVFN +DEP L  W+GIQQRKNSWQDG+ GT CPILPGTN+TYHFQVKDQIG++ 
Sbjct  65    NNIVINVFNNIDEPFLLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYI  124

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             Y+P+T +HR+AGG+G L ++SR LIPVP+  P D++ + L+DWY K H  L+K LD G +
Sbjct  125   YYPTTGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRS  184

Query  474   IARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             +ARP+G++IN K+     K EPL T++  KTY++R+CN G++ ++NFR Q H+M LVE+E
Sbjct  185   LARPDGVLINGKNAMGDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQDHTMKLVEME  244

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSHVVQN Y+SLD+H GQC SVLVTA+Q PKDYY+VA++RF K  L+  G+I+Y NGKG 
Sbjct  245   GSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-  303

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                   P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   ---PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   404 bits (1037),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 200/335 (60%), Positives = 251/335 (75%), Gaps = 4/335 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
             +  L L A A V + EDPYLF  W +TYG +SPLGV +  ILING+FPGP IN TSNNN+
Sbjct  7     ILFLCLSAWAAVARGEDPYLFFTWNITYGTVSPLGVPQQAILINGQFPGPNINSTSNNNI  66

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             V+NVFN LDEP L  WNG+QQRKNSWQDG+ GT CP+ PG NYTYHFQVKDQIG++FY+P
Sbjct  67    VINVFNHLDEPFLITWNGVQQRKNSWQDGVLGTNCPVPPGKNYTYHFQVKDQIGSYFYYP  126

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             ST++HR+AGG+G L ++SR LIPVP+  P D++ + + DWY K H  LK  LD G  + R
Sbjct  127   STAMHRAAGGFGGLRINSRLLIPVPYADPKDDYTVMIGDWYTKSHTQLKSFLDSGRALGR  186

Query  465   PNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSH  286
             P+G++IN K  +   K EPL T++ GKTY++R+CNVG++ S+NFR Q H M LVE+EGSH
Sbjct  187   PDGVLINGKSNKSRGKDEPLFTMKPGKTYKYRICNVGLKNSLNFRIQDHPMKLVEMEGSH  246

Query  285   VVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaa  106
              VQN+Y+SLD+H GQC  VLVTAD+ PKDY +VA++RF K  L+T  ++ Y NGKG    
Sbjct  247   TVQNNYESLDVHVGQCFGVLVTADKKPKDYLMVASTRFTKTVLTTTAVVSYTNGKG----  302

Query  105   elppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +  P  P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   QASPEIPKAPVGWAWSLNQFRSFRWNLTASAARPN  337



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   404 bits (1038),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 201/327 (61%), Positives = 245/327 (75%), Gaps = 9/327 (3%)
 Frame = -1

Query  963  AEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLF  784
             EDPY++  W V Y  LSPLGV + VI ING+FPGP IN TSNNN+VVNVFN LDEPLL 
Sbjct  27   CEDPYVYQTWDVKYATLSPLGVPQQVITINGQFPGPKINCTSNNNIVVNVFNNLDEPLLL  86

Query  783  HWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGAL  604
             WNG+QQRKNSWQ+G  GT CPILPGTNYTY FQVKDQIG+++Y+P+T LHR+ GGYG L
Sbjct  87   TWNGVQQRKNSWQEGTLGTNCPILPGTNYTYKFQVKDQIGSYYYYPTTPLHRAMGGYGPL  146

Query  603  TVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG---  433
             VHSR+LIPVPFD P D++++F+ DWY KGH  L+K LD G ++ RP+G++IN K     
Sbjct  147  AVHSRDLIPVPFDLPEDDYFVFVGDWYKKGHASLRKLLDGGRSLGRPDGVIINGKGSFGT  206

Query  432  --EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSL  259
              + G +  P+ T+ A KTYR+R CNVGM+ S+N R QGH+M +VE+EGSH VQN YDSL
Sbjct  207  GNKTGGEDSPMFTMIAKKTYRYRFCNVGMKDSVNVRIQGHTMKIVEIEGSHTVQNVYDSL  266

Query  258  DLHTGQCLSVLVTADQDPK-DYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPD  82
            D+H GQC SVLVTADQ P+ DYYLVA++RF K  L++  +I+Y  G         P  P 
Sbjct  267  DVHLGQCYSVLVTADQKPESDYYLVASTRFSKKALTSTAIIRYVGG---GQVPPSPELPP  323

Query  81   GTEGIAWSINQFRSFRWNLTASAARPN  1
               G+ WSINQFRSFRWNLTASAARPN
Sbjct  324  APVGLPWSINQFRSFRWNLTASAARPN  350



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   404 bits (1037),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 206/324 (64%), Positives = 249/324 (77%), Gaps = 5/324 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             V+AEDPYLF EWKVTYG  SP+GV + VILIN  FPGPTIN TSNNN+VVNVFN++D+P
Sbjct  25   AVRAEDPYLFFEWKVTYGTRSPMGVPQKVILINDMFPGPTINCTSNNNIVVNVFNQIDKP  84

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             LF W+GIQQRKNSWQDGMPGT CPI+PGTN+TY  Q KDQIGT FYFPS  + R+AGGY
Sbjct  85   FLFTWHGIQQRKNSWQDGMPGTQCPIMPGTNFTYKMQSKDQIGTFFYFPSIGMQRAAGGY  144

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G ++VHSR LIPVPFD PAD+F + + DWY K    L+K +D G +I RP GL+IN K+ 
Sbjct  145  GLMSVHSRPLIPVPFDPPADDFSVLVGDWYTKDFAVLEKHIDTGKSIGRPAGLLINGKN-  203

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            E      P+  +EAGKTYRFRVCNVG+++S+N R QGH + LVE+EGSH VQN+YDSLD+
Sbjct  204  EKDASNPPMYNVEAGKTYRFRVCNVGIKSSLNVRVQGHMIKLVEMEGSHTVQNEYDSLDV  263

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQCLS LVTA+Q P DY LVA++RF+K   +   +I+Y   KG ++    P  P+   
Sbjct  264  HVGQCLSFLVTANQKPGDYLLVASTRFIKEVSTITAIIRY---KG-SSVPASPKLPEAPN  319

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWSINQ+RSFRWNLTASAARPN
Sbjct  320  GWAWSINQWRSFRWNLTASAARPN  343



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 260/341 (76%), Gaps = 7/341 (2%)
 Frame = -1

Query  1011  GMVFLLWLF--AMAFV--VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             G++ +L+L   A AF+  V+ EDPYLF  W VTYG +SPLGV +  ILING+FPGP IN 
Sbjct  3     GVILMLFLCFSAGAFISEVRGEDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINS  62

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             T+NNN+V+NVFN LDEP L  W+GIQ RKNSWQDG+ GT CPI PG NYTYHFQVKDQIG
Sbjct  63    TTNNNIVINVFNNLDEPFLLTWSGIQHRKNSWQDGVLGTNCPIPPGKNYTYHFQVKDQIG  122

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDD  484
             ++ Y+PST++HR+AGG+G L V+SR LIPVP+  P  ++ + + DWY K H  LKK LD 
Sbjct  123   SYIYYPSTAMHRAAGGFGGLRVNSRLLIPVPYSDPEADYTVLIGDWYTKSHTMLKKFLDS  182

Query  483   GHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLV  304
             G ++ RP+G++IN K  +   K +PL T++ GKTY++R+CNVG++ S+NFR QGH M LV
Sbjct  183   GRSLGRPDGVLINGKVAKGNGKDKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHRMKLV  242

Query  303   EVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANG  124
             E+EGSH VQN Y+SLD+H GQC +VLVTADQ PKDY++VA++RF KN L+  G+I+Y NG
Sbjct  243   EMEGSHTVQNVYESLDVHVGQCFAVLVTADQGPKDYFMVASTRFTKNVLTATGIIRYTNG  302

Query  123   KGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             KG   A   P  P    G AWS+NQFR+FRWNLTASAARPN
Sbjct  303   KG---AAASPKLPPAPVGWAWSLNQFRTFRWNLTASAARPN  340



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   403 bits (1036),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 252/343 (73%), Gaps = 9/343 (3%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAF-----VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTI  850
             MG  +LL L A+        VQ+ DPYLF  W V Y  LSP+GV + VI ING+FPGP I
Sbjct  1     MGKPYLLPLIALIISPLCGFVQSGDPYLFFTWNVNYATLSPMGVPQQVITINGQFPGPWI  60

Query  849   NGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQ  670
             N TSNNN+VVNVFN LDEPLLF WNGIQQRKNSWQDG  GT CPI PGTNYTY FQVKDQ
Sbjct  61    NCTSNNNIVVNVFNNLDEPLLFTWNGIQQRKNSWQDGTLGTNCPIPPGTNYTYQFQVKDQ  120

Query  669   IGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTL  490
             IG+++YFP+T+LHR+AGGYG + VHSR LIP+PF+ P  EF + + DWY+KGH  LKK L
Sbjct  121   IGSYYYFPTTALHRAAGGYGPINVHSRNLIPIPFNSPEAEFNVLVGDWYSKGHVTLKKFL  180

Query  489   DDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             D G ++ RP+G+VIN K G    K      L  GKTYR+R+CNVGM+ S+N R QGH+M 
Sbjct  181   DSGRSLGRPDGVVINGKSGNEAPKW----NLIPGKTYRYRICNVGMKNSVNVRIQGHTMK  236

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQN YDSLD+H GQC SVLVTADQ PKDY  V ++RF K  L+T G I Y 
Sbjct  237   LVEIEGSHTVQNVYDSLDIHLGQCNSVLVTADQTPKDYAFVVSTRFTKTVLTTTGTIHYE  296

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                  A+ ELP  P +  EGIAWSINQFRS RWNLTASAARPN
Sbjct  297   GSNIPASTELPAAPGNAPEGIAWSINQFRSLRWNLTASAARPN  339



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   403 bits (1035),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 199/322 (62%), Positives = 248/322 (77%), Gaps = 4/322 (1%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            +A DPY ++ W V+YG  SPLGV + VILING+FPGP IN TSNNN+V+NVFN LDEP L
Sbjct  20   KAGDPYFYYTWNVSYGTASPLGVPQQVILINGQFPGPNINSTSNNNIVINVFNNLDEPFL  79

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
             HW+GIQ RKN WQDG+P TTCPI+PG N+TYHFQ KDQIG++FY+PSTSLHR +GG+G 
Sbjct  80   LHWSGIQHRKNCWQDGLPATTCPIMPGQNFTYHFQPKDQIGSYFYYPSTSLHRFSGGFGG  139

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            L V+SR LIPVP+  P D++ + +SDWY K H  LK  LD G  +  P+G++IN K  ++
Sbjct  140  LRVNSRLLIPVPYPDPEDDYTVLISDWYTKSHTSLKNLLDSGRALGSPDGVLINGKSAKM  199

Query  426  GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHT  247
              K +PL T++ GKTY++R+CNVG ++++NFR Q H M LVE+EGSHV+QNDYDSLD+H 
Sbjct  200  DGKDQPLFTMKLGKTYKYRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHV  259

Query  246  GQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGI  67
            GQC +VLVTADQ   DYY+VA+SRFLK QLS  GLI+Y  G+G    +  P  P    G 
Sbjct  260  GQCFAVLVTADQTATDYYMVASSRFLKKQLSGTGLIRYEGGQG----QASPVLPKAPVGW  315

Query  66   AWSINQFRSFRWNLTASAARPN  1
            AWS+NQFRSFRWNLTASAARPN
Sbjct  316  AWSLNQFRSFRWNLTASAARPN  337



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   403 bits (1035),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 251/336 (75%), Gaps = 5/336 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAF-VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
               LL L A A  VVQ EDPYLF  W VTYG +SPLGV +  ILING+FPGP IN TSNNN
Sbjct  7     ALLLCLTAGALSVVQGEDPYLFFTWNVTYGTISPLGVPQQAILINGQFPGPNINSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +V+NVFN LDEP L  W+GIQQRKNSWQDG  GT CPI PGTN+TY FQVKDQIG++ Y+
Sbjct  67    IVLNVFNNLDEPFLLTWSGIQQRKNSWQDGTLGTMCPIXPGTNFTYRFQVKDQIGSYMYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             P T++HR+AGG+G L ++SR LIPVP+  P DE+ + + DWY K H  LKK LD G T+ 
Sbjct  127   PVTAMHRAAGGFGGLRINSRLLIPVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP+ ++IN K+ +   K EPL T++ GKTY++RVCNVG + S+NFR QGH + LVE+EGS
Sbjct  187   RPDXILINGKNAKGDGKDEPLFTMKPGKTYKYRVCNVGFKNSLNFRIQGHPLKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN Y+SLD+H GQC S+LVTAD++ KDYY+VA++RF K  L+  G+I+Y N  G   
Sbjct  247   HTVQNTYESLDVHLGQCFSLLVTADKERKDYYMVASTRFTKTVLTGKGIIRYENXNG---  303

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   -PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   403 bits (1035),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 258/339 (76%), Gaps = 5/339 (1%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             K+  VF+  +  +A +V A DPY ++ W VTYG  SPLG+ + VILING+FPGP +N TS
Sbjct  5     KLLTVFVCLVSTVA-LVNAGDPYFYYTWNVTYGTASPLGIPQQVILINGQFPGPNLNSTS  63

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNNVV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTN+TYHFQ KDQIG++
Sbjct  64    NNNVVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSY  123

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             FY+PST+LHR +GG+G L V+SR LIPVP+  P D++ + ++DWY K H  LK  LD G 
Sbjct  124   FYYPSTALHRFSGGFGGLRVNSRLLIPVPYADPEDDYTVLINDWYTKSHTALKNFLDSGR  183

Query  477   TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             T+  P+G++IN K G+VG + +PL T++ GKTY++R+CNVG ++++NFR QGH M LVE+
Sbjct  184   TLGSPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEM  243

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSHV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y     
Sbjct  244   EGSHVLQNDYDSLDVHVGQCFAVLVTADQAAKNYYMVASTRFLKKEVSTVGVMSYEGSN-  302

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 +     P    G AWS+NQ+RSFRWNLTASAARPN
Sbjct  303   ---VQPSSELPKAPVGWAWSLNQYRSFRWNLTASAARPN  338



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   403 bits (1035),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 205/346 (59%), Positives = 251/346 (73%), Gaps = 10/346 (3%)
 Frame = -1

Query  1038  MEGALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPG  859
             M       +G+V LL     A  V+AEDPYLF EWKV YG  SP+GV + +ILING+FPG
Sbjct  8     MRACAAAVVGLVALL-----AVAVRAEDPYLFFEWKVAYGTKSPMGVPQKMILINGEFPG  62

Query  858   PTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQV  679
             PTIN TSNNN++VNVFN++D+PLLF W+GIQQRKNSWQDGMPG  CPI+PGTN+TY  Q 
Sbjct  63    PTINCTSNNNIIVNVFNQIDKPLLFTWHGIQQRKNSWQDGMPGDMCPIMPGTNFTYKMQF  122

Query  678   KDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLK  499
             KDQIGT FY+PS  + R+AGGYG ++VHSR LIPVPFD PAD+F   + DWY K H  L 
Sbjct  123   KDQIGTFFYYPSIGMQRAAGGYGLISVHSRPLIPVPFDPPADDFSALVGDWYTKDHEVLA  182

Query  498   KTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
             K LD G  I RP GL+IN K+ E      P+  +E GKTYRFRVCNVG++T++N R QGH
Sbjct  183   KNLDTGKGIGRPAGLLINGKN-EKDASNPPMYNVETGKTYRFRVCNVGIKTTLNVRIQGH  241

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
              + LVE+EGSH VQN+YDSLD+H GQCLS L TA+Q P DY+L+A++RF+K   +   ++
Sbjct  242   VVKLVEMEGSHTVQNEYDSLDVHIGQCLSFLTTANQKPGDYFLIASTRFIKGVNTITAVM  301

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y            P  P+   G AWSINQ+RSFRWNLTASAARPN
Sbjct  302   RYKGSNS----PPSPKLPEAPAGWAWSINQWRSFRWNLTASAARPN  343



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   402 bits (1034),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 254/323 (79%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            VQ EDPYLF  W VTYG LSPLGV + VILIN +FPGP IN TSNNN+V+NVFN +DEP 
Sbjct  4    VQGEDPYLFFTWNVTYGTLSPLGVPQQVILINDQFPGPNINSTSNNNIVINVFNNIDEPF  63

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L  W+GIQQRKNSWQDG+ GT CPILPGTN+TYHFQVKDQIG++ Y+P+T +HR+AGG+G
Sbjct  64   LLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAAGGFG  123

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L ++SR LIPVP+  P D++ + L+DWY K H  L+K LD G ++ARP+G++IN K+  
Sbjct  124  GLRINSRLLIPVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAM  183

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
               K EPL T++  KTY++R+CN G++ ++NFR QGH+M LVE+EGSHVVQN Y+SLD+H
Sbjct  184  GDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVH  243

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC SVLVTA+Q PKDYY++A++RF K  L+ +G+I+Y NGKG       P  P+   G
Sbjct  244  VGQCFSVLVTANQAPKDYYMMASTRFNKQVLTYMGIIRYTNGKG----PASPEFPEAPVG  299

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFRSFRWNLTASAARPN
Sbjct  300  WAWSLNQFRSFRWNLTASAARPN  322



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   402 bits (1034),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 197/336 (59%), Positives = 257/336 (76%), Gaps = 5/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +   + L ++A +V A DPY ++ W VTYG ++PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVFVCLVSVA-LVNAGDPYFYYTWNVTYGTVAPLGIPQQVILINGQFPGPNLNSTSNNN  65

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTNYTYHFQ KDQIG++FY+
Sbjct  66    VVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYY  125

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PST+LHR +GG+G L V+SR LIPVP+  P D+  I ++DWY K H  LK  LD G T+ 
Sbjct  126   PSTALHRFSGGFGGLRVNSRLLIPVPYADPEDDHTILINDWYTKSHTALKNFLDSGRTLG  185

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G+VG + +PL T++ GKTY++R+CNVG ++++NFR QGH M LVE+EGS
Sbjct  186   SPDGVLINGKSGKVGGQDKPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGS  245

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ+ K+YY+VA++RFLK ++STVG++ Y        
Sbjct  246   HVLQNDYDSLDVHVGQCFAVLVTADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSN----  301

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  302   VQPSNVLPKAPVGWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_004296148.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   402 bits (1032),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 249/324 (77%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   DP +F EW V++G LSPLG  + VILING+FPGP IN T+NNNVVVNVFN LDEP
Sbjct  19   VVHCGDPTIFFEWNVSHGTLSPLGSPQQVILINGQFPGPNINSTTNNNVVVNVFNNLDEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W+GIQQRKNSWQDG  GT CPI  GTN+TYHFQVKDQIG+  Y+P+T++HR+ G +
Sbjct  79   FLLTWSGIQQRKNSWQDGTLGTMCPIPAGTNFTYHFQVKDQIGSFIYYPTTAMHRAGGAF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+D P +++ + + DWY K H  LK+ LD G T+ARP+G++IN K  
Sbjct  139  GGLRVNSRPLIPVPYDTPEEDYTVLIGDWYKKSHIALKQQLDSGRTLARPDGVLINGKDA  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL T++AGKTY+FR+CN+G+++S+NFR Q H M+LVE+EGSH VQN Y SLD+
Sbjct  199  KGDGKDEPLFTMKAGKTYKFRICNIGVKSSLNFRIQEHWMMLVEMEGSHTVQNTYQSLDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC++VLVTADQ PKDYY+VA++RF K  L+  G+++Y NGKG          P+  E
Sbjct  259  HLGQCMAVLVTADQTPKDYYMVASTRFTKTVLTGKGILRYENGKG----PADSELPEAPE  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNL++SAARPN
Sbjct  315  GWAWSLNQFRSFRWNLSSSAARPN  338



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   402 bits (1034),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/336 (58%), Positives = 246/336 (73%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L  L     +V  EDPY +  W VTYG LSP GV + VILIN +FPGP IN TSNNN
Sbjct  7     LFMLCLLIGTTSMVMGEDPYFYFTWHVTYGTLSPAGVPQQVILINNEFPGPNINSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFNELDEPLLF W G+QQRKN WQDG+PGT CPI PGTNYTY FQVKDQIG++FY+
Sbjct  67    LVVNVFNELDEPLLFTWAGVQQRKNCWQDGVPGTNCPIAPGTNYTYRFQVKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PS  +HR+AGG+G L ++SR LIPVP+  P D++ + + DW+ K H  L K LD G  + 
Sbjct  127   PSLGMHRAAGGFGGLRINSRLLIPVPYADPEDDYTVLIGDWFTKSHSTLSKLLDSGRALG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             RP  +++N ++ +     +PL T++ GKTY++R+CNVG++ S+NF  Q H M LVE EGS
Sbjct  187   RPQAVLVNGQNAKGDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFGIQNHPMKLVEFEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H VQN YDSLD+H GQC  VLVTAD++PKDYY+VA++RF K  ++  G+++YANGKG   
Sbjct  247   HTVQNSYDSLDVHVGQCFGVLVTADKEPKDYYMVASTRFTKTVITGKGIMRYANGKG---  303

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  304   -PASPELPEAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   402 bits (1032),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 250/320 (78%), Gaps = 4/320 (1%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG +SPLGV + VILING+FPGP IN TSNNN+++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTVSPLGVPQQVILINGQFPGPNINSTSNNNIIINVFNNLDEPFLIT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKN WQDG PGT CPI+PGTN+TY FQ KDQIG++FY+PST+LHRSAGG+G L 
Sbjct  84   WNGIQHRKNCWQDGTPGTMCPIMPGTNFTYKFQPKDQIGSYFYYPSTALHRSAGGFGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G T+ RP+G++IN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDG  203

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               PL  L+ GKTYR R+CNVG++TS+NFR Q H + LVE+EGSHV+QNDYDSLD+H GQ
Sbjct  204  SDAPLFNLKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQ  263

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C   ++TA+Q+ KDYY+VA+SRFLK+ ++T GL++Y  GKG A+++LP     G  G AW
Sbjct  264  CYGTILTANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKGPASSQLPA----GPVGWAW  319

Query  60   SINQFRSFRWNLTASAARPN  1
            S+NQFRSFRWNLTASAARPN
Sbjct  320  SLNQFRSFRWNLTASAARPN  339



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   402 bits (1032),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 202/326 (62%), Positives = 236/326 (72%), Gaps = 6/326 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             VQAEDPYLF EW VTYG +SPLGV + VILIN +FPGP IN TSNNN++VNVFN LDEP
Sbjct  17   TVQAEDPYLFFEWNVTYGTISPLGVPQQVILINNQFPGPEINCTSNNNIIVNVFNNLDEP  76

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKNSW DGMPGT CPI+PG N+TYHFQ KDQIG+ FYFPS  + ++AGG 
Sbjct  77   FLLSWNGIQHRKNSWMDGMPGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSIGMQKAAGGM  136

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G + VHSR LIPVP+  PADEF I   DWY K H+ L   LD G +I RP G++IN KHG
Sbjct  137  GMIRVHSRLLIPVPYADPADEFNILAGDWYTKSHKVLAGRLDSGRSIGRPAGVLINGKHG  196

Query  432  E--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSL  259
            +   G    P+ T+EAGKTYRFRVCN+G++ S+NFR Q HS+ LVE+EGSHVVQN YDSL
Sbjct  197  KDASGKDEPPMFTMEAGKTYRFRVCNIGIKDSLNFRIQKHSLRLVEMEGSHVVQNTYDSL  256

Query  258  DLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDG  79
            DLH GQC SV VTADQ P DYY++ ++RF K       +++YA              P  
Sbjct  257  DLHIGQCFSVFVTADQQPGDYYILMSTRFTKYSCGGSAIVRYAGSNA----PPSKDLPPA  312

Query  78   TEGIAWSINQFRSFRWNLTASAARPN  1
              G AWS NQ+RSFRWNLTASAARPN
Sbjct  313  PSGWAWSFNQWRSFRWNLTASAARPN  338



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   400 bits (1029),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 252/336 (75%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ L +   +V A DPY ++ W VTYG ++PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCLASTVAMVNAGDPYFYYTWNVTYGTVAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W G+Q RKNSWQDG+ GT+CPI  GTN+TYHFQ KDQIG++FY+
Sbjct  67    VVINVFNNLDEPFLLTWIGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PST+LHR AGG+G L V+SR LIPVP+  P D+  I ++DWY K H  LK  LD G T+ 
Sbjct  127   PSTALHRFAGGFGGLRVNSRLLIPVPYADPEDDRTILINDWYTKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G++G    PL T++ GKTY++R+CNVG ++++NFR QGH M LVE+EGS
Sbjct  187   SPDGVLINGKSGKIGGNNAPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y        
Sbjct  247   HVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VQASNEIPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   400 bits (1028),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 252/336 (75%), Gaps = 4/336 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  L+ L +   +V A DPY ++ W VTYG  +PLG+ + VILING+FPGP +N TSNNN
Sbjct  7     LTVLVCLASTVALVSAGDPYFYYTWNVTYGTAAPLGIPQQVILINGQFPGPNLNSTSNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             VV+NVFN LDEP L  W+G+Q RKNSWQDG+ GT+CPI  GTN+TYHFQ KDQIG++FY+
Sbjct  67    VVINVFNNLDEPFLLTWSGLQHRKNSWQDGVTGTSCPIPAGTNFTYHFQPKDQIGSYFYY  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PST+LHR AGG+G L V+SR LIPVP+  P D+  I ++DWY K H  LK  LD G T+ 
Sbjct  127   PSTALHRFAGGFGGLRVNSRLLIPVPYADPEDDRTILINDWYAKSHTALKNFLDSGRTLG  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN K G++G    PL T++ GKTY++R+CNVG ++++NFR QGH M LVE+EGS
Sbjct  187   SPDGVLINGKSGKLGGNNAPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGS  246

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             HV+QNDYDSLD+H GQC +VLVTADQ  K+YY+VA++RFLK ++STVG++ Y        
Sbjct  247   HVLQNDYDSLDVHVGQCFAVLVTADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN----  302

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              +     P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   VQASSDIPKAPVGWAWSLNQFRSFRWNLTASAARPN  338



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   400 bits (1028),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 199/328 (61%), Positives = 253/328 (77%), Gaps = 4/328 (1%)
 Frame = -1

Query  984  AMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNE  805
             +  V++AEDPY F+ WKVTYG LSPLGV + VILIN KFPGP +N T+NNN+V+NV N 
Sbjct  19   VLTTVIKAEDPYFFYTWKVTYGTLSPLGVPQKVILINDKFPGPNLNTTTNNNIVINVINN  78

Query  804  LDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRS  625
            LDEP L  W+G+Q RKNSWQDGMPGTTCPI PG N+TYHFQ KDQIG++FY+PS  L R+
Sbjct  79   LDEPFLLTWSGMQHRKNSWQDGMPGTTCPIPPGQNFTYHFQPKDQIGSYFYYPSLGLQRA  138

Query  624  AGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVIN  445
            AGG+G L V+SR LIP+P+  P D++ + + DWY K H  LK  LD G +I RP G++IN
Sbjct  139  AGGFGGLRVNSRPLIPIPYADPEDDYTVLIGDWYTKTHVTLKNNLDSGRSIGRPAGVLIN  198

Query  444  AKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYD  265
             K G+     EP+ T++ GKTYR+R+CNVGM+ ++NFR Q H + LVE+EGSH +QN YD
Sbjct  199  GKSGKPDGTGEPIFTMKPGKTYRYRICNVGMKMALNFRIQNHKIKLVELEGSHTLQNLYD  258

Query  264  SLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppP  85
            SLDLH GQC  VLVTADQ+PKDYY+VA++RFLK+ L++  +++Y  GKGAA+ +LP  P 
Sbjct  259  SLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKSVLTSTAILRYEGGKGAASPQLPKSPV  318

Query  84   DGTEGIAWSINQFRSFRWNLTASAARPN  1
                G AWS+NQFRSFRWNLT++AARPN
Sbjct  319  ----GWAWSLNQFRSFRWNLTSNAARPN  342



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 200/339 (59%), Positives = 256/339 (76%), Gaps = 4/339 (1%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             +  ++    L  +  V++AEDPYLF  WKVTYG +SP G+ +  I+IN KFPGP +N T+
Sbjct  3     RKSVILGFLLTVLTTVIKAEDPYLFFTWKVTYGTISPFGIPQKAIMINDKFPGPNLNTTT  62

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNN+V+NV N LDEP LF W+G+Q RKNSWQDGMPGTTCPI PG N+TYHFQ KDQIG++
Sbjct  63    NNNIVINVINNLDEPFLFTWSGMQHRKNSWQDGMPGTTCPIPPGKNFTYHFQAKDQIGSY  122

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             FY+PS  L R+AGG+G L ++SR LIPVP+  P D++ + + DWY K H  LK  LD G 
Sbjct  123   FYYPSLGLQRAAGGFGGLRINSRALIPVPYPDPEDDYTVLIGDWYTKTHVALKDNLDSGR  182

Query  477   TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             +I RP G++IN K G+     EP+ T++ GKTY++R+CNVG++ ++NFR Q H + LVE+
Sbjct  183   SIGRPEGVLINGKAGKPDGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQNHKIKLVEL  242

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSH +QN YDSLDLH GQC  VLVTADQ+PKDYY+VA++RFLK  L++  L++Y  GKG
Sbjct  243   EGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKG  302

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             AA+ ELP PP     G AWS+NQFRSFRWNLTASAARPN
Sbjct  303   AASPELPKPPV----GWAWSLNQFRSFRWNLTASAARPN  337



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   399 bits (1025),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 209/338 (62%), Positives = 248/338 (73%), Gaps = 8/338 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +VFL  L   A  V AEDPYLF  W VTYG +SPLGV + VILING+FPGP IN T+NNN
Sbjct  9     LVFLCLLGPAA--VHAEDPYLFFTWNVTYGTVSPLGVPQQVILINGQFPGPNINSTTNNN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFN LDEP L  WNGIQQRKNSW DGMPGT CPI PG N+TYHFQVKDQIG+ FYF
Sbjct  67    IVVNVFNNLDEPFLLTWNGIQQRKNSWMDGMPGTNCPIPPGKNFTYHFQVKDQIGSFFYF  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PS  +HR+AG +G L V+SR LIPVPF  P D++ + + DWY K H+ L   LD GH I 
Sbjct  127   PSMGMHRAAGAFGGLRVNSRLLIPVPFADPTDDYTVLIGDWYAKSHKALAAILDAGHGIG  186

Query  468   RPNGLVINAKHGE--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
              P G++IN + G+   G    PL T+EAGKTYR+R+CNVGM+ S+NFR Q H M LVE++
Sbjct  187   NPAGVLINGRTGKDASGKDDTPLFTMEAGKTYRYRICNVGMKVSLNFRMQNHRMKLVEMD  246

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSH VQNDY+SLD+H GQCLSVLVTA+Q+PKDYY+VA++RF K   +  G+I+YA     
Sbjct  247   GSHTVQNDYESLDVHVGQCLSVLVTANQEPKDYYMVASTRFTKYMRTATGVIRYAGSS--  304

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                   P  P    G AWS NQ+RSFRWNLTASAARPN
Sbjct  305   --VPPSPELPAAPVGWAWSFNQWRSFRWNLTASAARPN  340



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   399 bits (1024),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 248/337 (74%), Gaps = 8/337 (2%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             G +  L +  MA  V++EDPY+++ WKVTYG ++PLG  +  ILING+FPGP INGTSNN
Sbjct  4     GAIIALMVCLMATAVRSEDPYVYYTWKVTYGNIAPLGTPQKGILINGQFPGPEINGTSNN  63

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             N+VVNVFN LDEPLLF W+GIQQRKNSW DG  G  CPI PGTNYTY FQVKDQIG++FY
Sbjct  64    NIVVNVFNNLDEPLLFTWSGIQQRKNSWADGTSGVQCPIAPGTNYTYKFQVKDQIGSYFY  123

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +P+T L R+AGG G + V+SR LIPVP+  PADE+++ + DWY K H  L+K LD G ++
Sbjct  124   YPTTGLMRAAGGIGGIRVYSRLLIPVPYADPADEYWVLMGDWYGKSHTQLQKFLDSGRSM  183

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP+G+ I  K     +  EPL  +E GKTY++R+CNVG++ S+NFR Q H M LVE+EG
Sbjct  184   GRPDGVHIMGK----SNSAEPLYKMEPGKTYKYRLCNVGLKDSLNFRIQDHPMKLVEMEG  239

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SH VQN YDSLD+H GQC SVLVTAD++PK Y +VA++RF K  L+T  +I Y NG G  
Sbjct  240   SHTVQNVYDSLDVHVGQCFSVLVTADKEPKQYKMVASTRFTKTVLTTTAVISYTNGNG--  297

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                  P  P    G AWS+NQ RSFRWNLTASAARPN
Sbjct  298   --PASPVLPPAPVGWAWSLNQVRSFRWNLTASAARPN  332



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   398 bits (1023),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 258/335 (77%), Gaps = 5/335 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
             VF LW+ ++  +VQ  DP +  EWKVTYG +SPLGV    ILING+FPGP IN T+NNNV
Sbjct  9     VFFLWVGSL-LMVQGGDPTISFEWKVTYGTISPLGVPVKGILINGQFPGPNINSTTNNNV  67

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             +VNVFN LDEP L  W+G+Q RKN WQDG+ GT CPI PGTNYTY FQVKDQIG++ Y+P
Sbjct  68    IVNVFNNLDEPFLLTWSGVQHRKNPWQDGVLGTNCPIPPGTNYTYKFQVKDQIGSYMYYP  127

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
              T +H++ GG+G L ++SR LIPVP+  PAD++ I   D++NKGH  LKK L+ G  + R
Sbjct  128   VTGMHKAVGGFGGLRINSRLLIPVPYADPADDYTIIAGDFFNKGHTTLKKILESGRNLGR  187

Query  465   PNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSH  286
              +G+ IN K  +     EPL T+EAGKTY++R+CN G++TS+N RFQGH+M LVE+EGSH
Sbjct  188   CDGVHINGKVAKGDGSDEPLFTMEAGKTYKYRICNAGLKTSLNVRFQGHNMKLVEMEGSH  247

Query  285   VVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaa  106
              VQNDY+SLD+H GQC SVLVTADQ+P DY++VA++RF K +++  G+I+Y NGKGA + 
Sbjct  248   TVQNDYESLDVHVGQCFSVLVTADQEPMDYFVVASTRFTKQEVTATGVIRYTNGKGAPSP  307

Query  105   elppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +LPPPP     G AWS+NQFR+FRWNLTASAARPN
Sbjct  308   KLPPPPV----GWAWSLNQFRTFRWNLTASAARPN  338



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   397 bits (1021),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 250/324 (77%), Gaps = 3/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            + +AEDPYLF  W VTYG +SPLGV +  ILING+FPGP IN T+NNN+V+NVFN +DEP
Sbjct  1    MARAEDPYLFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNIVLNVFNNIDEP  60

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
            +LF W GIQQRKNSWQDG+ GT CPILPGTN+TY FQVKDQIG++FY+P+T++HR+AGG+
Sbjct  61   ILFTWLGIQQRKNSWQDGVLGTNCPILPGTNFTYRFQVKDQIGSYFYYPTTAIHRAAGGF  120

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVP+  P D++ I + DWY + H  L+K LD G ++ RP+G++IN K  
Sbjct  121  GGLRVNSRLLIPVPYADPEDDYTILIGDWYTESHSTLRKFLDIGRSLGRPDGVLINGKSA  180

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +     EPL T++ GK Y++R+CNVG++ S+NFR QGH + LVE+EGSH VQN Y+SLD+
Sbjct  181  KSDGSDEPLFTMKPGKIYKYRICNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDV  240

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC +VLVTAD+ PKDY +VA++RF KN L+  G+I+Y N K    A   P   +   
Sbjct  241  HVGQCFAVLVTADKAPKDYLVVASTRFTKNVLTGKGIIRYTNAK---PAPPSPDVVEAPV  297

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLT+SAARPN
Sbjct  298  GWAWSLNQFRSFRWNLTSSAARPN  321



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   397 bits (1021),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 241/323 (75%), Gaps = 7/323 (2%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V AEDPYLF  W VTYG +SPLGV +  ILING+FPGP IN T+NNN+V+NVFN LDEP 
Sbjct  18   VGAEDPYLFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTNNNIVLNVFNNLDEPF  77

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L  WNGIQQRKNSWQ+GMPGT CPI PG N+TYHFQVKDQIG+ FYFPS  +HR+AG +G
Sbjct  78   LLTWNGIQQRKNSWQEGMPGTNCPIPPGKNFTYHFQVKDQIGSFFYFPSMGMHRAAGAFG  137

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L ++SR LIPVPF  PAD++ + +SDWY K H+ L   LD G +I  P G++IN   G 
Sbjct  138  GLRINSRLLIPVPFADPADDYTVLISDWYTKSHKALAGLLDAGRSIGNPAGVLIN---GL  194

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
             G    PL T+EAGKTYR+R+CNVG++ S+NFR Q H M LVE++GSH VQNDY+SLD+H
Sbjct  195  TGKDNAPLFTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYESLDVH  254

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQCLSVLVTA+Q+ KDYY+VA++RF K  LS  G+I+YA           P  P    G
Sbjct  255  VGQCLSVLVTANQEAKDYYMVASTRFTKYSLSATGIIRYAGS----VVPPSPELPKAPVG  310

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS NQ+RS RWNLTASAARPN
Sbjct  311  WAWSFNQWRSLRWNLTASAARPN  333



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   402 bits (1034),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 249/324 (77%), Gaps = 4/324 (1%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV   DP +F  W VTYG LSPLGV + VILING+FPGP IN T+NNNV+VNVFN L+EP
Sbjct  19   VVYCGDPTIFFTWNVTYGTLSPLGVPQQVILINGQFPGPNINSTTNNNVIVNVFNTLEEP  78

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  W G+QQRKN WQDG+ GT CPI PGTNYTY FQVKDQIG+  Y+P+T++HR+AG +
Sbjct  79   FLITWVGVQQRKNPWQDGVLGTMCPIPPGTNYTYKFQVKDQIGSFMYYPATAMHRAAGAF  138

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L ++SR LIPVP+  P D++ + + DWY K H  L+K LD G ++ARP+G++IN K  
Sbjct  139  GGLRINSRNLIPVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLINGKSA  198

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +   K EPL T++AGKTY++R+CNVG++ S+NFR QGH M LVE+EGSH VQN YDSLD+
Sbjct  199  KGDGKDEPLFTMKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDV  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC S+LVTAD++PKDYY+VA++RF K+ L+  G+I+Y NGKG     + P  P    
Sbjct  259  HIGQCFSMLVTADKEPKDYYMVASTRFTKSVLTGKGIIRYENGKG----PVSPEVPKAPV  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQFRSFRWNLTASAARPN
Sbjct  315  GWAWSLNQFRSFRWNLTASAARPN  338



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/326 (60%), Positives = 245/326 (75%), Gaps = 6/326 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             V+AEDPYL+  W V+YG +SPLGV +  ILING+FPGP IN T+NNN+V+NV+N LDEP
Sbjct  17   AVRAEDPYLYFTWNVSYGTISPLGVPQQGILINGEFPGPNINSTTNNNIVINVYNNLDEP  76

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             LF WNGIQQRKNSWQDG  G+ CPILPG N+TYHFQVKDQIG+  YFP+  + R+ GG+
Sbjct  77   FLFTWNGIQQRKNSWQDGTAGSNCPILPGKNFTYHFQVKDQIGSFVYFPTLGMQRAVGGF  136

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVPFD PAD++ + + DWY K H+ L+K LD G  + RP GL+IN   G
Sbjct  137  GGLRVNSRLLIPVPFDDPADDYTVLIGDWYTKSHKILEKILDAGRAVGRPAGLLINGHSG  196

Query  432  E--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSL  259
            +   G    PL T+EA KTYR+R+CN+GM+ ++NFR Q HSM LVE++GSH VQN+YDSL
Sbjct  197  KNGAGKDEPPLFTMEAKKTYRYRICNIGMKVTLNFRIQSHSMTLVEMDGSHTVQNNYDSL  256

Query  258  DLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDG  79
            D+H GQCLSVLVTA+Q P+DYY+VA+SRF K  L+  G+++YA  +           P+ 
Sbjct  257  DIHVGQCLSVLVTANQSPRDYYMVASSRFTKYMLTVTGIVRYAGSQ----TPPSQDLPEA  312

Query  78   TEGIAWSINQFRSFRWNLTASAARPN  1
              G AWS NQ+RSFRWNLTASAARPN
Sbjct  313  PAGWAWSFNQWRSFRWNLTASAARPN  338



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 238/324 (73%), Gaps = 6/324 (2%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            QAEDPY F EW VTYG +SPLGV + VILIN +FPGP IN TSNNN++VNVFN+LDEP L
Sbjct  19   QAEDPYHFFEWHVTYGTISPLGVPQQVILINNQFPGPEINCTSNNNIIVNVFNKLDEPFL  78

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
              WNGIQ RKNSW DGMPGT CPI+PG N+TYHFQ KDQIG+ FYFPS  + +++GG G 
Sbjct  79   LSWNGIQHRKNSWMDGMPGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSIGMQKASGGMGM  138

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE-  430
            + VHSR LIPVP+  PADEF I   +WY K H+ L + LD G  I RP G++IN KHG+ 
Sbjct  139  IRVHSRLLIPVPYTDPADEFNILAGEWYTKSHKVLARFLDSGRGIGRPAGVLINGKHGKD  198

Query  429  -VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
              G    P+ T+EAGKTYRFRVCN+G++ S+NFR Q H++ LVE+EGSHVVQN YDSLDL
Sbjct  199  ASGKDEPPMFTVEAGKTYRFRVCNIGIKNSLNFRIQKHALRLVEMEGSHVVQNMYDSLDL  258

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC SV VTADQ P DYY++A++RF K +     +I+YA              P G  
Sbjct  259  HIGQCFSVFVTADQQPGDYYILASTRFTKYKCDGSAIIRYAGSN----TPPSKDLPPGPS  314

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS NQ+RSFRWNLTASAARPN
Sbjct  315  GWAWSFNQWRSFRWNLTASAARPN  338



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 199/340 (59%), Positives = 250/340 (74%), Gaps = 7/340 (2%)
 Frame = -1

Query  1011  GMVFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             G VF+     +    V+AEDPYLF  W VTYG ++PLGV +  ILING+FPGP IN T+N
Sbjct  3     GAVFIALCLVLGLSGVRAEDPYLFFTWNVTYGTIAPLGVPQQGILINGQFPGPNINSTTN  62

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+V+NVFN LD+P L  WNGIQQRKNSWQDG+ GT CPI PG N+TYHFQVKDQIG+ F
Sbjct  63    NNIVINVFNNLDQPFLLSWNGIQQRKNSWQDGLAGTNCPIQPGKNFTYHFQVKDQIGSFF  122

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             YFPS  +H++AGG+G L ++SR LIPVPFD PAD++ + + DWY K H+ L   LD G +
Sbjct  123   YFPSLGMHKAAGGFGGLRINSRLLIPVPFDPPADDYTVLIGDWYAKDHKALAGILDAGRS  182

Query  474   IARPNGLVINAKHGE--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVE  301
             I  P+G++IN K G+   G   +PL  +E+GK YR+R+CN G+R S+NFR QGHSM LVE
Sbjct  183   IGLPDGVIINGKTGKDRTGKDGKPLFVMESGKVYRYRICNTGIRASLNFRIQGHSMELVE  242

Query  300   VEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             ++GSH +QN YDSLD+H GQC SVLVTA+Q P DYYLVA++RF+K +L+  G+++YA  K
Sbjct  243   IDGSHTMQNLYDSLDVHVGQCYSVLVTANQAPGDYYLVASTRFMKKELTATGIVRYAGSK  302

Query  120   GaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                        P    G AWS NQ+RSFRWNLTASAARPN
Sbjct  303   ----VPPSAVLPKAPTGWAWSFNQWRSFRWNLTASAARPN  338



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   395 bits (1016),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/323 (60%), Positives = 247/323 (76%), Gaps = 6/323 (2%)
 Frame = -1

Query  963  AEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLF  784
            AEDPYLF  W VTYG ++PLGV +  ILING+FPGP IN T+NNN+V+NVFN LDEP LF
Sbjct  22   AEDPYLFFTWNVTYGTIAPLGVPQKGILINGQFPGPNINSTTNNNIVINVFNNLDEPFLF  81

Query  783  HWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGAL  604
             WNGIQQRKNSWQDG+PGT CPI PG N+TYHFQVKDQIG+ +YFPS ++H++ GG+G L
Sbjct  82   SWNGIQQRKNSWQDGVPGTNCPIQPGKNFTYHFQVKDQIGSFYYFPSLAMHKAVGGFGGL  141

Query  603  TVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVG  424
             ++SR LIPVPFD PAD++ + + DWY K H+ L KTLD G +I  P+G++IN K G+ G
Sbjct  142  RINSRLLIPVPFDPPADDYTVLVGDWYAKDHKALAKTLDMGRSIGLPSGVLINGKSGKHG  201

Query  423  DKME--PLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
               +  PL  +EAGK YR+R+CN G++ S+NFR QGH+M LVE++GSH +QN YDSLD+H
Sbjct  202  SGKDDKPLFVMEAGKVYRYRICNTGIKASINFRIQGHTMELVEMDGSHTMQNMYDSLDIH  261

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC SVLVTAD+ PKDYYLVA++RFL+ +++   +++YA              P G  G
Sbjct  262  VGQCFSVLVTADRAPKDYYLVASTRFLRKEITATAVVRYAGSN----TPPSAVLPKGPTG  317

Query  69   IAWSINQFRSFRWNLTASAARPN  1
              WS+NQ+RSFRWNLTASAARPN
Sbjct  318  WGWSLNQWRSFRWNLTASAARPN  340



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   394 bits (1012),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 232/294 (79%), Gaps = 0/294 (0%)
 Frame = -1

Query  999  LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvv  820
            LL LF+    V  EDPYLF +W VTYG +SPLGV + VILING+FPGP IN TSNNN+VV
Sbjct  8    LLLLFSCLVKVHGEDPYLFFDWNVTYGTISPLGVPQQVILINGQFPGPKINCTSNNNIVV  67

Query  819  nVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPST  640
            NVFN+LDEP L  WNGIQQRKNSWQ+G  GT CPILPG N+TYHFQVKDQIG+++Y+P+T
Sbjct  68   NVFNQLDEPFLLTWNGIQQRKNSWQEGTLGTNCPILPGKNFTYHFQVKDQIGSYYYYPTT  127

Query  639  SLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPN  460
            +LHR+ GGYG +++HSR LIPVPFD P +EF +F+SDWY K H+ L+  LD+G +I RP 
Sbjct  128  ALHRATGGYGPISIHSRLLIPVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPE  187

Query  459  GLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVV  280
            G++IN K+G+   K EP+ ++ +GKTYR+R CNVGM+ S+N RFQGH+M LVE+EGSH V
Sbjct  188  GIIINGKNGKGDGKDEPMFSMVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTV  247

Query  279  QNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
            QN Y+SLD+H GQCLSVLVTADQ+PKDY+LVA+SRF K        I+Y N   
Sbjct  248  QNMYESLDIHLGQCLSVLVTADQEPKDYFLVASSRFTKEPHIATATIRYTNASA  301



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   395 bits (1015),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 239/322 (74%), Gaps = 5/322 (2%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            +AEDPY F EWKVTYG  + +G  + VILIN  FPGPTIN TSNNN++VNVFN LD+PLL
Sbjct  27   RAEDPYHFFEWKVTYGTRNIMGTPQKVILINDMFPGPTINCTSNNNIIVNVFNMLDQPLL  86

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
            FHW+GIQQRKNSWQDG+PGT CPI P TN+TYH+Q KDQIG+ +YFPS  + R+AGGYG 
Sbjct  87   FHWHGIQQRKNSWQDGLPGTMCPIQPNTNFTYHWQPKDQIGSFYYFPSIGMQRAAGGYGL  146

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            +TVHSR+LIPVPFD PAD+F + +SDWY K H  L K LD G  I RP GLVIN K+ E 
Sbjct  147  ITVHSRDLIPVPFDTPADDFPVLVSDWYTKDHTVLAKNLDSGKGIGRPAGLVINGKN-EK  205

Query  426  GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHT  247
                 P+  +EAGKTYRFRVCN+G++ S N R Q H + LVE+EGSH VQN YDSLDLH 
Sbjct  206  DASNPPMYNMEAGKTYRFRVCNLGIKASFNVRIQKHILKLVEMEGSHTVQNTYDSLDLHI  265

Query  246  GQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGI  67
            GQCLS LVTADQ P DY LVA++RF+K   +   +I+Y           P   P+   G 
Sbjct  266  GQCLSFLVTADQAPGDYLLVASTRFIKEVSTITAVIRYKGSN----TPPPSQLPEAPSGW  321

Query  66   AWSINQFRSFRWNLTASAARPN  1
            AWSINQ+RSFRWNLTASAARPN
Sbjct  322  AWSINQWRSFRWNLTASAARPN  343



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 205/338 (61%), Positives = 248/338 (73%), Gaps = 8/338 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +VF+ +L   A  V AEDPY++  WKVTYG +SPLG+ +  ILING+FPGP IN T+NNN
Sbjct  17    LVFIAFLGLTA--VGAEDPYIYFTWKVTYGTISPLGIPQQAILINGEFPGPNINSTTNNN  74

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             +VVNVFN LDEP LF WNGIQQRKNSWQ+G  G+ CPI PG NYTYHFQVKDQIG+  YF
Sbjct  75    IVVNVFNNLDEPFLFTWNGIQQRKNSWQEGTAGSNCPIPPGQNYTYHFQVKDQIGSFVYF  134

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PS  +HR+AGG+G L V+SR LIPVPF  PAD++ + + DWY K H+ L K LD G TI 
Sbjct  135   PSLGMHRAAGGFGGLRVNSRLLIPVPFADPADDYTVLIGDWYTKSHKILAKLLDSGRTIG  194

Query  468   RPNGLVINAKHGE--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             RP G++IN + G+   G    PL T+EAGKTYR+R+CNVGM+ ++NFR Q HSM LVE++
Sbjct  195   RPAGVLINGRSGKDSTGKDDPPLFTMEAGKTYRYRICNVGMKVTLNFRIQSHSMKLVEMD  254

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSH +QN Y+SLD+H GQCLS LV A Q PKDYY+VA+SRF K  L+  GLI+YA     
Sbjct  255   GSHTMQNVYESLDIHVGQCLSALVEATQAPKDYYMVASSRFTKYTLTASGLIRYAGSN--  312

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                      P    G AWS NQ+RSFRWNLTASAARPN
Sbjct  313   --TPPSQDLPAAPVGWAWSFNQWRSFRWNLTASAARPN  348



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   393 bits (1009),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 244/322 (76%), Gaps = 5/322 (2%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            +AEDPY F EWKVTYG  + +G  + VILIN  FPGPTIN TSNNN+V+NVFN LD+PLL
Sbjct  20   RAEDPYHFFEWKVTYGTKNIMGTPQKVILINDMFPGPTINCTSNNNIVINVFNMLDQPLL  79

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
            F W+GIQQRKNSWQDGMPGT CPI PGTN+TYH+Q KDQIG+ FYFPS ++ RSAGGYG 
Sbjct  80   FTWHGIQQRKNSWQDGMPGTMCPIKPGTNFTYHWQPKDQIGSFFYFPSIAMQRSAGGYGL  139

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            ++VHSR+LIPV FD PAD+F + + DWY K H  L K LD G  I RP GL+IN K+ + 
Sbjct  140  ISVHSRDLIPVLFDAPADDFPVLVGDWYTKDHTVLAKHLDAGKGIGRPAGLIINGKNDKD  199

Query  426  GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHT  247
                 P+   EAGKTYRFRVCNVG++ S+N R  GH++ LVE+EGSH VQN YDSLD+H 
Sbjct  200  AAS-APMYNFEAGKTYRFRVCNVGIKASLNVRVPGHNLKLVEMEGSHTVQNMYDSLDVHV  258

Query  246  GQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGI  67
            GQCLS LVTADQ P DY+LV ++RF+K   +   LI+Y   KG ++    P  P+G  G 
Sbjct  259  GQCLSFLVTADQKPADYFLVVSTRFIKEVSTITALIRY---KG-SSTPPSPKLPEGPSGW  314

Query  66   AWSINQFRSFRWNLTASAARPN  1
            AWSINQ+RSFRWNLTASAARPN
Sbjct  315  AWSINQWRSFRWNLTASAARPN  336



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   393 bits (1009),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 251/321 (78%), Gaps = 5/321 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY  H W VTYG  SPLGV + VILING+FPGP IN TSNNN+++NVFN LDEP L  
Sbjct  24   EDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNIIINVFNNLDEPFLLT  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKNSWQDG  GT CPI PG+N+TYHFQ KDQIG++FY+P+T++HR+AGG+G L 
Sbjct  84   WNGIQHRKNSWQDGTAGTMCPIPPGSNFTYHFQPKDQIGSYFYYPTTAMHRAAGGFGGLR  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            V+SR LIPVP+  P D++ + + DWY K H  LKK LD G ++ RP+G++IN K G+   
Sbjct  144  VNSRLLIPVPYADPEDDYTVLIGDWYAKSHTALKKFLDSGRSLGRPDGILINGKSGKGSS  203

Query  420  KME-PLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTG  244
              + PL T++ GKTYR R+CNVG++TS+NFR Q H M LVE+EGSHV+QNDYDSLD+H G
Sbjct  204  GSDAPLFTMKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVG  263

Query  243  QCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIA  64
            QC   +VTADQDPKDY +VA+SRFLK+ +ST G+++Y  GKG A++E+P  P     G A
Sbjct  264  QCYGTIVTADQDPKDYLMVASSRFLKSVISTTGVLRYDGGKGPASSEIPAAPV----GWA  319

Query  63   WSINQFRSFRWNLTASAARPN  1
            WS+NQFRSFRWNLTASAARPN
Sbjct  320  WSLNQFRSFRWNLTASAARPN  340



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   392 bits (1007),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 241/324 (74%), Gaps = 6/324 (2%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+AE+PY +  W +TYG +SPLGV +  ILIN +FPGP IN T+N+N+VVNVFN LD+P 
Sbjct  17   VEAENPYRYFNWNITYGTISPLGVPQKAILINNEFPGPNINSTTNDNIVVNVFNNLDQPF  76

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L  WNGIQQRKNSWQDGMPGT CPI PG N+TYHFQVKDQIG++FYFPS  +H++AG +G
Sbjct  77   LLSWNGIQQRKNSWQDGMPGTNCPIPPGQNFTYHFQVKDQIGSYFYFPSMYMHKAAGAFG  136

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L ++SR  IPVPFD PAD++ + + DWY   H  L++ LD G +I +P+G++IN  + +
Sbjct  137  GLRINSRLYIPVPFDDPADDYTVLIGDWYASDHNTLRRRLDSGRSIGQPDGVLINGMN-K  195

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 +PL  +E GKTYR+R+CNVG++TS+NFR QGH++ LVE+EGSH VQN Y+SLD+H
Sbjct  196  PNKANKPLFNMEPGKTYRYRICNVGLKTSLNFRIQGHTLKLVEIEGSHTVQNIYESLDVH  255

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTV-GLIKYANGKGaaaaelppppPDGTE  73
             GQC SVLVTA++ P+DYY+VA++RF      T   LI Y   K       P   P    
Sbjct  256  VGQCYSVLVTANKVPRDYYIVASTRFTNKYTHTATALIHYTGSK----KPAPLMLPPAPT  311

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G+AWS+NQFRSFRWNLTASAARPN
Sbjct  312  GVAWSLNQFRSFRWNLTASAARPN  335



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 247/343 (72%), Gaps = 5/343 (1%)
 Frame = -1

Query  1023  TNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             T ++    LL + A+A + +AEDPYLF EWKVTYG  S LGV + VILING+FPGP IN 
Sbjct  5     TMRVAAGVLLVVSALATLARAEDPYLFFEWKVTYGTRSLLGVPQKVILINGEFPGPRINC  64

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             +SNNN+VVNVFN+LD PLLF WNG+Q RKNSW DGMPGT CPI P TN+TY +Q KDQIG
Sbjct  65    SSNNNIVVNVFNQLDHPLLFTWNGMQHRKNSWMDGMPGTQCPIAPNTNFTYKWQPKDQIG  124

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADE--FYIFLSDWYNKGHRDLKKTL  490
             + FYFPS  + R+AGGYGA++V SR LIPVPFD P  E    + + DWY K H  L + L
Sbjct  125   SFFYFPSIGMQRAAGGYGAISVVSRLLIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQL  184

Query  489   DDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             D G ++ RP G++IN K G+  +   P+ T EAGKTYR RVCN G++ S+NFR QGH M 
Sbjct  185   DAGKSVGRPAGVLINGKGGKDLEAAAPMLTFEAGKTYRLRVCNTGIKASLNFRIQGHDMK  244

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH +Q+ YDSLD+H G CLSVLV ADQ P DYY+VA++RF+ +  S   +I+YA
Sbjct  245   LVELEGSHTLQDVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRFIHDAKSASAVIRYA  304

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                G   A   P   +   G AWSINQ RSFRWNLTASAARPN
Sbjct  305   GSSG---APPAPNMTEPPAGWAWSINQARSFRWNLTASAARPN  344



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   392 bits (1006),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 262/335 (78%), Gaps = 5/335 (1%)
 Frame = -1

Query  1005  VFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
             V  LW  +M  +VQ  DP LF EW VTYG ++PLGV    ILING+FPGP IN T+NNN+
Sbjct  9     VLFLWAGSM-LMVQGGDPTLFFEWNVTYGTIAPLGVPVKGILINGQFPGPNINSTTNNNI  67

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             VVNVFN LDEP L  WNG+Q RKNSWQDG+ GT CPI PG NYTY FQVKDQIG++ Y+P
Sbjct  68    VVNVFNNLDEPFLVTWNGVQHRKNSWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYIYYP  127

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
              T++H++ GG+G L V+SR LIPVP+  PAD++ + + D++NKGH  LKK LD G  + R
Sbjct  128   VTAMHKAVGGFGGLRVNSRLLIPVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGR  187

Query  465   PNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSH  286
              +G+ +N K  +   K EPL T+EAGKTY++R+CN G++TS+N RFQGH+M LVE+EGSH
Sbjct  188   CDGVHLNGKVAKGDRKDEPLFTMEAGKTYKYRICNTGIKTSLNVRFQGHTMKLVEMEGSH  247

Query  285   VVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaa  106
              +QNDYDSLD+H GQC SVLVTA+Q+P+DYY+VA++RF + +++  G+I+Y NGKGAA++
Sbjct  248   TMQNDYDSLDVHVGQCFSVLVTANQEPRDYYVVASTRFTRREVTATGIIRYKNGKGAASS  307

Query  105   elppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             ELPPPP     G AWS+NQFR+FRWNLT++AARPN
Sbjct  308   ELPPPPV----GWAWSLNQFRTFRWNLTSNAARPN  338



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 241/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY F +WKVTYG  + + VA+ V+LIN  FPGPTIN +SNNN+VVNVFN+LD PLLF+
Sbjct  24   EDPYHFFDWKVTYGTRTIMDVAQKVMLINDMFPGPTINCSSNNNIVVNVFNQLDHPLLFN  83

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRKNSW DGMPGT CPI PGTN+TY +Q KDQIGT FYFPS  + R+AGGYG +T
Sbjct  84   WHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQRAAGGYGIIT  143

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            VHSR LIPVPFD PA ++ + + DWY K H  L K LD G +I RP GLVIN K+ E   
Sbjct  144  VHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKN-EKDA  202

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+ T+EAGK YRFRVCNVG++TS+N R QGHS+ LVE+EGSH VQN YDSLD+H  Q
Sbjct  203  SNPPMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQ  262

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C+S LVTADQ P DY LVA++RFLK   +   +++Y NG         P  P+G  G AW
Sbjct  263  CVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRY-NGSN---TPASPKLPEGPSGWAW  318

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ+RSFRWNLTASAARPN
Sbjct  319  SINQWRSFRWNLTASAARPN  338



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 240/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY F EWKVTYG  + LG A+ VILIN  FPGPTIN +SNNN+VVNVFN+LD+PLLF 
Sbjct  27   EDPYHFFEWKVTYGTKTILGEAQKVILINDMFPGPTINCSSNNNIVVNVFNQLDQPLLFT  86

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRKNSWQDGMPGT CPI PGTN+TYH+Q KDQIG+ FYFPS  + R+AGGYG +T
Sbjct  87   WHGIQQRKNSWQDGMPGTMCPIQPGTNFTYHWQPKDQIGSFFYFPSIGMQRAAGGYGIIT  146

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            VHSR LIPVPFD PA ++ + + DWY K H  L K L+ G +I RP GLVIN K+ E   
Sbjct  147  VHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLEAGKSIGRPAGLVINGKN-EKDA  205

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+ T+EAGK YR+RVCNVG++TS+N R Q H + LVE+EGSH VQN YDSLD+H  Q
Sbjct  206  SNPPMYTMEAGKVYRYRVCNVGIKTSLNVRIQSHIIKLVEMEGSHTVQNTYDSLDVHVAQ  265

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C+S LV ADQ P DY LVA++RF+K   S   +I+Y NG         P  P+G  G AW
Sbjct  266  CVSFLVAADQKPGDYLLVASTRFMKETSSITAIIRY-NGSN---TPASPKLPEGPSGWAW  321

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ+RSFRWNLTASAARPN
Sbjct  322  SINQWRSFRWNLTASAARPN  341



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   392 bits (1006),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/343 (59%), Positives = 247/343 (72%), Gaps = 5/343 (1%)
 Frame = -1

Query  1023  TNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTING  844
             T ++    LL + A+A + +AEDPYLF EWKVTYG  S LGV + VILING+FPGP IN 
Sbjct  5     TMRVAAGVLLVVSALATLARAEDPYLFFEWKVTYGTRSLLGVPQKVILINGEFPGPRINC  64

Query  843   TSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIG  664
             +SNNN+VVNVFN+LD PLLF WNG+Q RKNSW DGMPGT CPI P TN+TY +Q KDQIG
Sbjct  65    SSNNNIVVNVFNQLDHPLLFTWNGMQHRKNSWMDGMPGTQCPIAPNTNFTYKWQPKDQIG  124

Query  663   THFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADE--FYIFLSDWYNKGHRDLKKTL  490
             + FYFPS  + R+AGGYGA++V SR LIPVPFD P  E    + + DWY K H  L + L
Sbjct  125   SFFYFPSIGMQRAAGGYGAISVVSRLLIPVPFDQPPPESDHAVLIGDWYTKDHEVLARQL  184

Query  489   DDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             D G ++ RP G++IN K G+  +   P+ T EAGKTYR RVCN G++ S+NFR QGH M 
Sbjct  185   DAGKSVGRPAGVLINGKGGKDLEAAAPMLTFEAGKTYRLRVCNTGIKASLNFRIQGHYMK  244

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH +Q+ YDSLD+H G CLSVLV ADQ P DYY+VA++RF+ +  S   +I+YA
Sbjct  245   LVELEGSHTLQDVYDSLDVHVGHCLSVLVDADQAPGDYYMVASTRFIHDAKSASAVIRYA  304

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                G   A   P   +   G AWSINQ RSFRWNLTASAARPN
Sbjct  305   GSSG---APPAPNMTEPPAGWAWSINQARSFRWNLTASAARPN  344



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   391 bits (1005),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 241/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY F +WKVTYG  + + VA+ V+LIN  FPGPTIN +SNNN+VVNVFN+LD PLLF+
Sbjct  21   EDPYHFFDWKVTYGTRTIMDVAQKVMLINDMFPGPTINCSSNNNIVVNVFNQLDHPLLFN  80

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRKNSW DGMPGT CPI PGTN+TY +Q KDQIGT FYFPS  + R+AGGYG +T
Sbjct  81   WHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQRAAGGYGIIT  140

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            VHSR LIPVPFD PA ++ + + DWY K H  L K LD G +I RP GLVIN K+ E   
Sbjct  141  VHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKN-EKDA  199

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+ T+EAGK YRFRVCNVG++TS+N R QGHS+ LVE+EGSH VQN YDSLD+H  Q
Sbjct  200  SNPPMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQ  259

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C+S LVTADQ P DY LVA++RFLK   +   +++Y NG         P  P+G  G AW
Sbjct  260  CVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRY-NGSN---TPASPKLPEGPSGWAW  315

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ+RSFRWNLTASAARPN
Sbjct  316  SINQWRSFRWNLTASAARPN  335



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 238/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPYLF +WKV YG  SP+G  + +ILING+FPGPTIN TSNNN++VNVFN+LD+PLLF 
Sbjct  53   EDPYLFFDWKVAYGTKSPMGTPQKMILINGEFPGPTINCTSNNNIIVNVFNQLDQPLLFT  112

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRK+SWQDGMPG  CPILPGTN+TY  Q KDQIGT FY+PS  + R+AG YG ++
Sbjct  113  WHGIQQRKSSWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQRAAGAYGLIS  172

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            +HSR LIPVPFD PAD+F   + DWY K H  L K LD G  I RP GL+IN K+ E   
Sbjct  173  IHSRPLIPVPFDPPADDFGALVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKN-EKDA  231

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+  +EAGKTYRFRVCNVG++T++N R QGH + LVE+EGSH VQN+YDS+D+H GQ
Sbjct  232  SNPPMYNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQ  291

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            CLS L TA+Q P DY+ +A++RF+K   +   +I+Y               PD  +G AW
Sbjct  292  CLSFLTTANQKPGDYFFIASTRFIKGVSTITAVIRYKGSN----TPPAAKLPDAPDGWAW  347

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ+RSFRWNLTASAARPN
Sbjct  348  SINQWRSFRWNLTASAARPN  367



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   390 bits (1002),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 236/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY F EWKVTYG  + +G  + VILIN   PGPTIN TSNNN+V+NVFN LD+PLLF 
Sbjct  30   EDPYHFFEWKVTYGTKTIMGTPQKVILINDMLPGPTINCTSNNNIVINVFNMLDQPLLFT  89

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRKNSWQDGMPGT CPI P TN+TYH+Q KDQIG+  Y+PST + R+AG YG ++
Sbjct  90   WHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFVYYPSTGMQRAAGAYGLIS  149

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            VHSR+LIPVPFD PAD+F + + DWY K H  L K LD G  I RP+GLVIN K+ E   
Sbjct  150  VHSRDLIPVPFDRPADDFPVLVGDWYTKDHAVLAKNLDAGKGIGRPSGLVINGKN-EKDA  208

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+  +EAGKTYRFR+CNVGM+ S+N   Q H M LVE+EGSH +QNDYDSLD+H GQ
Sbjct  209  ANPPMYNVEAGKTYRFRICNVGMKASINIGIQNHIMKLVEMEGSHTMQNDYDSLDIHVGQ  268

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            CLSVLVTADQ P DY LVA++RF+K   +T  +I+Y           P   P+   G AW
Sbjct  269  CLSVLVTADQKPGDYLLVASTRFIKEVSTTTAVIRYKGASA----PPPAKLPESPSGWAW  324

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ RSFRWNLTASAARPN
Sbjct  325  SINQARSFRWNLTASAARPN  344



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   390 bits (1002),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 254/338 (75%), Gaps = 7/338 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQ--AEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             ++F+ WL  ++ VVQ  AEDPYLF  W VTYG +SPLGV +  ILING+FPGP IN T+N
Sbjct  4     VIFVTWLVLLSAVVQLRAEDPYLFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTTN  63

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+V+NV N LDEP L  W G+Q RKNSWQDG+ GT CPI PG N+TYHFQVKDQIG++ 
Sbjct  64    NNIVLNVLNNLDEPFLLTWTGVQHRKNSWQDGVVGTNCPIPPGKNFTYHFQVKDQIGSYI  123

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             Y+P+T++HR+AG +G L V+SR LIPVP+  P D++ + + DWY K H+ LK  LD G +
Sbjct  124   YYPTTAVHRAAGAFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYVKSHKTLKNFLDSGRS  183

Query  474   IARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             + RP+G++IN   G+ G+  +PL T++ GKTY++R+CNVG++ S+NFR Q H M LVE+E
Sbjct  184   LGRPDGVLIN---GKSGNDKKPLFTMKPGKTYKYRICNVGLKDSLNFRIQDHPMKLVEME  240

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGa  115
             GSH VQN Y+SLD+H GQC SVLVTAD+ PK+YY+VA++RF K  L+   +I+Y NG+  
Sbjct  241   GSHTVQNTYESLDVHVGQCFSVLVTADKAPKEYYMVASTRFTKTVLTGKAIIRYTNGR--  298

Query  114   aaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
               +      P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  299   KGSASLKNIPEAPVGWAWSLNQFRSFRWNLTASAARPN  336



>gb|EEC71702.1| hypothetical protein OsI_04207 [Oryza sativa Indica Group]
Length=565

 Score =   390 bits (1003),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 241/320 (75%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY F +WKVTYG  + + VA+ V+LIN  FPGPTIN +SNNN+VVNVFN+LD PLLF+
Sbjct  21   EDPYHFFDWKVTYGTRTIMDVAQKVMLINDMFPGPTINCSSNNNIVVNVFNQLDHPLLFN  80

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRKNSW DGMPGT CPI PGTN+TY +Q KDQIGT FYFPS  + R+AGGYG +T
Sbjct  81   WHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQRAAGGYGIIT  140

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            VHSR LIPVPFD PA ++ + + DWY K H  L K LD G +I RP GLVIN K+ E   
Sbjct  141  VHSRLLIPVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKN-EKDA  199

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+ T+EAGK YRFRVCNVG++TS+N R QGHS+ LVE+EGSH VQN YDSLD+H  Q
Sbjct  200  SNPPMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQ  259

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            C+S LVTADQ P DY LVA++RFLK   +   +++Y NG         P  P+G  G AW
Sbjct  260  CVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRY-NGSN---TPASPKLPEGPSGWAW  315

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ+RSFRWNLTASAARPN
Sbjct  316  SINQWRSFRWNLTASAARPN  335



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   390 bits (1001),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 202/326 (62%), Positives = 237/326 (73%), Gaps = 6/326 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            +VQAEDPYLF  W VTYG +SPLGV + VILIN +FPGP IN TSNNN+++NVFN+LDEP
Sbjct  17   MVQAEDPYLFFTWNVTYGTISPLGVPQQVILINNQFPGPEINCTSNNNIIINVFNKLDEP  76

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNGIQ RKNSW DGM GT CPI+PG N+TYHFQ KDQIG+ FYFPS S+H+ AGG 
Sbjct  77   FLLSWNGIQHRKNSWMDGMTGTNCPIMPGKNWTYHFQPKDQIGSFFYFPSISMHKVAGGI  136

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L VHSR LIPVP+  PADEF +   DWY K H+ L + LD G  I RP G++IN KHG
Sbjct  137  GMLRVHSRLLIPVPYADPADEFNVLAGDWYTKSHKVLARLLDRGRGIGRPAGVLINGKHG  196

Query  432  E--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSL  259
            +   G    P+ T+EAGKTYR+RVCNVG++TS+N R Q H + LVE+EGSH +QN YDSL
Sbjct  197  KDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLNLRIQKHKLRLVEMEGSHTIQNVYDSL  256

Query  258  DLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDG  79
            DLHTGQC SV VTADQ P DYY+V ++RF K       +I+YA           P  P  
Sbjct  257  DLHTGQCFSVFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN----MPPSPDLPPS  312

Query  78   TEGIAWSINQFRSFRWNLTASAARPN  1
              G AWS NQ+RSFRWNLTASAARPN
Sbjct  313  PSGWAWSFNQWRSFRWNLTASAARPN  338



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   390 bits (1002),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 192/320 (60%), Positives = 238/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPYLF +WKV YG  SP+G  + +ILING+FPGPTIN TSNNN++VNVFN++D+PLLF 
Sbjct  28   EDPYLFFDWKVAYGTKSPMGTPQKMILINGEFPGPTINCTSNNNIIVNVFNQIDQPLLFT  87

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRK SWQDGMPG  CPILPGTN+TY  Q KDQIGT FY+PS  + R+AG YG ++
Sbjct  88   WHGIQQRKASWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQRAAGAYGLIS  147

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            +HSR LIPVPFD PAD+F + + DWY K H  L K LD G  I RP GL+IN K+ E   
Sbjct  148  IHSRPLIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKN-EKDA  206

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+  +EAGKTYRFRVCNVG++T++N R QGH + LVE+EGSH VQN+YDS+D+H GQ
Sbjct  207  SNPPMFNVEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQ  266

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            CLS L TA+Q P DY+ +A++RF+K   +   +++Y               PD  +G AW
Sbjct  267  CLSFLSTANQKPGDYFFIASTRFIKGVSTITAVMRYKGSN----TPPAAKLPDAPDGWAW  322

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ+RSFRWNLTASAARPN
Sbjct  323  SINQWRSFRWNLTASAARPN  342



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/326 (60%), Positives = 240/326 (74%), Gaps = 6/326 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             VQAEDPYLF  W +TYG +SPLGV + VILIN +FPGP IN TSNNN+++NVFN+LDEP
Sbjct  17   TVQAEDPYLFFTWTITYGTISPLGVPQQVILINNQFPGPEINCTSNNNIIINVFNKLDEP  76

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
            +LF WNGIQ RKNSW DG PGT CPI+PGTN+TYHFQ KDQIG++FYFPS  + ++AGG 
Sbjct  77   ILFSWNGIQHRKNSWMDGTPGTNCPIMPGTNWTYHFQPKDQIGSYFYFPSIGMQKAAGGI  136

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L VHSR LIPVP+  PA+EF +   DWY K H+ L + LD G  + RP G++IN KHG
Sbjct  137  GMLRVHSRLLIPVPYADPAEEFNVLAGDWYTKSHKVLARLLDSGRGVGRPAGVLINGKHG  196

Query  432  E--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSL  259
            +   G    P+ T+EAGKTYR+RVCNVG++TS++FR Q H++ LVE+EGSH +QN YDSL
Sbjct  197  KDASGKDEPPMFTMEAGKTYRYRVCNVGIKTSLSFRIQKHALRLVEMEGSHTIQNVYDSL  256

Query  258  DLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDG  79
            D+H GQC SV VTADQ P DYY+V ++RF K       +I+YA           P  P  
Sbjct  257  DIHIGQCFSVFVTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN----TPPSPDLPPA  312

Query  78   TEGIAWSINQFRSFRWNLTASAARPN  1
              G AWS NQ+RSFRWNLTASAARPN
Sbjct  313  PSGWAWSFNQWRSFRWNLTASAARPN  338



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   389 bits (1000),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/346 (55%), Positives = 254/346 (73%), Gaps = 15/346 (4%)
 Frame = -1

Query  1008  MVFLLWLFAMAF--VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M+ L+   A A   +V+A  P  F  W VTYG +SPLG+ +  ILING+FPGP IN T+N
Sbjct  7     MMLLICFLAAATSGLVEAGSPTFFFTWNVTYGTISPLGIPQQGILINGQFPGPNINSTTN  66

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             +N+V+NVFN+LDEP L  W GIQ +KNSWQDG+ GT CPI PG NYTY+ QVKDQIG++ 
Sbjct  67    DNLVINVFNKLDEPFLLTWPGIQHKKNSWQDGVLGTNCPIPPGKNYTYYLQVKDQIGSYI  126

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFD-WPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             Y PST  HR+AGG+G L +HSR ++PVP++ +  D+F + + DWY + H +L K LD G 
Sbjct  127   YHPSTGFHRAAGGFGGLCIHSRSVVPVPYNRFVEDDFTLLIGDWYTRSHVELGKQLDSGK  186

Query  477   TIARPNGLVINAKHGEV-------GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGH  319
              + +P+G++IN K G +       GD  EPL T++AGK Y++R+CNVG++TS+NFR QGH
Sbjct  187   LLGKPDGVLINGKSGRLDYDSDGKGDN-EPLFTMKAGKVYKYRICNVGVKTSLNFRIQGH  245

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
             +M LVE+EGSHVVQN+Y+SLD+H GQC +VLVTA+QDPKDYYL+A++RF +  ++T  ++
Sbjct  246   TMKLVEMEGSHVVQNEYESLDVHVGQCFTVLVTANQDPKDYYLIASTRFTRTVITTTAIV  305

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +Y++ KG       P  P    G  WS+NQFRSFRWNLTASAARPN
Sbjct  306   RYSDSKG----LASPDLPKAPVGWDWSLNQFRSFRWNLTASAARPN  347



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 244/321 (76%), Gaps = 8/321 (2%)
 Frame = -1

Query  963  AEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLF  784
            AE+PY +  WKVTYG +SPLGV ++VI+IN +FPGP IN T+N+N+VVNVFN+LDEP L 
Sbjct  21   AENPYRYFTWKVTYGTVSPLGVPQEVIMINDQFPGPNINSTTNDNIVVNVFNQLDEPFLI  80

Query  783  HWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGAL  604
             WNG+QQRKNSWQDGMPGT CPI PG NYTY FQVKDQIGT+FYF STS H++AGG+G L
Sbjct  81   SWNGVQQRKNSWQDGMPGTNCPIPPGGNYTYQFQVKDQIGTYFYFLSTSFHKAAGGFGGL  140

Query  603  TVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVG  424
             V+SR  IPVPFD PA+++ + + DWY K H++L+K LDD  ++ +P G++IN + G+  
Sbjct  141  RVNSRMYIPVPFDPPAEDYTLLIGDWYTKSHKELRKRLDDSKSLGKPCGVLINGRTGKNA  200

Query  423  DKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTG  244
            + +    T+E GKTYR R+ NVG++TS+NFR +GH+++LVE+EGSH VQN Y+SLD+H G
Sbjct  201  ETL----TVEPGKTYRIRISNVGIKTSLNFRIEGHALLLVEIEGSHTVQNVYESLDVHVG  256

Query  243  QCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIA  64
            Q  SVLVTA+Q  KDY +VA++RF K  L+   ++ Y+         +      G  G+A
Sbjct  257  QSYSVLVTANQAVKDYQIVASTRFTKYILTGTAVLHYSGA----TEGVSDAALSGPTGVA  312

Query  63   WSINQFRSFRWNLTASAARPN  1
            +S+NQFRSFRWNLTASAARPN
Sbjct  313  FSLNQFRSFRWNLTASAARPN  333



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   388 bits (997),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 237/320 (74%), Gaps = 5/320 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPYLF +WKV YG  SP+G  + +ILING+FPGPTIN TSNNN++VNVFN++D+PLLF 
Sbjct  28   EDPYLFFDWKVAYGTKSPMGTPQKMILINGEFPGPTINCTSNNNIIVNVFNQIDQPLLFT  87

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+GIQQRK SWQDGMPG  CPILPGTN+TY  Q KDQIGT FY+PS  + R+AG YG ++
Sbjct  88   WHGIQQRKASWQDGMPGDMCPILPGTNFTYKMQFKDQIGTFFYYPSIGMQRAAGAYGLIS  147

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGD  421
            +HSR LIPVPFD PAD+F + + DWY K H  L K LD G  I RP GL+IN K+ E   
Sbjct  148  IHSRPLIPVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKN-EKDA  206

Query  420  KMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQ  241
               P+  +E GKTYRFRVCNVG++T++N R QGH + LVE+EGSH VQN+YDS+D+H GQ
Sbjct  207  SNPPMFNVEEGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQ  266

Query  240  CLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIAW  61
            CLS L TA+Q P DY+ +A++RF+K   +   +++Y               PD  +G AW
Sbjct  267  CLSFLSTANQKPGDYFFIASTRFIKGVSTITAVMRYKGSN----TPPAAKLPDAPDGWAW  322

Query  60   SINQFRSFRWNLTASAARPN  1
            SINQ+RSFRWNLTASAARPN
Sbjct  323  SINQWRSFRWNLTASAARPN  342



>gb|EEE64155.1| hypothetical protein OsJ_18987 [Oryza sativa Japonica Group]
Length=513

 Score =   386 bits (991),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 237/322 (74%), Gaps = 5/322 (2%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            + EDPY+F EWKVTYG  + L   + VILING+FPGP IN +SNNN+VVNVFN+LDEPLL
Sbjct  26   RGEDPYVFFEWKVTYGTKTLLDAPQKVILINGEFPGPRINCSSNNNIVVNVFNQLDEPLL  85

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
            F WNG+Q RKNSWQDG+ GT CPI PGTNYTY +Q KDQIG+ FYFPS  +HR+AGGYG 
Sbjct  86   FTWNGMQHRKNSWQDGLAGTQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHRAAGGYGG  145

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            ++V SR LIPVPFD PAD+  + + DWY K H  + K LD G +  RP+G+VIN K G+ 
Sbjct  146  ISVVSRLLIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKA  205

Query  426  GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHT  247
                 P+ T+EAGKTYR RVCNVG++ S+NFR QGH M LVE+EGSH VQ+ YDSLD+H 
Sbjct  206  AAD-PPMFTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHV  264

Query  246  GQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGI  67
            G CLSVLV ADQ P DYY VA++RF+    S   +I+YA           P  P+   G 
Sbjct  265  GHCLSVLVDADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS----TPPSPAVPEPPAGW  320

Query  66   AWSINQFRSFRWNLTASAARPN  1
            AWSINQ+RSFRWNLTASAARPN
Sbjct  321  AWSINQWRSFRWNLTASAARPN  342



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/322 (62%), Positives = 234/322 (73%), Gaps = 5/322 (2%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            +AEDPY F EWKVTYG  + +G  + VILIN  FPGPTIN TSNNN+V+NVFN LD+PLL
Sbjct  27   RAEDPYHFFEWKVTYGTKTIMGTPQKVILINDMFPGPTINCTSNNNIVINVFNMLDQPLL  86

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
            F W+GIQQRKNSWQDGM GT CPI P TN+TYH+Q KDQIG+ FY+PST + R+AG YG 
Sbjct  87   FTWHGIQQRKNSWQDGMLGTMCPIQPNTNFTYHWQPKDQIGSFFYYPSTGMQRAAGAYGL  146

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            ++VHSR+LIPVPFD PAD+F + + DWY K H  L K LD G  I RP GLVIN K+ E 
Sbjct  147  ISVHSRDLIPVPFDTPADDFPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVINGKN-EK  205

Query  426  GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHT  247
                 P+  +EAGKTYRFRVCNVG++ S N R Q H M LVE+EGSH +QNDYDSLDLH 
Sbjct  206  DASNPPMYNVEAGKTYRFRVCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDYDSLDLHI  265

Query  246  GQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGI  67
            GQCLS LVTADQ P DY L  ++RF+K   S   +I+Y           P   P+   G 
Sbjct  266  GQCLSFLVTADQKPGDYLLAVSTRFIKEVNSITAVIRYKGSNA----PPPAKVPESPSGW  321

Query  66   AWSINQFRSFRWNLTASAARPN  1
            AWSINQ RSFRWNLTASAARPN
Sbjct  322  AWSINQCRSFRWNLTASAARPN  343



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 250/337 (74%), Gaps = 5/337 (1%)
 Frame = -1

Query  1008  MVFLLWLFAMAFV-VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnn  832
             ++ LL LFA A   V+ EDPY F  W VTYG LSP GV + VILIN +FPGP IN TSNN
Sbjct  7     LLMLLCLFAGAMSPVKGEDPYFFFTWNVTYGTLSPAGVPQQVILINNEFPGPNINSTSNN  66

Query  831   nvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFY  652
             N+VVNVFN LDEPLLFHW G+QQRKNSW+DG+ GT CPI PGTNYTYHFQVKDQIG+ FY
Sbjct  67    NIVVNVFNNLDEPLLFHWAGVQQRKNSWEDGVAGTNCPIQPGTNYTYHFQVKDQIGSFFY  126

Query  651   FPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTI  472
             +PS  L R+AGG+G L ++SR LIPVP+  P D++ +   DW+ K H  L+K LD G ++
Sbjct  127   YPSLGLQRAAGGFGGLRINSRLLIPVPYADPEDDYTVLAGDWFTKSHSTLRKLLDGGRSL  186

Query  471   ARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEG  292
              RP  +++N ++ +     +PL T+  GKTY++R+CNVG++ ++NFR Q H M LVE+EG
Sbjct  187   GRPQAVLLNGQNAKGDGTDKPLFTMIPGKTYKYRICNVGLKNTINFRIQNHPMKLVEMEG  246

Query  291   SHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaa  112
             SH VQN Y+SLD+H GQC  VLVTA+Q+PKDYY+VA++RF K+ L+  G+++Y  GK   
Sbjct  247   SHTVQNTYNSLDVHLGQCFGVLVTANQEPKDYYMVASTRFTKSILTGKGIMRYTTGKA--  304

Query  111   aaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                  P  P+   G AWS+NQFRSFRWNLTASAARPN
Sbjct  305   --PPSPEIPEAPVGWAWSLNQFRSFRWNLTASAARPN  339



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   386 bits (991),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 237/322 (74%), Gaps = 5/322 (2%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            + EDPY+F EWKVTYG  + L   + VILING+FPGP IN +SNNN+VVNVFN+LDEPLL
Sbjct  26   RGEDPYVFFEWKVTYGTKTLLDAPQKVILINGEFPGPRINCSSNNNIVVNVFNQLDEPLL  85

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
            F WNG+Q RKNSWQDG+ GT CPI PGTNYTY +Q KDQIG+ FYFPS  +HR+AGGYG 
Sbjct  86   FTWNGMQHRKNSWQDGLAGTQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHRAAGGYGG  145

Query  606  LTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            ++V SR LIPVPFD PAD+  + + DWY K H  + K LD G +  RP+G+VIN K G+ 
Sbjct  146  ISVVSRLLIPVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKA  205

Query  426  GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHT  247
                 P+ T+EAGKTYR RVCNVG++ S+NFR QGH M LVE+EGSH VQ+ YDSLD+H 
Sbjct  206  AAD-PPMFTVEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHV  264

Query  246  GQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGI  67
            G CLSVLV ADQ P DYY VA++RF+    S   +I+YA           P  P+   G 
Sbjct  265  GHCLSVLVDADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS----TPPSPAVPEPPAGW  320

Query  66   AWSINQFRSFRWNLTASAARPN  1
            AWSINQ+RSFRWNLTASAARPN
Sbjct  321  AWSINQWRSFRWNLTASAARPN  342



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 234/325 (72%), Gaps = 6/325 (2%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+AEDPYLF  W VTYG ++P G  + VILIN +FPGP IN TSNNN+V+NVFN LDEP 
Sbjct  19   VRAEDPYLFFTWNVTYGTIAPFGTPQQVILINNQFPGPEINCTSNNNIVINVFNNLDEPF  78

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L  WNGIQ RKNSW DG PGT CPILPG N+TYHFQ KDQIG+ FY PS  + ++AGG+G
Sbjct  79   LLTWNGIQHRKNSWMDGAPGTNCPILPGQNFTYHFQPKDQIGSFFYIPSLGMQKAAGGFG  138

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L VHSR LIPVPFD PA+EF +   DW+ K H+ L   LD G ++  P G++IN + G+
Sbjct  139  MLRVHSRLLIPVPFDPPAEEFNVLAGDWFTKSHKVLAGQLDAGRSVGHPAGVLINGRRGK  198

Query  429  --VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLD  256
               G    P+ T++AG  YRFR CNVG++TS+NFR Q H + LVE+EGSH VQN Y SLD
Sbjct  199  DAAGHDEPPMFTMQAGDVYRFRFCNVGLKTSLNFRIQKHPLKLVEMEGSHTVQNLYTSLD  258

Query  255  LHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGT  76
            +H GQCLSVLVTADQ P DYYLVA++RF K  L+   +++YA           P  P+G 
Sbjct  259  VHVGQCLSVLVTADQAPGDYYLVASTRFTKKVLTATAVLRYAGSN----TPPSPVIPEGP  314

Query  75   EGIAWSINQFRSFRWNLTASAARPN  1
             G AWS NQ+R+FRWNLTASAARPN
Sbjct  315  TGWAWSFNQWRTFRWNLTASAARPN  339



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 241/335 (72%), Gaps = 7/335 (2%)
 Frame = -1

Query  999  LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvv  820
            LL L A+A + +AEDPYLF EWKVTYG  S LGV + VILING+FPGP IN +SNNN+VV
Sbjct  15   LLVLSALATLARAEDPYLFFEWKVTYGTKSLLGVPQKVILINGEFPGPRINCSSNNNIVV  74

Query  819  nVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPST  640
            NVFN+LD PLLF WNG+Q RKNSW DGMPGT CPILP TN+TY +Q KDQIG+ FYFPS 
Sbjct  75   NVFNQLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFTYKWQPKDQIGSFFYFPSI  134

Query  639  SLHRSAGGYGALTVHSRELIPVPFDWPADE--FYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             + R+AGGYGA++V SR LIPVPFD P  E    + + DWY K H  L + +D G  + R
Sbjct  135  GMQRAAGGYGAISVVSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGR  194

Query  465  PNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSH  286
            P G++IN K G+   +  P  T EAGKTYR RVCN G++ S+NFR QGH M LVE+EGSH
Sbjct  195  PAGVLINGKGGK-DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSH  253

Query  285  VVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaa  106
             +QN YDSLD+H G CLSVLV ADQ P DYY+VA++RF+ +  S   +I+YA        
Sbjct  254  TLQNTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSSA----  309

Query  105  elppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
               P   +   G AWSINQ RSFRWNLTASAARPN
Sbjct  310  PPSPNMTEPPAGWAWSINQARSFRWNLTASAARPN  344



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 242/323 (75%), Gaps = 4/323 (1%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+ EDPY +  W +TYG +SP GV + VILIN +FPGP IN TSNNN+VVNVFN LDEP 
Sbjct  20   VKGEDPYFYFTWNITYGTISPAGVPQQVILINNEFPGPNINSTSNNNIVVNVFNNLDEPF  79

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            LF W GIQQRKNSWQDG+ GT CPI  G+N+TYHFQVKDQIG++FY+PS  +HR+AGG+G
Sbjct  80   LFTWAGIQQRKNSWQDGVAGTNCPIPVGSNFTYHFQVKDQIGSYFYYPSLGMHRAAGGFG  139

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L V+SR LIPVP+  P D++ + + DWY K H  L K LD G ++ RP  +++N +  +
Sbjct  140  GLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALAKLLDSGRSLGRPQAVLVNGQVAK  199

Query  429  VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLH  250
                 +PL T++ GKTY++R+CNVG++ S+NFR QGH M LVE EGSH VQN YDSLD+H
Sbjct  200  GDGSDKPLFTMKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEFEGSHTVQNSYDSLDVH  259

Query  249  TGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEG  70
             GQC  VLVTAD+DPKDYY+VA++RF K+ ++  G+I+Y NGKG       P  P+   G
Sbjct  260  LGQCFGVLVTADKDPKDYYMVASTRFTKSIVTGKGIIRYTNGKG----PASPELPEAPVG  315

Query  69   IAWSINQFRSFRWNLTASAARPN  1
             AWS+NQFRSF WNLTASAARPN
Sbjct  316  WAWSLNQFRSFHWNLTASAARPN  338



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   385 bits (989),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 241/335 (72%), Gaps = 7/335 (2%)
 Frame = -1

Query  999  LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvv  820
            LL L A+A + +AEDPYLF EWKVTYG  S LGV + VILING+FPGP IN +SNNN+VV
Sbjct  15   LLVLSALATLARAEDPYLFFEWKVTYGTKSLLGVPQKVILINGEFPGPRINCSSNNNIVV  74

Query  819  nVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPST  640
            NVFN+LD PLLF WNG+Q RKNSW DGMPGT CPILP TN+TY +Q KDQIG+ FYFPS 
Sbjct  75   NVFNQLDHPLLFTWNGMQHRKNSWMDGMPGTQCPILPNTNFTYKWQPKDQIGSFFYFPSI  134

Query  639  SLHRSAGGYGALTVHSRELIPVPFDWPADE--FYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             + R+AGGYGA++V SR LIPVPFD P  E    + + DWY K H  L + +D G  + R
Sbjct  135  GMQRAAGGYGAISVVSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGR  194

Query  465  PNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSH  286
            P G++IN K G+   +  P  T EAGKTYR RVCN G++ S+NFR QGH M LVE+EGSH
Sbjct  195  PAGVLINGKGGK-DLEAAPAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSH  253

Query  285  VVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaa  106
             +QN YDSLD+H G CLSVLV ADQ P DYY+VA++RF+ +  S   +I+YA        
Sbjct  254  TLQNTYDSLDVHVGHCLSVLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSS----V  309

Query  105  elppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
               P   +   G AWSINQ RSFRWNLTASAARPN
Sbjct  310  PPAPNMTEPPAGWAWSINQARSFRWNLTASAARPN  344



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   384 bits (987),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/331 (59%), Positives = 247/331 (75%), Gaps = 5/331 (2%)
 Frame = -1

Query  1026  LTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTIN  847
             +   M  V L    A   +V+ EDPY F  W +TYG +SPLGV +  ILING+FPGP IN
Sbjct  1     MATMMFTVLLCLSAATMSMVRGEDPYFFFTWNITYGTISPLGVPQQGILINGQFPGPNIN  60

Query  846   GTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQI  667
              TSNNN+V+NVFN L+EP L HW+GIQ RKNSWQDG+ GT CPILPGTN+TYHFQVKDQI
Sbjct  61    STSNNNIVINVFNNLNEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNFTYHFQVKDQI  120

Query  666   GTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLD  487
             G+ FY+P  ++HR+AGG+G L V+SR LIPVP+  P D++ + + DWY K H  LK+ LD
Sbjct  121   GSFFYYPPIAMHRAAGGFGGLRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTTLKQILD  180

Query  486   DGH-TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             +GH +IARP G++IN K  +     EPL T++  KTY++RVCNVG++TS+NFRFQGH+M 
Sbjct  181   NGHRSIARPEGVLINGKTAKGDGTDEPLFTMKPEKTYKYRVCNVGLKTSLNFRFQGHTMK  240

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVE+EGSH VQNDY SLD+H GQC SVLVTA+Q+PKDYY+VA++RF+KN L   G+I+Y 
Sbjct  241   LVEMEGSHTVQNDYQSLDVHVGQCFSVLVTANQEPKDYYMVASTRFIKNVLIGKGIIRYT  300

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSF  37
             NGKG       P  P    G AWS+NQFR+F
Sbjct  301   NGKG----PASPEIPKAPMGWAWSLNQFRTF  327



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   387 bits (994),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/326 (62%), Positives = 245/326 (75%), Gaps = 6/326 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             V AEDPYL+  W VTYG +SPLGV +  ILING+FPGP IN T+NNN+VVNVFN LDEP
Sbjct  106  AVGAEDPYLYFTWNVTYGTVSPLGVPQQAILINGEFPGPNINSTTNNNIVVNVFNHLDEP  165

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             LF WNGIQQRKNSW DG  GT CPI PG N+TYHFQVKDQIG+  YFP+  +HR+AGG+
Sbjct  166  FLFTWNGIQQRKNSWVDGTAGTNCPIPPGQNFTYHFQVKDQIGSFVYFPALDMHRAAGGF  225

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L V+SR LIPVPF  PAD++ + + DWY K H++L + LD G TI RP+G++IN + G
Sbjct  226  GGLRVNSRLLIPVPFADPADDYTVLVGDWYTKSHKNLARLLDAGRTIGRPSGILINGRPG  285

Query  432  E--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSL  259
            +   G    PL T+++GKTYR+RVCNVGM+ S+NFR Q H+M LVE++GSH VQN YDSL
Sbjct  286  KDSTGKDDPPLFTMKSGKTYRYRVCNVGMKVSLNFRIQSHAMKLVEMDGSHTVQNVYDSL  345

Query  258  DLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDG  79
            D+H GQCLSVLVTA Q+ +DYY+VA+SRF K  LS  G+I+YA      + +LP      
Sbjct  346  DVHVGQCLSVLVTAHQEHRDYYMVASSRFTKYALSATGVIRYAGSNTPPSPDLPA----A  401

Query  78   TEGIAWSINQFRSFRWNLTASAARPN  1
              G AWS NQ+RSFR NLTASAARPN
Sbjct  402  PSGWAWSFNQWRSFRLNLTASAARPN  427



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 238/324 (73%), Gaps = 5/324 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            V +AEDPY+F EW VTYG  + +G  + VILING+FPGP IN +SNNN++VNVFN+LD+P
Sbjct  28   VARAEDPYVFFEWHVTYGTKNIVGTPQKVILINGEFPGPRINCSSNNNIMVNVFNQLDQP  87

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
            LLF WNGIQ RKNSWQDG+PGT CP+ PGTNYTYH+Q KDQIGT FYFPS  + R+ GG+
Sbjct  88   LLFTWNGIQHRKNSWQDGVPGTNCPVAPGTNYTYHWQPKDQIGTFFYFPSIGMQRAVGGF  147

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G ++V SR LIPVPFD PAD+  + + DW+ K H  +   LD G +  RP G++IN K G
Sbjct  148  GLISVVSRLLIPVPFDPPADDLQVVIGDWFTKDHAVMASLLDAGRSFGRPAGVLINGKGG  207

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +      P+ T EA KTYR R+CNVG+++S+NFR QGH M LVE++GSH +Q+ YDSLD+
Sbjct  208  KEATN-PPMFTWEAAKTYRLRICNVGIKSSLNFRIQGHDMKLVEIDGSHTLQDSYDSLDV  266

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQCLSVLV ADQ P DY +VA++RF+ +  S   +++YA           P  P+   
Sbjct  267  HVGQCLSVLVDADQKPADYLMVASTRFMADASSVSAVVRYAGSN----TPPAPNVPEPPA  322

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWS+NQ+RSFRWNLTASAARPN
Sbjct  323  GWAWSLNQWRSFRWNLTASAARPN  346



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   384 bits (985),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/325 (60%), Positives = 249/325 (77%), Gaps = 4/325 (1%)
 Frame = -1

Query  975  FVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDE  796
              VQ  DP +  EWKVTYG +SPLGV    ILING+FPGP IN T+NNNV+VNVFN LDE
Sbjct  2    LTVQGGDPTITFEWKVTYGTISPLGVPVKGILINGQFPGPNINSTTNNNVIVNVFNNLDE  61

Query  795  PLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGG  616
            P L  W+G+Q RKN WQDG+ GT CPI PG NYTY FQVKDQIG++ Y+P T++H++AGG
Sbjct  62   PFLLTWSGVQHRKNPWQDGVLGTNCPIPPGKNYTYKFQVKDQIGSYMYYPVTAMHKAAGG  121

Query  615  YGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKH  436
            +G L ++SR LIPVP+  PAD++ +   D++NKG+  LKK L  G  + R +G+ IN K 
Sbjct  122  FGGLRINSRLLIPVPYADPADDYTLIAGDFFNKGYTSLKKVLLSGRNLGRCDGVHINGKV  181

Query  435  GEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLD  256
             +     EPL T+EAGKTY++R+CN G++TS+N RFQGH+M LVE+EGSH VQNDY+SLD
Sbjct  182  AKGDGNDEPLFTMEAGKTYKYRICNAGIKTSLNVRFQGHTMKLVEMEGSHTVQNDYESLD  241

Query  255  LHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGT  76
            +H GQC SVLVTA+Q+PKDY++VA++RF K ++   G+I+Y NGKGA + +LPPPP    
Sbjct  242  VHVGQCFSVLVTANQEPKDYFVVASTRFTKREVIATGVIRYNNGKGAPSPKLPPPPVS--  299

Query  75   EGIAWSINQFRSFRWNLTASAARPN  1
               AWS+NQFR+FRWNLTASAARPN
Sbjct  300  --WAWSLNQFRTFRWNLTASAARPN  322



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/325 (59%), Positives = 235/325 (72%), Gaps = 6/325 (2%)
 Frame = -1

Query  969  VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPL  790
            V+AEDPYLF  W +TYG ++PLG  + VILIN +FPGP IN TSNNN+V+NVFN LDEP 
Sbjct  19   VRAEDPYLFFTWNITYGTIAPLGTPQQVILINNQFPGPEINCTSNNNIVINVFNYLDEPF  78

Query  789  LFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYG  610
            L  WNGIQ RKNSW DG PGT CPILPG N+TYHFQ KDQIG+ FYFPS  + ++AGG+G
Sbjct  79   LLTWNGIQHRKNSWMDGTPGTNCPILPGQNFTYHFQPKDQIGSFFYFPSIGMQKAAGGFG  138

Query  609  ALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGE  430
             L VHSR LIPVPF  PA+EF +   DW+ +GH+ L + LD G  +  P G++IN + G 
Sbjct  139  MLRVHSRLLIPVPFAPPAEEFNVLAGDWFTRGHKVLARKLDAGRRLGLPAGVLINGRSGR  198

Query  429  --VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLD  256
               G    P+ T++AG  YRFR CNVG++ S+NFR Q HS+ LVE+EGSH VQN YDSLD
Sbjct  199  NAAGHDDLPMFTMQAGNVYRFRFCNVGLKASLNFRIQKHSLKLVEMEGSHTVQNLYDSLD  258

Query  255  LHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGT  76
            +H GQC+SVLVTADQ P DYYLVA++RF K   +   +++YA      +  +P     G 
Sbjct  259  VHVGQCMSVLVTADQAPGDYYLVASTRFTKKVHTATAVLRYAGSNSPPSRVIPR----GP  314

Query  75   EGIAWSINQFRSFRWNLTASAARPN  1
             G AWS NQ+R+FRWNLTASAARPN
Sbjct  315  SGWAWSFNQWRTFRWNLTASAARPN  339



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   382 bits (981),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 192/321 (60%), Positives = 242/321 (75%), Gaps = 7/321 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPY+F EW VTYG  + +GV + VILING+FPGP IN +SNNN+VVNVFN+LD+PLLF 
Sbjct  12   EDPYVFFEWHVTYGTKTLVGVPQKVILINGEFPGPRINCSSNNNIVVNVFNQLDQPLLFT  71

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            W+G+QQRKNSWQDGMPGT CP+ PGTNYT+ +Q KDQIG+ FYFPS  + R+AGGYG ++
Sbjct  72   WHGMQQRKNSWQDGMPGTNCPVAPGTNYTFKWQAKDQIGSFFYFPSVGMQRAAGGYGLIS  131

Query  600  VHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG-EVG  424
            V SR LIPVPFD PAD+  + + DWY K H  + + LD+G +  RP G++IN + G E  
Sbjct  132  VVSRLLIPVPFDPPADDLQVLIGDWYTKDHAVMARLLDEGRSFGRPAGVLINGRGGKEAA  191

Query  423  DKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTG  244
            D   PL T EAGKTYR R+CNVG+++++NFR QGH M LVE++GSH VQ+ YDSLD+H G
Sbjct  192  DP--PLFTFEAGKTYRLRICNVGIKSTLNFRIQGHDMKLVEMDGSHTVQDMYDSLDVHVG  249

Query  243  QCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGIA  64
             CLSVLV ADQ P DYY+VA++RF+ ++ S   +I+YA           P  P+   G A
Sbjct  250  HCLSVLVDADQKPGDYYVVASTRFISDKSSVSAVIRYAGSN----TPPAPNVPEPPAGWA  305

Query  63   WSINQFRSFRWNLTASAARPN  1
            WS+NQ+RSFRWNLTASAARPN
Sbjct  306  WSLNQWRSFRWNLTASAARPN  326



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/342 (58%), Positives = 244/342 (71%), Gaps = 6/342 (2%)
 Frame = -1

Query  1020  NKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGT  841
             +++  VF+L       VV+AEDPYL+  W VTYG ++PLG+ + VILIN +FPGP IN T
Sbjct  2     SQVTAVFVLVSLLGLSVVRAEDPYLWFPWNVTYGTIAPLGIPQQVILINNQFPGPEINCT  61

Query  840   SnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGT  661
             SNNN+++NVFN LDEP L  WNG+Q RKNSW DG PGT CPILPG N+T+HFQ KDQIG+
Sbjct  62    SNNNIIINVFNNLDEPFLLTWNGVQHRKNSWMDGTPGTNCPILPGQNFTFHFQPKDQIGS  121

Query  660   HFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDG  481
              FYFPS  + ++AGG G L VHSR LIPVPF  PA EF +   DW+ K H+ L + LD G
Sbjct  122   FFYFPSLGMQKAAGGVGMLRVHSRLLIPVPFAPPAQEFNVLAGDWFTKSHKVLARQLDAG  181

Query  480   HTIARPNGLVINAKHGE--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVL  307
               +  P G++IN + G+   G    P+ T++AG  YRFR CNVG++TS+NFR Q HS+ L
Sbjct  182   RGLGLPAGVLINGRLGKDAAGRDEPPMFTMQAGNVYRFRFCNVGLKTSLNFRLQKHSLKL  241

Query  306   VEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYAN  127
             VE+EGSH VQN YDSLD+H GQCLSVLVTADQ P DYYLVA++RF K  L+   +++YA 
Sbjct  242   VEMEGSHTVQNLYDSLDVHVGQCLSVLVTADQAPGDYYLVASTRFTKEILAATAVLRYAG  301

Query  126   GKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                       P  PDG  G AWS NQ+R+FRWNLTASAARPN
Sbjct  302   SNA----PPSPVIPDGPSGWAWSFNQWRTFRWNLTASAARPN  339



>gb|KGN54013.1| hypothetical protein Csa_4G267480 [Cucumis sativus]
Length=476

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/327 (57%), Positives = 234/327 (72%), Gaps = 28/327 (9%)
 Frame = -1

Query  981  MAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNEL  802
            M   V+ EDPY F  W VTYG +SPLGV +  ILING+FPGP IN TSNNN+V+NVFN L
Sbjct  17   MTATVRGEDPYFFFTWNVTYGTISPLGVPQQGILINGQFPGPNINSTSNNNLVINVFNNL  76

Query  801  DEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSA  622
            DEP L HW+GIQ RKNSWQDG+ GT CPILPGTNYTYHFQ                    
Sbjct  77   DEPFLLHWSGIQHRKNSWQDGLLGTNCPILPGTNYTYHFQ--------------------  116

Query  621  GGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINA  442
                   V+SR LIPVP+  P D++ + + DWY K H  LK+ LD G +IARP+G++IN 
Sbjct  117  ----GSRVNSRLLIPVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIARPDGVLING  172

Query  441  KHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDS  262
            K  +     EPL T++ GKTY++RVCNVG+++S+NFRFQGH+M LVE+EGSH VQNDY+S
Sbjct  173  KSAKGDGTDEPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYES  232

Query  261  LDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPD  82
            LD+H GQC SVLVTA+Q+PKDYY+VA++RF+K+ L   G+++Y +GKG       P  P+
Sbjct  233  LDVHVGQCFSVLVTANQEPKDYYMVASTRFIKSILVGKGIVRYTDGKG----PASPEIPE  288

Query  81   GTEGIAWSINQFRSFRWNLTASAARPN  1
               G AWS+NQFR+FRWNLTASAARPN
Sbjct  289  APMGWAWSLNQFRTFRWNLTASAARPN  315



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   376 bits (966),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 230/295 (78%), Gaps = 4/295 (1%)
 Frame = -1

Query  885  ILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPG  706
            ILING+FPGP IN TSNNNVV NVFN LDEPLLF W+G+QQRKNSWQDG PG  CPILPG
Sbjct  10   ILINGQFPGPEINSTSNNNVVANVFNNLDEPLLFTWHGVQQRKNSWQDGTPGVQCPILPG  69

Query  705  TNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDW  526
            TNYTY FQVKDQIG++FY+P+T L R+ GG+G L + SR LIPVP+  P DE+++ + DW
Sbjct  70   TNYTYKFQVKDQIGSYFYYPTTGLQRAVGGFGGLRIFSRLLIPVPYADPEDEYWVLICDW  129

Query  525  YNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRT  346
            Y K H+ LK  LD G +I RP G++IN K+ +     EPL T++ GKTY++R+CN G++ 
Sbjct  130  YGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKD  189

Query  345  SMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLK  166
            ++NFRFQGH M LVE EGSHVVQN YDSLD+H GQC +VLVTAD++P+DYY++A++R  K
Sbjct  190  TLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  249

Query  165  NQLSTVGLIKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              L   G+I+Y NGKG A+  LPP P     G AWS+NQFRSFRWNLTASAARPN
Sbjct  250  YNLLGKGIIRYTNGKGPASPVLPPAPV----GWAWSLNQFRSFRWNLTASAARPN  300



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   377 bits (969),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 232/326 (71%), Gaps = 6/326 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            VV AEDPYLF  W VTYG ++PLG+ + VILIN +FPGP +N TSNNN+++NVFN LDEP
Sbjct  18   VVLAEDPYLFFTWNVTYGSIAPLGIRQKVILINNQFPGPEVNCTSNNNIIINVFNNLDEP  77

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNG+Q RKNSW DG PGT CPI PG N+TYHFQ KDQIGT FYFPS  + ++AGG+
Sbjct  78   FLLTWNGVQNRKNSWMDGTPGTNCPIPPGQNFTYHFQPKDQIGTFFYFPSVGMQKAAGGF  137

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G L VHSR LIPVPF  PA+EF +   DW+   H+ L + LD G  +  P G++IN + G
Sbjct  138  GMLRVHSRLLIPVPFAPPAEEFDVLAGDWFTASHKLLARKLDAGRGLGLPAGVLINGRPG  197

Query  432  E--VGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSL  259
                G    P+ T++AG  YRFR CNVG++TS+NFR Q HS+ LVE+EGSH +QN YDSL
Sbjct  198  RPVTGHDDPPMFTVQAGNVYRFRFCNVGLKTSLNFRIQKHSLKLVEMEGSHTIQNLYDSL  257

Query  258  DLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDG  79
            D+H GQCLSVLV ADQ P DYYLV ++RF K   +   +++YA           P  P+G
Sbjct  258  DVHVGQCLSVLVVADQGPGDYYLVVSTRFTKKIHTATAVLRYAGSN----TPPSPVIPEG  313

Query  78   TEGIAWSINQFRSFRWNLTASAARPN  1
              G AWS NQ+R+FRWNLTASAARPN
Sbjct  314  PSGWAWSFNQWRTFRWNLTASAARPN  339



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   377 bits (967),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 226/295 (77%), Gaps = 4/295 (1%)
 Frame = -1

Query  885  ILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPG  706
            ILING+FPGP IN TSNNNVV NVFN LDEPLLF W+G+QQRKNSWQDG PG  CPILPG
Sbjct  51   ILINGQFPGPEINSTSNNNVVANVFNNLDEPLLFTWHGVQQRKNSWQDGTPGVQCPILPG  110

Query  705  TNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDW  526
            TNYTY FQVKDQIG++FY+P+T L R+ GG+G L + SR LIPVP+  P DE+++ + DW
Sbjct  111  TNYTYKFQVKDQIGSYFYYPTTGLQRAVGGFGGLRIFSRLLIPVPYADPEDEYWVLICDW  170

Query  525  YNKGHRDLKKTLDDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRT  346
            Y K H+ LK  LD G +I RP G++IN K+ +     EPL T++ GKTY++R+CN G++ 
Sbjct  171  YGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKD  230

Query  345  SMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLK  166
            ++NFRFQGH M LVE EGSHVVQN YDSLD+H GQC +VLVTAD++P+DYY++A++R  K
Sbjct  231  TLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPRDYYMIASTRMTK  290

Query  165  NQLSTVGLIKYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              L   G+I+Y NGKG       P  P    G AWS+NQFRSFRWNLTASAARPN
Sbjct  291  YNLLGKGIIRYTNGKG----PASPVLPPAPVGWAWSLNQFRSFRWNLTASAARPN  341



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   373 bits (958),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/324 (60%), Positives = 237/324 (73%), Gaps = 7/324 (2%)
 Frame = -1

Query  966  QAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLL  787
            +AEDPYLF EWKVTYG  S LGV + VILING+FPGP IN TSNNN+V+NVFN+LD PLL
Sbjct  26   RAEDPYLFFEWKVTYGTKSLLGVPQKVILINGEFPGPRINCTSNNNIVINVFNQLDHPLL  85

Query  786  FHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGA  607
            F WNG+Q RKNSW DGMPGT CPILP TN+ Y +Q KDQIG+ +YFPS  + R+ GGYG 
Sbjct  86   FTWNGMQHRKNSWMDGMPGTQCPILPNTNFMYKWQPKDQIGSFYYFPSMGMQRAVGGYGG  145

Query  606  LTVHSRELIPVPFDWPADE--FYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            ++V+SR LIPVPFD P  E    + + DWY K H  L + LD G ++ RP G+VIN K G
Sbjct  146  ISVYSRLLIPVPFDQPPPENDHVVLIGDWYTKDHEVLARQLDAGKSVGRPAGVVINGKGG  205

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
            +  +   PL T +AGKTYR RVCN G++ S+NFR QGH M LVE+EGSH +Q+ YDSLD+
Sbjct  206  KDLES-APLFTFDAGKTYRLRVCNTGIKASLNFRIQGHHMTLVELEGSHTLQDVYDSLDV  264

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H G CLSVLVTADQ P DYY+VA++RF+ +  S   +++YA       AE+P P      
Sbjct  265  HVGHCLSVLVTADQKPGDYYMVASTRFIHDAKSARAVVRYAGSSAPPPAEMPEP----PA  320

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
            G AWSINQ RS RWNLT+SAARPN
Sbjct  321  GWAWSINQARSIRWNLTSSAARPN  344



>emb|CDY68850.1| BnaA10g29650D [Brassica napus]
Length=303

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 225/299 (75%), Gaps = 0/299 (0%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             +  ++    L  +  V++AEDPYLF  WKVTYG +SPLGV +  I+IN KFPGP +N T+
Sbjct  3     RKSVILGFLLTVLTTVIKAEDPYLFFTWKVTYGTISPLGVPQKAIMINDKFPGPNLNTTT  62

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             NNN+V+NV N LDEP LF W+G+Q RKNSWQDGMPGTTCPI PG N+TYHFQ KDQIG++
Sbjct  63    NNNIVINVINNLDEPFLFTWSGMQHRKNSWQDGMPGTTCPIPPGKNFTYHFQAKDQIGSY  122

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
             FY+PS  L R+AGG+G L ++SR LIPVP+  P D++ + + DWY K H  LK  LD G 
Sbjct  123   FYYPSLGLQRAAGGFGGLRINSRALIPVPYPDPEDDYTVLIGDWYTKTHVALKDNLDSGR  182

Query  477   TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
             +I RP G++IN K G+     EP+ T++ GKTY++R+CNVG++ ++NFR Q H + LVE+
Sbjct  183   SIGRPEGVLINGKAGKPDGTGEPIFTMKPGKTYKYRICNVGLKMALNFRIQNHKIKLVEL  242

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGK  121
             EGSH +QN YDSLDLH GQC  VLVTADQ+PKDYY+VA++RFLK  L++  L++Y  GK
Sbjct  243   EGSHTLQNLYDSLDLHVGQCFGVLVTADQEPKDYYMVASTRFLKTVLTSTALLRYEGGK  301



>gb|KDP30646.1| hypothetical protein JCGZ_16211 [Jatropha curcas]
Length=450

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/287 (60%), Positives = 226/287 (79%), Gaps = 0/287 (0%)
 Frame = -1

Query  1014  MGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSn  835
             M ++FL +L      V +EDPYLF  WK+TYG LSPLG+ + VILIN +FPGP IN T+N
Sbjct  5     MHVLFLCFLSGAMIGVNSEDPYLFFTWKITYGTLSPLGIPQQVILINDQFPGPLINSTTN  64

Query  834   nnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHF  655
             NN+VVNVFN LDEP L  W+GIQQRKNSWQ+G+ GT CPI PGTNYTYHFQVKDQIG+  
Sbjct  65    NNIVVNVFNNLDEPFLLTWSGIQQRKNSWQEGVLGTNCPIQPGTNYTYHFQVKDQIGSFM  124

Query  654   YFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHT  475
             Y+PST+LHR+AG +G L ++SR LIPVP+  P D++ + ++DWY K H+ L+  LD G +
Sbjct  125   YYPSTALHRAAGAFGGLNINSRLLIPVPYPDPEDDYTVIINDWYTKSHKALRSFLDSGRS  184

Query  474   IARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVE  295
             + RP+ ++IN K  +   K EPL T++ GKTY++R+CN G++TS+NFR QGH+M LVE+E
Sbjct  185   LGRPDAVLINGKTAKGDGKDEPLFTMKPGKTYKYRICNAGLKTSINFRIQGHTMKLVEME  244

Query  294   GSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLS  154
             GSHV+QN Y+SLD+H GQCL+VLVTADQ P+DYY+VA++RF+K  L+
Sbjct  245   GSHVIQNVYESLDVHVGQCLTVLVTADQAPRDYYIVASTRFIKTILT  291



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/333 (57%), Positives = 236/333 (71%), Gaps = 33/333 (10%)
 Frame = -1

Query  996  LWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvn  817
            L L  MA  V++EDPY+++ WKVTYG ++P+GV +  ILING FPGP IN TSNNNVV+N
Sbjct  3    LMLCLMAASVRSEDPYIYYTWKVTYGTIAPMGVPQQGILINGHFPGPEINSTSNNNVVIN  62

Query  816  VFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQ-VKDQIGTHFYFPST  640
            VFN LDEPLLF W+G+Q RKNSWQDG  G  CPI PGTNYTYHFQ VKDQIGT+FY+P+T
Sbjct  63   VFNNLDEPLLFTWHGVQHRKNSWQDGTLGVQCPIAPGTNYTYHFQVVKDQIGTYFYYPTT  122

Query  639  SLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPN  460
             L R+ GG+G L + SR                         H  LK+ LD G +I RP 
Sbjct  123  GLQRAIGGFGGLRIFSRL------------------------HTALKQKLDSGRSIGRPV  158

Query  459  GLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVV  280
            G+ IN K+G     +EPL T+E GKTY++R+CNVG++ S+NFR QGH + LVE EGSHVV
Sbjct  159  GVHINGKNG----GLEPLYTMEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVV  214

Query  279  QNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaael  100
            QN+YDSLD+H GQC +VLVTADQ+PKDY++VA++RF K  L+   +I+Y+NG G      
Sbjct  215  QNNYDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVG----PA  270

Query  99   ppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                P   +G AWS+NQFRSFRWNLTASAARPN
Sbjct  271  SGGLPPAPQGWAWSLNQFRSFRWNLTASAARPN  303



>ref|XP_004506275.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 235/336 (70%), Gaps = 11/336 (3%)
 Frame = -1

Query  1005  VFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
             VFLL +F +A  V  EDPY F+ W VTYG + P G+ +  ILING+FPGP I   +N+NV
Sbjct  9     VFLLLVFFVA-CVSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNV  67

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             ++NVFN LDEP L  WNG+ QR+NSWQDG+ GT CPI PG N+TY  QVK+QIG++FYFP
Sbjct  68    IINVFNSLDEPFLISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFP  127

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             S +LH++AGGYG L+V SR +IPVPFD P+ +F I   DWY K H +L+  LD+G+ +  
Sbjct  128   SLALHKAAGGYGGLSVASRPMIPVPFDPPSGDFTILAGDWYQKSHTELRAILDNGNNLPF  187

Query  465   PNGLVINAKHGEVGDKMEPLA-TLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             P+G++IN  HG       P+  T++ GKTYRFR+ NVG+ TS+NFR QGH M LVEVEG+
Sbjct  188   PDGIIING-HGS-----NPITFTVDQGKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGT  241

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H +QN YDS+D+H GQ  SVLVTADQ P+DYY+V ++RF    L+ V ++ Y N +G  +
Sbjct  242   HTLQNIYDSIDIHLGQSYSVLVTADQPPQDYYIVVSTRFTSKVLTVVSILHYRNSEGTVS  301

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                P  P   TE   W I Q RS R NLTAS  RPN
Sbjct  302   GPFPLGPTIDTE---WPIEQVRSIRGNLTASGPRPN  334



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   358 bits (920),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 196/322 (61%), Positives = 234/322 (73%), Gaps = 7/322 (2%)
 Frame = -1

Query  960  EDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEPLLFH  781
            EDPYLF EWKVTYG  + LG  + VILING+FPGP IN +SNNN+VVNVFN+LD+PLLFH
Sbjct  25   EDPYLFFEWKVTYGTKNLLGKPQKVILINGEFPGPRINCSSNNNIVVNVFNQLDQPLLFH  84

Query  780  WNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGYGALT  601
            WNGIQ RKNSW DG+ GT CPI P TN+TY +Q KDQIGT FYFP   + R+AGGYGA+T
Sbjct  85   WNGIQHRKNSWMDGLLGTNCPIAPNTNFTYKWQPKDQIGTFFYFPIIGMQRAAGGYGAIT  144

Query  600  VHSRELIPVPFDWPADE--FYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHGEV  427
            V SR LIPVPFD P  E    + + DWY K H  + + LD G ++ RP G++IN K G  
Sbjct  145  VVSRLLIPVPFDPPPPESDHVVLIGDWYTKDHEVMARMLDAGRSVGRPEGVLINGKGGP-  203

Query  426  GDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDLHT  247
                 P+ T EAGKTYRFRVCN G++ S+NFR QGH M LVE+EGSH VQ+ YDSLD+H 
Sbjct  204  DAAAAPMFTFEAGKTYRFRVCNTGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHV  263

Query  246  GQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTEGI  67
            G CLSVLV ADQ P DYY+VA++RF+ +  S + +I+YA           P  P+   G 
Sbjct  264  GHCLSVLVDADQKPGDYYMVASTRFIHDARSVMAVIRYAGSN----TPPSPNVPEPPAGW  319

Query  66   AWSINQFRSFRWNLTASAARPN  1
            AWSINQ+RSFRWNLTASAARPN
Sbjct  320  AWSINQWRSFRWNLTASAARPN  341



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score =   357 bits (916),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 228/324 (70%), Gaps = 8/324 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
            +V AEDPY F  W +TYG + PLG+A+  ILING+FPGP I   +N+N++VNVFN LD+P
Sbjct  14   IVAAEDPYRFFNWNITYGTIYPLGIAQQGILINGQFPGPEIYSVTNDNIIVNVFNSLDQP  73

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L HWNGIQ R+NS++DG+ GTTCPI  G N+TY  Q+KDQIG+ FYFPS   H++AG +
Sbjct  74   FLIHWNGIQNRRNSYEDGVYGTTCPIPAGGNFTYILQMKDQIGSFFYFPSLGFHKAAGAF  133

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            GA+ + SR LIPVPFD P D+F + + DWY   H DLK  LD G+ +  P+G++IN +  
Sbjct  134  GAIKILSRPLIPVPFDNPTDDFSVLIGDWYTSNHTDLKAILDKGNKLPFPDGILINGRGP  193

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
             V        T++ GKTYRFR+CNVG++ S+NFR QGH M +VEVEG+H VQ  Y SLD+
Sbjct  194  NVTS-----FTIQQGKTYRFRICNVGLQNSLNFRIQGHKMKVVEVEGTHTVQVSYSSLDI  248

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQC+SVL+TADQ P+DYY+V +SRF    LST G ++YA   G+    L P P   T 
Sbjct  249  HVGQCMSVLLTADQQPQDYYIVVSSRFTTPVLSTTGFLRYA---GSNRPALGPLPGGPTI  305

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
             + WS+NQ RS R NLTAS  RPN
Sbjct  306  EVDWSLNQARSIRTNLTASGPRPN  329



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 236/343 (69%), Gaps = 9/343 (3%)
 Frame = -1

Query  1029  ALTNKMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTI  850
              L   +  V L+ L  ++F    EDPY F+ W VTYG + PLGV +  ILING+FPGP I
Sbjct  2     GLYTSVCCVLLVALLTVSFT-NGEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQI  60

Query  849   NGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQ  670
             +  +N+N++++VFN LDEP L  WNG+QQR+NSWQDG+ GT CPI PG N+TY  QVKDQ
Sbjct  61    DCVTNDNLIISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQ  120

Query  669   IGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTL  490
             IG+++YFPS + H++AGGYG + + SR  IPVPFD PA +F I   DW+ + H DLK  L
Sbjct  121   IGSYYYFPSLAFHKAAGGYGGIKISSRPRIPVPFDPPAGDFTILAGDWFKQNHTDLKAIL  180

Query  489   DDGHTIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMV  310
             D G+ +  P+GL+IN + G  G+      T++ GKTYRFR+ NVG+ TS+NFR QGH M+
Sbjct  181   DGGNNLPFPDGLIINGR-GSNGNTF----TVDQGKTYRFRISNVGIATSINFRIQGHKML  235

Query  309   LVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYA  130
             LVEVEG H +QN Y SLD+H GQ LSVLVTADQ P+DYY+V ++RF    LS   ++ Y+
Sbjct  236   LVEVEGIHTLQNTYSSLDIHLGQSLSVLVTADQPPQDYYIVVSTRFTSQVLSATSILHYS  295

Query  129   NGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             N  G+ +   P  P   T  + WS+ Q RSFR NLTAS  RPN
Sbjct  296   NSGGSVSGPPPGGP---TTEVDWSLEQARSFRRNLTASGPRPN  335



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   357 bits (915),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 179/336 (53%), Positives = 227/336 (68%), Gaps = 8/336 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  LL +F +    + E PY F  W VTYG + PLGV +  ILING+FPGP+I   +N+N
Sbjct  7     ICCLLLVFMLVSCTRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             ++++VFN LDEP L  WNG+QQR+NSWQDG+ GT CPI PG N+TY  QVKDQIG++FYF
Sbjct  67    LIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYF  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PS + H++AGGYG + + SR LIPVPFD PA +F I   DWY K H DLK  LD G  + 
Sbjct  127   PSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLP  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+GLVIN +            T++ GKTYRFR+ NVG+ TS+NFR QGH M+LVEVEG+
Sbjct  187   FPDGLVINGRGSNAN-----TFTVDQGKTYRFRISNVGISTSINFRIQGHKMLLVEVEGT  241

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H +QN YDSLD+H GQ  SVLV ADQ P+ YY+V ++RF    LS   ++ Y+N  G+ +
Sbjct  242   HTLQNTYDSLDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNSAGSVS  301

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                P  P   T  I WS+ Q RS R NLTAS  RPN
Sbjct  302   GPPPGGP---TTQIDWSLEQARSLRRNLTASGPRPN  334



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   357 bits (915),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 179/336 (53%), Positives = 227/336 (68%), Gaps = 8/336 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             +  LL +F +    + E PY F  W VTYG + PLGV +  ILING+FPGP+I   +N+N
Sbjct  7     ICCLLLVFMLVSCTRGESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDN  66

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             ++++VFN LDEP L  WNG+QQR+NSWQDG+ GT CPI PG N+TY  QVKDQIG++FYF
Sbjct  67    LIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQVKDQIGSYFYF  126

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PS + H++AGGYG + + SR LIPVPFD PA +F I   DWY K H DLK  LD G  + 
Sbjct  127   PSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLKAILDSGSDLP  186

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+GLVIN +            T++ GKTYRFR+ NVG+ TS+NFR QGH M+LVEVEG+
Sbjct  187   FPDGLVINGRGSNAN-----TFTVDQGKTYRFRISNVGISTSINFRIQGHKMLLVEVEGT  241

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H +QN YDSLD+H GQ  SVLV ADQ P+ YY+V ++RF    LS   ++ Y+N  G+ +
Sbjct  242   HTLQNTYDSLDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNSAGSVS  301

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                P  P   T  I WS+ Q RS R NLTAS  RPN
Sbjct  302   GPPPGGP---TTQIDWSLEQARSLRRNLTASGPRPN  334



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   356 bits (914),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 230/336 (68%), Gaps = 8/336 (2%)
 Frame = -1

Query  1008  MVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnn  829
             ++ L  +FA   +  AE PY F+ W VTYG + PLGV +  ILING+FPGP I   +N+N
Sbjct  4     LLKLAVVFACFAIAAAESPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDN  63

Query  828   vvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYF  649
             ++VNVFN LDEP L HW+G+Q R+NS++DG+ GTTCPI PG N+TY  Q+KDQIG+ FYF
Sbjct  64    IIVNVFNSLDEPFLIHWSGVQNRRNSYEDGVYGTTCPIPPGQNFTYILQMKDQIGSFFYF  123

Query  648   PSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIA  469
             PS + H++AGG+G + + SR LIPVPFD PAD++ + + DWY   H  LK  LD GH + 
Sbjct  124   PSLAFHKAAGGFGGIKILSRPLIPVPFDPPADDYTVLIGDWYKSNHTALKAILDKGHKLP  183

Query  468   RPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
              P+G++IN +   V        T++ GK YR R+CNVG++ S+NFR QGH M +VEVEG+
Sbjct  184   FPDGILINGRGPNVTS-----FTVQQGKIYRLRICNVGLQNSLNFRIQGHKMKVVEVEGT  238

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H +Q  Y SLD+H GQC+SVLVTADQ P+DYY+V +SRF    L+T G ++YAN      
Sbjct  239   HTLQVSYSSLDIHLGQCMSVLVTADQQPQDYYIVVSSRFTSTVLTTTGFLRYANSN---R  295

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                 P P   T  I WS+NQ RS R NLTAS  RPN
Sbjct  296   PASGPLPGGPTTQIDWSLNQARSIRTNLTASGPRPN  331



>ref|XP_004506310.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   356 bits (914),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 235/336 (70%), Gaps = 11/336 (3%)
 Frame = -1

Query  1005  VFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnv  826
             VFLL +F +A  V  EDPY F+ W VTYG + P G+ +  ILING+FPGP I   +N+NV
Sbjct  9     VFLLLVFFVA-CVSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNV  67

Query  825   vvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFP  646
             ++NVFN LDEP L  WNG+ QR+NSWQDG+ GT CPI PG N+TY  QVK+QIG++FYFP
Sbjct  68    IINVFNSLDEPFLISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFP  127

Query  645   STSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIAR  466
             S +LH++AGGYG L+V SR +IPVPFD P+ +F I   DWY K H +L+  LD+G+ +  
Sbjct  128   SLALHKAAGGYGGLSVASRPMIPVPFDPPSGDFTILAGDWYQKSHTELRAILDNGNNLPF  187

Query  465   PNGLVINAKHGEVGDKMEPLA-TLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGS  289
             P+G++IN  HG       P+  T++ GKTY+FR+ NVG+ TS+NFR QGH M LVEVEG+
Sbjct  188   PDGIIING-HGS-----NPITFTVDQGKTYQFRISNVGLTTSINFRIQGHKMKLVEVEGT  241

Query  288   HVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaa  109
             H +QN YDS+D+H GQ  SVLVTADQ P+DYY+V ++RF    L+ V ++ Y N +G  +
Sbjct  242   HTLQNIYDSIDIHLGQSYSVLVTADQPPQDYYIVVSTRFTSKVLTVVSILHYRNSEGTVS  301

Query  108   aelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
                P  P   TE   W I Q RS R NLTAS  RPN
Sbjct  302   GPFPLGPTIDTE---WPIEQVRSIRGNLTASGPRPN  334



>ref|XP_009407426.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 231/333 (69%), Gaps = 10/333 (3%)
 Frame = -1

Query  999  LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvv  820
            +L   A AFV  A+DPY F  W VTYG + PLGV +  ILING+FPGP ++  +N+N+V+
Sbjct  8    VLVFLAAAFVAGADDPYRFFTWTVTYGPIYPLGVQQQGILINGQFPGPRLDCVTNDNIVI  67

Query  819  nVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPST  640
            +V N+LDEPLL  WNGI+QRKNSWQDG+ GT CPILP  N+TY FQ KDQIG   YFPST
Sbjct  68   DVINKLDEPLLLTWNGIKQRKNSWQDGVLGTNCPILPSGNFTYKFQTKDQIGGFTYFPST  127

Query  639  SLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPN  460
             + R+AGG+G+L V+ R  IPVP+  PAD+F + + DWY   H+ L+K LD G ++  P+
Sbjct  128  GMQRAAGGFGSLNVYQRPQIPVPYAKPADDFSLLVGDWYRASHKVLQKALDSGSSLPFPD  187

Query  459  GLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVV  280
             L+IN      G K    A  + GKTY FR+ NVGM TS+NFR QGH M LVEVEGSH +
Sbjct  188  DLLIN------GQKYTAFAG-DQGKTYLFRISNVGMTTSINFRIQGHKMKLVEVEGSHTL  240

Query  279  QNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaael  100
            QN YDSLD+H GQ LSVLVT DQ PKDYY+VA++RF +  L+   ++ Y N     +  +
Sbjct  241  QNIYDSLDIHVGQSLSVLVTLDQAPKDYYIVASTRFTRKVLTATAVLHYGNSNSPVSGPI  300

Query  99   ppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
            P  P     G+ WS+ Q R+FRWNLTASAARPN
Sbjct  301  PGGP---AYGLHWSMKQARTFRWNLTASAARPN  330



>ref|XP_003537368.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Glycine max]
 ref|XP_006590664.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Glycine max]
Length=537

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 239/339 (71%), Gaps = 8/339 (2%)
 Frame = -1

Query  1017  KMGMVFLLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTS  838
             + G++ LL L      VQAED Y ++ W VTYG +SPLG  + VILING+FPGP ++  +
Sbjct  3     RTGLLHLLCLVIALVSVQAEDAYKYYTWTVTYGTISPLGSPQQVILINGQFPGPRLDLVT  62

Query  837   nnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTH  658
             N NV++N+ N+LDEP L  WNGI+QRKNSWQDG+ GT CPI P +NYTY FQ KDQIGT+
Sbjct  63    NENVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQAKDQIGTY  122

Query  657   FYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGH  478
              YFPST LH++AGG+GAL V+ R +IP+P+  P  +F + + DWY   H+ L++TL+ G 
Sbjct  123   TYFPSTQLHKAAGGFGALNVYHRSVIPIPYPNPDGDFTLLVGDWYKTNHKTLRQTLESGK  182

Query  477   TIARPNGLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEV  298
              +A P+GL+IN        +     T   GKTY FR+ NVG  TS+NFR QGH++ LVEV
Sbjct  183   PLAFPDGLLING-------QAHSTFTGNPGKTYMFRISNVGFSTSINFRIQGHTLKLVEV  235

Query  297   EGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKG  118
             EGSH VQN YDSLD+H GQ ++VLVT +Q PKDYY+VA++RF +  L+T  ++ YAN   
Sbjct  236   EGSHTVQNLYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTETPLTTTAVLHYANSFS  295

Query  117   aaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
             +A   +P PP D  +   WS+ Q R++RWNLTA+AARPN
Sbjct  296   SALGPVPAPPVDKYD-FDWSMKQARTYRWNLTANAARPN  333



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 229/324 (71%), Gaps = 8/324 (2%)
 Frame = -1

Query  972  VVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvvnVFNELDEP  793
             + AEDPY F  W VTYG + PLGV +  ILING+FPGP I   +N+N+++NVFN LDEP
Sbjct  22   CIIAEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEP  81

Query  792  LLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPSTSLHRSAGGY  613
             L  WNG++QR+NSWQDG+ GT CPI PG NYTY  QVKDQIG++FYFPS + H++AGGY
Sbjct  82   FLISWNGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGSYFYFPSLAFHKAAGGY  141

Query  612  GALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPNGLVINAKHG  433
            G + + SR +IPVPF  PA ++ I   DW+N+ H DLK  LD GH +  PNGL+IN + G
Sbjct  142  GGIKIASRSVIPVPFAPPAGDYTILAGDWFNQSHNDLKAILDSGHNLPFPNGLLINGR-G  200

Query  432  EVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVVQNDYDSLDL  253
              G     + T+E GKTYRFR+ NVG+ TS+NFR QGH MVLVEVEG+H +QN YDSLD+
Sbjct  201  TNGY----VFTVEHGKTYRFRISNVGLATSINFRIQGHKMVLVEVEGTHTLQNTYDSLDI  256

Query  252  HTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaaelppppPDGTE  73
            H GQ  SVLVTADQ  +DYYLVA+ RF    L+   +++Y+N +    +   PPP   T 
Sbjct  257  HLGQSYSVLVTADQPIQDYYLVASMRFTPQVLTATSVLRYSNSQ---KSVSGPPPGGPTI  313

Query  72   GIAWSINQFRSFRWNLTASAARPN  1
             + WS+NQ RS R NLTAS  RPN
Sbjct  314  EVDWSLNQARSLRRNLTASGPRPN  337



>ref|XP_007156841.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
 gb|ESW28835.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
Length=540

 Score =   354 bits (909),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 244/346 (71%), Gaps = 18/346 (5%)
 Frame = -1

Query  1014  MGMVFLLWL--FAMAFV----VQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPT  853
             MG   LL L  F +A V    VQAED Y F+ W VTYG LSPLG  + VILING+FPGP 
Sbjct  1     MGSATLLHLLCFVIASVSVSLVQAEDAYKFYTWTVTYGNLSPLGSPQQVILINGQFPGPK  60

Query  852   INGTSnnnvvvnVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKD  673
             ++  +N+NV++N+ N+LDEP L  WNGI+QRKNSWQDG+ GT CPI P +NYTY FQ KD
Sbjct  61    LDLVTNDNVILNLINKLDEPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNYTYKFQTKD  120

Query  672   QIGTHFYFPSTSLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKT  493
             QIGT+ YFPST LH++AGG+G L V+ R +IP+P+  P  +F + + DWY   H+ L++T
Sbjct  121   QIGTYSYFPSTQLHKAAGGFGGLNVYHRSVIPIPYQNPDGDFTLLIGDWYKTNHKTLRQT  180

Query  492   LDDGHTIARPNGLVINAKHGEVGDKMEPLATLEA--GKTYRFRVCNVGMRTSMNFRFQGH  319
             LD G +I  P+GL+IN          +P +T     GKTY FR+ NVG+ TS+NFR QGH
Sbjct  181   LDSGKSIGLPDGLLING---------QPHSTFTGNQGKTYMFRISNVGLSTSINFRIQGH  231

Query  318   SMVLVEVEGSHVVQNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLI  139
             ++ LVEVEGSH +QN YDSLD+H GQ +S+LVT +Q PKDYY+VA++RF +  L+T  ++
Sbjct  232   TLKLVEVEGSHTIQNIYDSLDVHVGQSVSLLVTLNQPPKDYYIVASTRFTETPLTTTAVL  291

Query  138   KYANGKGaaaaelppppPDGTEGIAWSINQFRSFRWNLTASAARPN  1
              Y+N   +A   +PP P D  +   WS+ Q R++RWNLTA+AARPN
Sbjct  292   HYSNSFSSALGPVPPSPVDKYD-FDWSMKQARTYRWNLTANAARPN  336



>ref|XP_010558427.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=539

 Score =   354 bits (908),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/334 (51%), Positives = 235/334 (70%), Gaps = 12/334 (4%)
 Frame = -1

Query  999  LLWLFAMAFVVQAEDPYLFHEWKVTYGKLSPLGVAKDVILINGKFPGPTINGTSnnnvvv  820
            ++ +F     V+ +DPY ++ W VTYG +SPLGV + VI ING+FPGP ++  +N+N+++
Sbjct  13   VMAVFGSVVKVKGDDPYKYYTWTVTYGIISPLGVPQQVIFINGQFPGPRLDVVTNDNIIL  72

Query  819  nVFNELDEPLLFHWNGIQQRKNSWQDGMPGTTCPILPGTNYTYHFQVKDQIGTHFYFPST  640
            N+ N+LD+P L  WNGI+QRKNSWQDG+ GT CPI P +N+TY FQ KDQIGT+ YFPST
Sbjct  73   NLINKLDQPFLLTWNGIKQRKNSWQDGVLGTNCPIPPNSNFTYKFQTKDQIGTYTYFPST  132

Query  639  SLHRSAGGYGALTVHSRELIPVPFDWPADEFYIFLSDWYNKGHRDLKKTLDDGHTIARPN  460
            + H++AGGYGA+ V++R  IP+P+  PA +F + + DW+   H  L++ LD G  +  P+
Sbjct  133  AFHKAAGGYGAINVYARPRIPIPYPLPASDFTLLIGDWFKTNHNTLQQRLDSGTPLLYPD  192

Query  459  GLVINAKHGEVGDKMEPLATLEAGKTYRFRVCNVGMRTSMNFRFQGHSMVLVEVEGSHVV  280
            GL+IN        + +   T + GKTY FR+ NVG+ TS N R QGH+M +VEVEGSHV+
Sbjct  193  GLLING-------QTQATFTGDQGKTYMFRISNVGLSTSFNLRIQGHTMKVVEVEGSHVI  245

Query  279  QNDYDSLDLHTGQCLSVLVTADQDPKDYYLVATSRFLKNQLSTVGLIKYANGKGaaaael  100
            Q DYDSLD+H GQ LS+LVT +Q PKDYY++A++RF +  LS  GL++Y+N +       
Sbjct  246  QTDYDSLDIHVGQSLSILVTLNQSPKDYYIMASTRFTRRVLSVTGLLRYSNSRA----PA  301

Query  99   ppppPDGTEG-IAWSINQFRSFRWNLTASAARPN  1
                PD   G + WS+ Q R+FRWNLTA+AARPN
Sbjct  302  SGSLPDPPPGELVWSMRQARTFRWNLTANAARPN  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2557218196608