BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34798_g1_i1 len=217 path=[195:0-216]

Length=217
                                                                      Score     E

ref|XP_010315086.1|  PREDICTED: chlorophyll a-b binding protein C...    148   3e-42   
ref|XP_006351797.1|  PREDICTED: chlorophyll a-b binding protein C...    147   9e-42   
ref|XP_004230588.1|  PREDICTED: chlorophyll a-b binding protein C...    141   2e-39   
ref|XP_006351799.1|  PREDICTED: chlorophyll a-b binding protein C...    140   3e-39   
ref|XP_009770890.1|  PREDICTED: chlorophyll a-b binding protein C...    140   5e-39   
gb|ACF78789.1|  unknown                                                 137   6e-39   Zea mays [maize]
ref|XP_009795766.1|  PREDICTED: chlorophyll a-b binding protein C...    140   7e-39   
ref|XP_009613269.1|  PREDICTED: chlorophyll a-b binding protein C...    140   7e-39   
ref|XP_009613268.1|  PREDICTED: chlorophyll a-b binding protein C...    139   7e-39   
ref|XP_002447312.1|  hypothetical protein SORBIDRAFT_06g032690          139   9e-39   Sorghum bicolor [broomcorn]
gb|EMS60756.1|  Chlorophyll a-b binding protein CP24 10A, chlorop...    138   1e-38   
ref|XP_004975829.1|  PREDICTED: chlorophyll a-b binding protein C...    138   3e-38   
ref|NP_001141632.1|  uncharacterized protein LOC100273752               137   4e-38   Zea mays [maize]
gb|ACG30470.1|  chlorophyll a-b binding protein CP24                    137   5e-38   Zea mays [maize]
gb|EMT32851.1|  Chlorophyll a-b binding protein CP24 10A, chlorop...    137   9e-38   
dbj|BAJ89706.1|  predicted protein                                      136   1e-37   
gb|AFW59862.1|  chlorophyll a/b-binding apoprotein CP24 Precursor       136   1e-37   
ref|XP_004140973.1|  PREDICTED: chlorophyll a-b binding protein C...    136   1e-37   
ref|XP_006494019.1|  PREDICTED: chlorophyll a-b binding protein C...    136   1e-37   
ref|XP_006423921.1|  hypothetical protein CICLE_v10029116mg             136   1e-37   
ref|XP_008441527.1|  PREDICTED: chlorophyll a-b binding protein C...    136   2e-37   
ref|XP_007148423.1|  hypothetical protein PHAVU_006G207300g             135   2e-37   
ref|XP_002533515.1|  chlorophyll A/B binding protein, putative          135   3e-37   Ricinus communis
ref|XP_002298178.1|  chlorophyll A-B binding family protein             135   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_009110471.1|  PREDICTED: chlorophyll a-b binding protein C...    135   4e-37   
gb|KHG12653.1|  Chlorophyll a-b binding CP24 10A, chloroplastic         135   4e-37   
emb|CDX96833.1|  BnaA08g23760D                                          135   4e-37   
ref|XP_010269191.1|  PREDICTED: chlorophyll a-b binding protein C...    135   4e-37   
ref|XP_009149012.1|  PREDICTED: chlorophyll a-b binding protein C...    135   4e-37   
emb|CDX81735.1|  BnaC08g38660D                                          135   5e-37   
emb|CDY35042.1|  BnaA06g10520D                                          135   5e-37   
ref|XP_009117802.1|  PREDICTED: chlorophyll a-b binding protein C...    135   6e-37   
ref|XP_010939618.1|  PREDICTED: chlorophyll a-b binding protein C...    135   6e-37   
gb|KFK43827.1|  hypothetical protein AALP_AA1G178900                    134   6e-37   
ref|XP_006416877.1|  hypothetical protein EUTSA_v10008533mg             135   6e-37   
gb|AAD27882.2|AF139470_1  chlorophyll a/b-binding protein CP24 pr...    134   7e-37   Vigna radiata var. radiata [golden gram]
ref|XP_010905907.1|  PREDICTED: chlorophyll a-b binding protein C...    134   7e-37   
gb|AFK41475.1|  unknown                                                 134   7e-37   
ref|XP_011007955.1|  PREDICTED: chlorophyll a-b binding protein C...    134   7e-37   
gb|ABK95437.1|  unknown                                                 134   7e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007043011.1|  Light harvesting complex photosystem II subu...    134   7e-37   
gb|EPS71396.1|  hypothetical protein M569_03363                         134   7e-37   
gb|AAT74560.1|  Lhcb6 protein                                           134   7e-37   Brassica rapa subsp. pekinensis [bai cai]
gb|ACF05839.1|  chloroplast light-harvesting complex II protein         132   7e-37   Populus tremula [European aspen]
ref|XP_010103822.1|  Chlorophyll a-b binding protein CP24 10A           134   8e-37   
gb|ACF05852.1|  chloroplast light-harvesting complex II protein         132   8e-37   Populus tremula [European aspen]
gb|ACF05843.1|  chloroplast light-harvesting complex II protein         132   8e-37   Populus tremula [European aspen]
gb|ACF05833.1|  chloroplast light-harvesting complex II protein         132   8e-37   Populus tremula [European aspen]
ref|NP_001105375.1|  light harvesting chlorophyll a/b binding pro...    134   8e-37   Zea mays [maize]
ref|XP_011005195.1|  PREDICTED: chlorophyll a-b binding protein C...    134   9e-37   
ref|XP_003593177.1|  Chloroplast chlorophyll a/b-binding protein ...    134   1e-36   
ref|XP_008790804.1|  PREDICTED: chlorophyll a-b binding protein C...    134   1e-36   
ref|XP_010497422.1|  PREDICTED: chlorophyll a-b binding protein C...    134   1e-36   
ref|XP_010532097.1|  PREDICTED: chlorophyll a-b binding protein C...    134   1e-36   
ref|XP_010476680.1|  PREDICTED: chlorophyll a-b binding protein C...    134   1e-36   
ref|XP_010261229.1|  PREDICTED: chlorophyll a-b binding protein C...    134   1e-36   
ref|XP_003531041.1|  PREDICTED: chlorophyll a-b binding protein C...    134   1e-36   
ref|XP_009387775.1|  PREDICTED: chlorophyll a-b binding protein C...    134   1e-36   
ref|XP_009362479.1|  PREDICTED: chlorophyll a-b binding protein C...    134   2e-36   
ref|XP_004300703.1|  PREDICTED: chlorophyll a-b binding protein C...    133   2e-36   
ref|XP_002303160.2|  hypothetical protein POPTR_0003s01450g             135   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_006303285.1|  hypothetical protein CARUB_v10010058mg             133   3e-36   
gb|EYU39149.1|  hypothetical protein MIMGU_mgv1a012260mg                133   3e-36   
gb|KHN33514.1|  Chlorophyll a-b binding protein CP24 10A, chlorop...    133   3e-36   
ref|XP_006827820.1|  hypothetical protein AMTR_s00009p00268360          133   3e-36   
dbj|BAI52949.1|  light-harvesting complex II protein                    132   3e-36   Citrullus lanatus subsp. vulgaris
gb|KHN31645.1|  Chlorophyll a-b binding protein CP24 10B, chlorop...    132   3e-36   
gb|AFA36512.1|  chloroplast a/b binding protein cab-PhE11               130   4e-36   
ref|XP_010537903.1|  PREDICTED: chlorophyll a-b binding protein C...    132   5e-36   
ref|XP_004485563.1|  PREDICTED: chlorophyll a-b binding protein C...    132   5e-36   
ref|XP_002892885.1|  Lhcb6 protein                                      132   5e-36   
ref|XP_007223489.1|  hypothetical protein PRUPE_ppa010195mg             132   5e-36   
gb|ACF05842.1|  chloroplast light-harvesting complex II protein         130   5e-36   Populus tremula [European aspen]
gb|KDP27379.1|  hypothetical protein JCGZ_20203                         132   6e-36   
gb|ACU15016.1|  unknown                                                 132   6e-36   Glycine max [soybeans]
ref|XP_010065599.1|  PREDICTED: chlorophyll a-b binding protein C...    132   6e-36   
ref|XP_003531552.1|  PREDICTED: chlorophyll a-b binding protein C...    132   6e-36   
gb|ACF05831.1|  chloroplast light-harvesting complex II protein         130   7e-36   Populus tremula [European aspen]
gb|ACF05841.1|  chloroplast light-harvesting complex II protein         129   7e-36   Populus tremula [European aspen]
gb|ACF05832.1|  chloroplast light-harvesting complex II protein         129   7e-36   Populus tremula [European aspen]
ref|XP_009379581.1|  PREDICTED: chlorophyll a-b binding protein C...    132   1e-35   
ref|XP_007159087.1|  hypothetical protein PHAVU_002G207500g             131   1e-35   
ref|XP_008391511.1|  PREDICTED: chlorophyll a-b binding protein C...    131   1e-35   
gb|ACU23773.1|  unknown                                                 131   2e-35   Glycine max [soybeans]
gb|EAZ30952.1|  hypothetical protein OsJ_15029                          130   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001236415.1|  uncharacterized protein LOC100527463               130   3e-35   
gb|AAD28777.1|AF134130_1  Lhcb6 protein                                 130   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173034.1|  light harvesting complex photosystem II subunit 6     130   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579885.1|  PREDICTED: chlorophyll a-b binding protein C...    129   7e-35   
ref|NP_001052969.1|  Os04g0457000                                       129   8e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010459118.1|  PREDICTED: chlorophyll a-b binding protein C...    129   1e-34   
ref|XP_006653476.1|  PREDICTED: chlorophyll a-b binding protein C...    129   1e-34   
emb|CAH67022.1|  H0523F07.10                                            127   5e-34   Oryza sativa [red rice]
ref|XP_009381511.1|  PREDICTED: chlorophyll a-b binding protein C...    122   3e-33   
ref|XP_001757538.1|  predicted protein                                  121   4e-32   
sp|P36494.1|CB4_SPIOL  RecName: Full=Chlorophyll a-b binding prot...    115   2e-29   Spinacia oleracea
ref|XP_010666865.1|  PREDICTED: chlorophyll a-b binding protein C...    114   5e-29   
gb|AAX23999.1|  chloroplast chlorophyll a/b-binding protein CP24 ...    111   7e-29   Fragaria x ananassa
emb|CDY33376.1|  BnaC05g12070D                                          113   2e-28   
ref|XP_010030053.1|  PREDICTED: chlorophyll a-b binding protein C...    112   3e-28   
ref|XP_008368146.1|  PREDICTED: chlorophyll a-b binding protein C...    112   7e-28   
ref|XP_008809318.1|  PREDICTED: chlorophyll a-b binding protein C...    110   2e-27   
gb|ACA13177.1|  chloroplast a/b binding protein cab-PhE11               110   2e-27   Phyllostachys edulis [kikko-chiku]
gb|AEW70714.1|  light harvesting chlorophyll a-b binding protein 6      109   2e-27   
ref|XP_002986118.1|  light-harvesting complex                           102   1e-24   
gb|AFR32945.1|  light-harvesting complex photosystem II                 101   3e-24   
ref|XP_006385220.1|  hypothetical protein POPTR_0003s01450g             100   5e-24   
emb|CDO97468.1|  unnamed protein product                              94.7    4e-22   
gb|ABS58590.1|  chloroplast light-harvesting complex b6               90.5    4e-21   Scutellaria baicalensis [Baikal skullcap]
ref|XP_002263201.1|  PREDICTED: chlorophyll a-b binding protein C...  90.9    3e-20   Vitis vinifera
gb|EYU18497.1|  hypothetical protein MIMGU_mgv1a012167mg              90.9    3e-20   
ref|XP_011087853.1|  PREDICTED: chlorophyll a-b binding protein C...  89.4    9e-20   
ref|XP_011092414.1|  PREDICTED: chlorophyll a-b binding protein C...  89.4    9e-20   
gb|ACG39852.1|  hypothetical protein                                  83.6    1e-18   Zea mays [maize]
emb|CDX83968.1|  BnaC08g16770D                                        63.9    1e-11   
tpg|DAA35392.1|  TPA: hypothetical protein ZEAMMB73_596183            52.4    3e-07   
emb|CAA50763.1|  light harvesting complex I chlorophyll binding p...  46.6    3e-04   Pyrobotrys stellata



>ref|XP_010315086.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic 
[Solanum lycopersicum]
 sp|P27525.1|CB4B_SOLLC RecName: Full=Chlorophyll a-b binding protein CP24 10B, chloroplastic; 
Short=CAB-10B; Short=LHCP; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34146.1| chlorophyll b-binding protein [Solanum lycopersicum]
Length=256

 Score =   148 bits (374),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE
Sbjct  122  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  181

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  182  NFANFTGEQGY  192



>ref|XP_006351797.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Solanum tuberosum]
Length=256

 Score =   147 bits (371),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFG+LLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE
Sbjct  122  GIPWFEAGADPGAIAPFSFGTLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  181

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  182  NFANFTGEQGY  192



>ref|XP_004230588.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Solanum lycopersicum]
 sp|P27524.1|CB4A_SOLLC RecName: Full=Chlorophyll a-b binding protein CP24 10A, chloroplastic; 
Short=CAB-10A; Short=LHCP; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34143.1| a-binding protein [Solanum lycopersicum]
Length=256

 Score =   141 bits (355),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFG+LLGTQL+LMGWVESKRWVDFFD DSQS++WATPWSKTAE
Sbjct  122  GIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAE  181

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  182  NFANFTGEQGY  192



>ref|XP_006351799.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Solanum tuberosum]
Length=256

 Score =   140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFG+LLGTQL+LMGWVESKRWVDFFD DSQS++WATPWSKTAE
Sbjct  122  GIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAE  181

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  182  NFANFTGEQGY  192



>ref|XP_009770890.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Nicotiana sylvestris]
 gb|ABG73416.1| chloroplast pigment-binding protein CP24 [Nicotiana tabacum]
Length=257

 Score =   140 bits (352),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  123  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  183  NFANFTGEQGY  193



>gb|ACF78789.1| unknown [Zea mays]
 gb|AFW59863.1| hypothetical protein ZEAMMB73_098595 [Zea mays]
 gb|AFW59864.1| hypothetical protein ZEAMMB73_098595 [Zea mays]
Length=149

 Score =   137 bits (344),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQ+++WATPWS+TAE
Sbjct  15   GIPWFEAGADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAE  74

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  75   NFANFTGEQGY  85



>ref|XP_009795766.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Nicotiana sylvestris]
Length=256

 Score =   140 bits (352),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  122  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTAE  181

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  182  NFANFTGEQGY  192



>ref|XP_009613269.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Nicotiana tomentosiformis]
Length=257

 Score =   140 bits (352),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  123  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  183  NFANFTGEQGY  193



>ref|XP_009613268.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=256

 Score =   139 bits (351),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  122  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTAE  181

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  182  NFANFTGEQGY  192



>ref|XP_002447312.1| hypothetical protein SORBIDRAFT_06g032690 [Sorghum bicolor]
 gb|EES11640.1| hypothetical protein SORBIDRAFT_06g032690 [Sorghum bicolor]
Length=255

 Score =   139 bits (351),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  121  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  180

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  181  NFANFTGEQGY  191



>gb|EMS60756.1| Chlorophyll a-b binding protein CP24 10A, chloroplastic [Triticum 
urartu]
Length=208

 Score =   138 bits (347),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA PGA+APFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  74   GVPWFEAGAQPGAVAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  133

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  134  NFANFTGEQGY  144



>ref|XP_004975829.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Setaria italica]
Length=252

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  118  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  177

Query  35   NFANFTGEQGY  3
            NFANFTG+QGY
Sbjct  178  NFANFTGDQGY  188



>ref|NP_001141632.1| uncharacterized protein LOC100273752 [Zea mays]
 ref|NP_001148406.1| chlorophyll a-b binding protein CP24 [Zea mays]
 gb|ACF86753.1| unknown [Zea mays]
 gb|ACG31358.1| chlorophyll a-b binding protein CP24 [Zea mays]
 tpg|DAA35390.1| TPA: chlorophyll a-b binding protein CP24 isoform 1 [Zea mays]
 tpg|DAA35391.1| TPA: chlorophyll a-b binding protein CP24 isoform 2 [Zea mays]
Length=253

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  119  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  178

Query  35   NFANFTGEQGY  3
            NFANFTG+QGY
Sbjct  179  NFANFTGDQGY  189



>gb|ACG30470.1| chlorophyll a-b binding protein CP24 [Zea mays]
 gb|ACG39451.1| chlorophyll a-b binding protein CP24 [Zea mays]
Length=244

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQ+++WATPWS+TAE
Sbjct  110  GIPWFEAGADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAE  169

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  170  NFANFTGEQGY  180



>gb|EMT32851.1| Chlorophyll a-b binding protein CP24 10A, chloroplastic [Aegilops 
tauschii]
Length=255

 Score =   137 bits (344),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA PGA+APFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  121  GVPWFEAGAQPGAVAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  180

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  181  NFANFTGEQGY  191



>dbj|BAJ89706.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85189.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA PGA+APFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  121  GVPWFEAGAQPGAVAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  180

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  181  NFANFTGEQGY  191



>gb|AFW59862.1| chlorophyll a/b-binding apoprotein CP24 Precursor [Zea mays]
Length=248

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQ+++WATPWS+TAE
Sbjct  114  GIPWFEAGADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAE  173

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  174  NFANFTGEQGY  184



>ref|XP_004140973.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160305.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46151.1| hypothetical protein Csa_6G057170 [Cucumis sativus]
Length=255

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  121  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  180

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  181  NFANATGEQGY  191



>ref|XP_006494019.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Citrus sinensis]
Length=253

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  119  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  178

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  179  NFANATGEQGY  189



>ref|XP_006423921.1| hypothetical protein CICLE_v10029116mg [Citrus clementina]
 gb|ESR37161.1| hypothetical protein CICLE_v10029116mg [Citrus clementina]
 gb|KDO40181.1| hypothetical protein CISIN_1g025421mg [Citrus sinensis]
Length=253

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  119  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  178

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  179  NFANATGEQGY  189



>ref|XP_008441527.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Cucumis melo]
Length=255

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  121  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  180

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  181  NFANATGEQGY  191



>ref|XP_007148423.1| hypothetical protein PHAVU_006G207300g [Phaseolus vulgaris]
 gb|AGV54678.1| chlorophyll A/B binding protein CP24 10A chloroplastic [Phaseolus 
vulgaris]
 gb|ESW20417.1| hypothetical protein PHAVU_006G207300g [Phaseolus vulgaris]
Length=258

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWSKTAE
Sbjct  124  GVPWFEAGADPNAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAE  183

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  184  NFANATGEQGY  194



>ref|XP_002533515.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF28871.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=256

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWS+T+E
Sbjct  122  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTSE  181

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  182  NFANATGEQGY  192



>ref|XP_002298178.1| chlorophyll A-B binding family protein [Populus trichocarpa]
 gb|ABK95197.1| unknown [Populus trichocarpa]
 gb|EEE82983.1| chlorophyll A-B binding family protein [Populus trichocarpa]
Length=257

 Score =   135 bits (340),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  123  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  183  NFANATGDQGY  193



>ref|XP_009110471.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Brassica rapa]
Length=259

 Score =   135 bits (340),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  125  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  184

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  185  NFANYTGDQGY  195



>gb|KHG12653.1| Chlorophyll a-b binding CP24 10A, chloroplastic [Gossypium arboreum]
Length=259

 Score =   135 bits (340),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+  SQS++WATPWSKTAE
Sbjct  125  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPQSQSVEWATPWSKTAE  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANATGEQGY  195



>emb|CDX96833.1| BnaA08g23760D [Brassica napus]
Length=259

 Score =   135 bits (340),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  125  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  184

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  185  NFANYTGDQGY  195



>ref|XP_010269191.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Nelumbo nucifera]
Length=260

 Score =   135 bits (340),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  126  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTAE  185

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  186  NFANATGDQGY  196



>ref|XP_009149012.1| PREDICTED: chlorophyll a-b binding protein CP24, chloroplastic 
[Brassica rapa]
Length=258

 Score =   135 bits (339),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  124  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>emb|CDX81735.1| BnaC08g38660D [Brassica napus]
Length=259

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  125  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  184

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  185  NFANYTGDQGY  195



>emb|CDY35042.1| BnaA06g10520D [Brassica napus]
Length=258

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  124  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>ref|XP_009117802.1| PREDICTED: chlorophyll a-b binding protein CP24, chloroplastic-like 
[Brassica rapa]
 emb|CDY52865.1| BnaA09g56570D [Brassica napus]
Length=259

 Score =   135 bits (339),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  125  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  184

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  185  NFANYTGDQGY  195



>ref|XP_010939618.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Elaeis guineensis]
Length=261

 Score =   135 bits (339),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWF+AGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  125  GVPWFQAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANATGEQGY  195



>gb|KFK43827.1| hypothetical protein AALP_AA1G178900 [Arabis alpina]
Length=255

 Score =   134 bits (338),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  121  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  180

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  181  NFANYTGDQGY  191



>ref|XP_006416877.1| hypothetical protein EUTSA_v10008533mg [Eutrema salsugineum]
 dbj|BAJ33632.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35230.1| hypothetical protein EUTSA_v10008533mg [Eutrema salsugineum]
Length=258

 Score =   135 bits (339),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  124  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>gb|AAD27882.2|AF139470_1 chlorophyll a/b-binding protein CP24 precursor [Vigna radiata]
Length=258

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWSKTAE
Sbjct  124  GVPWFEAGADPNAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSKTAE  183

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  184  NFANATGEQGY  194



>ref|XP_010905907.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Elaeis guineensis]
Length=260

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  126  GVPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  185

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  186  NFANATGDQGY  196



>gb|AFK41475.1| unknown [Lotus japonicus]
Length=260

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWSKTAE
Sbjct  126  GVPWFEAGADPNAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSKTAE  185

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  186  NFANYTGDQGY  196



>ref|XP_011007955.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Populus euphratica]
Length=257

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  123  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  183  NFANATGDQGY  193



>gb|ABK95437.1| unknown [Populus trichocarpa]
 gb|ABK96703.1| unknown [Populus trichocarpa x Populus deltoides]
Length=257

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  123  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  183  NFANATGDQGY  193



>ref|XP_007043011.1| Light harvesting complex photosystem II subunit 6 [Theobroma 
cacao]
 gb|EOX98842.1| Light harvesting complex photosystem II subunit 6 [Theobroma 
cacao]
Length=254

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+  SQS++WATPWSKTAE
Sbjct  120  GVPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPQSQSVEWATPWSKTAE  179

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  180  NFANATGEQGY  190



>gb|EPS71396.1| hypothetical protein M569_03363 [Genlisea aurea]
Length=256

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWF+AGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQSI+WATPWSKTAE
Sbjct  122  GVPWFQAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSIEWATPWSKTAE  181

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  182  NFANATGDQGY  192



>gb|AAT74560.1| Lhcb6 protein [Brassica rapa subsp. pekinensis]
Length=254

 Score =   134 bits (338),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  120  GVPWFEAGADPRAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  179

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  180  NFANYTGDQGY  190



>gb|ACF05839.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05840.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   132 bits (332),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  89   GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>ref|XP_010103822.1| Chlorophyll a-b binding protein CP24 10A [Morus notabilis]
 gb|EXB97263.1| Chlorophyll a-b binding protein CP24 10A [Morus notabilis]
Length=257

 Score =   134 bits (338),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQSI+WATPWS+TAE
Sbjct  123  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSIEWATPWSRTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  183  NFANATGDQGY  193



>gb|ACF05852.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   132 bits (332),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  89   GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>gb|ACF05843.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05845.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   132 bits (332),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  89   GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>gb|ACF05833.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05834.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05835.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05836.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05837.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05838.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05844.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05846.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05847.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05848.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05849.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05850.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05851.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05853.1| chloroplast light-harvesting complex II protein [Populus tremula]
 gb|ACF05854.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   132 bits (332),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  89   GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>ref|NP_001105375.1| light harvesting chlorophyll a/b binding protein6 precursor [Zea 
mays]
 gb|AAA64416.1| chlorophyll a/b-binding apoprotein CP24 precursor [Zea mays]
Length=247

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP  IAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQ+++WATPWS+TAE
Sbjct  113  GIPWFEAGADPTRIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAE  172

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  173  NFANFTGEQGY  183



>ref|XP_011005195.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Populus euphratica]
 ref|XP_011015216.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Populus euphratica]
Length=257

 Score =   134 bits (337),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  123  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  183  NFANATGDQGY  193



>ref|XP_003593177.1| Chloroplast chlorophyll a/b-binding protein CP24 [Medicago truncatula]
 gb|AES63428.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=261

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFG+LLGTQL+LMGWVESKRWVDFF+ DSQSI+WATPWSKTAE
Sbjct  127  GVPWFEAGADPNAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSIEWATPWSKTAE  186

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  187  NFANATGEQGY  197



>ref|XP_008790804.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Phoenix dactylifera]
Length=261

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  125  GVPWFEAGADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANATGEQGY  195



>ref|XP_010497422.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic 
[Camelina sativa]
Length=258

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA+P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  124  GVPWFEAGAEPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>ref|XP_010532097.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic 
[Tarenaya hassleriana]
Length=259

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQSIDWATPWS+TA 
Sbjct  125  GVPWFEAGADPAAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSIDWATPWSRTAG  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANATGEQGY  195



>ref|XP_010476680.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Camelina sativa]
Length=256

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA+P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  122  GVPWFEAGAEPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  181

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  182  NFANYTGDQGY  192



>ref|XP_010261229.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Nelumbo nucifera]
Length=261

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  127  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  186

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  187  NFANATGDQGY  197



>ref|XP_003531041.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN39211.1| Chlorophyll a-b binding protein CP24 10A, chloroplastic [Glycine 
soja]
Length=258

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWSKTAE
Sbjct  124  GVPWFEAGADPNAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAE  183

Query  35   NFANFTGEQGY  3
            NF N TGEQGY
Sbjct  184  NFGNSTGEQGY  194



>ref|XP_009387775.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  127  GVPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  186

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  187  NFANATGDQGY  197



>ref|XP_009362479.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009362480.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Pyrus x bretschneideri]
Length=257

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDF++ +SQS++WATPWSKTAE
Sbjct  123  GVPWFEAGADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  183  NFANATGEQGY  193



>ref|XP_004300703.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=257

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWF+AGADP A+APFSFGSLLGTQLLLMGWVESKRWVDF++ +SQS++WATPWSKTAE
Sbjct  123  GVPWFQAGADPSAVAPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTAE  182

Query  35   NFANFTGEQGY  3
            NF+NFTGEQGY
Sbjct  183  NFSNFTGEQGY  193



>ref|XP_002303160.2| hypothetical protein POPTR_0003s01450g [Populus trichocarpa]
 gb|EEE78139.2| hypothetical protein POPTR_0003s01450g [Populus trichocarpa]
Length=334

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  200  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  259

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  260  NFANATGDQGY  270



>ref|XP_006303285.1| hypothetical protein CARUB_v10010058mg [Capsella rubella]
 gb|EOA36183.1| hypothetical protein CARUB_v10010058mg [Capsella rubella]
Length=258

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA+P AIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  124  GVPWFEAGAEPSAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>gb|EYU39149.1| hypothetical protein MIMGU_mgv1a012260mg [Erythranthe guttata]
Length=256

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFE GA PGA+APFSFGSLLGTQL LMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  122  GIPWFEVGAAPGAVAPFSFGSLLGTQLFLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  181

Query  35   NFANFTGEQGY  3
            NFANFTGEQGY
Sbjct  182  NFANFTGEQGY  192



>gb|KHN33514.1| Chlorophyll a-b binding protein CP24 10A, chloroplastic [Glycine 
soja]
Length=260

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFG+LLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  126  GVPWFEAGADPNAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  185

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  186  NFANATGEQGY  196



>ref|XP_006827820.1| hypothetical protein AMTR_s00009p00268360 [Amborella trichopoda]
 gb|ERM95236.1| hypothetical protein AMTR_s00009p00268360 [Amborella trichopoda]
Length=252

 Score =   133 bits (334),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWF+AGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+T+E
Sbjct  118  GIPWFKAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTSE  177

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  178  NFANATGEQGY  188



>dbj|BAI52949.1| light-harvesting complex II protein [Citrullus lanatus subsp. 
vulgaris]
Length=255

 Score =   132 bits (333),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQ+++WATPW +TAE
Sbjct  121  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQAVEWATPWLRTAE  180

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  181  NFANTTGEQGY  191



>gb|KHN31645.1| Chlorophyll a-b binding protein CP24 10B, chloroplastic [Glycine 
soja]
Length=232

 Score =   132 bits (332),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  98   GVPWFEAGADPNAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  157

Query  35   NFANFTGEQGY  3
            NF N TGEQGY
Sbjct  158  NFGNSTGEQGY  168



>gb|AFA36512.1| chloroplast a/b binding protein cab-PhE11, partial [Lolium perenne]
Length=160

 Score =   130 bits (326),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+ WFEAGA PGA+APFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  26   GVAWFEAGAQPGAVAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  85

Query  35   NFANFTGEQGY  3
            NF+N TGEQGY
Sbjct  86   NFSNSTGEQGY  96



>ref|XP_010537903.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010537904.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=257

 Score =   132 bits (333),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS+DWATPWS+TA 
Sbjct  123  GIPWFEAGADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVDWATPWSRTAG  182

Query  35   NFANFTGEQGY  3
            NF+N TGEQGY
Sbjct  183  NFSNATGEQGY  193



>ref|XP_004485563.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Cicer arietinum]
Length=260

 Score =   132 bits (333),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFG+LLGTQL+LMGWVESKRWVDFF+ DSQSI+WATPWSKTAE
Sbjct  126  GVPWFEAGADPNAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSIEWATPWSKTAE  185

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  186  NFANATGDQGY  196



>ref|XP_002892885.1| Lhcb6 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69144.1| Lhcb6 protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   132 bits (332),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  122  GVPWFEAGAQPEAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  181

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  182  NFANYTGDQGY  192



>ref|XP_007223489.1| hypothetical protein PRUPE_ppa010195mg [Prunus persica]
 ref|XP_008218907.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Prunus mume]
 gb|EMJ24688.1| hypothetical protein PRUPE_ppa010195mg [Prunus persica]
Length=259

 Score =   132 bits (333),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDF++ +SQSI+WATPWSKT+E
Sbjct  125  GVPWFEAGADPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSIEWATPWSKTSE  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANATGEQGY  195



>gb|ACF05842.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   130 bits (326),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WA PWSKTAE
Sbjct  89   GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWAPPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>gb|KDP27379.1| hypothetical protein JCGZ_20203 [Jatropha curcas]
Length=254

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AI PFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  120  GVPWFEAGADPEAIKPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  179

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  180  NFANATGEQGY  190



>gb|ACU15016.1| unknown [Glycine max]
Length=247

 Score =   132 bits (331),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFG+LLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWS+T+E
Sbjct  127  GVPWFEAGADPNAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTSE  186

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  187  NFANATGEQGY  197



>ref|XP_010065599.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW63168.1| hypothetical protein EUGRSUZ_G00777 [Eucalyptus grandis]
Length=259

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP AIAPFSFG+LLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  125  GIPWFEAGADPSAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  184

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  185  NFANATGDQGY  195



>ref|XP_003531552.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Glycine max]
 gb|KHN26736.1| Chlorophyll a-b binding protein CP24 10A, chloroplastic [Glycine 
soja]
Length=261

 Score =   132 bits (332),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFG+LLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWS+T+E
Sbjct  127  GVPWFEAGADPNAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTSE  186

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  187  NFANATGEQGY  197



>gb|ACF05831.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   130 bits (326),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEA ADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  89   GIPWFEACADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>gb|ACF05841.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   129 bits (325),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEA ADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  89   GIPWFEACADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>gb|ACF05832.1| chloroplast light-harvesting complex II protein [Populus tremula]
Length=174

 Score =   129 bits (325),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEA ADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  89   GIPWFEACADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAE  148

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  149  NFANATGDQGY  159



>ref|XP_009379581.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Pyrus x bretschneideri]
Length=259

 Score =   132 bits (331),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP AI+PFSFGSLLGTQLLLMGWVESKRWVDF++ +SQS++WATPWSKT+E
Sbjct  125  GIPWFEAGADPSAISPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTSE  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANATGEQGY  195



>ref|XP_007159087.1| hypothetical protein PHAVU_002G207500g [Phaseolus vulgaris]
 gb|ESW31081.1| hypothetical protein PHAVU_002G207500g [Phaseolus vulgaris]
Length=258

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  124  GVPWFEAGADPNAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  183

Query  35   NFANFTGEQGY  3
            NF+N TG+QGY
Sbjct  184  NFSNSTGDQGY  194



>ref|XP_008391511.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Malus domestica]
Length=259

 Score =   131 bits (330),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADP AI+PFSFGSLLGTQLLLMGWVESKRWVDF++ +SQS++WATPWSKT+E
Sbjct  125  GIPWFEAGADPSAISPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTSE  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANSTGEQGY  195



>gb|ACU23773.1| unknown [Glycine max]
Length=258

 Score =   131 bits (329),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DS S++WATPWSKTAE
Sbjct  124  GVPWFEAGADPNAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSLSVEWATPWSKTAE  183

Query  35   NFANFTGEQGY  3
            NF N TGEQGY
Sbjct  184  NFGNSTGEQGY  194



>gb|EAZ30952.1| hypothetical protein OsJ_15029 [Oryza sativa Japonica Group]
Length=236

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQ+++WATPWS+TAE
Sbjct  102  GVPWFEAGAQPEAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAE  161

Query  35   NFANFTGEQGY  3
            NF+N TGEQGY
Sbjct  162  NFSNATGEQGY  172



>ref|NP_001236415.1| uncharacterized protein LOC100527463 [Glycine max]
 gb|ACU16555.1| unknown [Glycine max]
Length=259

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFG+LLGTQL+LMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  126  GVPWFEAGADPNAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  185

Query  35   NFANFTGEQGY  3
            NFAN +GE GY
Sbjct  186  NFANASGEHGY  196



>gb|AAD28777.1|AF134130_1 Lhcb6 protein [Arabidopsis thaliana]
Length=258

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+ WFEAGA P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWSKTAE
Sbjct  124  GVAWFEAGAQPDAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>ref|NP_173034.1| light harvesting complex photosystem II subunit 6 [Arabidopsis 
thaliana]
 gb|AAF82152.1|AC034256_16 Identical to Lhcb6 protein from Arabidopsis thaliana gb|AF134130 
and is a member of the Chlorophyll A-B binding proteins 
PF|00504. ESTs gb|AI100562, gb|AI999227, gb|AA067457, gb|BE037598, 
gb|BE039058, gb|BE038945, gb|BE038657, gb|BE038604, gb|H76294, 
gb|H77256, gb|N65776, gb|N38000, gb|R90377, gb|R90578, 
gb|R90082, gb|T44923, gb|T76598, gb|T04144, gb|T43786, 
gb|T76834, gb|T04153, gb|T45475, gb|T76179, gb|T46781, gb|T45938, 
gb|T45430, gb|W43165, gb|Z18774 come from this gene [Arabidopsis 
thaliana]
 gb|AAG48788.1|AF332425_1 putative chlorophyll binding protein [Arabidopsis thaliana]
 gb|AAL38289.1| Lhcb6 protein [Arabidopsis thaliana]
 gb|AAM10206.1| chlorophyll A-B binding protein [Arabidopsis thaliana]
 gb|AEE29369.1| light harvesting complex photosystem II subunit 6 [Arabidopsis 
thaliana]
Length=258

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+ WFEAGA P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWSKTAE
Sbjct  124  GVAWFEAGAQPDAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>ref|XP_003579885.1| PREDICTED: chlorophyll a-b binding protein CP24, chloroplastic 
[Brachypodium distachyon]
Length=256

 Score =   129 bits (324),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA PGA+APFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQ+++WATPWS+TA+
Sbjct  122  GVPWFEAGAQPGAVAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAD  181

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  182  NFANSTGDQGY  192



>ref|NP_001052969.1| Os04g0457000 [Oryza sativa Japonica Group]
 emb|CAD40888.1| OSJNBa0036B21.6 [Oryza sativa Japonica Group]
 dbj|BAF14883.1| Os04g0457000 [Oryza sativa Japonica Group]
 gb|EAY94371.1| hypothetical protein OsI_16135 [Oryza sativa Indica Group]
 gb|EAY94374.1| hypothetical protein OsI_16138 [Oryza sativa Indica Group]
 dbj|BAG96969.1| unnamed protein product [Oryza sativa Japonica Group]
Length=252

 Score =   129 bits (324),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQ+++WATPWS+TAE
Sbjct  118  GVPWFEAGAQPEAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAE  177

Query  35   NFANFTGEQGY  3
            NF+N TGEQGY
Sbjct  178  NFSNATGEQGY  188



>ref|XP_010459118.1| PREDICTED: chlorophyll a-b binding protein CP24 10B, chloroplastic-like 
[Camelina sativa]
Length=261

 Score =   129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 3/74 (4%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQS---IDWATPWSK  45
            G+PWFEAGA+P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS   ++WATPWS+
Sbjct  124  GVPWFEAGAEPSAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEXVEWATPWSR  183

Query  44   TAENFANFTGEQGY  3
            TAENFAN+TG+QGY
Sbjct  184  TAENFANYTGDQGY  197



>ref|XP_006653476.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Oryza brachyantha]
Length=281

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+ WFEAGA P AIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  147  GVAWFEAGAQPEAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  206

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  207  NFANATGEQGY  217



>emb|CAH67022.1| H0523F07.10 [Oryza sativa Indica Group]
Length=252

 Score =   127 bits (319),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA P AIAPFS GSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  118  GVPWFEAGAQPEAIAPFSSGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  177

Query  35   NFANFTGEQGY  3
            NF+N TGEQGY
Sbjct  178  NFSNATGEQGY  188



>ref|XP_009381511.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=149

 Score =   122 bits (306),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGAD GAIAPFSFGSLLG QL+ MG VESKRWVDFF+ +SQS++WATPW +TAE
Sbjct  15   GVPWFEAGADLGAIAPFSFGSLLGMQLIFMGRVESKRWVDFFNLESQSVEWATPWYRTAE  74

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  75   NFANATGEQGY  85



>ref|XP_001757538.1| predicted protein [Physcomitrella patens]
 ref|XP_001757640.1| predicted protein [Physcomitrella patens]
 gb|EDQ77595.1| predicted protein [Physcomitrella patens]
 gb|EDQ77697.1| predicted protein [Physcomitrella patens]
Length=219

 Score =   121 bits (304),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP A+APFSFGSLLGTQLLLMGWVE+KRW+DF +  +QS++WATPWS+TAE
Sbjct  85   GVPWFEAGADPAALAPFSFGSLLGTQLLLMGWVETKRWIDFLNPGTQSVEWATPWSRTAE  144

Query  35   NFANFTGEQGY  3
            NF N TG QGY
Sbjct  145  NFNNSTGLQGY  155



>sp|P36494.1|CB4_SPIOL RecName: Full=Chlorophyll a-b binding protein CP24, chloroplastic; 
Flags: Precursor [Spinacia oleracea]
 emb|CAA81105.1| 20 kDa protein of CP24 precursor protein [Spinacia oleracea]
Length=261

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFFD DSQS++WATPWS+TAE
Sbjct  127  GIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAE  186

Query  35   NFANFTGEQGY  3
            NF+N TGEQGY
Sbjct  187  NFSNSTGEQGY  197



>ref|XP_010666865.1| PREDICTED: chlorophyll a-b binding protein CP24, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=266

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFFD DSQS++WATPWS+TAE
Sbjct  132  GIPWFEAGADPGALAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAE  191

Query  35   NFANFTGEQGY  3
            NF+N TGEQGY
Sbjct  192  NFSNATGEQGY  202



>gb|AAX23999.1| chloroplast chlorophyll a/b-binding protein CP24 precursor, partial 
[Fragaria x ananassa]
Length=147

 Score =   111 bits (277),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWF+AGADP A+APFSFG+LLGTQLLLMGWVESKRWVDF++ +SQS++WATPWSKTAE
Sbjct  32   GVPWFQAGADPSAVAPFSFGTLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTAE  91

Query  35   NFANFTGEQGY  3
            NF+NFTGEQGY
Sbjct  92   NFSNFTGEQGY  102



>emb|CDY33376.1| BnaC05g12070D [Brassica napus]
Length=258

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGADP AIAPFSFG+LLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  124  GVPWFEAGADPRAIAPFSFGTLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  183

Query  35   NFANFTGEQGY  3
            NFAN+TG+QGY
Sbjct  184  NFANYTGDQGY  194



>ref|XP_010030053.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW57010.1| hypothetical protein EUGRSUZ_I02677 [Eucalyptus grandis]
Length=260

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGA PGA+APFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS++WATPWS+TAE
Sbjct  126  GIPWFEAGAAPGAVAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSRTAE  185

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  186  NFANATGDQGY  196



>ref|XP_008368146.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Malus domestica]
Length=297

 Score =   112 bits (279),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G PWF+AGADPGAIAPFSFG+LLGTQLLLMGWVESKRWVDF++ +SQS++WATPWSKTAE
Sbjct  163  GXPWFQAGADPGAIAPFSFGTLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSKTAE  222

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  223  NFANATGEQGY  233



>ref|XP_008809318.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Phoenix dactylifera]
Length=257

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWF+AGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  123  GVPWFKAGADPGALAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  183  NFANATGDQGY  193



>gb|ACA13177.1| chloroplast a/b binding protein cab-PhE11 [Phyllostachys edulis]
Length=252

 Score =   110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA PGA+APFSFG+LLGTQLLLMGWVESKRWVDFF  DSQS++WATPWS+TA+
Sbjct  118  GVPWFEAGAQPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFSPDSQSVEWATPWSRTAD  177

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  178  NFANATGEQGY  188



>gb|AEW70714.1| light harvesting chlorophyll a-b binding protein 6 [Phyllostachys 
edulis]
Length=250

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA PGA+APFSFG+LLGTQLLLMGWVESKRWVDFF  DSQS++WATPWS+TA+
Sbjct  116  GVPWFEAGAQPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFSPDSQSVEWATPWSRTAD  175

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  176  NFANATGEQGY  186



>ref|XP_002986118.1| light-harvesting complex [Selaginella moellendorffii]
 ref|XP_002989669.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ09339.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ12937.1| light-harvesting complex [Selaginella moellendorffii]
Length=259

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGA PGA+APFSFGSLLGTQLLLMGWVESKR+VDFF+ ++Q+++WATPWS+TA 
Sbjct  125  GIPWFEAGAAPGAVAPFSFGSLLGTQLLLMGWVESKRYVDFFEPNTQAVEWATPWSRTAV  184

Query  35   NFANFTGEQGY  3
            NFAN TG QGY
Sbjct  185  NFANSTGLQGY  195



>gb|AFR32945.1| light-harvesting complex photosystem II, partial [Selaginella 
martensii]
Length=226

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            G+PWFEAGA PGA+APFSFGSLLGTQLLLMGWVESKR+VDFFD  +Q+++WATPWS+TA 
Sbjct  92   GVPWFEAGAAPGAVAPFSFGSLLGTQLLLMGWVESKRYVDFFDPGTQALEWATPWSRTAS  151

Query  35   NFANFTGEQGY  3
            NF N TG QGY
Sbjct  152  NFGNSTGLQGY  162



>ref|XP_006385220.1| hypothetical protein POPTR_0003s01450g [Populus trichocarpa]
 gb|ERP63017.1| hypothetical protein POPTR_0003s01450g [Populus trichocarpa]
Length=261

 Score =   100 bits (250),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWAT  57
            GIPWFEAGADPGAIAPFSFGSLLGTQL+LMGWVESKRWVDFF+ +SQS++WA 
Sbjct  200  GIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWAC  252



>emb|CDO97468.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 94.7 bits (234),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQS  72
            GIPWF+AGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ DSQS
Sbjct  125  GIPWFQAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQS  172



>gb|ABS58590.1| chloroplast light-harvesting complex b6 [Scutellaria baicalensis]
Length=125

 Score = 90.5 bits (223),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGA PGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKTAE
Sbjct  17   GIPWFEAGAAPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTAE  76

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  77   NFANATGEQGY  87



>ref|XP_002263201.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Vitis vinifera]
 emb|CAN71620.1| hypothetical protein VITISV_015544 [Vitis vinifera]
Length=257

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGA PGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  123  GIPWFEAGAAPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  182

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  183  NFANATGEQGY  193



>gb|EYU18497.1| hypothetical protein MIMGU_mgv1a012167mg [Erythranthe guttata]
Length=259

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGA PGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWSKT+E
Sbjct  125  GIPWFEAGAAPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSKTSE  184

Query  35   NFANFTGEQGY  3
            NFAN TGEQGY
Sbjct  185  NFANSTGEQGY  195



>ref|XP_011087853.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic 
[Sesamum indicum]
Length=256

 Score = 89.4 bits (220),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGA PGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  122  GIPWFEAGAAPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  181

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  182  NFANATGDQGY  192



>ref|XP_011092414.1| PREDICTED: chlorophyll a-b binding protein CP24 10A, chloroplastic-like 
[Sesamum indicum]
Length=253

 Score = 89.4 bits (220),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  215  GIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAE  36
            GIPWFEAGA PGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAE
Sbjct  119  GIPWFEAGAAPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAE  178

Query  35   NFANFTGEQGY  3
            NFAN TG+QGY
Sbjct  179  NFANATGDQGY  189



>gb|ACG39852.1| hypothetical protein [Zea mays]
Length=106

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  MGWVESKRWVDFFDNDSQSIDWATPWSKTAENFANFTGEQGY  3
            MGWVESKRWVDFF+ DSQ+++WATPWS+TAENFANFTGEQGY
Sbjct  1    MGWVESKRWVDFFNPDSQAVEWATPWSRTAENFANFTGEQGY  42



>emb|CDX83968.1| BnaC08g16770D [Brassica napus]
Length=37

 Score = 63.9 bits (154),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -3

Query  128  MGWVESKRWVDFFDNDSQSIDWATPWSKTAENFA  27
            MGWV+SKRWVDFF+ DSQS++WATPWS+TAENFA
Sbjct  1    MGWVDSKRWVDFFNPDSQSVEWATPWSRTAENFA  34



>tpg|DAA35392.1| TPA: hypothetical protein ZEAMMB73_596183, partial [Zea mays]
Length=42

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/24 (100%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -3

Query  188  DPGAIAPFSFGSLLGTQLLLMGWV  117
            DPGAIAPFSFGSLLGTQLLLMGWV
Sbjct  19   DPGAIAPFSFGSLLGTQLLLMGWV  42



>emb|CAA50763.1| light harvesting complex I chlorophyll binding protein [Pyrobotrys 
stellata]
Length=260

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = -3

Query  206  WFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWA  60
            W+EAG       P+S GSL  T  LLMGW E KR  DF    SQ++ WA
Sbjct  109  WWEAGKVVAESGPWSMGSLTFTMFLLMGWAEHKRLYDFVKPGSQAVGWA  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509447715952