BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34678_g1_i1 len=901 path=[879:0-900]

Length=901
                                                                      Score     E

ref|XP_011087364.1|  PREDICTED: DNA-damage-repair/toleration prot...  90.5    3e-29   
emb|CAE76632.1|  leucine rich repeat protein                          93.6    1e-28   Cicer arietinum [garbanzo]
ref|XP_004514841.1|  PREDICTED: DNA-damage-repair/toleration prot...  93.6    2e-28   
gb|ACE97232.1|  leucine rich repeat protein                           96.3    4e-28   Populus tremula [European aspen]
gb|ACE97229.1|  leucine rich repeat protein                           96.3    4e-28   Populus tremula [European aspen]
ref|XP_011093532.1|  PREDICTED: DNA-damage-repair/toleration prot...  87.0    5e-28   
gb|ACE97234.1|  leucine rich repeat protein                           96.3    2e-27   Populus tremula [European aspen]
gb|ACE97231.1|  leucine rich repeat protein                           96.3    2e-27   Populus tremula [European aspen]
gb|ACE97245.1|  leucine rich repeat protein                           96.3    2e-27   Populus tremula [European aspen]
emb|CDP07735.1|  unnamed protein product                              79.7    3e-27   
ref|XP_004229610.1|  PREDICTED: DNA-damage-repair/toleration prot...  85.1    4e-27   
ref|XP_008461788.1|  PREDICTED: DNA-damage-repair/toleration prot...  85.9    7e-27   
gb|EYU27081.1|  hypothetical protein MIMGU_mgv1a008561mg              84.7    7e-27   
gb|AFK38065.1|  unknown                                               91.3    9e-27   
ref|XP_003599106.1|  DNA-damage-repair/toleration protein DRT100      90.9    1e-26   
gb|ACJ85058.1|  unknown                                               90.9    1e-26   Medicago truncatula
ref|XP_002313289.1|  DNA-damage-repair/toleration protein DRT100 ...  92.8    2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009766712.1|  PREDICTED: DNA-damage-repair/toleration prot...  86.7    2e-26   
gb|EYU31352.1|  hypothetical protein MIMGU_mgv1a018246mg              89.4    3e-26   
ref|XP_009623381.1|  PREDICTED: DNA-damage-repair/toleration prot...  85.9    3e-26   
ref|XP_011007343.1|  PREDICTED: DNA-damage-repair/toleration prot...  92.0    4e-26   
ref|XP_011025407.1|  PREDICTED: DNA-damage-repair/toleration prot...  91.7    4e-26   
gb|EPS67382.1|  hypothetical protein M569_07393                       87.4    4e-26   
ref|NP_001268187.1|  DNA-damage-repair/toleration protein DRT100-...  90.1    5e-26   
ref|XP_006660260.1|  PREDICTED: DNA-damage-repair/toleration prot...  89.4    7e-26   
gb|EYU45210.1|  hypothetical protein MIMGU_mgv1a023427mg              86.3    7e-26   
ref|XP_007220472.1|  hypothetical protein PRUPE_ppa007530mg           90.9    1e-25   
gb|ABK94260.1|  unknown                                               92.8    1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010544847.1|  PREDICTED: DNA-damage-repair/toleration prot...  88.2    4e-25   
ref|XP_008231308.1|  PREDICTED: DNA-damage-repair/toleration prot...  89.4    4e-25   
ref|XP_008375150.1|  PREDICTED: DNA-damage-repair/toleration prot...  88.2    4e-25   
ref|XP_009390646.1|  PREDICTED: DNA-damage-repair/toleration prot...  95.1    4e-25   
ref|NP_001062185.1|  Os08g0505900                                     85.9    5e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008350016.1|  PREDICTED: DNA-damage-repair/toleration prot...  89.0    5e-25   
ref|XP_011025084.1|  PREDICTED: DNA-damage-repair/toleration prot...  90.1    6e-25   
ref|XP_009795492.1|  PREDICTED: DNA-damage-repair/toleration prot...  85.5    6e-25   
ref|XP_011087290.1|  PREDICTED: DNA-damage-repair/toleration prot...  86.7    7e-25   
ref|XP_010091334.1|  hypothetical protein L484_000482                 87.0    7e-25   
ref|XP_010913131.1|  PREDICTED: DNA-damage-repair/toleration prot...  90.9    9e-25   
ref|XP_009365014.1|  PREDICTED: DNA-damage-repair/toleration prot...  88.2    1e-24   
ref|XP_010067884.1|  PREDICTED: DNA-damage-repair/toleration prot...  89.4    1e-24   
ref|XP_008791578.1|  PREDICTED: DNA-damage-repair/toleration prot...  91.3    1e-24   
ref|XP_003627718.1|  DNA-damage-repair/toleration protein DRT100      89.7    1e-24   
ref|XP_007052566.1|  Serine-threonine protein kinase, plant-type,...  82.8    2e-24   
gb|KDP43447.1|  hypothetical protein JCGZ_16734                       87.4    3e-24   
gb|ABO47744.1|  polygalacturonase-inhibiting protein                  84.0    3e-24   Gossypium hirsutum [American cotton]
ref|XP_011090389.1|  PREDICTED: DNA-damage-repair/toleration prot...  87.8    3e-24   
ref|XP_006850131.1|  hypothetical protein AMTR_s00022p00230910        82.4    5e-24   
ref|XP_009354707.1|  PREDICTED: DNA-damage-repair/toleration prot...  86.7    6e-24   
ref|XP_010257339.1|  PREDICTED: DNA-damage-repair/toleration prot...  78.6    8e-24   
ref|XP_004510977.1|  PREDICTED: DNA-damage-repair/toleration prot...  85.9    9e-24   
ref|XP_009417308.1|  PREDICTED: DNA-damage-repair/toleration prot...  91.3    1e-23   
ref|XP_004973861.1|  PREDICTED: DNA-damage-repair/toleration prot...  81.3    1e-23   
ref|XP_002513181.1|  serine-threonine protein kinase, plant-type,...  84.0    2e-23   Ricinus communis
gb|KDO83367.1|  hypothetical protein CISIN_1g017912mg                 84.7    2e-23   
ref|XP_006438982.1|  hypothetical protein CICLE_v10031896mg           84.7    2e-23   
gb|AHY03429.1|  lrr protein                                           85.1    3e-23   
ref|XP_009590650.1|  PREDICTED: DNA-damage-repair/toleration prot...  83.2    3e-23   
ref|NP_001241507.1|  DNA-damage-repair/toleration protein DRT100-...  77.4    4e-23   
ref|XP_006299860.1|  hypothetical protein CARUB_v10016063mg           88.2    5e-23   
ref|XP_007149050.1|  hypothetical protein PHAVU_005G036600g           79.3    5e-23   
ref|XP_009120492.1|  PREDICTED: DNA-damage-repair/toleration prot...  87.4    5e-23   
ref|XP_010673595.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.4    6e-23   
ref|XP_010265772.1|  PREDICTED: DNA-damage-repair/toleration prot...  80.1    7e-23   
ref|XP_009394996.1|  PREDICTED: DNA-damage-repair/toleration prot...  89.7    8e-23   
gb|EYU46293.1|  hypothetical protein MIMGU_mgv1a008423mg              84.7    1e-22   
ref|XP_008219342.1|  PREDICTED: DNA-damage-repair/toleration prot...  81.6    1e-22   
ref|XP_009803455.1|  PREDICTED: DNA-damage-repair/toleration prot...  84.0    1e-22   
ref|XP_010486984.1|  PREDICTED: DNA-damage-repair/toleration prot...  87.4    1e-22   
ref|XP_010499242.1|  PREDICTED: DNA-damage-repair/toleration prot...  87.4    1e-22   
gb|AFB75322.1|  leucine-rich repeat receptor-like protein             79.0    1e-22   
gb|KHN29211.1|  DNA-damage-repair/toleration protein DRT100           78.6    2e-22   
emb|CDY52664.1|  BnaC01g38540D                                        87.0    2e-22   
gb|ACM89582.1|  leucine rich repeat protein                           79.0    2e-22   Glycine max [soybeans]
ref|XP_007205432.1|  hypothetical protein PRUPE_ppa007765mg           80.5    2e-22   
ref|XP_011080256.1|  PREDICTED: DNA-damage-repair/toleration prot...  82.0    2e-22   
ref|NP_001241499.1|  DNA-damage-repair/toleration protein DRT100-...  81.3    3e-22   
gb|EPS65874.1|  hypothetical protein M569_08903                       82.4    3e-22   
dbj|BAJ98015.1|  predicted protein                                    77.8    3e-22   
ref|XP_004250859.1|  PREDICTED: DNA-damage-repair/toleration prot...  82.0    3e-22   
ref|XP_002285553.1|  PREDICTED: DNA-damage-repair/toleration prot...  84.0    3e-22   Vitis vinifera
dbj|BAJ87499.1|  predicted protein                                    77.8    4e-22   
ref|XP_009420044.1|  PREDICTED: DNA-damage-repair/toleration prot...  88.2    4e-22   
emb|CDY50534.1|  BnaA01g30460D                                        86.3    4e-22   
ref|XP_009379431.1|  PREDICTED: DNA-damage-repair/toleration prot...  79.0    4e-22   
ref|XP_008349465.1|  PREDICTED: DNA-damage-repair/toleration prot...  79.0    4e-22   
ref|XP_009374638.1|  PREDICTED: DNA-damage-repair/toleration prot...  79.3    5e-22   
ref|XP_010557788.1|  PREDICTED: DNA-damage-repair/toleration prot...  84.0    5e-22   
gb|AFB75324.1|  leucine-rich repeat receptor-like protein             79.0    5e-22   
ref|XP_006354265.1|  PREDICTED: DNA-damage-repair/toleration prot...  81.6    5e-22   
ref|XP_002444779.1|  hypothetical protein SORBIDRAFT_07g027860        76.3    5e-22   Sorghum bicolor [broomcorn]
ref|XP_006407315.1|  hypothetical protein EUTSA_v10020961mg           85.1    5e-22   
gb|AFB75323.1|  leucine-rich repeat receptor-like protein             79.0    6e-22   
ref|XP_010536054.1|  PREDICTED: DNA-damage-repair/toleration prot...  85.9    6e-22   
dbj|BAJ34133.1|  unnamed protein product                              85.1    6e-22   
ref|XP_008354996.1|  PREDICTED: DNA-damage-repair/toleration prot...  78.6    7e-22   
ref|XP_004295208.1|  PREDICTED: DNA-damage-repair/toleration prot...  84.3    7e-22   
gb|KDP20186.1|  hypothetical protein JCGZ_07906                       81.6    9e-22   
ref|XP_007014956.1|  Leucine-rich repeat (LRR) family protein         84.0    1e-21   
ref|NP_187867.1|  DNA-damage-repair/toleration protein DRT100         87.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006493666.1|  PREDICTED: DNA-damage-repair/toleration prot...  78.2    2e-21   
gb|KDO64852.1|  hypothetical protein CISIN_1g017578mg                 78.2    2e-21   
ref|XP_010527663.1|  PREDICTED: DNA-damage-repair/toleration prot...  82.4    2e-21   
ref|XP_009110137.1|  PREDICTED: DNA-damage-repair/toleration prot...  81.3    3e-21   
gb|ABD46739.1|  leucine-rich repeat protein                           79.3    3e-21   Nicotiana tabacum [American tobacco]
ref|XP_009617306.1|  PREDICTED: DNA-damage-repair/toleration prot...  79.3    3e-21   
ref|XP_009135241.1|  PREDICTED: DNA-damage-repair/toleration prot...  81.6    3e-21   
ref|NP_001241713.1|  uncharacterized protein LOC100856891 precursor   79.7    3e-21   
emb|CDY60388.1|  BnaA01g36810D                                        81.3    3e-21   
ref|NP_001150670.1|  polygalacturonase inhibitor 2                    79.7    3e-21   Zea mays [maize]
ref|XP_002303879.1|  polygalacturonase inhibitor-like family protein  79.0    3e-21   Populus trichocarpa [western balsam poplar]
emb|CDY00787.1|  BnaC03g37710D                                        81.6    3e-21   
emb|CDP15759.1|  unnamed protein product                              80.5    3e-21   
ref|XP_011037855.1|  PREDICTED: DNA-damage-repair/toleration prot...  78.2    4e-21   
ref|XP_004306517.1|  PREDICTED: DNA-damage-repair/toleration prot...  82.8    4e-21   
tpg|DAA47950.1|  TPA: polygalacturonase inhibitor 2                   79.3    4e-21   
emb|CDY27559.1|  BnaC01g32420D                                        80.1    4e-21   
ref|XP_006446033.1|  hypothetical protein CICLE_v10015508mg           77.0    4e-21   
gb|KFK38609.1|  hypothetical protein AALP_AA3G136400                  85.1    6e-21   
ref|XP_010091979.1|  DNA-damage-repair/toleration protein             80.9    6e-21   
ref|XP_006446037.1|  hypothetical protein CICLE_v10015677mg           83.2    9e-21   
ref|XP_002299240.1|  polygalacturonase inhibitor-like family protein  78.2    1e-20   Populus trichocarpa [western balsam poplar]
emb|CDX73812.1|  BnaA03g32350D                                        81.6    2e-20   
ref|NP_001240925.1|  DNA-damage-repair/toleration protein DRT100-...  81.3    2e-20   
ref|NP_188718.1|  leucine-rich repeat-containing protein              80.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142131.1|  PREDICTED: DNA-damage-repair/toleration prot...  79.0    2e-20   
ref|XP_006298942.1|  hypothetical protein CARUB_v10015066mg           79.3    2e-20   
ref|XP_002884914.1|  DNA-damage repair/toleration 100                 87.0    2e-20   
gb|KFK39397.1|  hypothetical protein AALP_AA3G239800                  78.6    2e-20   
ref|XP_008449738.1|  PREDICTED: DNA-damage-repair/toleration prot...  79.3    3e-20   
ref|XP_004149603.1|  PREDICTED: DNA-damage-repair/toleration prot...  67.8    3e-20   
ref|XP_011042054.1|  PREDICTED: DNA-damage-repair/toleration prot...  75.9    3e-20   
ref|XP_002883270.1|  leucine-rich repeat family protein               79.0    3e-20   
gb|KGN58604.1|  Leucine rich repeat protein                           67.8    4e-20   
gb|KFK25532.1|  hypothetical protein AALP_AA8G127300                  78.6    4e-20   
ref|XP_010045004.1|  PREDICTED: DNA-damage-repair/toleration prot...  80.9    6e-20   
ref|XP_007150390.1|  hypothetical protein PHAVU_005G149200g           82.0    6e-20   
ref|XP_010466290.1|  PREDICTED: DNA-damage-repair/toleration prot...  78.2    7e-20   
emb|CDP15760.1|  unnamed protein product                              77.4    7e-20   
ref|XP_010509390.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.0    1e-19   
ref|XP_010488069.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.0    1e-19   
ref|XP_009145581.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.4    1e-19   
dbj|BAJ33628.1|  unnamed protein product                              74.7    3e-19   
ref|XP_003572360.1|  PREDICTED: DNA-damage-repair/toleration prot...  65.9    4e-19   
ref|XP_010031829.1|  PREDICTED: DNA-damage-repair/toleration prot...  73.6    4e-19   
gb|KHN00811.1|  DNA-damage-repair/toleration protein DRT100           70.1    5e-19   
ref|XP_010551035.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.0    5e-19   
ref|XP_006369639.1|  hypothetical protein POPTR_0001s27660g           71.6    5e-19   
ref|XP_007133826.1|  hypothetical protein PHAVU_011G212100g           69.7    7e-19   
ref|XP_006493681.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.4    8e-19   
ref|XP_010492030.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.4    8e-19   
ref|XP_010453346.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.4    9e-19   
emb|CDX85681.1|  BnaA02g01320D                                        76.6    1e-18   
emb|CDY06385.1|  BnaC05g31450D                                        74.7    1e-18   
ref|XP_009125872.1|  PREDICTED: DNA-damage-repair/toleration prot...  76.6    1e-18   
ref|XP_010419853.1|  PREDICTED: DNA-damage-repair/toleration prot...  77.4    1e-18   
ref|XP_006289832.1|  hypothetical protein CARUB_v10003437mg           77.8    1e-18   
ref|XP_007131991.1|  hypothetical protein PHAVU_011G057600g           72.4    6e-18   
ref|XP_003555428.1|  PREDICTED: DNA-damage-repair/toleration prot...  67.0    2e-17   
ref|XP_004507136.1|  PREDICTED: DNA-damage-repair/toleration prot...  79.0    2e-17   
ref|XP_002871534.1|  hypothetical protein ARALYDRAFT_909242           73.2    3e-17   
gb|ACU27355.1|  polygalacturonase inhibiting protein                  64.7    7e-17   Panax ginseng [Asiatic ginseng]
ref|XP_006399780.1|  hypothetical protein EUTSA_v10013835mg           72.4    7e-17   
ref|XP_003539410.2|  PREDICTED: DNA-damage-repair/toleration prot...  77.8    9e-17   
gb|KHN24357.1|  DNA-damage-repair/toleration protein DRT100           67.8    1e-16   
ref|XP_006595269.1|  PREDICTED: DNA-damage-repair/toleration prot...  67.4    1e-16   
gb|AAK64162.1|  unknown protein                                       70.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65656.1|  leucine rich repeat protein, putative                 70.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91155.1|  BnaC02g04420D                                        70.1    1e-16   
ref|NP_196798.1|  leucine-rich repeat-containing protein              70.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003537957.1|  PREDICTED: DNA-damage-repair/toleration prot...  72.4    2e-16   
ref|XP_004507113.1|  PREDICTED: DNA-damage-repair/toleration prot...  72.0    3e-16   
emb|CDY69775.1|  BnaAnng31490D                                        70.9    3e-16   
emb|CDY68308.1|  BnaA10g30080D                                        71.2    4e-16   
ref|XP_009121823.1|  PREDICTED: DNA-damage-repair/toleration prot...  71.2    5e-16   
ref|XP_003592471.1|  DNA-damage-repair/toleration protein DRT100      67.0    1e-15   
gb|ACJ86289.1|  unknown                                               67.0    1e-15   Medicago truncatula
ref|XP_003540709.2|  PREDICTED: DNA-damage-repair/toleration prot...  72.4    1e-15   
ref|XP_002513458.1|  serine-threonine protein kinase, plant-type,...  84.0    4e-15   Ricinus communis
ref|XP_010445380.1|  PREDICTED: DNA-damage-repair/toleration prot...  82.0    5e-15   
emb|CAD56505.1|  polygalacturonase inhibitor-like protein             80.9    3e-14   Cicer arietinum [garbanzo]
ref|XP_004486948.1|  PREDICTED: DNA-damage-repair/toleration prot...  80.9    5e-14   
ref|XP_003597454.1|  DNA-damage-repair/toleration protein DRT100      80.1    1e-13   
gb|KEH30247.1|  leucine-rich receptor-like kinase family protein      57.4    2e-11   
ref|XP_009121824.1|  PREDICTED: DNA-damage-repair/toleration prot...  73.2    2e-11   
emb|CDY69275.1|  BnaCnng62760D                                        72.8    4e-11   
emb|CBN79590.1|  LRR-GTPase of the ROCO family                        57.8    8e-11   
ref|XP_003609928.1|  DNA-damage-repair/toleration protein DRT100      52.0    1e-09   
emb|CAA47109.2|  DRT 100                                              68.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|WP_013306123.1|  hypothetical protein                             47.4    2e-09   
ref|XP_010661012.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-09   
emb|CDY53975.1|  BnaA10g30070D                                        67.4    2e-09   
gb|KCW56179.1|  hypothetical protein EUGRSUZ_I01928                   50.1    3e-09   
ref|XP_010271504.1|  PREDICTED: LRR receptor-like serine/threonin...  44.7    7e-09   
gb|KCW56528.1|  hypothetical protein EUGRSUZ_I02256                   47.8    1e-08   
ref|XP_006296911.1|  hypothetical protein CARUB_v10012903mg           48.5    2e-08   
gb|KGN58605.1|  hypothetical protein Csa_3G698220                     47.4    2e-08   
ref|XP_010113397.1|  Receptor-like protein kinase 2                   48.1    2e-08   
emb|CDX70023.1|  BnaA10g23720D                                        45.4    5e-08   
ref|NP_198058.1|  receptor like protein 53                            48.5    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043950.1|  Os01g0694100                                     45.1    7e-08   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG92989.1|  unnamed protein product                              45.1    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405286.1|  PREDICTED: probable LRR receptor-like serine...  54.3    8e-08   
gb|EEE55227.1|  hypothetical protein OsJ_03104                        45.1    8e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDY36314.1|  BnaA01g31040D                                        48.5    8e-08   
emb|CDP13963.1|  unnamed protein product                              48.9    9e-08   
gb|EYU27469.1|  hypothetical protein MIMGU_mgv1a026753mg              43.1    9e-08   
ref|XP_006470750.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-07   
ref|XP_009122355.1|  PREDICTED: leucine-rich repeat receptor prot...  44.3    1e-07   
ref|XP_006446084.1|  hypothetical protein CICLE_v10017805mg           48.5    1e-07   
gb|KDO64793.1|  hypothetical protein CISIN_1g042931mg                 48.5    1e-07   
ref|XP_007021418.1|  Disease resistance family protein / LRR fami...  50.1    1e-07   
emb|CBJ26389.1|  LRR-GTPase of the ROCO family                        47.0    1e-07   
emb|CBN80251.1|  Putative leucine rich repeat protein                 45.4    1e-07   
emb|CDP09573.1|  unnamed protein product                              44.3    2e-07   
ref|XP_009780958.1|  PREDICTED: probable leucine-rich repeat rece...  45.1    2e-07   
ref|XP_010272486.1|  PREDICTED: LRR receptor-like serine/threonin...  49.7    2e-07   
ref|NP_001068106.2|  Os11g0565000                                     42.4    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568841.2|  PREDICTED: probable LRR receptor-like serine...  44.3    2e-07   
ref|XP_006399210.1|  hypothetical protein EUTSA_v10012465mg           42.7    2e-07   
ref|XP_009387278.1|  PREDICTED: probable leucine-rich repeat rece...  50.4    3e-07   
emb|CDP06297.1|  unnamed protein product                              49.3    3e-07   
ref|XP_007046768.1|  Leucine-rich repeat receptor-like protein ki...  43.1    3e-07   
gb|KHM99087.1|  Putative LRR receptor-like serine/threonine-prote...  50.8    3e-07   
ref|XP_008669002.1|  PREDICTED: probable LRR receptor-like serine...  46.2    3e-07   
emb|CAN79070.1|  hypothetical protein VITISV_031965                   48.1    3e-07   Vitis vinifera
ref|XP_006404790.1|  hypothetical protein EUTSA_v10000033mg           42.7    4e-07   
ref|XP_002457354.1|  hypothetical protein SORBIDRAFT_03g005920        42.0    4e-07   Sorghum bicolor [broomcorn]
ref|WP_030001877.1|  hypothetical protein                             43.9    4e-07   
ref|XP_002267269.1|  PREDICTED: probable leucine-rich repeat rece...  44.7    4e-07   Vitis vinifera
emb|CDP11438.1|  unnamed protein product                              47.4    4e-07   
gb|EAY77539.1|  hypothetical protein OsI_32579                        44.3    4e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010023353.1|  PREDICTED: LRR receptor-like serine/threonin...  47.4    4e-07   
gb|AAL31654.1|AC079179_9  Putative protein kinase                     44.3    4e-07   Oryza sativa [red rice]
ref|XP_010023354.1|  PREDICTED: LRR receptor-like serine/threonin...  47.4    4e-07   
ref|XP_002460722.1|  hypothetical protein SORBIDRAFT_02g033810        48.1    4e-07   Sorghum bicolor [broomcorn]
ref|NP_001064062.2|  Os10g0119200                                     44.3    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008778616.1|  PREDICTED: receptor-like protein kinase 5        55.8    5e-07   
gb|KCW59611.1|  hypothetical protein EUGRSUZ_H02353                   47.0    5e-07   
ref|XP_006428844.1|  hypothetical protein CICLE_v10011222mg           48.5    6e-07   
ref|XP_006428843.1|  hypothetical protein CICLE_v10011222mg           48.5    6e-07   
gb|KDO48083.1|  hypothetical protein CISIN_1g0097712mg                48.5    6e-07   
ref|XP_009373339.1|  PREDICTED: probable LRR receptor-like serine...  48.9    6e-07   
ref|XP_009599479.1|  PREDICTED: probable leucine-rich repeat rece...  42.7    6e-07   
ref|NP_001235554.1|  receptor protein kinase-like protein             50.1    6e-07   
gb|KCW56526.1|  hypothetical protein EUGRSUZ_I02251                   46.2    6e-07   
gb|KDO48084.1|  hypothetical protein CISIN_1g0097712mg                48.5    6e-07   
ref|XP_009387282.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    6e-07   
ref|XP_006436574.1|  hypothetical protein CICLE_v10030632mg           45.8    7e-07   
ref|XP_006357362.1|  PREDICTED: probable LRR receptor-like serine...  43.9    7e-07   
ref|XP_008644796.1|  PREDICTED: probable LRR receptor-like serine...  42.7    7e-07   
gb|EEE65937.1|  hypothetical protein OsJ_21808                        50.1    7e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EMT33735.1|  LRR receptor-like serine/threonine-protein kinase...  48.9    7e-07   
ref|XP_008644797.1|  PREDICTED: probable LRR receptor-like serine...  42.7    7e-07   
gb|KCW46821.1|  hypothetical protein EUGRSUZ_K00629                   49.7    8e-07   
gb|EMT32475.1|  Putative LRR receptor-like serine/threonine-prote...  46.2    8e-07   
ref|XP_010038545.1|  PREDICTED: receptor-like protein 12              49.7    8e-07   
ref|XP_003545194.1|  PREDICTED: probable LRR receptor-like serine...  47.4    8e-07   
gb|KEH29463.1|  LRR receptor-like kinase family protein               40.4    8e-07   
ref|XP_002978200.1|  hypothetical protein SELMODRAFT_50240            42.7    9e-07   
ref|XP_002966360.1|  hypothetical protein SELMODRAFT_60230            42.7    9e-07   
ref|XP_010278009.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    9e-07   
emb|CDX98990.1|  BnaC09g48450D                                        42.4    9e-07   
gb|KHN44768.1|  Putative LRR receptor-like serine/threonine-prote...  47.4    9e-07   
gb|KEH21959.1|  LRR receptor-like kinase family protein               40.4    9e-07   
ref|XP_011000225.1|  PREDICTED: probable leucine-rich repeat rece...  43.1    9e-07   
gb|EEC66487.1|  hypothetical protein OsI_32581                        43.1    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_009387212.1|  PREDICTED: receptor-like protein kinase 2        45.4    1e-06   
gb|KCW54595.1|  hypothetical protein EUGRSUZ_I00550                   48.1    1e-06   
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...  42.4    1e-06   
ref|XP_007157942.1|  hypothetical protein PHAVU_002G111100g           52.0    1e-06   
gb|KCW48759.1|  hypothetical protein EUGRSUZ_K02402                   45.8    1e-06   
ref|XP_011045147.1|  PREDICTED: probable LRR receptor-like serine...  41.6    1e-06   
ref|XP_008440787.1|  PREDICTED: probable leucine-rich repeat rece...  40.4    1e-06   
ref|XP_004956857.1|  PREDICTED: putative leucine-rich repeat rece...  47.0    1e-06   
emb|CBJ29199.1|  LRR-GTPase of the ROCO family                        47.0    1e-06   
ref|XP_002523410.1|  serine-threonine protein kinase, plant-type,...  41.6    1e-06   Ricinus communis
ref|WP_030001770.1|  hypothetical protein                             46.6    1e-06   
ref|XP_010030460.1|  PREDICTED: receptor-like protein 12              47.8    1e-06   
ref|XP_002448543.1|  hypothetical protein SORBIDRAFT_06g028760        51.6    1e-06   
ref|XP_011000226.1|  PREDICTED: probable LRR receptor-like serine...  43.1    1e-06   
ref|XP_006446083.1|  hypothetical protein CICLE_v10018319mg           49.7    1e-06   
ref|XP_003631896.2|  PREDICTED: probable LRR receptor-like serine...  42.0    1e-06   
ref|XP_010069084.1|  PREDICTED: probable leucine-rich repeat rece...  45.4    1e-06   
gb|KDP47112.1|  hypothetical protein JCGZ_03920                       44.7    2e-06   
gb|KDP22307.1|  hypothetical protein JCGZ_26138                       45.1    2e-06   
gb|KDO64794.1|  hypothetical protein CISIN_1g038466mg                 49.7    2e-06   
ref|XP_006485337.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    2e-06   
ref|XP_008652733.1|  PREDICTED: putative leucine-rich repeat rece...  52.0    2e-06   
emb|CDP04632.1|  unnamed protein product                              42.4    2e-06   
gb|AFW77358.1|  putative leucine-rich repeat receptor protein kin...  44.7    2e-06   
emb|CDM82223.1|  unnamed protein product                              47.0    2e-06   
ref|XP_008649417.1|  PREDICTED: probable LRR receptor-like serine...  44.7    2e-06   
emb|CDX77019.1|  BnaC04g38140D                                        45.4    2e-06   
gb|KDP47111.1|  hypothetical protein JCGZ_03919                       45.1    2e-06   
gb|AFW83643.1|  putative leucine-rich repeat receptor-like protei...  43.9    2e-06   
dbj|BAJ91808.1|  predicted protein                                    40.0    2e-06   
ref|XP_001771841.1|  predicted protein                                44.3    2e-06   
dbj|BAJ92205.1|  predicted protein                                    40.0    2e-06   
dbj|BAJ95579.1|  predicted protein                                    40.0    2e-06   
dbj|BAJ88110.1|  predicted protein                                    40.0    2e-06   
ref|XP_008656772.1|  PREDICTED: probable LRR receptor-like serine...  43.9    2e-06   
gb|KHN41912.1|  Putative LRR receptor-like serine/threonine-prote...  53.1    2e-06   
ref|XP_008241779.1|  PREDICTED: probable leucine-rich repeat rece...  44.3    2e-06   
dbj|BAJ96072.1|  predicted protein                                    40.0    2e-06   
ref|XP_010491332.1|  PREDICTED: leucine-rich repeat receptor prot...  44.7    2e-06   
ref|XP_010030330.1|  PREDICTED: probable leucine-rich repeat rece...  48.5    2e-06   
ref|XP_002521135.1|  Receptor protein kinase CLAVATA1 precursor, ...  43.5    2e-06   
ref|XP_010423232.1|  PREDICTED: leucine-rich repeat receptor prot...  44.7    2e-06   
ref|XP_010523517.1|  PREDICTED: leucine-rich repeat receptor prot...  45.8    2e-06   
gb|EMT23073.1|  Putative LRR receptor-like serine/threonine-prote...  51.2    2e-06   
gb|KFK41560.1|  hypothetical protein AALP_AA2G145000                  42.4    2e-06   
ref|XP_009388674.1|  PREDICTED: probable LRR receptor-like serine...  49.3    2e-06   
ref|XP_010026069.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-06   
ref|XP_007224439.1|  hypothetical protein PRUPE_ppa021898mg           43.5    2e-06   
ref|XP_006357742.1|  PREDICTED: LRR receptor-like serine/threonin...  49.7    2e-06   
gb|KCW54189.1|  hypothetical protein EUGRSUZ_I00178                   48.1    2e-06   
emb|CDP08225.1|  unnamed protein product                              42.4    2e-06   
ref|XP_002306906.2|  hypothetical protein POPTR_0005s25640g           42.0    3e-06   
ref|XP_002965447.1|  hypothetical protein SELMODRAFT_67606            48.9    3e-06   
ref|XP_010093090.1|  putative LRR receptor-like serine/threonine-...  45.8    3e-06   
ref|XP_010456432.1|  PREDICTED: leucine-rich repeat receptor prot...  44.3    3e-06   
emb|CAN61272.1|  hypothetical protein VITISV_039063                   44.7    3e-06   
gb|KFK25085.1|  hypothetical protein AALP_AA8G064000                  48.5    3e-06   
emb|CBI35045.3|  unnamed protein product                              43.9    3e-06   
gb|EAZ05523.1|  hypothetical protein OsI_27741                        43.5    3e-06   
ref|XP_002984543.1|  hypothetical protein SELMODRAFT_47607            48.9    3e-06   
ref|XP_006599971.1|  PREDICTED: LRR receptor-like serine/threonin...  40.4    3e-06   
emb|CDP02659.1|  unnamed protein product                              47.0    3e-06   
ref|XP_010522021.1|  PREDICTED: probable LRR receptor-like serine...  47.0    3e-06   
ref|XP_010030332.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  45.8    3e-06   
ref|XP_010910274.1|  PREDICTED: LRR receptor-like serine/threonin...  42.7    3e-06   
ref|XP_008346010.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  42.4    3e-06   
ref|XP_008439079.1|  PREDICTED: probable LRR receptor-like serine...  45.1    3e-06   
ref|XP_008371765.1|  PREDICTED: LRR receptor-like serine/threonin...  42.4    3e-06   
ref|XP_007152129.1|  hypothetical protein PHAVU_004G104700g           43.9    3e-06   
gb|KCW54192.1|  hypothetical protein EUGRSUZ_I00181                   45.8    3e-06   
ref|XP_002446972.1|  hypothetical protein SORBIDRAFT_06g026090        43.9    3e-06   
ref|XP_008455656.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  48.5    3e-06   
ref|XP_004956858.1|  PREDICTED: putative leucine-rich repeat rece...  47.4    3e-06   
gb|AGO88094.1|  hypothetical protein                                  45.1    3e-06   
emb|CDP04099.1|  unnamed protein product                              44.3    3e-06   
ref|XP_010522022.1|  PREDICTED: probable LRR receptor-like serine...  46.6    3e-06   
ref|XP_008229942.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  51.2    4e-06   
gb|EMT29923.1|  LRR receptor-like serine/threonine-protein kinase...  43.9    4e-06   
ref|XP_004972903.1|  PREDICTED: probable LRR receptor-like serine...  42.0    4e-06   
ref|XP_010027736.1|  PREDICTED: receptor-like protein 12              43.5    4e-06   
gb|KCW54326.1|  hypothetical protein EUGRSUZ_I00290                   43.5    4e-06   
emb|CDP05445.1|  unnamed protein product                              45.8    4e-06   
ref|XP_010265954.1|  PREDICTED: uncharacterized protein LOC104603587  45.4    4e-06   
ref|XP_010061291.1|  PREDICTED: leucine-rich repeat receptor prot...  43.5    4e-06   
ref|XP_008380224.1|  PREDICTED: probable LRR receptor-like serine...  45.8    4e-06   
dbj|BAJ95809.1|  predicted protein                                    43.1    4e-06   
ref|XP_006485605.1|  PREDICTED: probable LRR receptor-like serine...  48.9    4e-06   
ref|WP_030001613.1|  hypothetical protein                             44.7    4e-06   
ref|XP_010429585.1|  PREDICTED: probably inactive leucine-rich re...  45.8    4e-06   
ref|XP_004309920.1|  PREDICTED: probable LRR receptor-like serine...  49.3    4e-06   
ref|XP_006436486.1|  hypothetical protein CICLE_v10030587mg           48.9    4e-06   
ref|XP_002522985.1|  receptor protein kinase, putative                41.6    4e-06   
ref|XP_004972904.1|  PREDICTED: probable LRR receptor-like serine...  41.6    4e-06   
emb|CDY05337.1|  BnaC02g40450D                                        46.2    4e-06   
emb|CDP21236.1|  unnamed protein product                              43.9    4e-06   
emb|CAN59750.1|  hypothetical protein VITISV_033634                   44.3    4e-06   
ref|XP_008373864.1|  PREDICTED: probable LRR receptor-like serine...  46.2    4e-06   
ref|XP_010999665.1|  PREDICTED: probable LRR receptor-like serine...  40.0    4e-06   
ref|XP_009140710.1|  PREDICTED: receptor-like protein 12              44.3    4e-06   
ref|XP_008241625.1|  PREDICTED: probable LRR receptor-like serine...  41.6    4e-06   
gb|EMT15641.1|  Putative LRR receptor-like serine/threonine-prote...  47.0    4e-06   
ref|XP_007151334.1|  hypothetical protein PHAVU_004G037500g           45.4    4e-06   
ref|XP_010037672.1|  PREDICTED: probably inactive leucine-rich re...  44.3    4e-06   
ref|XP_010489771.1|  PREDICTED: receptor-like protein 12              48.1    5e-06   
ref|XP_010526101.1|  PREDICTED: probably inactive leucine-rich re...  42.4    5e-06   
gb|AGO88092.1|  hypothetical protein                                  42.7    5e-06   
ref|XP_007152413.1|  hypothetical protein PHAVU_004G128100g           49.7    5e-06   
ref|XP_001778749.1|  predicted protein                                43.5    5e-06   
gb|KCW89015.1|  hypothetical protein EUGRSUZ_A01340                   43.1    5e-06   
ref|XP_006828909.1|  hypothetical protein AMTR_s00001p00202650        39.3    5e-06   
emb|CDP19284.1|  unnamed protein product                              42.7    5e-06   
ref|XP_009395787.1|  PREDICTED: probable LRR receptor-like serine...  47.8    5e-06   
emb|CDY63395.1|  BnaCnng41990D                                        47.8    5e-06   
ref|XP_004504632.1|  PREDICTED: LRR receptor-like serine/threonin...  44.3    5e-06   
ref|XP_010450496.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  47.4    5e-06   
ref|XP_002276923.2|  PREDICTED: probable LRR receptor-like serine...  43.9    5e-06   
ref|XP_010913138.1|  PREDICTED: probably inactive leucine-rich re...  46.2    5e-06   
ref|XP_009387610.1|  PREDICTED: probable leucine-rich repeat rece...  51.6    5e-06   
ref|XP_002453561.1|  hypothetical protein SORBIDRAFT_04g008110        50.1    6e-06   
ref|XP_006599539.1|  PREDICTED: LRR receptor-like serine/threonin...  40.8    6e-06   
ref|XP_008464627.1|  PREDICTED: LRR receptor-like serine/threonin...  48.5    6e-06   
ref|XP_006599538.1|  PREDICTED: LRR receptor-like serine/threonin...  40.8    6e-06   
emb|CDY35328.1|  BnaA04g15190D                                        43.9    6e-06   
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...  45.4    6e-06   
emb|CBI24849.3|  unnamed protein product                              48.5    6e-06   
ref|XP_010546682.1|  PREDICTED: receptor-like protein 12              45.4    6e-06   
emb|CBI19983.3|  unnamed protein product                              41.2    6e-06   
ref|XP_004957750.1|  PREDICTED: LRR receptor-like serine/threonin...  45.1    6e-06   
ref|XP_010925541.1|  PREDICTED: receptor-like protein kinase HSL1     41.6    6e-06   
gb|KCW45796.1|  hypothetical protein EUGRSUZ_L00370                   39.7    6e-06   
gb|KCW90729.1|  hypothetical protein EUGRSUZ_A02805                   43.5    6e-06   
gb|EMT01434.1|  Putative LRR receptor-like serine/threonine-prote...  39.7    6e-06   
ref|XP_010489056.1|  PREDICTED: leucine-rich repeat receptor-like...  45.1    6e-06   
ref|XP_002980714.1|  hypothetical protein SELMODRAFT_444590           48.1    6e-06   
ref|XP_008647994.1|  PREDICTED: uncharacterized protein LOC100304...  46.2    6e-06   
ref|XP_010489073.1|  PREDICTED: leucine-rich repeat receptor-like...  45.1    6e-06   
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...  38.9    6e-06   
ref|XP_007021415.1|  Disease resistance family protein / LRR fami...  42.7    6e-06   
gb|EYU28868.1|  hypothetical protein MIMGU_mgv1a020498mg              45.1    6e-06   
ref|WP_030001612.1|  hypothetical protein                             40.8    6e-06   
ref|XP_008237371.1|  PREDICTED: LRR receptor-like serine/threonin...  47.0    6e-06   
ref|XP_002278001.2|  PREDICTED: LRR receptor-like serine/threonin...  41.2    7e-06   
ref|XP_008219743.1|  PREDICTED: probable LRR receptor-like serine...  44.7    7e-06   
ref|XP_009388377.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    7e-06   
ref|XP_002976976.1|  hypothetical protein SELMODRAFT_443356           48.1    7e-06   
emb|CBI22181.3|  unnamed protein product                              42.4    7e-06   
ref|XP_003589783.1|  Receptor protein kinase-like protein             46.2    7e-06   
emb|CDP05229.1|  unnamed protein product                              39.3    7e-06   
ref|XP_010943411.1|  PREDICTED: receptor-like protein 12              48.1    7e-06   
gb|AES60034.2|  LRR receptor-like kinase family protein               46.2    7e-06   
ref|XP_010662200.1|  PREDICTED: probable leucine-rich repeat rece...  46.2    7e-06   
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...  38.9    7e-06   
ref|XP_002863930.1|  hypothetical protein ARALYDRAFT_917829           43.9    7e-06   
ref|XP_002263523.1|  PREDICTED: polygalacturonase inhibitor-like      48.5    7e-06   
gb|KHN26671.1|  Leucine-rich repeat receptor protein kinase EXS       42.0    7e-06   
gb|AFA28255.1|  polygalacturonase-inhibitor protein 1                 57.0    7e-06   
ref|XP_009601042.1|  PREDICTED: probable LRR receptor-like serine...  45.8    7e-06   
dbj|BAK02926.1|  predicted protein                                    44.7    7e-06   
gb|EYU28103.1|  hypothetical protein MIMGU_mgv1a001115mg              39.3    7e-06   
gb|EEC80874.1|  hypothetical protein OsI_23501                        47.0    7e-06   
ref|XP_009122420.1|  PREDICTED: receptor-like protein 12              41.2    7e-06   
gb|KCW56673.1|  hypothetical protein EUGRSUZ_I02373                   40.0    7e-06   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...  45.8    7e-06   
ref|XP_010472587.1|  PREDICTED: probably inactive leucine-rich re...  44.7    7e-06   
ref|XP_009387280.1|  PREDICTED: probable leucine-rich repeat rece...  51.2    7e-06   
ref|XP_002871261.1|  extra sporogenous cells                          47.4    7e-06   
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...  42.4    7e-06   
gb|KDO57278.1|  hypothetical protein CISIN_1g002155mg                 44.3    7e-06   
emb|CDX83164.1|  BnaA03g23420D                                        44.3    7e-06   
ref|XP_010103838.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  44.3    8e-06   
ref|XP_008237370.1|  PREDICTED: LRR receptor-like serine/threonin...  47.0    8e-06   
gb|ABZ07819.1|  putative leucine-rich repeat protein                  39.7    8e-06   
ref|XP_006421503.1|  hypothetical protein CICLE_v10004265mg           44.3    8e-06   
dbj|BAJ86449.1|  predicted protein                                    44.7    8e-06   
ref|XP_006446432.1|  hypothetical protein CICLE_v100183241mg          43.5    8e-06   
ref|XP_006485260.1|  PREDICTED: probable LRR receptor-like serine...  44.7    8e-06   
gb|KHN32792.1|  Leucine-rich repeat receptor-like tyrosine-protei...  46.2    8e-06   
ref|XP_006351211.1|  PREDICTED: leucine-rich repeat receptor-like...  45.1    8e-06   
gb|KDO37537.1|  hypothetical protein CISIN_1g044133mg                 42.7    8e-06   
ref|XP_006485259.1|  PREDICTED: probable LRR receptor-like serine...  44.7    8e-06   
ref|XP_006490029.1|  PREDICTED: leucine-rich repeat receptor prot...  44.3    8e-06   
ref|XP_010937037.1|  PREDICTED: somatic embryogenesis receptor ki...  42.7    8e-06   
ref|XP_006354070.1|  PREDICTED: probable LRR receptor-like serine...  41.6    8e-06   
ref|XP_010910578.1|  PREDICTED: putative receptor-like protein ki...  42.4    8e-06   
ref|XP_007198984.1|  hypothetical protein PRUPE_ppa023417mg           46.6    8e-06   
ref|XP_010486728.1|  PREDICTED: receptor-like protein 12              42.0    8e-06   
ref|XP_004976562.1|  PREDICTED: probable LRR receptor-like serine...  42.7    8e-06   
ref|XP_003625353.1|  Leucine-rich repeat receptor protein kinase EXS  42.4    8e-06   
gb|KHN36048.1|  Putative LRR receptor-like serine/threonine-prote...  50.4    8e-06   
gb|KHN19163.1|  Probably inactive leucine-rich repeat receptor-li...  40.4    8e-06   
ref|XP_008226320.1|  PREDICTED: probable LRR receptor-like serine...  45.4    9e-06   
ref|XP_010029719.1|  PREDICTED: probable leucine-rich repeat rece...  40.4    9e-06   
gb|AIE39580.1|  LRR receptor-like protein kinase                      54.7    9e-06   
ref|XP_006854255.1|  hypothetical protein AMTR_s00039p00029750        42.0    9e-06   
ref|XP_004231961.1|  PREDICTED: LRR receptor-like serine/threonin...  47.4    9e-06   
ref|XP_006493289.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  40.4    9e-06   
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...  44.7    9e-06   
ref|XP_006408867.1|  hypothetical protein EUTSA_v10001899mg           42.4    9e-06   
gb|KDO56533.1|  hypothetical protein CISIN_1g007200mg                 40.4    9e-06   
dbj|BAJ90172.1|  predicted protein                                    44.7    9e-06   
ref|XP_003548947.2|  PREDICTED: leucine-rich repeat receptor-like...  45.8    9e-06   
ref|XP_003555374.1|  PREDICTED: leucine-rich repeat receptor prot...  41.6    9e-06   
ref|XP_002275364.2|  PREDICTED: probable LRR receptor-like serine...  41.6    9e-06   
ref|XP_008339051.1|  PREDICTED: putative receptor-like protein ki...  45.1    9e-06   
gb|KDO56534.1|  hypothetical protein CISIN_1g007200mg                 40.4    9e-06   
gb|EEE57058.1|  hypothetical protein OsJ_06864                        48.5    9e-06   
ref|XP_011048672.1|  PREDICTED: leucine-rich repeat receptor prot...  43.9    9e-06   
gb|AAX93036.1|  Leucine Rich Repeat, putative                         40.0    9e-06   
dbj|BAD23652.1|  putative leucine rich repeat containing protein ...  48.5    1e-05   
dbj|BAJ98355.1|  predicted protein                                    44.3    1e-05   
ref|XP_010922023.1|  PREDICTED: probable LRR receptor-like serine...  42.0    1e-05   
gb|KFK31276.1|  hypothetical protein AALP_AA6G091700                  41.6    1e-05   
ref|XP_007203081.1|  hypothetical protein PRUPE_ppa023580mg           43.5    1e-05   
ref|XP_006600019.1|  PREDICTED: probable LRR receptor-like serine...  39.3    1e-05   
ref|XP_008667904.1|  PREDICTED: cytokinin-O-glucosyltransferase 3...  45.1    1e-05   
ref|XP_010260807.1|  PREDICTED: LRR receptor-like serine/threonin...  39.3    1e-05   
ref|XP_008801286.1|  PREDICTED: probable leucine-rich repeat rece...  42.0    1e-05   
ref|XP_008660396.1|  PREDICTED: somatic embryogenesis receptor ki...  45.4    1e-05   
ref|XP_006485338.1|  PREDICTED: probable leucine-rich repeat rece...  44.7    1e-05   
ref|XP_002278561.2|  PREDICTED: uncharacterized protein LOC100243949  45.8    1e-05   
emb|CDP21414.1|  unnamed protein product                              39.3    1e-05   
ref|XP_009390803.1|  PREDICTED: probable leucine-rich repeat rece...  45.1    1e-05   
ref|XP_006395138.1|  hypothetical protein EUTSA_v10003549mg           41.6    1e-05   
tpg|DAA35987.1|  TPA: putative leucine-rich repeat receptor-like ...  49.3    1e-05   
ref|XP_009400940.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    1e-05   
emb|CAN68996.1|  hypothetical protein VITISV_008862                   45.4    1e-05   
ref|XP_002510817.1|  leucine-rich repeat receptor protein kinase ...  43.1    1e-05   
ref|XP_008668880.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    1e-05   
gb|KDO56535.1|  hypothetical protein CISIN_1g007200mg                 40.0    1e-05   
ref|XP_007010902.1|  Kinase family protein with leucine-rich repe...  43.9    1e-05   
ref|XP_010041484.1|  PREDICTED: probable LRR receptor-like serine...  41.6    1e-05   
ref|XP_006363236.1|  PREDICTED: LRR receptor-like serine/threonin...  41.6    1e-05   
ref|XP_003551442.2|  PREDICTED: LRR receptor-like serine/threonin...  43.1    1e-05   



>ref|XP_011087364.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Sesamum 
indicum]
Length=368

 Score = 90.5 bits (223),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TL++ADWK ISG IP CIT+L N  ILDL G +I+  I   IG L++LT+LN
Sbjct  103  ICQLDRLTTLVVADWKDISGEIPACITSLPNLRILDLIGNKISGQIPADIGKLSRLTVLN  162

Query  328  LADNQISGVIPT  363
            LADNQISG +P+
Sbjct  163  LADNQISGSLPS  174


 Score = 66.2 bits (160),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P SIVNL SL HL+LS+NKL+GE+PS+IGKL+MMSRALL R Q   P+ ++L    R
Sbjct  173  PSSIVNLNSLMHLELSNNKLSGEIPSDIGKLSMMSRALLSRNQLTGPIPSSLASIYR  229



>emb|CAE76632.1| leucine rich repeat protein [Cicer arietinum]
Length=368

 Score = 93.6 bits (231),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CK+DRL++LI+ADWKAI+G IPPC+T+LSN  ILDL G QI   I + IG L  L++LN
Sbjct  101  ICKIDRLTSLIIADWKAITGDIPPCVTSLSNLRILDLIGNQIAGKIPSTIGNLQSLSVLN  160

Query  328  LADNQISGVIPTPLS  372
            LADN ISG IP  ++
Sbjct  161  LADNSISGEIPASIA  175


 Score = 60.8 bits (146),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI +LGSLKHLDLS+N LTG +P+N GKL M+SRALL R 
Sbjct  171  PASIADLGSLKHLDLSNNVLTGSIPANFGKLQMLSRALLNRN  212



>ref|XP_004514841.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cicer 
arietinum]
Length=388

 Score = 93.6 bits (231),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CK+DRL++LI+ADWKAI+G IPPC+T+LSN  ILDL G QI   I + IG L  L++LN
Sbjct  121  ICKIDRLTSLIIADWKAITGDIPPCVTSLSNLRILDLIGNQIAGKIPSTIGNLQSLSVLN  180

Query  328  LADNQISGVIPTPLS  372
            LADN ISG IP  ++
Sbjct  181  LADNSISGEIPASIA  195


 Score = 60.5 bits (145),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI +LGSLKHLDLS+N LTG +P+N GKL M+SRALL R 
Sbjct  191  PASIADLGSLKHLDLSNNVLTGSIPANFGKLQMLSRALLNRN  232



>gb|ACE97232.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97235.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97236.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97239.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97243.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97247.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97249.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97250.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97255.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97257.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97258.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97261.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97262.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97263.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97265.1| leucine rich repeat protein [Populus tremula]
Length=267

 Score = 96.3 bits (238),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G QI+  I   IG L +LT+L
Sbjct  42   SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL  101

Query  325  NLADNQISGVIPTPLST  375
            NLADN+++G IP  L+ 
Sbjct  102  NLADNRLTGEIPASLTA  118


 Score = 56.6 bits (135),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  LG++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  113  PASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKN  154



>gb|ACE97229.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97230.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97241.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97242.1| leucine rich repeat protein [Populus tremula]
Length=267

 Score = 96.3 bits (238),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G QI+  I   IG L +LT+L
Sbjct  42   SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL  101

Query  325  NLADNQISGVIPTPLST  375
            NLADN+++G IP  L+ 
Sbjct  102  NLADNRLTGEIPASLTA  118


 Score = 56.6 bits (135),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  LG++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  113  PASLTALGNMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKN  154



>ref|XP_011093532.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Sesamum 
indicum]
Length=364

 Score = 87.0 bits (214),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TL++ADWK ISG IPPC+ +L +  ILDL G +++  I   IG L++LT+LN
Sbjct  99   LCQLDRLTTLVVADWKDISGDIPPCLASLPHLRILDLIGNKLSGEIPADIGKLSRLTVLN  158

Query  328  LADNQISGVIPT  363
            LADNQISG IP 
Sbjct  159  LADNQISGSIPA  170


 Score = 65.5 bits (158),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P SIVNL SL HLDLS+NKL GE+PS+IGKL+MMSRALL R Q   P+  +L    R
Sbjct  169  PASIVNLKSLMHLDLSNNKLCGEIPSDIGKLSMMSRALLSRNQLTGPIPGSLANIYR  225



>gb|ACE97234.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97240.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97254.1| leucine rich repeat protein [Populus tremula]
Length=267

 Score = 96.3 bits (238),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G QI+  I   IG L +LT+L
Sbjct  42   SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL  101

Query  325  NLADNQISGVIPTPLST  375
            NLADN+++G IP  L+ 
Sbjct  102  NLADNRLTGEIPASLTA  118


 Score = 54.3 bits (129),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  113  PASLTALANMKHLDLSSNKLTGQLPADFGSLKMLSRALLSKN  154



>gb|ACE97231.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97233.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97237.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97238.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97244.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97246.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97248.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97251.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97252.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97253.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97256.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97259.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97260.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97264.1| leucine rich repeat protein [Populus tremula]
 gb|ACE97266.1| leucine rich repeat protein [Populus tremula]
Length=267

 Score = 96.3 bits (238),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G QI+  I   IG L +LT+L
Sbjct  42   SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL  101

Query  325  NLADNQISGVIPTPLST  375
            NLADN+++G IP  L+ 
Sbjct  102  NLADNRLTGEIPASLTA  118


 Score = 54.3 bits (129),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  113  PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKN  154



>gb|ACE97245.1| leucine rich repeat protein [Populus tremula]
Length=267

 Score = 96.3 bits (238),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G QI+  I   IG L +LT+L
Sbjct  42   SICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVL  101

Query  325  NLADNQISGVIPTPLST  375
            NLADN+++G IP  L+ 
Sbjct  102  NLADNRLTGEIPASLTA  118


 Score = 54.3 bits (129),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  113  PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKN  154



>emb|CDP07735.1| unnamed protein product [Coffea canephora]
Length=366

 Score = 79.7 bits (195),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
            VC+LDRL+TL++ADWKAI+G IP CI ++L    I D+ G QI+  I   IG L +LT+L
Sbjct  100  VCQLDRLTTLVVADWKAIAGEIPACIPSSLPILRIFDIVGNQISGKIPADIGSLGRLTVL  159

Query  325  NLADNQISGVIP  360
            NLADN+++G IP
Sbjct  160  NLADNKLTGAIP  171


 Score = 70.5 bits (171),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVNLGSL HLDLS+NKLTGE+PS++GKLTMMSRALL R 
Sbjct  171  PPSIVNLGSLMHLDLSNNKLTGEIPSDVGKLTMMSRALLSRN  212



>ref|XP_004229610.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Solanum 
lycopersicum]
Length=368

 Score = 85.1 bits (209),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD+L+TLI+ADWK ISG IP C+T+L +  IL+L G +IT  I   IG L+KLT+LN
Sbjct  103  LCKLDKLTTLIVADWKDISGEIPACVTSLPDLRILELIGNKITGQIPENIGQLSKLTVLN  162

Query  328  LADNQISGVIP  360
            LADN+I G IP
Sbjct  163  LADNKICGSIP  173


 Score = 64.3 bits (155),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P SIVNLG LKHL+LS+N+LTGE+PS+IGKL MMSRALL +
Sbjct  173  PASIVNLGKLKHLELSNNQLTGEIPSDIGKLGMMSRALLNK  213



>ref|XP_008461788.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cucumis 
melo]
Length=363

 Score = 85.9 bits (211),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRL+ L++ADWK ISG IP C+T LS   +LDL G +I+  I + IG LN LT+LN
Sbjct  98   ICKLDRLTVLVIADWKGISGEIPKCLTKLSPLRVLDLVGNKISGEIPSDIGNLNSLTVLN  157

Query  328  LADNQISGVIPT  363
            LA+N ISG IP 
Sbjct  158  LAENAISGSIPA  169


 Score = 63.2 bits (152),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVN+GSLKHLDL +N++TGE+PS+ GKL M+SRALL R 
Sbjct  168  PASIVNIGSLKHLDLRNNRITGEIPSDFGKLQMLSRALLGRN  209



>gb|EYU27081.1| hypothetical protein MIMGU_mgv1a008561mg [Erythranthe guttata]
Length=369

 Score = 84.7 bits (208),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC LDRL+TL++ADWK ISG IP CI +L +  ILDL G +++  I   IG L+ LT+LN
Sbjct  104  VCHLDRLTTLVVADWKGISGEIPSCIASLPHLRILDLIGNKLSGQIPADIGKLSHLTVLN  163

Query  328  LADNQISGVIP  360
            LADNQISG +P
Sbjct  164  LADNQISGHLP  174


 Score = 64.3 bits (155),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVNL SL HL+LS+NKLTGE+PS+IGKL+MMSRALL R 
Sbjct  174  PPSIVNLNSLMHLELSNNKLTGEIPSDIGKLSMMSRALLTRN  215


 Score = 45.4 bits (106),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL  L+ L LAD   ISGH+PP I  L++   L+L+  ++T  I + IG L+ ++   
Sbjct  153  IGKLSHLTVLNLAD-NQISGHLPPSIVNLNSLMHLELSNNKLTGEIPSDIGKLSMMSRAL  211

Query  328  LADNQISGVIPTPLS  372
            L  N+++G IP  L+
Sbjct  212  LTRNELTGSIPNSLA  226


 Score = 30.4 bits (67),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P+S+  +  L  LDLS N++TG +P  +G + ++S
Sbjct  222  PNSLAKIYRLADLDLSMNQITGSIPVQLGSMPVLS  256



>gb|AFK38065.1| unknown [Medicago truncatula]
Length=230

 Score = 91.3 bits (225),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CK+D L++ ILADWKAISG IP C+T+LSN  ILDL G Q+T  I   IG L +LT+LN
Sbjct  102  ICKIDSLTSFILADWKAISGEIPQCLTSLSNLRILDLIGNQLTGKIPVNIGKLQRLTVLN  161

Query  328  LADNQISGVIPT  363
            LA+N ISG IPT
Sbjct  162  LAENSISGEIPT  173


 Score = 57.4 bits (137),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+V L SLKHLDLSSN LTG +P N G L M+SRALL R
Sbjct  172  PTSVVELCSLKHLDLSSNSLTGSIPVNFGNLQMLSRALLNR  212



>ref|XP_003599106.1| DNA-damage-repair/toleration protein DRT100 [Medicago truncatula]
 gb|AES69357.1| DNA-damage-repair/toleration DRT100-like protein [Medicago truncatula]
Length=369

 Score = 90.9 bits (224),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CK+D L++ ILADWKAISG IP C+T+LSN  ILDL G Q+T  I   IG L +LT+LN
Sbjct  102  ICKIDSLTSFILADWKAISGEIPQCLTSLSNLRILDLIGNQLTGKIPVNIGKLQRLTVLN  161

Query  328  LADNQISGVIPT  363
            LA+N ISG IPT
Sbjct  162  LAENSISGEIPT  173


 Score = 57.0 bits (136),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V L SLKHLDLSSN LTG +P N G L M+SRALL R 
Sbjct  172  PTSVVELCSLKHLDLSSNSLTGSIPVNFGNLQMLSRALLNRN  213



>gb|ACJ85058.1| unknown [Medicago truncatula]
Length=369

 Score = 90.9 bits (224),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CK+D L++ ILADWKAISG IP C+T+LSN  ILDL G Q+T  I   IG L +LT+LN
Sbjct  102  ICKIDSLTSFILADWKAISGEIPQCLTSLSNLRILDLIGNQLTGKIPVNIGKLQRLTVLN  161

Query  328  LADNQISGVIPT  363
            LA+N ISG IPT
Sbjct  162  LAENSISGEIPT  173


 Score = 57.0 bits (136),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V L SLKHLDLSSN LTG +P N G L M+SRALL R 
Sbjct  172  PTSVVELCSLKHLDLSSNSLTGSIPVNFGNLQMLSRALLNRN  213



>ref|XP_002313289.1| DNA-damage-repair/toleration protein DRT100 precursor [Populus 
trichocarpa]
 gb|ABS18952.1| DRT100 [Populus deltoides]
 gb|EEE87244.1| DNA-damage-repair/toleration protein DRT100 precursor [Populus 
trichocarpa]
Length=365

 Score = 92.8 bits (229),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G QI+  I   IG L +LT+LN
Sbjct  100  LCKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            LADN ++G IP  L+ 
Sbjct  160  LADNGLTGEIPASLTA  175


 Score = 54.3 bits (129),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  170  PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKN  211



>ref|XP_009766712.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nicotiana 
sylvestris]
Length=368

 Score = 86.7 bits (213),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+TLI+ADWK ISG +P C+T+L N  I+DL G +IT  I   IG L+KL +LN
Sbjct  103  LCKLDGLTTLIVADWKDISGELPACLTSLKNLRIVDLIGNKITGQIPANIGQLSKLAVLN  162

Query  328  LADNQISGVIP  360
            LADNQISG IP
Sbjct  163  LADNQISGSIP  173


 Score = 60.5 bits (145),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVNLG L HL+LS+N+++GE+PS+IGKL+MMSRALL + 
Sbjct  173  PVSIVNLGKLMHLELSNNQISGEIPSDIGKLSMMSRALLNKN  214



>gb|EYU31352.1| hypothetical protein MIMGU_mgv1a018246mg, partial [Erythranthe 
guttata]
Length=273

 Score = 89.4 bits (220),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TL++ADWK+ISG IP C+ AL    ILDL G +IT  I   IG L++LT+LN
Sbjct  9    LCRLDRLTTLVIADWKSISGEIPACVAALPRLRILDLVGNKITGAIPASIGNLSRLTVLN  68

Query  328  LADNQISGVIPT  363
            LADN+ISG IP 
Sbjct  69   LADNRISGEIPA  80


 Score = 57.4 bits (137),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV+L SL HL+L++NKL GE+P NIG L+MMSRALL R 
Sbjct  79   PASIVDLKSLMHLELANNKLCGEIPFNIGNLSMMSRALLSRN  120



>ref|XP_009623381.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nicotiana 
tomentosiformis]
Length=368

 Score = 85.9 bits (211),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+TLI+ADWK IS  IP C+T+L N  I+DL G +IT  I   IG L+KL +LN
Sbjct  103  LCKLDGLTTLIVADWKGISSEIPACLTSLKNLRIVDLIGNKITGQIPANIGQLSKLAVLN  162

Query  328  LADNQISGVIP  360
            LADNQISG IP
Sbjct  163  LADNQISGSIP  173


 Score = 60.5 bits (145),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVNLG L HL+LS+N+++GE+PS+IGKL+MMSRALL + 
Sbjct  173  PGSIVNLGKLMHLELSNNQISGEIPSDIGKLSMMSRALLNKN  214



>ref|XP_011007343.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Populus 
euphratica]
Length=365

 Score = 92.0 bits (227),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G +I+  I   IG L +LT+LN
Sbjct  100  ICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNKISGKIPANIGNLQRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            LADN ++G IP  L+ 
Sbjct  160  LADNGLTGEIPASLTA  175


 Score = 54.7 bits (130),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  170  PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKN  211



>ref|XP_011025407.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Populus 
euphratica]
Length=365

 Score = 91.7 bits (226),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G +I+  I   IG L +LT+LN
Sbjct  100  ICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNKISGKIPANIGNLQRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            LADN ++G IP  L+ 
Sbjct  160  LADNGLTGEIPASLTA  175


 Score = 54.3 bits (129),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLSSNKLTG+LP++ G L M+SRALL + 
Sbjct  170  PASLTALANMKHLDLSSNKLTGQLPADFGNLKMLSRALLSKN  211



>gb|EPS67382.1| hypothetical protein M569_07393 [Genlisea aurea]
Length=374

 Score = 87.4 bits (215),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C+LD L+T +LADWKAISG IPPCI +L    ILDL G +I+  I   IG L++LT+L
Sbjct  107  AICQLDYLTTFVLADWKAISGEIPPCIASLPRLRILDLIGNRISGRIPADIGQLSRLTVL  166

Query  325  NLADNQISGVIP  360
            NLADNQI G IP
Sbjct  167  NLADNQIYGEIP  178


 Score = 58.9 bits (141),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P SIVNL SL HL+L +N L+G +PS+IGKL+MMSRALL R Q   P+ A+L    R
Sbjct  178  PPSIVNLKSLMHLELGNNYLSGGIPSDIGKLSMMSRALLSRNQLTGPIPASLSGIYR  234



>ref|NP_001268187.1| DNA-damage-repair/toleration protein DRT100-like precursor [Vitis 
vinifera]
 gb|AFA35119.1| DRT100-like protein [Vitis vinifera]
Length=356

 Score = 90.1 bits (222),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+TLI+ADWK ISG IPPCI++LS   ILDL G +IT  I   IG L +LT+LN
Sbjct  98   ICKLDSLTTLIIADWKGISGEIPPCISSLSKLRILDLVGNKITGVIPADIGKLQRLTVLN  157

Query  328  LADNQISGVIPT  363
            +ADN ISG IP 
Sbjct  158  VADNSISGSIPA  169


 Score = 55.5 bits (132),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+VNL SL HLDL +N++TG +P + GKLTM+SRA+L R 
Sbjct  168  PASVVNLASLMHLDLRNNQITGGIPQDFGKLTMLSRAMLGRN  209



>ref|XP_006660260.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Oryza 
brachyantha]
Length=377

 Score = 89.4 bits (220),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC+LDRLS+LILADWK ISG IPPC+ T+L    IL+L G ++T  I   I
Sbjct  101  VMSGYISDAVCRLDRLSSLILADWKQISGAIPPCVATSLPYLRILELPGNRLTGEIPQSI  160

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G L++LT+LNLADN ISG IP+ +++
Sbjct  161  GSLSRLTVLNLADNLISGAIPSSITS  186


 Score = 55.8 bits (133),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI +L SLKHLDL++N+LTG +P+++G L M+SRALL R 
Sbjct  181  PSSITSLASLKHLDLTNNQLTGRIPADVGSLAMLSRALLGRN  222



>gb|EYU45210.1| hypothetical protein MIMGU_mgv1a023427mg [Erythranthe guttata]
Length=368

 Score = 86.3 bits (212),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TLI+ADWK+ISG IP CI +L    ILDL G +I+  I   IG L++LT+LN
Sbjct  103  LCRLDRLTTLIIADWKSISGEIPTCIASLPRLRILDLVGNKISGAIPASIGNLSRLTVLN  162

Query  328  LADNQISGVIP  360
            +ADN+ISG IP
Sbjct  163  VADNRISGEIP  173


 Score = 59.3 bits (142),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV+L SL HL+L++NKL GE+P NIGKL+MMSRALL R 
Sbjct  173  PASIVDLKSLMHLELANNKLCGEIPFNIGKLSMMSRALLSRN  214



>ref|XP_007220472.1| hypothetical protein PRUPE_ppa007530mg [Prunus persica]
 gb|EMJ21671.1| hypothetical protein PRUPE_ppa007530mg [Prunus persica]
Length=364

 Score = 90.9 bits (224),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRL+TLI+ADWK I+G IP C+T+LSN  +LDL G +I+  I   IG L  LT+LN
Sbjct  99   ICKLDRLTTLIVADWKGITGEIPKCLTSLSNLRVLDLIGNKISGDIPADIGNLKMLTVLN  158

Query  328  LADNQISGVIPTPL  369
            LADNQISG IP  +
Sbjct  159  LADNQISGKIPASI  172


 Score = 53.9 bits (128),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV++  L HLDLS+N+++GE+P++ GKL M+SRALL R 
Sbjct  169  PASIVSMSGLMHLDLSNNQISGEMPADFGKLKMLSRALLNRN  210



>gb|ABK94260.1| unknown [Populus trichocarpa]
Length=365

 Score = 92.8 bits (229),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G QI+  I   IG L +LT+LN
Sbjct  100  LCKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIGNLQRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            LADN ++G IP  L+ 
Sbjct  160  LADNGLTGEIPASLTA  175


 Score = 52.0 bits (123),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLD SSNKLTG+LP++ G L M+SRALL + 
Sbjct  170  PASLTALANMKHLDRSSNKLTGQLPADFGNLKMLSRALLSKN  211



>ref|XP_010544847.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Tarenaya 
hassleriana]
Length=373

 Score = 88.2 bits (217),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C LDRL+T +LADWK+ISG IP C+T+LS   ILDL G  ++  I   IG L +L +LN
Sbjct  107  ICNLDRLTTFVLADWKSISGEIPSCLTSLSYLRILDLVGNSLSGKIPPSIGNLRRLAVLN  166

Query  328  LADNQISGVIPTPLST  375
            LADNQISG IP  L++
Sbjct  167  LADNQISGEIPASLTS  182


 Score = 54.7 bits (130),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P S+ +L  LKHLDLS N+LTG +P+++G L M+SRAL+ R Q   P+ +++ R  R
Sbjct  177  PASLTSLSELKHLDLSGNRLTGRIPNDLGSLKMLSRALMDRNQLSGPIPSSIGRLDR  233



>ref|XP_008231308.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Prunus 
mume]
Length=368

 Score = 89.4 bits (220),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRL+TLI+ADWK I+G IP C+T+LSN  +LDL G +I+  I   IG L  L ILN
Sbjct  103  ICKLDRLTTLIVADWKGITGEIPKCLTSLSNLRVLDLIGNKISGDIPADIGNLKMLAILN  162

Query  328  LADNQISGVIPT  363
            LADNQISG IP 
Sbjct  163  LADNQISGKIPA  174


 Score = 53.5 bits (127),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V++  L HLDLS+N+++GE+P++ GKL M+SRALL R 
Sbjct  173  PASVVSMSGLMHLDLSNNQISGEMPADFGKLKMLSRALLNRN  214



>ref|XP_008375150.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Malus 
domestica]
Length=368

 Score = 88.2 bits (217),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C LDRL+TL+LADWK ++G IP C+T LSN  +LDL G +I+  I   IG L  L +LN
Sbjct  103  ICSLDRLTTLVLADWKGVTGEIPQCLTTLSNLRVLDLVGNKISGKIPADIGNLKMLRVLN  162

Query  328  LADNQISGVIPTPL  369
            LADNQISG IP  L
Sbjct  163  LADNQISGKIPASL  176


 Score = 54.7 bits (130),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V L  L H+DLS+N++TGELP++ GKL M+SRALL R 
Sbjct  173  PASLVGLSGLMHMDLSNNQITGELPADFGKLKMLSRALLNRN  214



>ref|XP_009390646.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Musa 
acuminata subsp. malaccensis]
Length=372

 Score = 95.1 bits (235),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TLILADWK ISG IPPC+T+LS   ILDL G +++ PI   IG L++LT+LN
Sbjct  106  ICRLDRLTTLILADWKQISGPIPPCLTSLSFLSILDLVGNRLSGPIPNDIGNLSRLTVLN  165

Query  328  LADNQISGVIPT  363
            +A+NQISG IPT
Sbjct  166  VANNQISGSIPT  177


 Score = 47.8 bits (112),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI+ L SL HLDLS+N+++G +P + G L M+SRA+L R 
Sbjct  176  PTSILALSSLMHLDLSNNQISGPIPGDFGNLRMLSRAMLSRN  217



>ref|NP_001062185.1| Os08g0505900 [Oryza sativa Japonica Group]
 dbj|BAD08838.1| putative DNA-damage-repair/toleration protein [Oryza sativa Japonica 
Group]
 dbj|BAD10175.1| putative DNA-damage-repair/toleration protein [Oryza sativa Japonica 
Group]
 dbj|BAF24099.1| Os08g0505900 [Oryza sativa Japonica Group]
 gb|EAZ07550.1| hypothetical protein OsI_29804 [Oryza sativa Indica Group]
 gb|EAZ43271.1| hypothetical protein OsJ_27868 [Oryza sativa Japonica Group]
 dbj|BAG87534.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00207.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00223.1| unnamed protein product [Oryza sativa Japonica Group]
Length=380

 Score = 85.9 bits (211),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC+L RLS+LILADWK ISG IPPC+ TAL    IL+L G ++T  I   I
Sbjct  104  VMSGYISDAVCRLGRLSSLILADWKQISGPIPPCVATALPYLRILELPGNRLTGEIPRSI  163

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G L++LT+LNLADN I+G IP+ +++
Sbjct  164  GSLSRLTVLNLADNLIAGEIPSSITS  189


 Score = 56.6 bits (135),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI +L SLKHLDL++N+LTG +P ++G LTM+SRALL R 
Sbjct  184  PSSITSLASLKHLDLTNNQLTGGIPDDVGDLTMLSRALLGRN  225



>ref|XP_008350016.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
Length=368

 Score = 89.0 bits (219),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C LDRL+TL+LADWK ++G IP C+  LSN  +LDL G +I+  I   IG L  LT+LN
Sbjct  103  ICSLDRLTTLVLADWKGVTGEIPQCVATLSNLRVLDLVGNKISGGIPABIGNLKMLTVLN  162

Query  328  LADNQISGVIPTPL  369
            LADNQISG IP  L
Sbjct  163  LADNQISGKIPASL  176


 Score = 53.5 bits (127),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V+L  L HLDLS+N+++GE+P++ GKL M+SRALL R 
Sbjct  173  PASLVSLSGLMHLDLSNNQISGEIPADFGKLKMLSRALLYRN  214



>ref|XP_011025084.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Populus 
euphratica]
Length=482

 Score = 90.1 bits (222),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRLSTLILADWK +SG IP C+ +LSN  ILDL G +I+  I   IG L +L +LN
Sbjct  217  ICKLDRLSTLILADWKGVSGEIPECVVSLSNLRILDLIGNKISGKIPANIGNLQRLAVLN  276

Query  328  LADNQISGVIPTPLS  372
            LADN ++G IP+ L+
Sbjct  277  LADNGLAGEIPSSLT  291


 Score = 52.0 bits (123),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLS+N LTG+LPS+ G L M+SRALL + 
Sbjct  287  PSSLTKLANMKHLDLSNNMLTGQLPSDFGNLKMLSRALLSKN  328



>ref|XP_009795492.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nicotiana 
sylvestris]
Length=365

 Score = 85.5 bits (210),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+TL++ADWK ISG IP C+ +L N  ILDL G +I+  I + IG LN+LTILN
Sbjct  100  LCKLDMLTTLVVADWKDISGEIPTCLASLQNLRILDLIGNKISGDIPSDIGQLNELTILN  159

Query  328  LADNQISGVIP  360
            L +NQISG IP
Sbjct  160  LGENQISGSIP  170


 Score = 56.6 bits (135),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV+LG L HLDLS+N LTGE+PS+IGK++M+SRA++   
Sbjct  170  PPSIVSLGKLIHLDLSTNMLTGEIPSDIGKMSMLSRAIMNNN  211



>ref|XP_011087290.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Sesamum 
indicum]
Length=338

 Score = 86.7 bits (213),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 9/91 (10%)
 Frame = +1

Query  103  QRLIWR-----VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGK  267
            Q+L+W      ++S+     +C LD+L+TLI+ DW +ISG IPPCIT+LS   ILDL+G 
Sbjct  87   QKLLWTGDWTGLISD----SLCLLDQLTTLIVTDWGSISGEIPPCITSLSRLRILDLSGN  142

Query  268  QITSPILTYIG*LNKLTILNLADNQISGVIP  360
            +I+  I T IG L++L +LNLADN++SG IP
Sbjct  143  RISGGIPTDIGKLSQLVVLNLADNELSGSIP  173


 Score = 55.5 bits (132),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SIV+L SLK LD+S+NKL+GE+PS+IGKL M+SRA++
Sbjct  173  PASIVDLSSLKLLDISNNKLSGEIPSDIGKLKMLSRAIM  211


 Score = 47.8 bits (112),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL  LS  I+     +SG +P  I ALS    LDL+  QI+  I   IG +  L+ LN
Sbjct  200  IGKLKMLSRAIMGG-NQLSGSMPTSIAALSRMADLDLSMNQISGSIPEQIGSMPVLSTLN  258

Query  328  LADNQISGVIPTPL  369
            L  NQ+SG IP  L
Sbjct  259  LYSNQLSGEIPASL  272


 Score = 28.5 bits (62),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  393  LDLSSNKLTGELPSNIGKLTMM  458
            LDLS N+L+GE+P +IG +  M
Sbjct  305  LDLSYNRLSGEVPKSIGSVKYM  326



>ref|XP_010091334.1| hypothetical protein L484_000482 [Morus notabilis]
 gb|EXC36913.1| hypothetical protein L484_000482 [Morus notabilis]
Length=371

 Score = 87.0 bits (214),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRL+  ILADWK ISG IP C+T+LS+  +LDL G ++T  I T IG L +LT+LN
Sbjct  107  ICKLDRLTNFILADWKGISGEIPSCLTSLSSLHVLDLIGNRLTGKIPTDIGSLTRLTVLN  166

Query  328  LADNQISGVIP  360
            LADN ++G IP
Sbjct  167  LADNALTGKIP  177


 Score = 55.1 bits (131),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV++  LKH+DLS+N+LTGE+P   G+L M+SRALL R 
Sbjct  177  PESIVSIKGLKHIDLSNNQLTGEIPVQFGQLKMLSRALLNRN  218



>ref|XP_010913131.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Elaeis 
guineensis]
Length=367

 Score = 90.9 bits (224),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TL+LADWK ISG IPPCIT+L    ILDL G +++ P+   IG L+ LT+LN
Sbjct  101  ICRLDRLTTLVLADWKQISGPIPPCITSLPLLRILDLIGNRLSGPLPADIGRLSHLTVLN  160

Query  328  LADNQISGVIPTPLST  375
            +ADNQISG IP  L +
Sbjct  161  VADNQISGQIPASLPS  176


 Score = 50.8 bits (120),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P S+ +L SL HLDLS+N+L+G +P N G L M+SRALL R Q   P+ A++    R
Sbjct  171  PASLPSLSSLMHLDLSNNRLSGRVPPNFGDLRMLSRALLARNQISGPIPASICSMAR  227



>ref|XP_009365014.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Pyrus 
x bretschneideri]
Length=368

 Score = 88.2 bits (217),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C LDRL+TL+LADWK ++G IP C+  LSN  ILDL G +I+  I   IG L  LT+LN
Sbjct  103  ICSLDRLTTLVLADWKGVTGKIPQCLATLSNLRILDLVGNKISGGIPADIGNLKMLTVLN  162

Query  328  LADNQISGVIPTPL  369
            LADNQISG IP  L
Sbjct  163  LADNQISGKIPASL  176


 Score = 53.1 bits (126),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V+L  L HLDLS+N+++GE+P++ GKL M+SRALL R 
Sbjct  173  PASLVSLSGLMHLDLSNNQISGEIPADFGKLKMLSRALLYRN  214



>ref|XP_010067884.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Eucalyptus 
grandis]
 gb|KCW66122.1| hypothetical protein EUGRSUZ_G03393 [Eucalyptus grandis]
Length=364

 Score = 89.4 bits (220),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+ LILADWK ISG IP CIT+LS+  ++DL G +I+  I   IG L ++T+LN
Sbjct  99   ICRLDRLTNLILADWKGISGEIPACITSLSSLRVVDLVGNKISGRIPPAIGDLRRVTVLN  158

Query  328  LADNQISGVIPT  363
            LADNQISG IP 
Sbjct  159  LADNQISGEIPA  170


 Score = 52.4 bits (124),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV + SL H+DL +N+++G +P++ GKLTM+SRALL R 
Sbjct  169  PASIVQMSSLMHVDLRNNRISGPIPADFGKLTMLSRALLGRN  210



>ref|XP_008791578.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Phoenix 
dactylifera]
Length=367

 Score = 91.3 bits (225),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TL++ADWK ISG IPPCIT+L    ILDLTG ++T P+   IG L++LT+LN
Sbjct  101  ICRLDRLTTLVVADWKRISGPIPPCITSLPLLRILDLTGNRLTGPLPADIGRLSRLTVLN  160

Query  328  LADNQISGVIPTPL  369
            +ADN++SG IP  L
Sbjct  161  VADNKLSGSIPGSL  174


 Score = 50.1 bits (118),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L SL HLDLS+N L+G++PSN G L M+SRALL R 
Sbjct  171  PGSLPSLSSLMHLDLSNNLLSGQIPSNFGGLRMLSRALLARN  212



>ref|XP_003627718.1| DNA-damage-repair/toleration protein DRT100 [Medicago truncatula]
 gb|AET02194.1| DNA-damage-repair/toleration DRT100-like protein [Medicago truncatula]
Length=365

 Score = 89.7 bits (221),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VCKLD L+TL++ADWK+ISG IP CIT+LS+  ILDLTG +I+  I   IG L  LT+LN
Sbjct  100  VCKLDELTTLVVADWKSISGEIPSCITSLSSLRILDLTGNKISGNIPGNIGKLQHLTVLN  159

Query  328  LADNQISGVIP  360
            LADN ISG IP
Sbjct  160  LADNAISGEIP  170


 Score = 51.6 bits (122),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV +  L HLDL+ N+++GELPS+IGKL  +SRAL  R 
Sbjct  170  PMSIVRISGLMHLDLAGNQISGELPSDIGKLRRLSRALFSRN  211


 Score = 47.8 bits (112),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL  L+ L LAD  AISG IP  I  +S    LDL G QI+  + + IG L +L+   
Sbjct  149  IGKLQHLTVLNLAD-NAISGEIPMSIVRISGLMHLDLAGNQISGELPSDIGKLRRLSRAL  207

Query  328  LADNQISGVIP  360
             + NQ++G IP
Sbjct  208  FSRNQLTGSIP  218


 Score = 35.8 bits (81),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S++ +  L  LDLS N++TG +P+ IGK+ ++S
Sbjct  218  PDSVLKMNRLADLDLSMNRITGSIPARIGKMRVLS  252



>ref|XP_007052566.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOX96723.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=365

 Score = 82.8 bits (203),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+TLI+ADWK IS  IP C+ +L N  +LDL G  ++  I   IG L KLT+LN
Sbjct  100  ICKLDHLTTLIIADWKGISWEIPQCLASLPNLRVLDLIGNSLSGKIPQQIGNLQKLTVLN  159

Query  328  LADNQISGVIPTPL  369
            LADN++SG IP+ L
Sbjct  160  LADNKLSGEIPSSL  173


 Score = 57.4 bits (137),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V L SLKHLDLS+N LTGE+P+N G L M+SRALL R 
Sbjct  170  PSSLVQLSSLKHLDLSNNLLTGEIPANFGNLKMLSRALLSRN  211



>gb|KDP43447.1| hypothetical protein JCGZ_16734 [Jatropha curcas]
Length=365

 Score = 87.4 bits (215),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD LSTLI+ADWK ISG IP C+  LS+  ILDL G +I+  I   IG L +LT+LN
Sbjct  100  ICKLDGLSTLIIADWKGISGEIPACVATLSSLRILDLVGNKISGKIPADIGNLQRLTVLN  159

Query  328  LADNQISGVIPTPLS  372
            LADN+I G IP  L+
Sbjct  160  LADNEIWGAIPASLT  174


 Score = 52.8 bits (125),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L +LKHLDLS+NK++G+LP++ G L M+SRALL R 
Sbjct  170  PASLTKLANLKHLDLSNNKVSGKLPADFGNLKMLSRALLNRN  211



>gb|ABO47744.1| polygalacturonase-inhibiting protein [Gossypium hirsutum]
Length=370

 Score = 84.0 bits (206),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDR++TLI+ADWK I+G IP C+ +L N  +LDL G  ++  I   IG L KLT+LN
Sbjct  105  ICQLDRVTTLIIADWKGIAGEIPSCLASLPNLRVLDLIGNSLSGKIPDQIGNLQKLTVLN  164

Query  328  LADNQISGVIPT  363
            LADN+I+G IP+
Sbjct  165  LADNKINGEIPS  176


 Score = 55.8 bits (133),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SIV L SLKHLDLS+N LTGE+P+N G L M+SRALL
Sbjct  175  PSSIVQLSSLKHLDLSNNLLTGEVPANFGNLKMLSRALL  213



>ref|XP_011090389.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Sesamum 
indicum]
Length=366

 Score = 87.8 bits (216),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS+L +A+W  ISG IPPCI +LS   ILDLTG ++T  + + IG L +L +LN
Sbjct  102  ICRLTRLSSLTIAEWNGISGPIPPCIASLSALRILDLTGNKLTGEVPSEIGRLRRLAVLN  161

Query  328  LADNQISGVIPTPLST  375
            LADNQISG+IP  L+ 
Sbjct  162  LADNQISGIIPQSLTN  177


 Score = 52.4 bits (124),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL++NK++G +P N G+L M+SRALL + 
Sbjct  172  PQSLTNLSSLTHLDLANNKISGSIPKNFGRLRMLSRALLSQN  213



>ref|XP_006850131.1| hypothetical protein AMTR_s00022p00230910 [Amborella trichopoda]
 gb|ERN11712.1| hypothetical protein AMTR_s00022p00230910 [Amborella trichopoda]
Length=366

 Score = 82.4 bits (202),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L+RLSTL+LADWK ISG IP CIT+L     LDL G + +  I   IG L++L +LN
Sbjct  100  ICALNRLSTLVLADWKNISGEIPACITSLPFLRTLDLVGNRFSGEIPAEIGRLSRLAVLN  159

Query  328  LADNQISGVIPT  363
            LADNQ +G IPT
Sbjct  160  LADNQFTGHIPT  171


 Score = 56.6 bits (135),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P SIV + SL HLDLS+NKL+G LPS+ G L M+SRALL R Q   P+ A++ R  R
Sbjct  170  PTSIVQIQSLMHLDLSNNKLSGPLPSDFGWLRMLSRALLNRNQLSGPIPASISRMNR  226



>ref|XP_009354707.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Pyrus 
x bretschneideri]
Length=368

 Score = 86.7 bits (213),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LD L+TL+LADWK ++G IP CIT LS   ILDL G +I+  I   IG +  LT+LN
Sbjct  103  ICRLDHLTTLVLADWKGVTGKIPQCITTLSKLRILDLVGNKISGEIPADIGNIKMLTVLN  162

Query  328  LADNQISGVIPTPL  369
            LADNQISG IP  L
Sbjct  163  LADNQISGKIPASL  176


 Score = 52.4 bits (124),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V L  L H+DLS+N++TGE+P++ GKL M+SRA L R 
Sbjct  173  PASLVGLSGLMHMDLSNNQITGEIPADFGKLKMLSRAXLNRN  214



>ref|XP_010257339.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nelumbo 
nucifera]
Length=364

 Score = 78.6 bits (192),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RL+ LI+ADWK I+G +P CIT++    +LDL G +++  I + IG L  LT+LN
Sbjct  99   ICKLNRLTNLIIADWKGITGPVPACITSIPYLRVLDLIGNKLSGSIPSGIGKLKHLTVLN  158

Query  328  LADNQISGVIPT  363
            +ADNQI+G IP 
Sbjct  159  VADNQITGRIPA  170


 Score = 60.1 bits (144),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P SIVNL +L HLDL +N++TGE+PS+ GKL M+SRALL R Q   P+ +++ +  R
Sbjct  169  PASIVNLATLMHLDLRNNRITGEIPSDFGKLRMLSRALLSRNQIYGPIPSSISKIYR  225



>ref|XP_004510977.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cicer 
arietinum]
Length=386

 Score = 85.9 bits (211),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C LD+LSTLI+ADWK ISG IP CI++LS+  ILDLTG +I+  I   IG L ++T+LN
Sbjct  121  ICNLDKLSTLIVADWKTISGEIPSCISSLSSLQILDLTGNKISGEIPADIGKLQRITLLN  180

Query  328  LADNQISGVIP  360
            LADN I+G IP
Sbjct  181  LADNVITGEIP  191


 Score = 52.4 bits (124),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIV L  L HLDLS+N++ GELPS+ GKL  +SRALL R 
Sbjct  191  PPSIVKLAGLMHLDLSNNQIAGELPSDFGKLRKLSRALLSRN  232


 Score = 47.4 bits (111),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL R++ L LAD   I+G IPP I  L+    LDL+  QI   + +  G L KL+   
Sbjct  170  IGKLQRITLLNLAD-NVITGEIPPSIVKLAGLMHLDLSNNQIAGELPSDFGKLRKLSRAL  228

Query  328  LADNQISGVIPT  363
            L+ NQ++G IP 
Sbjct  229  LSRNQLTGSIPN  240


 Score = 34.3 bits (77),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P+S++ +  L  LDLS N++TG +P+ +GK+ ++S
Sbjct  239  PNSVLKMNRLADLDLSLNRITGSIPARLGKMRVLS  273



>ref|XP_009417308.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Musa 
acuminata subsp. malaccensis]
Length=361

 Score = 91.3 bits (225),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+LDRL+TL+LADWK ISG IPPC+T+L    ILDL G + + PI   IG L++L +LN
Sbjct  95   ICRLDRLTTLVLADWKHISGPIPPCLTSLPLLRILDLIGNRFSGPIPDDIGNLSRLAVLN  154

Query  328  LADNQISGVIPTPLST  375
            +ADNQISG IP  LS 
Sbjct  155  VADNQISGSIPASLSA  170


 Score = 47.0 bits (110),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L SL HLDLS+N++ G +P + G+L M+SRALL R 
Sbjct  165  PASLSALSSLMHLDLSNNQIAGPIPGDFGELRMLSRALLARN  206



>ref|XP_004973861.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Setaria 
italica]
Length=376

 Score = 81.3 bits (199),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC+L RLS+L+LADWK ISG IP C+ T L    IL+L G ++T  I   +
Sbjct  100  VMSGYVSDAVCRLGRLSSLVLADWKQISGPIPSCVATDLPYLRILELPGNRLTGGIPPAV  159

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G L++LT+LNLADNQ++G +P  +++
Sbjct  160  GSLSRLTVLNLADNQLTGAVPGSITS  185


 Score = 56.6 bits (135),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI +L SLKHLDL++N+LTG +P+++GKL M+SRALL R 
Sbjct  180  PGSITSLASLKHLDLANNQLTGRVPADLGKLVMLSRALLGRN  221



>ref|XP_002513181.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF49172.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=422

 Score = 84.0 bits (206),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            +S F    +CKLD L+TL +ADWK ISG IP C+ +L +  ILDL G +I+  I T IG 
Sbjct  149  MSGFINPSICKLDSLTTLTIADWKDISGEIPECVVSLRSLRILDLVGNKISGKIPTDIGN  208

Query  304  LNKLTILNLADNQISGVIPTPLS  372
            L +LT+LNLADN+I G IP  ++
Sbjct  209  LQRLTVLNLADNEIWGEIPASIT  231


 Score = 53.1 bits (126),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI  L +LKHLDL +N+++GELPS+ G L M+SRA+L R 
Sbjct  227  PASITKLANLKHLDLRNNQVSGELPSDFGSLKMLSRAMLSRN  268



>gb|KDO83367.1| hypothetical protein CISIN_1g017912mg [Citrus sinensis]
Length=364

 Score = 84.7 bits (208),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C+LD LSTL++ADWK ISG +P CIT++++  +LDL G +++  I   IG L KLT+L
Sbjct  98   AICQLDTLSTLVIADWKGISGQLPSCITSIASLRVLDLVGNKLSGKIPDDIGNLQKLTVL  157

Query  325  NLADNQISGVIPTPL  369
            NLADN +SG IP+ L
Sbjct  158  NLADNAVSGEIPSSL  172


 Score = 52.4 bits (124),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+V L SLKHLDLS+N+L+G++P++ G L M+SRALL+
Sbjct  169  PSSLVRLSSLKHLDLSNNQLSGKIPADFGNLKMLSRALLR  208


 Score = 39.3 bits (90),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +  L +L+ L LAD  A+SG IP  +  LS+   LDL+  Q++  I    G L  L+   
Sbjct  148  IGNLQKLTVLNLAD-NAVSGEIPSSLVRLSSLKHLDLSNNQLSGKIPADFGNLKMLSRAL  206

Query  328  LADNQISGVIP  360
            L  N+++G IP
Sbjct  207  LRGNKLTGSIP  217


 Score = 31.6 bits (70),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI N+  L  LDLS N+++G +P  +GK+ ++S
Sbjct  217  PDSIGNMYRLADLDLSMNQISGPIPDILGKMLVLS  251



>ref|XP_006438982.1| hypothetical protein CICLE_v10031896mg [Citrus clementina]
 ref|XP_006482906.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Citrus 
sinensis]
 gb|ESR52222.1| hypothetical protein CICLE_v10031896mg [Citrus clementina]
Length=364

 Score = 84.7 bits (208),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C+LD LSTL++ADWK ISG +P CIT++++  +LDL G +++  I   IG L KLT+L
Sbjct  98   AICQLDTLSTLVIADWKGISGQLPSCITSIASLRVLDLVGNKLSGKIPDDIGNLQKLTVL  157

Query  325  NLADNQISGVIPTPL  369
            NLADN +SG IP+ L
Sbjct  158  NLADNAVSGEIPSSL  172


 Score = 52.4 bits (124),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+V L SLKHLDLS+N+L+G++P++ G L M+SRALL+
Sbjct  169  PSSLVRLSSLKHLDLSNNQLSGKIPADFGNLKMLSRALLR  208


 Score = 38.9 bits (89),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +  L +L+ L LAD  A+SG IP  +  LS+   LDL+  Q++  I    G L  L+   
Sbjct  148  IGNLQKLTVLNLAD-NAVSGEIPSSLVRLSSLKHLDLSNNQLSGKIPADFGNLKMLSRAL  206

Query  328  LADNQISGVIP  360
            L  N+++G IP
Sbjct  207  LRGNKLTGSIP  217


 Score = 33.1 bits (74),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI N+  L  LDLS+N+++G +P  +GK+ ++S
Sbjct  217  PDSIGNMYRLADLDLSTNQISGPIPDILGKMLVLS  251



>gb|AHY03429.1| lrr protein [Sedum alfredii]
Length=368

 Score = 85.1 bits (209),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + VCK+D L+ L++ADWK ISG IP CI +L    +LDL G  ++ PI + IG L+KL +
Sbjct  100  SSVCKIDSLTLLVIADWKGISGSIPSCIASLPKLRVLDLIGNSLSGPIPSNIGALSKLKV  159

Query  322  LNLADNQISGVIPTPLSTWE  381
            LNLADNQ+SG IP+ L+  +
Sbjct  160  LNLADNQLSGPIPSSLAQMQ  179


 Score = 51.6 bits (122),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  +  L+HLDLS+NKL+G +P NIG L M+SRALL R 
Sbjct  172  PSSLAQMQDLRHLDLSNNKLSGNIPQNIGNLRMLSRALLSRN  213



>ref|XP_009590650.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nicotiana 
tomentosiformis]
Length=365

 Score = 83.2 bits (204),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+TL++ADWK ISG IP C+ +L N  ILDL G +I+  I + IG L++LTIL 
Sbjct  100  LCKLDMLTTLVVADWKDISGEIPTCLASLQNLRILDLIGNKISGEIPSDIGQLSELTILK  159

Query  328  LADNQISGVIP  360
            L+DNQISG IP
Sbjct  160  LSDNQISGSIP  170


 Score = 53.1 bits (126),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVN G L HLDLS+N L GE+PS+IGK++M+SRA++   
Sbjct  170  PPSIVNHGKLIHLDLSNNMLIGEIPSDIGKISMLSRAIVNNN  211



>ref|NP_001241507.1| DNA-damage-repair/toleration protein DRT100-like precursor [Glycine 
max]
 gb|ACM89604.1| leucine rich repeat protein [Glycine max]
Length=365

 Score = 77.4 bits (189),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L  L+TLI+ADWKA+SG IP C+ +L    ILDL+G +I+  I T IG L  LT+L+
Sbjct  100  ICNLSNLTTLIVADWKAVSGEIPACVASLYTLQILDLSGNRISGKIPTDIGNLWSLTLLS  159

Query  328  LADNQISGVIP  360
            L DN+ISG IP
Sbjct  160  LGDNEISGEIP  170


 Score = 58.5 bits (140),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+VNL  LKHLDLS+N+LTGE+P + GKL M+SRALL   
Sbjct  170  PMSVVNLARLKHLDLSNNRLTGEIPYDFGKLAMLSRALLSEN  211



>ref|XP_006299860.1| hypothetical protein CARUB_v10016063mg [Capsella rubella]
 gb|EOA32758.1| hypothetical protein CARUB_v10016063mg [Capsella rubella]
Length=373

 Score = 88.2 bits (217),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADWK I+G IPPC+T+L++  ILDL G +IT  I   IG L+KL++LN
Sbjct  107  VCDLTALTSLVLADWKGITGEIPPCVTSLASLRILDLAGNRITGEIPAEIGKLSKLSVLN  166

Query  328  LADNQISGVIPTPLST  375
            LA+NQ+SG IP  L++
Sbjct  167  LAENQMSGEIPASLTS  182


 Score = 47.8 bits (112),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N +TG +P+N G L M+SRALL R 
Sbjct  177  PASLTSLTELKHLELTENGITGVIPANFGSLKMLSRALLARN  218



>ref|XP_007149050.1| hypothetical protein PHAVU_005G036600g [Phaseolus vulgaris]
 gb|ESW21044.1| hypothetical protein PHAVU_005G036600g [Phaseolus vulgaris]
Length=367

 Score = 79.3 bits (194),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C +D L+T ++ADWK I+G IP CIT LS+  ILDL G +++  I   IG LN+LT+LN
Sbjct  102  ICGIDTLTTFVVADWKDIAGDIPACITGLSSLRILDLIGNKLSGEIPGDIGRLNRLTVLN  161

Query  328  LADNQISGVIP  360
            LADN ++G IP
Sbjct  162  LADNALTGKIP  172


 Score = 56.6 bits (135),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI  L SLKHLDLSSN LTGE+P N G L M+SRA+L R 
Sbjct  172  PPSITQLTSLKHLDLSSNLLTGEIPKNFGNLAMLSRAMLNRN  213


 Score = 45.8 bits (107),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L+RL+ L LAD  A++G IPP IT L++   LDL+   +T  I    G L  L+   
Sbjct  151  IGRLNRLTVLNLAD-NALTGKIPPSITQLTSLKHLDLSSNLLTGEIPKNFGNLAMLSRAM  209

Query  328  LADNQISGVIPTPLS  372
            L  NQ++G IP  +S
Sbjct  210  LNRNQLTGSIPVSIS  224


 Score = 32.3 bits (72),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI  +  L  LDLS N+LTG +P  +GK+ ++S
Sbjct  220  PVSISKIYRLADLDLSVNRLTGSVPFELGKMPVLS  254



>ref|XP_009120492.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Brassica 
rapa]
Length=373

 Score = 87.4 bits (215),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++ +LADWK ISG IPPC+T+L++  ILDL G +IT  I T IG L KL +LN
Sbjct  107  VCGLSALTSFVLADWKGISGEIPPCVTSLASLRILDLAGNRITGEIPTDIGKLTKLGVLN  166

Query  328  LADNQISGVIPTPLST  375
            LA+N++SG IP+ L++
Sbjct  167  LAENRMSGEIPSSLTS  182


 Score = 48.5 bits (114),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++GE+P++ G L M+SRALL R 
Sbjct  177  PSSLTSLSELKHLELTENGISGEIPADFGSLKMLSRALLGRN  218



>ref|XP_010673595.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Beta 
vulgaris subsp. vulgaris]
Length=379

 Score = 77.4 bits (189),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L +ADWK ISG IP CIT+L     LDL G + +  I   IG L +LT+LN
Sbjct  114  ICKLERLSSLTIADWKGISGEIPGCITSLLFIRTLDLIGNRFSGRIPGDIGRLKELTVLN  173

Query  328  LADNQISGVIP  360
            LADN +SG IP
Sbjct  174  LADNSLSGPIP  184


 Score = 58.5 bits (140),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SIVNLG L HLDL +NKL+GELP  +GKL MMSRALL 
Sbjct  184  PRSIVNLGRLMHLDLRNNKLSGELPREMGKLQMMSRALLS  223



>ref|XP_010265772.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nelumbo 
nucifera]
Length=364

 Score = 80.1 bits (196),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLDRL+TLI+ADWK ISG IP CIT++    +LDL G ++T  I + IG L  LT+LN
Sbjct  99   ICKLDRLTTLIIADWKGISGEIPACITSIPYLRVLDLIGNKLTGKIPSDIGKLQHLTVLN  158

Query  328  LADNQISGVIPTPL  369
            +ADN I+  IP  L
Sbjct  159  VADNLITXTIPPSL  172


 Score = 55.1 bits (131),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+VNL  L HLDL +N++TG++PS+ GKL M+SRALL R 
Sbjct  169  PPSLVNLAGLMHLDLRNNRITGQIPSDFGKLQMLSRALLSRN  210



>ref|XP_009394996.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Musa 
acuminata subsp. malaccensis]
Length=374

 Score = 89.7 bits (221),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC+LDRL+TLILADWK ISG IPPC+T+L    ILDL G ++T  I   IG L++L +LN
Sbjct  108  VCRLDRLATLILADWKHISGPIPPCLTSLPFLRILDLVGNRLTGTIPADIGRLSRLAVLN  167

Query  328  LADNQISGVIPTPL  369
            +ADNQISG IP  L
Sbjct  168  VADNQISGHIPASL  181


 Score = 45.4 bits (106),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L SL HLDLS+N+++G +P + G L M+SRALL R 
Sbjct  178  PASLPALSSLMHLDLSNNQISGPIPHDFGNLRMLSRALLGRN  219



>gb|EYU46293.1| hypothetical protein MIMGU_mgv1a008423mg [Erythranthe guttata]
Length=374

 Score = 84.7 bits (208),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC+L+RLS+  +ADWK ISG IPPCI +L    ILDL G ++T  +   IG L++LT+LN
Sbjct  110  VCQLERLSSFTIADWKGISGPIPPCIASLPYLRILDLIGNKLTGELPADIGRLSRLTVLN  169

Query  328  LADNQISGVIPTPLST  375
            +ADNQ+SG IP  L+ 
Sbjct  170  VADNQLSGTIPRSLTN  185


 Score = 50.1 bits (118),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLD+  N+++G +P N GKL M+SRALL + 
Sbjct  180  PRSLTNLSSLMHLDIRGNRISGTIPRNFGKLRMLSRALLSKN  221



>ref|XP_008219342.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Prunus 
mume]
Length=430

 Score = 81.6 bits (200),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C+L RLS+L +ADWK ISG IP CIT L    I DL G +I+  I   IG L++LT+L
Sbjct  165  AICRLTRLSSLTIADWKGISGEIPKCITTLPFLRIFDLIGNKISGQIPAGIGRLHRLTVL  224

Query  325  NLADNQISGVIPTPLS  372
            N ADN ISG IPT L+
Sbjct  225  NFADNLISGPIPTSLT  240


 Score = 53.1 bits (126),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R
Sbjct  236  PTSLTNLSSLMHLDLRNNKISGELPRDFGRLGMLSRALLSR  276



>ref|XP_009803455.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nicotiana 
sylvestris]
Length=366

 Score = 84.0 bits (206),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L +ADWK I+G IP C+T+L    I+DL G ++T PI + IG L++LT+LN
Sbjct  100  ICKLERLSSLTIADWKGITGPIPSCVTSLPFLRIIDLIGNKLTGPIPSEIGRLSRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            +ADN +SG IP  L+ 
Sbjct  160  VADNSLSGRIPRSLTN  175


 Score = 50.4 bits (119),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N++ G LP+N GKL M+SRALL
Sbjct  170  PRSLTNLSSLMHLDLRNNRIFGTLPTNFGKLRMLSRALL  208


 Score = 38.9 bits (89),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L +AD  ++SG IP  +T LS+   LDL   +I   + T  G L  L+   
Sbjct  149  IGRLSRLTVLNVAD-NSLSGRIPRSLTNLSSLMHLDLRNNRIFGTLPTNFGKLRMLSRAL  207

Query  328  LADNQISGVIPTPLS  372
            L+ N++ G IP  +S
Sbjct  208  LSGNRLIGKIPYSIS  222


 Score = 32.3 bits (72),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P+SI  +  L  LDLS NKL+G +P ++GK+ +++
Sbjct  218  PYSISYIYRLSDLDLSLNKLSGTIPPSLGKMHVLA  252



>ref|XP_010486984.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Camelina 
sativa]
Length=372

 Score = 87.4 bits (215),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADWK I+G IPPC+T+L++  ILDL G +IT  I   IG L+KL +LN
Sbjct  106  VCDLTALTSLVLADWKGITGEIPPCVTSLASLRILDLAGNRITGEIPAEIGKLSKLAVLN  165

Query  328  LADNQISGVIPTPLST  375
            LA+NQ+SG IP  L++
Sbjct  166  LAENQMSGEIPASLTS  181


 Score = 47.0 bits (110),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N +TG +P++ G L M+SRALL R 
Sbjct  176  PASLTSLAELKHLELTENGITGVIPADFGSLKMLSRALLGRN  217



>ref|XP_010499242.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Camelina 
sativa]
Length=372

 Score = 87.4 bits (215),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADWK I+G IPPC+T+L++  ILDL G +IT  I   IG L+KL +LN
Sbjct  106  VCDLTALTSLVLADWKGITGEIPPCVTSLASLRILDLAGNRITGEIPAEIGKLSKLAVLN  165

Query  328  LADNQISGVIPTPLST  375
            LA+NQ+SG IP  L++
Sbjct  166  LAENQMSGEIPASLTS  181


 Score = 47.0 bits (110),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N +TG +P++ G L M+SRALL R 
Sbjct  176  PASLTSLAELKHLELTENGITGVIPADFGSLKMLSRALLGRN  217



>gb|AFB75322.1| leucine-rich repeat receptor-like protein [Malus domestica]
 gb|AFB75328.1| leucine-rich repeat receptor-like protein [Malus domestica]
Length=367

 Score = 79.0 bits (193),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK I+G IP CIT L    ILDL G +I+  I   IG L++LT+LN
Sbjct  103  ICRLTRLSSVTIADWKGITGEIPKCITTLPFLRILDLIGNRISGEIPAGIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLS  372
             ADN ISG IP  L+
Sbjct  163  FADNLISGPIPASLT  177


 Score = 55.5 bits (132),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQW  485
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R +
Sbjct  173  PASLTNLSSLMHLDLRNNKISGELPRDFGRLAMLSRALLSRNF  215



>gb|KHN29211.1| DNA-damage-repair/toleration protein DRT100 [Glycine soja]
Length=367

 Score = 78.6 bits (192),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C +D L+TL++ADWK I+G IP C+TAL +  ILDL G +++  I   +G L++LT+LN
Sbjct  102  ICGIDTLTTLVVADWKDIAGEIPTCVTALPSLRILDLIGNKLSGEIPADVGKLSRLTVLN  161

Query  328  LADNQISGVIPTPLS  372
            LADN +SG IP  ++
Sbjct  162  LADNALSGKIPASIT  176


 Score = 55.5 bits (132),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI  LGSLKHLDLS+N+L GE+P + G L M+SR LL R 
Sbjct  172  PASITQLGSLKHLDLSNNQLCGEIPEDFGNLGMLSRMLLSRN  213


 Score = 47.4 bits (111),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            V KL RL+ L LAD  A+SG IP  IT L +   LDL+  Q+   I    G L  L+ + 
Sbjct  151  VGKLSRLTVLNLAD-NALSGKIPASITQLGSLKHLDLSNNQLCGEIPEDFGNLGMLSRML  209

Query  328  LADNQISGVIPTPLS  372
            L+ NQ++G IP  +S
Sbjct  210  LSRNQLTGKIPVSVS  224


 Score = 29.6 bits (65),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  LDLS+N+L+G +P  +G + ++S
Sbjct  220  PVSVSKIYRLADLDLSANRLSGSVPFELGTMPVLS  254



>emb|CDY52664.1| BnaC01g38540D [Brassica napus]
Length=373

 Score = 87.0 bits (214),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++ +LADWK ISG IPPCIT+L++  ILDL G +IT  I T IG L KL +LN
Sbjct  107  VCDLTALTSFVLADWKGISGEIPPCITSLASLRILDLAGNRITGEIPTDIGKLTKLGVLN  166

Query  328  LADNQISGVIPTPLST  375
            LA+N++SG IP+ L++
Sbjct  167  LAENRMSGEIPSSLTS  182


 Score = 47.0 bits (110),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++G++P++ G L M+SRALL R 
Sbjct  177  PSSLTSLSELKHLELTENGISGQIPADFGSLKMLSRALLGRN  218



>gb|ACM89582.1| leucine rich repeat protein [Glycine max]
Length=274

 Score = 79.0 bits (193),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C +D L+TL++ADWK I+G IP C+TAL +  ILDL G +++  I   +G L++LT+L
Sbjct  8    AICGIDTLTTLVVADWKDIAGEIPTCVTALPSLRILDLIGNKLSGEIPADVGKLSRLTVL  67

Query  325  NLADNQISGVIPTPLS  372
            NLADN +SG IP  ++
Sbjct  68   NLADNALSGKIPASIT  83


 Score = 55.1 bits (131),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI  LGSLKHLDLS+N+L GE+P + G L M+SR LL R 
Sbjct  79   PASITQLGSLKHLDLSNNQLCGEIPEDFGNLGMLSRMLLSRN  120


 Score = 47.4 bits (111),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            V KL RL+ L LAD  A+SG IP  IT L +   LDL+  Q+   I    G L  L+ + 
Sbjct  58   VGKLSRLTVLNLAD-NALSGKIPASITQLGSLKHLDLSNNQLCGEIPEDFGNLGMLSRML  116

Query  328  LADNQISGVIPTPLS  372
            L+ NQ++G IP  +S
Sbjct  117  LSRNQLTGKIPVSVS  131


 Score = 29.3 bits (64),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  LDLS+N+L+G +P  +G + ++S
Sbjct  127  PVSVSKIYRLADLDLSANRLSGSVPFELGTMPVLS  161



>ref|XP_007205432.1| hypothetical protein PRUPE_ppa007765mg [Prunus persica]
 gb|EMJ06631.1| hypothetical protein PRUPE_ppa007765mg [Prunus persica]
Length=356

 Score = 80.5 bits (197),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C+L RLS+L +ADWK I+G IP CIT L    I DL G +I+  I   IG L++LT+L
Sbjct  91   AICRLTRLSSLTIADWKGITGEIPKCITTLPFLRIFDLMGNKISGQIPAGIGRLHRLTVL  150

Query  325  NLADNQISGVIPTPLS  372
            N ADN ISG IPT L+
Sbjct  151  NFADNLISGPIPTSLT  166


 Score = 53.1 bits (126),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R 
Sbjct  162  PTSLTNLSSLMHLDLRNNKISGELPRDFGRLGMLSRALLSRN  203



>ref|XP_011080256.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Sesamum 
indicum]
Length=367

 Score = 82.0 bits (201),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS+L +ADWK ISG IP CI +L    ILDL G Q+T  I   IG L++LT+LN
Sbjct  103  ICQLTRLSSLTIADWKGISGPIPSCIASLPFLRILDLIGNQLTGEIPADIGRLSRLTVLN  162

Query  328  LADNQISGVIPTPLST  375
            +ADNQ+SG IP  L+ 
Sbjct  163  VADNQLSGTIPRSLTN  178


 Score = 51.6 bits (122),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLD+  NK++G LP N GKL M+SRALL + 
Sbjct  173  PRSLTNLSSLMHLDIRGNKISGTLPRNFGKLRMLSRALLSKN  214



>ref|NP_001241499.1| DNA-damage-repair/toleration protein DRT100-like precursor [Glycine 
max]
 gb|ACM89584.1| leucine rich repeat protein [Glycine max]
Length=366

 Score = 81.3 bits (199),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L  L+TL++ADWKA+SG IP C+ +L +  ILDL+G +I+  I   IG L  LT+L+
Sbjct  101  ICNLSNLTTLVVADWKAVSGEIPACVASLYSLQILDLSGNRISGEISADIGNLRSLTLLS  160

Query  328  LADNQISGVIPT  363
            LADN+ISG IPT
Sbjct  161  LADNEISGKIPT  172


 Score = 52.0 bits (123),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+V L  LKHLDLS+N+L+GE+P N G L M+SRALL 
Sbjct  171  PTSVVKLIRLKHLDLSNNQLSGEIPYNFGNLAMLSRALLS  210



>gb|EPS65874.1| hypothetical protein M569_08903 [Genlisea aurea]
Length=353

 Score = 82.4 bits (202),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             VC L RLS LI+ADWK ISG IP CI+ L    ILDL G ++T  I   IG L +LT+L
Sbjct  85   AVCGLTRLSGLIIADWKGISGSIPHCISQLPFLRILDLIGNKLTGEIPGDIGLLTQLTVL  144

Query  325  NLADNQISGVIPTPL  369
            NLADNQISG IP  L
Sbjct  145  NLADNQISGEIPRSL  159


 Score = 50.8 bits (120),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+VNL SL HLDL +N+++ ++P N GKL M+SRALL +
Sbjct  156  PRSLVNLSSLMHLDLRNNQISAQIPRNFGKLRMISRALLSK  196



>dbj|BAJ98015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score = 77.8 bits (190),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC LD LS+LILADWK ISG IP C+ T+L N  IL+L   ++T  I   I
Sbjct  102  VMSGYISDHVCHLDALSSLILADWKQISGPIPSCVATSLPNLRILELHANRLTGEIPPSI  161

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G L++L +LNLADN +SG IP+ +++
Sbjct  162  GSLSRLIVLNLADNLLSGAIPSSIAS  187


 Score = 55.1 bits (131),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI +L S+KHLDL++N+LTG +P+NIG L  +SRALL R 
Sbjct  182  PSSIASLASIKHLDLANNQLTGTIPANIGNLATLSRALLSRN  223



>ref|XP_004250859.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Solanum 
lycopersicum]
Length=365

 Score = 82.0 bits (201),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L +ADWK I+G IP CIT+L    I+DL G ++T  I + IG L++LT+LN
Sbjct  100  ICKLERLSSLTIADWKGITGSIPSCITSLPFLRIIDLVGNKLTGSIPSTIGRLSRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            +A+NQ++G IP  L+ 
Sbjct  160  VAENQLTGYIPRSLTN  175


 Score = 50.8 bits (120),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +N + G +P+N GKL M+SRALL R 
Sbjct  170  PRSLTNLSSLMHLDLRNNGIYGNIPTNFGKLRMLSRALLSRN  211



>ref|XP_002285553.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Vitis 
vinifera]
Length=364

 Score = 84.0 bits (206),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL RLS++I+ADWK ISG IP CIT+L    ILDL G +++ PI   IG L +LT+L
Sbjct  99   AICKLRRLSSIIIADWKGISGEIPTCITSLPFLRILDLIGNKLSGPIPAGIGRLQRLTVL  158

Query  325  NLADNQISGVIPTPLS  372
            N+ADN IS  IP+ L+
Sbjct  159  NVADNLISATIPSSLT  174


 Score = 48.9 bits (115),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  + +L HLDL +N+++GELP + G+L M+SRALL R 
Sbjct  170  PSSLTRISTLTHLDLRNNRISGELPRDFGRLGMLSRALLSRN  211



>dbj|BAJ87499.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88028.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score = 77.8 bits (190),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC LD LS+LILADWK ISG IP C+ T+L N  IL+L   ++T  I   I
Sbjct  102  VMSGYISDHVCHLDALSSLILADWKQISGPIPSCVATSLPNLRILELPANRLTGEIPPSI  161

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G L++L +LNLADN +SG IP+ +++
Sbjct  162  GSLSRLIVLNLADNLLSGAIPSSIAS  187


 Score = 55.1 bits (131),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI +L S+KHLDL++N+LTG +P+NIG L  +SRALL R 
Sbjct  182  PSSIASLASIKHLDLANNQLTGTIPANIGNLATLSRALLSRN  223



>ref|XP_009420044.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Musa 
acuminata subsp. malaccensis]
Length=373

 Score = 88.2 bits (217),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C LDRL+TLILADWK ISG IPPCIT+L    ILDL G +++  +   IG L++LT+LN
Sbjct  107  ICLLDRLTTLILADWKQISGPIPPCITSLPLLRILDLVGNRLSGSLPADIGRLSRLTVLN  166

Query  328  LADNQISGVIPTPL  369
            +ADNQISG IP+ L
Sbjct  167  VADNQISGTIPSSL  180


 Score = 44.7 bits (104),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+V L SL HL+LS+N+++G +P++ G L  +SRALL R 
Sbjct  177  PSSLVALSSLMHLELSNNQISGTIPTDFGNLRKLSRALLGRN  218



>emb|CDY50534.1| BnaA01g30460D [Brassica napus]
Length=373

 Score = 86.3 bits (212),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++ +LADWK ISG IPPC+T+L++  ILDL G +IT  I T IG L KL +LN
Sbjct  107  VCGLTALTSFVLADWKGISGEIPPCVTSLASLRILDLAGNRITGEIPTDIGKLTKLGVLN  166

Query  328  LADNQISGVIPTPLS  372
            LA+N++SG IP+ L+
Sbjct  167  LAENRMSGEIPSSLT  181


 Score = 46.6 bits (109),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L  LKHL+L+ N ++GE+P++ G L M+SRALL R 
Sbjct  177  PSSLTLLSELKHLELTENGISGEIPADFGSLKMLSRALLGRN  218



>ref|XP_009379431.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Pyrus 
x bretschneideri]
Length=367

 Score = 79.0 bits (193),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK I+G IP CIT L    ILDL G +I+  I + IG L++LT+LN
Sbjct  103  ICRLTRLSSVTIADWKGITGEIPKCITTLPFLRILDLIGNRISGEIPSGIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLS  372
            +ADN ISG IP  L+
Sbjct  163  VADNLISGPIPASLT  177


 Score = 53.9 bits (128),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R 
Sbjct  173  PASLTNLSSLMHLDLRNNKISGELPQDFGRLGMLSRALLSRN  214



>ref|XP_008349465.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
 ref|XP_008358884.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
Length=367

 Score = 79.0 bits (193),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK I+G IP CIT L    ILDL G +I+  I + IG L++LT+LN
Sbjct  103  ICRLTRLSSVTIADWKGITGEIPKCITTLPFLRILDLIGNKISGEIPSGIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLS  372
            +ADN ISG IP  L+
Sbjct  163  VADNLISGPIPASLT  177


 Score = 53.9 bits (128),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R 
Sbjct  173  PASLTNLSSLMHLDLRNNKISGELPQDFGRLGMLSRALLSRN  214



>ref|XP_009374638.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Pyrus 
x bretschneideri]
Length=367

 Score = 79.3 bits (194),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK I+G IP CIT L    ILDL G +I+  I + IG L++LT+LN
Sbjct  103  ICRLTRLSSVTIADWKGITGEIPKCITTLPFLRILDLIGNRISGEIPSGIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLST  375
             ADN ISG IP  L+ 
Sbjct  163  FADNLISGPIPASLTN  178


 Score = 53.5 bits (127),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R 
Sbjct  173  PASLTNLSSLMHLDLRNNKISGELPRDFGRLGMLSRALLSRN  214



>ref|XP_010557788.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Tarenaya 
hassleriana]
Length=371

 Score = 84.0 bits (206),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             VC+L  L++L+LADWK ISG IP CITAL++  +LDL G  IT  I T IG L +  +L
Sbjct  105  AVCELVSLNSLVLADWKGISGEIPACITALASLRVLDLAGNSITGEIPTEIGNLRRFAVL  164

Query  325  NLADNQISGVIPTPLST  375
            NLA+N++SG IP  L++
Sbjct  165  NLAENRMSGEIPPSLTS  181


 Score = 48.5 bits (114),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++GE+PS+ G L M+SRALL R 
Sbjct  176  PPSLTSLSELKHLELTENGISGEIPSDFGSLKMLSRALLGRN  217



>gb|AFB75324.1| leucine-rich repeat receptor-like protein [Malus domestica]
Length=367

 Score = 79.0 bits (193),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK I+G IP CIT L    ILDL G +I+  I   IG L++LT+LN
Sbjct  103  ICRLTRLSSVTIADWKGITGEIPKCITTLPFLRILDLIGNRISGEIPASIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLS  372
             ADN ISG IP  L+
Sbjct  163  FADNLISGPIPASLT  177


 Score = 53.5 bits (127),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R 
Sbjct  173  PASLTNLSSLMHLDLRNNKISGELPRDFGRLGMLSRALLSRN  214



>ref|XP_006354265.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Solanum 
tuberosum]
Length=364

 Score = 81.6 bits (200),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L +ADWK I+G IP CIT+L    I+DL G ++T  I + IG L++LT+LN
Sbjct  99   ICKLERLSSLTIADWKGITGPIPSCITSLPFLRIIDLVGNKLTGSIPSTIGRLSRLTVLN  158

Query  328  LADNQISGVIPTPLST  375
            +A+NQ++G IP  L+ 
Sbjct  159  VAENQLTGYIPRSLTN  174


 Score = 50.8 bits (120),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +N + G +P+N GKL M+SRALL R 
Sbjct  169  PRSLTNLSSLMHLDLRNNFIYGNIPTNFGKLRMLSRALLSRN  210



>ref|XP_002444779.1| hypothetical protein SORBIDRAFT_07g027860 [Sorghum bicolor]
 gb|EES14274.1| hypothetical protein SORBIDRAFT_07g027860 [Sorghum bicolor]
Length=379

 Score = 76.3 bits (186),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC+LDRLS+L+LADWK ISG +P C+ T+L    IL+L G ++T  I    
Sbjct  99   VMSGYVSDAVCRLDRLSSLVLADWKQISGPVPACVATSLPYLRILELPGNRLTGAIPPLA  158

Query  298  G*LNKLTILNLADNQISGVIP  360
              L++L +LNLADNQ++G IP
Sbjct  159  A-LSRLAVLNLADNQLTGGIP  178


 Score = 56.2 bits (134),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHLDL++N+LTG LPS+ GKL M+SRALL R 
Sbjct  178  PGSVTSLAELKHLDLANNRLTGRLPSDFGKLRMLSRALLGRN  219



>ref|XP_006407315.1| hypothetical protein EUTSA_v10020961mg [Eutrema salsugineum]
 gb|ESQ48768.1| hypothetical protein EUTSA_v10020961mg [Eutrema salsugineum]
Length=373

 Score = 85.1 bits (209),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADWK ISG IPPCIT+L++  +LDL G +IT  I   IG L+KL +LN
Sbjct  107  VCDLTILTSLVLADWKGISGEIPPCITSLASLRVLDLAGNRITGEIPAEIGKLSKLVVLN  166

Query  328  LADNQISGVIPTPLST  375
            LA+N++SG IP  L++
Sbjct  167  LAENRMSGEIPPSLTS  182


 Score = 47.4 bits (111),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++GE+P++ G L M+SRALL R 
Sbjct  177  PPSLTSLTELKHLELTENGISGEIPADFGSLKMLSRALLGRN  218



>gb|AFB75323.1| leucine-rich repeat receptor-like protein [Malus domestica]
Length=367

 Score = 79.0 bits (193),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK I+G IP CIT L    ILDL G +I+  I   IG L++LT+LN
Sbjct  103  ICRLTRLSSVTIADWKGITGEIPKCITTLPFLRILDLIGNRISGEIPAGIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLS  372
             ADN ISG IP  L+
Sbjct  163  FADNLISGPIPASLT  177


 Score = 53.5 bits (127),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R 
Sbjct  173  PASLTNLSSLMHLDLRNNKISGELPRDFGRLGMLSRALLSRN  214



>ref|XP_010536054.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Tarenaya 
hassleriana]
Length=374

 Score = 85.9 bits (211),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL RLS +ILADWK ISG IP C+  L    ILD+ G +I  PI   IG L +L++L
Sbjct  107  AICKLTRLSGIILADWKGISGEIPSCVANLPFLRILDVVGNRIYGPIPERIGQLQRLSVL  166

Query  325  NLADNQISGVIPTPLS  372
            NLADNQISG IP  L+
Sbjct  167  NLADNQISGRIPESLT  182


 Score = 46.2 bits (108),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+  L  L HLD+ +NK++GE+P +IG L M+SRALL
Sbjct  178  PESLTRLSGLMHLDIRNNKISGEIPRDIGLLKMLSRALL  216



>dbj|BAJ34133.1| unnamed protein product [Thellungiella halophila]
Length=406

 Score = 85.1 bits (209),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADWK ISG IPPCIT+L++  +LDL G +IT  I   IG L+KL +LN
Sbjct  140  VCDLTILTSLVLADWKGISGEIPPCITSLASLRVLDLAGNRITGEIPAEIGKLSKLVVLN  199

Query  328  LADNQISGVIPTPLST  375
            LA+N++SG IP  L++
Sbjct  200  LAENRMSGEIPPSLTS  215


 Score = 47.4 bits (111),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++GE+P++ G L M+SRALL R 
Sbjct  210  PPSLTSLTELKHLELTENGISGEIPADFGSLKMLSRALLGRN  251



>ref|XP_008354996.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
 ref|XP_008363347.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
 gb|AFB75321.1| leucine-rich repeat receptor-like protein [Malus domestica]
 gb|AFB75325.1| leucine-rich repeat receptor-like protein [Malus domestica]
 gb|AFB75326.1| leucine-rich repeat receptor-like protein [Malus domestica]
 gb|AFB75327.1| leucine-rich repeat receptor-like protein [Malus domestica]
Length=367

 Score = 78.6 bits (192),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK I+G IP CIT L    ILDL G +I+  I   IG L++LT+LN
Sbjct  103  ICRLTRLSSVTIADWKGITGEIPKCITTLPFLRILDLIGNRISGEIPAGIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLS  372
             ADN ISG IP  L+
Sbjct  163  FADNLISGPIPASLT  177


 Score = 53.5 bits (127),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +NK++GELP + G+L M+SRALL R 
Sbjct  173  PASLTNLSSLMHLDLRNNKISGELPRDFGRLGMLSRALLSRN  214



>ref|XP_004295208.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Fragaria 
vesca subsp. vesca]
Length=364

 Score = 84.3 bits (207),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS++ +ADWK ISG IP CI+ L    ILDL G ++T P+ + IG L +LT+LN
Sbjct  100  ICRLTRLSSITIADWKGISGEIPRCISNLPFLRILDLIGNKLTGPLPSDIGRLQRLTVLN  159

Query  328  LADNQISGVIPTPLS  372
            +ADNQISG IP  L+
Sbjct  160  VADNQISGTIPESLT  174


 Score = 47.8 bits (112),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  + SL HLDL +NK++G+LP +  +LTM+SRALL + 
Sbjct  170  PESLTKISSLMHLDLRNNKISGKLPQDFNRLTMLSRALLSKN  211



>gb|KDP20186.1| hypothetical protein JCGZ_07906 [Jatropha curcas]
Length=311

 Score = 81.6 bits (200),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L +ADWK ISG IP CIT+L    I+DL G +I+  +   IG L++LT+LN
Sbjct  100  ICKLERLSSLTIADWKGISGEIPRCITSLPFLRIVDLIGNRISGDLPADIGRLHRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            +ADN ISG IP  L+ 
Sbjct  160  VADNLISGEIPRSLTN  175


 Score = 50.1 bits (118),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQW  485
            P S+ NL SL HLDL +N+++G LP + G+L M+SRALL + +
Sbjct  170  PRSLTNLSSLMHLDLRNNRISGPLPQDFGRLRMLSRALLSQNF  212



>ref|XP_007014956.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
 gb|EOY32575.1| Leucine-rich repeat (LRR) family protein [Theobroma cacao]
Length=402

 Score = 84.0 bits (206),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS++I+ADWK I+G IP CI  L    ILDL G +I+  I + IG L +LT+LN
Sbjct  138  ICKLPRLSSIIIADWKGITGEIPKCIATLPFLRILDLIGNKISGEIPSDIGRLQRLTVLN  197

Query  328  LADNQISGVIPTPLST  375
            +ADNQISG IP+ L+ 
Sbjct  198  IADNQISGRIPSSLTN  213


 Score = 47.4 bits (111),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ-RQWR*PVQAALHRRQR  524
            P S+ NL SL HLDL +NK++G +P   G+L M+SRALL   Q   P+  ++ +  R
Sbjct  208  PSSLTNLSSLMHLDLRNNKISGPIPRAFGRLRMLSRALLSGNQISGPIPGSISQIYR  264



>ref|NP_187867.1| DNA-damage-repair/toleration protein DRT100 [Arabidopsis thaliana]
 sp|Q00874.2|DR100_ARATH RecName: Full=DNA-damage-repair/toleration protein DRT100; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51016.1|AC069474_15 leucine rich repeat protein, putative; 20015-21133 [Arabidopsis 
thaliana]
 dbj|BAB02252.1| DNA-damage-repair/toleration protein-like; disease resistance 
protein; polygalacturonase inhibitor-like protein [Arabidopsis 
thaliana]
 gb|AAL15283.1| AT3g12610/T2E22_107 [Arabidopsis thaliana]
 gb|AAM64495.1| leucine rich repeat protein, putative [Arabidopsis thaliana]
 gb|AAN33189.1| At3g12610/T2E22_107 [Arabidopsis thaliana]
 gb|AEE75223.1| DNA-damage-repair/toleration protein DRT100 [Arabidopsis thaliana]
Length=372

 Score = 87.8 bits (216),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADWK I+G IPPCIT+L++  ILDL G +IT  I   IG L+KL +LN
Sbjct  106  VCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLN  165

Query  328  LADNQISGVIPTPLST  375
            LA+NQ+SG IP  L++
Sbjct  166  LAENQMSGEIPASLTS  181


 Score = 43.1 bits (100),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N +TG +P++ G L M+SR LL R 
Sbjct  176  PASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRN  217



>ref|XP_006493666.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Citrus 
sinensis]
Length=394

 Score = 78.2 bits (191),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VCKL RLS+L LADWK I+G IP CI+++    ILDL G +++  I   IG L++L +LN
Sbjct  130  VCKLTRLSSLTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPRDIGRLHRLAVLN  189

Query  328  LADNQISGVIP  360
            +ADN ISG IP
Sbjct  190  IADNNISGAIP  200


 Score = 52.4 bits (124),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI NL SL HLDL +N+++G +P ++G+L MMSRALL R 
Sbjct  200  PPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMMSRALLSRN  241



>gb|KDO64852.1| hypothetical protein CISIN_1g017578mg [Citrus sinensis]
Length=369

 Score = 78.2 bits (191),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VCKL RLS+L LADWK I+G IP CI+++    ILDL G +++  I   IG L++L +LN
Sbjct  105  VCKLTRLSSLTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPRDIGRLHRLAVLN  164

Query  328  LADNQISGVIP  360
            +ADN ISG IP
Sbjct  165  IADNNISGAIP  175


 Score = 52.4 bits (124),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI NL SL HLDL +N+++G +P ++G+L MMSRALL R 
Sbjct  175  PPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMMSRALLSRN  216



>ref|XP_010527663.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Tarenaya 
hassleriana]
Length=373

 Score = 82.4 bits (202),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS++I+ADWK ISG IP C+T L    ILD+TG +I+  I   IG L +L++LN
Sbjct  107  ICKLTSLSSIIIADWKGISGEIPKCVTNLPFLRILDITGNRISGEIPARIGQLKRLSVLN  166

Query  328  LADNQISGVIPTPLS  372
            LADNQISG +P  ++
Sbjct  167  LADNQISGRMPESIT  181


 Score = 48.1 bits (113),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L  L HLDL +NK++G++P +IG+L M+SRALL
Sbjct  177  PESITGLTGLMHLDLRNNKISGKIPRDIGRLKMLSRALL  215



>ref|XP_009110137.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Brassica 
rapa]
Length=361

 Score = 81.3 bits (199),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS L +ADWK ISG IP CIT LS    +DL G QI+  I   IG LN+L +LN
Sbjct  98   ICDLARLSALTIADWKGISGDIPKCITRLSFLRTIDLIGNQISGEIPNDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGSIPKSLTN  173


 Score = 48.9 bits (115),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N +TG +P++ G+LTM+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNLITGLIPTDFGRLTMLSRALL  206



>gb|ABD46739.1| leucine-rich repeat protein [Nicotiana tabacum]
Length=365

 Score = 79.3 bits (194),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L +ADWK I+G IP C+T+L    I+DL G ++T  I + IG L++LT+LN
Sbjct  100  ICKLERLSSLTIADWKGITGPIPSCVTSLPFLRIIDLIGNKLTGEIPSEIGRLSRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            +ADN +SG IP  L+ 
Sbjct  160  VADNCLSGRIPRSLTN  175


 Score = 50.4 bits (119),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N++ G LP+N GKL M+SRALL
Sbjct  170  PRSLTNLSSLMHLDLRNNRIFGTLPTNFGKLRMLSRALL  208



>ref|XP_009617306.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nicotiana 
tomentosiformis]
Length=365

 Score = 79.3 bits (194),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L +ADWK I+G IP C+T+L    I+DL G ++T  I + IG L++LT+LN
Sbjct  100  ICKLERLSSLTIADWKGITGPIPSCVTSLPFLRIIDLIGNKLTGEIPSEIGRLSRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            +ADN +SG IP  L+ 
Sbjct  160  VADNCLSGRIPRSLTN  175


 Score = 50.8 bits (120),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N++ G LP+N GKL M+SRALL
Sbjct  170  PRSLTNLSSLMHLDLRNNRIFGTLPTNFGKLRMLSRALL  208



>ref|XP_009135241.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Brassica 
rapa]
Length=372

 Score = 81.6 bits (200),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  LS+ +LADWK ISG IP CIT+L++  ++DL G +IT  I   IG L KL +LN
Sbjct  106  VCDLTALSSFVLADWKGISGEIPTCITSLASLRVIDLAGNKITGEIPAEIGKLTKLAVLN  165

Query  328  LADNQISGVIPTPLST  375
            LA+N++SG IP  L++
Sbjct  166  LAENRMSGEIPPSLTS  181


 Score = 48.1 bits (113),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++GE+P++ G L M+SRALL R 
Sbjct  176  PPSLTSLAELKHLELTENGISGEIPADFGSLKMLSRALLGRN  217



>ref|NP_001241713.1| uncharacterized protein LOC100856891 precursor [Zea mays]
 gb|ACF88180.1| unknown [Zea mays]
Length=381

 Score = 79.7 bits (195),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC+LDRLSTL+LADWK ISG IP C+ T+L    +L+L G ++T  +    
Sbjct  101  VMSGYVSDAVCRLDRLSTLVLADWKRISGPIPACVATSLPYLRVLELPGNRLTGAVPPLG  160

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G  ++L +LNLA NQ+SG IP  L++
Sbjct  161  GGQSRLAVLNLAGNQLSGGIPASLTS  186


 Score = 50.1 bits (118),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ +L  LKHLDL+ N+L+G +P ++G+L M+SRALL R
Sbjct  181  PASLTSLTELKHLDLAGNRLSGRVPPDLGRLRMLSRALLAR  221



>emb|CDY60388.1| BnaA01g36810D [Brassica napus]
Length=365

 Score = 81.3 bits (199),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS L +ADWK ISG IP CIT LS    +DL G QI+  I   IG LN+L +LN
Sbjct  98   ICDLARLSALTIADWKGISGDIPKCITRLSFLRTIDLIGNQISGEIPNDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGSIPKSLTN  173


 Score = 48.5 bits (114),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N +TG +P++ G+LTM+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNLITGLIPTDFGRLTMLSRALL  206



>ref|NP_001150670.1| polygalacturonase inhibitor 2 [Zea mays]
 gb|ACG39952.1| polygalacturonase inhibitor 2 precursor [Zea mays]
Length=425

 Score = 79.7 bits (195),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC+LDRLSTL+LADWK ISG IP C+ T+L    +L+L G ++T  +    
Sbjct  145  VMSGYVSDAVCRLDRLSTLVLADWKRISGPIPACVATSLPYLRVLELPGNRLTGAVPPLG  204

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G  ++L +LNLA NQ+SG IP  L++
Sbjct  205  GGQSRLAVLNLAGNQLSGGIPASLTS  230


 Score = 50.1 bits (118),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ +L  LKHLDL+ N+L+G +P ++G+L M+SRALL R
Sbjct  225  PASLTSLTELKHLDLAGNRLSGRVPPDLGRLRMLSRALLAR  265



>ref|XP_002303879.1| polygalacturonase inhibitor-like family protein [Populus trichocarpa]
 gb|ABK92966.1| unknown [Populus trichocarpa]
 gb|EEE78858.1| polygalacturonase inhibitor-like family protein [Populus trichocarpa]
Length=368

 Score = 79.0 bits (193),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS+L +ADWK ISG IP CIT+L    ILDL G +++ PI   IG L++LT+LN
Sbjct  103  ICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGPIPEDIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLST  375
            +ADN ++  IP  L+ 
Sbjct  163  IADNLVTSRIPRSLTN  178


 Score = 50.8 bits (120),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQW  485
            P S+ NL SL HLDL +N++ G LP + G+L M+SRALL R +
Sbjct  173  PRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNY  215



>emb|CDY00787.1| BnaC03g37710D [Brassica napus]
Length=372

 Score = 81.6 bits (200),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  LS+ +LADWK ISG IP CIT+L++  ++DL G +IT  I   IG L KL +LN
Sbjct  106  VCDLTALSSFVLADWKGISGEIPTCITSLASLRVIDLAGNKITGEIPAEIGKLTKLVVLN  165

Query  328  LADNQISGVIPTPLST  375
            LA+N++SG IP  L++
Sbjct  166  LAENRMSGEIPPSLTS  181


 Score = 48.1 bits (113),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++GE+P++ G L M+SRALL R 
Sbjct  176  PPSLTSLAELKHLELTENGISGEIPADFGSLKMLSRALLGRN  217



>emb|CDP15759.1| unnamed protein product [Coffea canephora]
Length=363

 Score = 80.5 bits (197),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L+RLS+L +ADWK ISG IPPCIT+L    I+DL G ++T  +   IG L++LT+LN
Sbjct  99   ICQLNRLSSLTIADWKGISGTIPPCITSLPFLRIVDLIGNKLTGELPADIGRLSRLTVLN  158

Query  328  LADNQISGVIPTPLST  375
            +ADN+++G +P  L+ 
Sbjct  159  VADNRLTGRLPRSLTN  174


 Score = 49.3 bits (116),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +N   G +P N GKL M+SRALL R 
Sbjct  169  PRSLTNLSSLMHLDLRNNLFRGTIPRNFGKLRMLSRALLSRN  210



>ref|XP_011037855.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Populus 
euphratica]
Length=368

 Score = 78.2 bits (191),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L ++DWK ISG IP CIT+L    I+DL G +I+  I   IG L ++T+LN
Sbjct  103  ICKLERLSSLTISDWKGISGPIPACITSLPFLRIIDLIGNRISGEIPADIGRLERMTVLN  162

Query  328  LADNQISGVIPTPLST  375
            +ADN ++G IP  L+ 
Sbjct  163  IADNLVTGRIPRSLTN  178


 Score = 51.6 bits (122),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQW  485
            P S+ NL SL HLDL +N+++G LP ++G+L M+SRALL R +
Sbjct  173  PRSLTNLSSLMHLDLRNNRISGPLPLDLGRLRMLSRALLSRNY  215



>ref|XP_004306517.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Fragaria 
vesca subsp. vesca]
Length=364

 Score = 82.8 bits (203),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C LD L+TL+LADWK +SG IP C+T LS+  +LDLTG +++  I T IG L  L +LN
Sbjct  99   ICNLDSLTTLVLADWKGLSGQIPQCLTFLSSLRVLDLTGNKLSGVIPTDIGKLKMLRVLN  158

Query  328  LADNQISGVIPTPL  369
            LADNQI+G IP  +
Sbjct  159  LADNQIAGDIPASI  172


 Score = 47.0 bits (110),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SIVNL  L HLDL +NKLTG +P+    + M+SRALL 
Sbjct  169  PASIVNLAGLMHLDLRNNKLTGGVPAGFSNMKMLSRALLS  208



>tpg|DAA47950.1| TPA: polygalacturonase inhibitor 2 [Zea mays]
Length=428

 Score = 79.3 bits (194),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +1

Query  121  VVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCI-TALSNFCILDLTGKQITSPILTYI  297
            V+S +    VC+LDRLSTL+LADWK ISG IP C+ T+L    +L+L G ++T  +    
Sbjct  148  VMSGYVSDAVCRLDRLSTLVLADWKRISGPIPACVATSLPYLRVLELPGNRLTGAVPPLG  207

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G  ++L +LNLA NQ+SG IP  L++
Sbjct  208  GGQSRLAVLNLAGNQLSGGIPASLTS  233


 Score = 50.1 bits (118),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ +L  LKHLDL+ N+L+G +P ++G+L M+SRALL R
Sbjct  228  PASLTSLTELKHLDLAGNRLSGRVPPDLGRLRMLSRALLAR  268



>emb|CDY27559.1| BnaC01g32420D [Brassica napus]
Length=365

 Score = 80.1 bits (196),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS + +ADWK ISG IP CIT LS    +DL G QI+  I   IG LN+L +LN
Sbjct  98   ICDLARLSAITIADWKGISGDIPKCITRLSFLRTIDLIGNQISGEIPNDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGSIPKSLTN  173


 Score = 49.3 bits (116),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N +TG +P++ G+LTM+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRTNLITGLIPTDFGRLTMLSRALL  206



>ref|XP_006446033.1| hypothetical protein CICLE_v10015508mg [Citrus clementina]
 gb|ESR59273.1| hypothetical protein CICLE_v10015508mg [Citrus clementina]
Length=396

 Score = 77.0 bits (188),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VCKL RLS+  LADWK I+G IP CI+++    ILDL G +++  I   IG L++L +LN
Sbjct  132  VCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLN  191

Query  328  LADNQISGVIP  360
            +ADN ISG IP
Sbjct  192  IADNNISGAIP  202


 Score = 52.8 bits (125),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI NL SL HLDL +N+++G +P ++G+L MMSRALL R 
Sbjct  202  PPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMMSRALLSRN  243



>gb|KFK38609.1| hypothetical protein AALP_AA3G136400 [Arabis alpina]
Length=373

 Score = 85.1 bits (209),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADW  ISG IPPCI++L++  ILDL G ++T  I + IG L+KL++LN
Sbjct  107  VCDLTALTSLVLADWTGISGEIPPCISSLASLRILDLAGNKLTGEIPSEIGKLSKLSVLN  166

Query  328  LADNQISGVIPTPLST  375
            LA+NQ+SG IP  L++
Sbjct  167  LAENQMSGEIPPSLTS  182


 Score = 43.9 bits (102),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++G +P++ G L ++SRALL R 
Sbjct  177  PPSLTSLTELKHLELTENGISGAIPADFGSLKLLSRALLSRN  218



>ref|XP_010091979.1| DNA-damage-repair/toleration protein [Morus notabilis]
 gb|EXB48385.1| DNA-damage-repair/toleration protein [Morus notabilis]
Length=367

 Score = 80.9 bits (198),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS++ +ADWK I+G IP CIT+L    ILDL G +I+  +   IG L++LT+LN
Sbjct  103  ICKLPRLSSVTIADWKGITGEIPKCITSLPFLRILDLIGNRISGELPADIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLST  375
            +ADN ISG IPT L+ 
Sbjct  163  VADNLISGRIPTSLTN  178


 Score = 48.1 bits (113),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR-QWR*PVQAALHRRQR  524
            P S+ NL SL HLDL +N+++G LP +  +L M+SRALL R Q    + AA+ R  R
Sbjct  173  PTSLTNLSSLMHLDLRNNRISGSLPRDFHRLVMLSRALLSRNQISGTIPAAISRIYR  229



>ref|XP_006446037.1| hypothetical protein CICLE_v10015677mg [Citrus clementina]
 gb|ESR59277.1| hypothetical protein CICLE_v10015677mg [Citrus clementina]
Length=369

 Score = 83.2 bits (204),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            ++ F  + VCKL  LS+L L DW+ ISG IPPCIT+L    ILDLTG +I+  I   IG 
Sbjct  96   MTGFISSAVCKLPHLSSLTLTDWEGISGEIPPCITSLPFLRILDLTGNKISGEIPRDIGK  155

Query  304  LNKLTILNLADNQISGVIP  360
            L++L++LN+ADN +SG IP
Sbjct  156  LHRLSVLNIADNYVSGPIP  174


 Score = 45.1 bits (105),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI NL SL HLD+ +N+++G +P+  G+L M+SRALL 
Sbjct  174  PGSIGNLSSLMHLDVRNNRISGPIPACFGRLHMLSRALLS  213



>ref|XP_002299240.1| polygalacturonase inhibitor-like family protein [Populus trichocarpa]
 gb|EEE84045.1| polygalacturonase inhibitor-like family protein [Populus trichocarpa]
Length=368

 Score = 78.2 bits (191),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL+RLS+L ++DWK ISG IP CIT+L    I+DL G +I+  I   IG L ++T+LN
Sbjct  103  ICKLERLSSLTISDWKGISGPIPACITSLPFLRIIDLIGNRISGEIPADIGRLERMTVLN  162

Query  328  LADNQISGVIPTPLST  375
            +ADN ++G IP  L+ 
Sbjct  163  IADNLVTGRIPRSLTN  178


 Score = 49.7 bits (117),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQW  485
            P S+ NL SL HLDL +N++ G LP + G+L M+SRALL R +
Sbjct  173  PRSLTNLSSLMHLDLRNNRIWGPLPLDFGRLRMLSRALLSRNY  215



>emb|CDX73812.1| BnaA03g32350D [Brassica napus]
Length=372

 Score = 81.6 bits (200),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  LS+ +LADWK ISG IP CIT+L++  ++DL G +IT  I   IG L KL +LN
Sbjct  106  VCDLTALSSFVLADWKGISGEIPTCITSLASLRVIDLAGNKITGEIPAEIGKLTKLAVLN  165

Query  328  LADNQISGVIPTPLST  375
            LA+N++SG IP  L++
Sbjct  166  LAENRMSGEIPPSLTS  181


 Score = 45.4 bits (106),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ +L  LKHL+L+ N ++GE+P++ G L M+SR LL R 
Sbjct  176  PPSLTSLTELKHLELTENGISGEIPADFGSLKMLSRVLLGRN  217



>ref|NP_001240925.1| DNA-damage-repair/toleration protein DRT100-like precursor [Glycine 
max]
 gb|ACM89597.1| leucine rich repeat protein [Glycine max]
Length=368

 Score = 81.3 bits (199),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS++ +ADWK ISG IP CIT L    I+DL G +++  I   IG L++LT+LN
Sbjct  103  ICKLARLSSITIADWKGISGEIPRCITTLPFLRIVDLIGNRLSGSIPAGIGRLHRLTVLN  162

Query  328  LADNQISGVIPTPLST  375
            +ADN ISG IPT L+ 
Sbjct  163  VADNLISGTIPTSLAN  178


 Score = 46.2 bits (108),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+ NL SL HLDL +N  +G +P N G L+M+SRALL 
Sbjct  173  PTSLANLSSLMHLDLRNNLFSGPIPRNFGSLSMLSRALLS  212



>ref|NP_188718.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02490.1| polygalacturonase inhibitor-like protein [Arabidopsis thaliana]
 gb|AAL36278.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51409.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76428.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=365

 Score = 80.1 bits (196),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS + +ADWK ISG IP CIT L     LDL G QI+  I   IG LN+L +LN
Sbjct  98   ICELTRLSAITIADWKGISGEIPKCITRLPFLRTLDLIGNQISGGIPYDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGSIPKSLTN  173


 Score = 47.4 bits (111),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +PS++G+L M+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNLISGVIPSDVGRLKMLSRALL  206



>ref|XP_004142131.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cucumis 
sativus]
 ref|XP_004168190.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cucumis 
sativus]
 gb|KGN54158.1| hypothetical protein Csa_4G290740 [Cucumis sativus]
Length=365

 Score = 79.0 bits (193),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS++I+ADWK I+G IP CIT+L    ILDL G +++  +   IG L +LT+LN
Sbjct  101  ICKLTRLSSVIIADWKGITGEIPRCITSLPFLRILDLIGNRLSGDLPADIGRLRRLTVLN  160

Query  328  LADNQISGVIPTPLST  375
            +ADN ISG IP  L+ 
Sbjct  161  VADNLISGSIPASLTA  176


 Score = 48.1 bits (113),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L +L HLDL +NK +G+LP N G L M+SRALL R 
Sbjct  171  PASLTALTNLMHLDLRNNKFSGQLPRNFGNLRMLSRALLSRN  212


 Score = 43.1 bits (100),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L +AD   ISG IP  +TAL+N   LDL   + +  +    G L  L+   
Sbjct  150  IGRLRRLTVLNVAD-NLISGSIPASLTALTNLMHLDLRNNKFSGQLPRNFGNLRMLSRAL  208

Query  328  LADNQISGVIPTPLS  372
            L+ NQ+SG +P  +S
Sbjct  209  LSRNQLSGSLPDSIS  223


 Score = 33.1 bits (74),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI  +  L  LDLS N+L+G +PS IG++ +++
Sbjct  219  PDSISKIYRLADLDLSQNQLSGVIPSWIGRMAVLA  253



>ref|XP_006298942.1| hypothetical protein CARUB_v10015066mg [Capsella rubella]
 gb|EOA31840.1| hypothetical protein CARUB_v10015066mg [Capsella rubella]
Length=365

 Score = 79.3 bits (194),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS + +ADWK ISG IP CIT L     LDL G QI+  I   IG LN+L +LN
Sbjct  98   ICELTRLSAITIADWKGISGEIPKCITRLPFLRTLDLIGNQISGGIPYDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGPIPRSLTN  173


 Score = 47.4 bits (111),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +PS+IG++ M+SRALL
Sbjct  168  PRSLTNLSSLMHLDLRNNLISGVIPSDIGRMKMLSRALL  206



>ref|XP_002884914.1| DNA-damage repair/toleration 100 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61173.1| DNA-damage repair/toleration 100 [Arabidopsis lyrata subsp. lyrata]
Length=372

 Score = 87.0 bits (214),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VC L  L++L+LADWK I+G IPPC+T+L++  ILDL G +IT  I   IG L+KL +LN
Sbjct  106  VCDLTALTSLVLADWKGITGEIPPCVTSLASLRILDLAGNKITGEIPAEIGKLSKLAVLN  165

Query  328  LADNQISGVIPTPLST  375
            LA+NQ+SG IP+ L++
Sbjct  166  LAENQMSGEIPSLLTS  181


 Score = 40.0 bits (92),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P  + +L  LKHL+L+ N +TG +P++ G L M+SR L+ R 
Sbjct  176  PSLLTSLVGLKHLELTENGITGVIPADFGSLKMLSRVLMGRN  217



>gb|KFK39397.1| hypothetical protein AALP_AA3G239800 [Arabis alpina]
Length=367

 Score = 78.6 bits (192),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS + +ADWK ISG IP CIT L     LDL G QI+  I T IG L +L +LN
Sbjct  100  ICDLTRLSAVTIADWKGISGDIPKCITRLPFLRTLDLIGNQISGTIPTDIGRLRRLAVLN  159

Query  328  LADNQISGVIPTPLS  372
            +ADN+ISG IP  L+
Sbjct  160  VADNRISGTIPKSLT  174


 Score = 48.1 bits (113),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+ NL SL HLDL +N ++G +PS+ G+LTM+SRALL 
Sbjct  170  PKSLTNLSSLMHLDLRNNLISGLIPSDFGRLTMLSRALLS  209



>ref|XP_008449738.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cucumis 
melo]
Length=412

 Score = 79.3 bits (194),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS++I+ADWK I+G IP CIT+L    ILDL G +++  +   IG L +LT+LN
Sbjct  148  ICKLTRLSSVIIADWKGITGEIPRCITSLPFLRILDLIGNRLSGDLPADIGRLRRLTVLN  207

Query  328  LADNQISGVIPTPLST  375
            +ADN ISG IP+ L+ 
Sbjct  208  VADNLISGSIPSSLTA  223


 Score = 47.4 bits (111),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L +L HLDL +NK +G LP N G L M+SRALL R 
Sbjct  218  PSSLTALTNLMHLDLRNNKFSGRLPRNFGNLRMLSRALLSRN  259


 Score = 42.7 bits (99),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L +AD   ISG IP  +TAL+N   LDL   + +  +    G L  L+   
Sbjct  197  IGRLRRLTVLNVAD-NLISGSIPSSLTALTNLMHLDLRNNKFSGRLPRNFGNLRMLSRAL  255

Query  328  LADNQISGVIPTPLS  372
            L+ NQ SG +P  +S
Sbjct  256  LSRNQFSGSLPDSIS  270


 Score = 33.1 bits (74),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI  +  L  LDLS N+L+G +PS IG++ +++
Sbjct  266  PDSISKIYRLADLDLSQNQLSGVIPSWIGRMAVLA  300



>ref|XP_004149603.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cucumis 
sativus]
 ref|XP_004172421.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cucumis 
sativus]
Length=363

 Score = 67.8 bits (164),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+ L++ADWK ISG IP C+T LSN  ++DL G +I+  I + IG LN+LT+LN
Sbjct  98   ICKLDSLTILVVADWKGISGEIPKCLTKLSNLRVIDLVGNKISGEIPSDIGNLNRLTLLN  157

Query  328  LADNQISGVIPT  363
            L +N ISG IP 
Sbjct  158  LGENAISGSIPA  169


 Score = 58.5 bits (140),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVN+GSL  LDL +N++TGE+PS+ GKL M+SRALL R 
Sbjct  168  PASIVNIGSLTQLDLRNNRITGEIPSDFGKLQMLSRALLGRN  209



>ref|XP_011042054.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Populus 
euphratica]
Length=368

 Score = 75.9 bits (185),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS+L +ADWK ISG IP CIT+L    ILDL G +++  I   IG L +LT+LN
Sbjct  103  ICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGQIPEDIGRLRRLTVLN  162

Query  328  LADNQISGVIPTPLST  375
            +ADN ++  IP  L+ 
Sbjct  163  IADNLVTSRIPRSLTN  178


 Score = 50.4 bits (119),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQW  485
            P S+ NL SL HLDL +N++ G LP + G+L M+SRALL R +
Sbjct  173  PRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNY  215



>ref|XP_002883270.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59529.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score = 79.0 bits (193),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS + +ADWK ISG IP CIT L     LDL G QI+  I   IG LN+L +LN
Sbjct  98   ICDLTRLSAITIADWKGISGEIPKCITRLPFLRTLDLIGNQISGGIPYDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGSIPKSLTN  173


 Score = 47.4 bits (111),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +PS++G+L M+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNLISGVIPSDVGRLKMLSRALL  206



>gb|KGN58604.1| Leucine rich repeat protein [Cucumis sativus]
Length=387

 Score = 67.8 bits (164),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKLD L+ L++ADWK ISG IP C+T LSN  ++DL G +I+  I + IG LN+LT+LN
Sbjct  122  ICKLDSLTILVVADWKGISGEIPKCLTKLSNLRVIDLVGNKISGEIPSDIGNLNRLTLLN  181

Query  328  LADNQISGVIPT  363
            L +N ISG IP 
Sbjct  182  LGENAISGSIPA  193


 Score = 58.5 bits (140),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SIVN+GSL  LDL +N++TGE+PS+ GKL M+SRALL R 
Sbjct  192  PASIVNIGSLTQLDLRNNRITGEIPSDFGKLQMLSRALLGRN  233



>gb|KFK25532.1| hypothetical protein AALP_AA8G127300 [Arabis alpina]
Length=375

 Score = 78.6 bits (192),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LST+I+ADWK ISG IP CIT L    I+DL G +++  I   IG L +L +LN
Sbjct  109  ICKLTSLSTIIIADWKGISGVIPNCITNLLFLRIVDLVGNRLSGVIPANIGRLQRLKVLN  168

Query  328  LADNQISGVIPTPLST  375
             ADNQI+G+IPT +++
Sbjct  169  FADNQITGMIPTSVTS  184


 Score = 47.4 bits (111),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ +L SL HLDL +N +TG +P +IG+LTMMSR LL
Sbjct  179  PTSVTSLTSLSHLDLRNNNITGVIPLDIGRLTMMSRLLL  217



>ref|XP_010045004.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Eucalyptus 
grandis]
 gb|KCW87144.1| hypothetical protein EUGRSUZ_B03671 [Eucalyptus grandis]
Length=361

 Score = 80.9 bits (198),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +C+L+RLS+L +ADWK ISG IP C+ +L    ILDL G +++  I   IG L +LT+
Sbjct  95   SAICRLERLSSLTVADWKGISGEIPACLASLPYLRILDLIGNRLSGEIPADIGRLKRLTV  154

Query  322  LNLADNQISGVIPTPLS  372
            LN+ADN I+G IP+ L+
Sbjct  155  LNVADNMITGRIPSSLT  171


 Score = 44.7 bits (104),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+  L SL HLDL +N+++G LP + G L M+SRALL
Sbjct  167  PSSLTGLSSLMHLDLRNNRISGPLPQDFGMLRMLSRALL  205



>ref|XP_007150390.1| hypothetical protein PHAVU_005G149200g [Phaseolus vulgaris]
 gb|ESW22384.1| hypothetical protein PHAVU_005G149200g [Phaseolus vulgaris]
Length=352

 Score = 82.0 bits (201),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS++ +ADWK ISG IP CI AL    I+DL G +I+  I   IG L++LT+LN
Sbjct  88   ICKLARLSSITIADWKGISGEIPRCIAALPFLRIVDLIGNRISGSIPADIGRLHRLTVLN  147

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  148  IADNRISGTIPASLAN  163


 Score = 43.5 bits (101),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+ NL SL HLDL +N L+G +P + G L M+SRALL 
Sbjct  158  PASLANLTSLMHLDLRNNLLSGPIPRHFGSLRMLSRALLS  197



>ref|XP_010466290.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Camelina 
sativa]
Length=365

 Score = 78.2 bits (191),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS + +ADWK ISG IP CIT L     LDL G QI+  +   IG LN+L +LN
Sbjct  98   ICELTRLSAITIADWKGISGEIPKCITRLPFLRTLDLIGNQISGGLPYDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGPIPKSLTN  173


 Score = 47.0 bits (110),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +PS+IG++ M+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNLISGVIPSDIGRMKMLSRALL  206



>emb|CDP15760.1| unnamed protein product [Coffea canephora]
Length=363

 Score = 77.4 bits (189),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L+RLS+L +ADWK ISG IP CIT+L +  ILDL G ++T  + T IG L+ LT+L 
Sbjct  99   ICRLNRLSSLAIADWKGISGTIPSCITSLPSLRILDLVGNKLTGGLPTDIGQLSGLTMLI  158

Query  328  LADNQISGVIPTPLS  372
            +ADNQ++G +P  L+
Sbjct  159  VADNQLTGRLPRSLT  173


 Score = 47.8 bits (112),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+ NL SL HLDL +N + G +P + GKL M+SRALL R 
Sbjct  169  PRSLTNLSSLTHLDLRNNFIRGTIPRHFGKLRMLSRALLSRN  210



>ref|XP_010509390.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Camelina 
sativa]
Length=365

 Score = 77.0 bits (188),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS + +ADWK ISG IP CIT L     LDL G QI+  +   IG LN+L +LN
Sbjct  98   ICELTRLSAITIADWKGISGEIPKCITRLPFLRTLDLIGNQISGGLPYDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+I+G IP  L+ 
Sbjct  158  VADNRITGPIPKSLTN  173


 Score = 47.4 bits (111),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +PS+IG++ M+SRALL
Sbjct  168  PKSLTNLASLMHLDLRNNLISGVIPSDIGRMKMLSRALL  206



>ref|XP_010488069.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Camelina 
sativa]
Length=365

 Score = 77.0 bits (188),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L RLS + +ADWK ISG IP CIT L     LDL G QI+  +   IG LN+L +LN
Sbjct  98   ICELTRLSAITIADWKGISGEIPKCITRLPFLRTLDLIGNQISGGLPYDIGRLNRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+I+G IP  L+ 
Sbjct  158  VADNRITGPIPKSLTN  173


 Score = 47.4 bits (111),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +PS+IG++ M+SRALL
Sbjct  168  PKSLTNLASLMHLDLRNNLISGVIPSDIGRMKMLSRALL  206



>ref|XP_009145581.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Brassica 
rapa]
 emb|CDY19601.1| BnaA05g20090D [Brassica napus]
Length=365

 Score = 77.4 bits (189),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS + +ADWK ISG IP CIT L     LDL G QI+  I   IG L++L +LN
Sbjct  98   ICDLARLSAITIADWKGISGEIPTCITRLPFLRTLDLIGNQISGGIPNDIGRLHRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGSIPKSLTN  173


 Score = 47.0 bits (110),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +P + G+LTM+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNLISGVIPPDFGRLTMLSRALL  206



>dbj|BAJ33628.1| unnamed protein product [Thellungiella halophila]
Length=365

 Score = 74.7 bits (182),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS + +A WK ISG IP CIT L     LDL G QI+  I   IG L++L +LN
Sbjct  98   ICNLPRLSAITIAGWKGISGEIPKCITRLPFLRTLDLIGNQISGGIPNDIGRLHRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGPIPKSLTN  173


 Score = 48.9 bits (115),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N+++G +P + G+LTM+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNQISGVIPPDFGRLTMLSRALL  206



>ref|XP_003572360.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Brachypodium 
distachyon]
Length=380

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALS--NFCILDLTGKQITSPILTYIG*LNKLTI  321
            VC L  LSTL++ADWK ISG IP C+ A S     +L+L G +++  I   +G L++L +
Sbjct  107  VCILTGLSTLVIADWKQISGPIPACLGAQSLPELRVLELPGNRLSGEIPPALGTLSRLAV  166

Query  322  LNLADNQISGVIPTPLS  372
            LNLADN +SG IP+ ++
Sbjct  167  LNLADNLLSGNIPSEIT  183


 Score = 56.6 bits (135),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P  I NLGSLKHLDL++N+LTG +P+  G L M+SRALL R 
Sbjct  179  PSEITNLGSLKHLDLANNELTGSIPAEFGSLKMLSRALLSRN  220



>ref|XP_010031829.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Eucalyptus 
grandis]
 gb|KCW51215.1| hypothetical protein EUGRSUZ_J00794 [Eucalyptus grandis]
Length=364

 Score = 73.6 bits (179),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L  L++L LADWK I+G IP CIT +    + DL G +++  I   IG L++LT+LN
Sbjct  100  ICRLKGLASLTLADWKGITGEIPSCITTIPFLRVFDLIGNRLSGEIPANIGKLHRLTVLN  159

Query  328  LADNQISGVIPTPLST  375
            +ADN I+G IP  L+ 
Sbjct  160  VADNMITGEIPRSLTN  175


 Score = 48.9 bits (115),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+ NL SL HLD+ +N+++G LP + GKL M+SRALL 
Sbjct  170  PRSLTNLSSLMHLDMRNNRISGPLPRDFGKLRMLSRALLS  209



>gb|KHN00811.1| DNA-damage-repair/toleration protein DRT100 [Glycine soja]
Length=240

 Score = 70.1 bits (170),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C ++ L+TL++ADWK I+G IP C+TAL +  ILDL G ++   I   +  L+ LT+L+
Sbjct  98   ICGINTLTTLVVADWKDIAGEIPACVTALPSLRILDLIGNKLFGEIPVNVDKLSHLTVLD  157

Query  328  LADNQISGVIPTPLS  372
            LADN ++G IPT ++
Sbjct  158  LADNTLNGKIPTSIT  172


 Score = 52.4 bits (124),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI  LGSLKHLDL++N+L  E+P + G L M+SR LL R 
Sbjct  168  PTSITRLGSLKHLDLNNNQLCSEIPKDFGNLAMLSRMLLNRN  209



>ref|XP_010551035.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Tarenaya 
hassleriana]
Length=367

 Score = 77.0 bits (188),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C L RLS + +ADWK ISG IP CIT L     LDL G +I+  I   IG LN+L +L
Sbjct  102  AICDLTRLSAITIADWKGISGEIPRCITRLPYLRTLDLIGNRISGGIPYDIGRLNRLAVL  161

Query  325  NLADNQISGVIPTPLST  375
            N+ADN++SG IP  L+ 
Sbjct  162  NIADNRLSGRIPRSLTN  178


 Score = 45.1 bits (105),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL +L HLDL +N ++G +P + G+L M+SRALL
Sbjct  173  PRSLTNLSTLMHLDLRNNNISGMIPPDFGRLRMLSRALL  211



>ref|XP_006369639.1| hypothetical protein POPTR_0001s27660g, partial [Populus trichocarpa]
 gb|ERP66208.1| hypothetical protein POPTR_0001s27660g, partial [Populus trichocarpa]
Length=283

 Score = 71.6 bits (174),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  187  DWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTP  366
            DWK +SG IP C+ +LSN  ILDL G +I+  I   IG L +LT+LNLADN ++G IP+ 
Sbjct  1    DWKGVSGEIPECVVSLSNLRILDLIGNKISGKIPANIGNLQRLTVLNLADNGLTGEIPSS  60

Query  367  LSTWE  381
            L+  E
Sbjct  61   LTKLE  65


 Score = 50.4 bits (119),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P S+  L ++KHLDLS+N LTG+LPS+ G L M+SRALL + 
Sbjct  58   PSSLTKLENMKHLDLSNNMLTGQLPSDFGNLKMLSRALLSKN  99



>ref|XP_007133826.1| hypothetical protein PHAVU_011G212100g [Phaseolus vulgaris]
 gb|ESW05820.1| hypothetical protein PHAVU_011G212100g [Phaseolus vulgaris]
Length=367

 Score = 69.7 bits (169),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L  L++L++ADWKAISG IP C+T+LS+  +LDL G +I   I T IG +  L++++
Sbjct  102  ICTLSNLTSLVVADWKAISGEIPACVTSLSSLRLLDLAGNRIAGEIPTEIGNMRSLSVVS  161

Query  328  LADNQISGVIPT  363
            LADN+ISG IPT
Sbjct  162  LADNEISGEIPT  173


 Score = 52.4 bits (124),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ-RQWR*PVQAALHRRQR  524
            P SIVNL  L HLDLS+N+++GE+P + GKL M+SRALL   Q    +  ++ R +R
Sbjct  172  PTSIVNLRRLMHLDLSNNQVSGEIPYDFGKLRMLSRALLSGNQLTGSIPKSISRMKR  228



>ref|XP_006493681.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Citrus 
sinensis]
 gb|KDO64848.1| hypothetical protein CISIN_1g037720mg [Citrus sinensis]
Length=369

 Score = 77.4 bits (189),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            ++ F    VCKL  LS+L L DW+ ISG IP C T L    ILDLTG +I+  I  +IG 
Sbjct  96   MTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGK  155

Query  304  LNKLTILNLADNQISGVIP  360
            L++L++LN+ADN +SG IP
Sbjct  156  LHRLSVLNIADNYVSGPIP  174


 Score = 44.3 bits (103),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI NL SL HLD+ +N+++G +P   G+L M+SRALL 
Sbjct  174  PGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLS  213



>ref|XP_010492030.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Camelina 
sativa]
Length=367

 Score = 77.4 bits (189),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL RLS +I+ADWK ISG IP CI  L     +DL G +I+  I   IG L +L +L
Sbjct  100  AICKLTRLSGIIIADWKGISGGIPSCIAKLPFLRHIDLVGNKISGVIPANIGMLLRLKVL  159

Query  325  NLADNQISGVIP  360
            NLADNQISGVIP
Sbjct  160  NLADNQISGVIP  171


 Score = 44.3 bits (103),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL
Sbjct  171  PPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRVLL  209


 Score = 44.7 bits (104),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +1

Query  163  RLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQ  342
            RL  L LAD   ISG IPP IT L++   LDL    I+  I   IG L  L+ + L+ N+
Sbjct  155  RLKVLNLAD-NQISGVIPPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRVLLSGNK  213

Query  343  ISGVIPTPLS  372
            ISG IP  L+
Sbjct  214  ISGQIPESLT  223


 Score = 31.2 bits (69),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L++S N+LTG +P + GK+++++
Sbjct  219  PESLTRIYRLADLEISMNRLTGSIPVSFGKMSVLA  253



>ref|XP_010453346.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like isoform 
X1 [Camelina sativa]
 ref|XP_010453347.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like isoform 
X2 [Camelina sativa]
Length=373

 Score = 77.4 bits (189),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL RLS +I+ADWK ISG IP CI  L     +DL G +I+  I   IG L +L +L
Sbjct  106  AICKLTRLSGIIIADWKGISGGIPSCIAKLPFLRHIDLVGNKISGVIPANIGMLLRLKVL  165

Query  325  NLADNQISGVIP  360
            NLADNQISGVIP
Sbjct  166  NLADNQISGVIP  177


 Score = 44.3 bits (103),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL
Sbjct  177  PPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRVLL  215


 Score = 44.3 bits (103),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +1

Query  163  RLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQ  342
            RL  L LAD   ISG IPP IT L++   LDL    I+  I   IG L  L+ + L+ N+
Sbjct  161  RLKVLNLAD-NQISGVIPPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRVLLSGNK  219

Query  343  ISGVIPTPLS  372
            ISG IP  L+
Sbjct  220  ISGQIPESLT  229


 Score = 31.2 bits (69),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L++S N+LTG +P + GK+++++
Sbjct  225  PESLTRIYRLADLEISMNRLTGSIPVSFGKMSVLA  259



>emb|CDX85681.1| BnaA02g01320D [Brassica napus]
Length=345

 Score = 76.6 bits (187),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C+L +LS + L+DW+ ISG IP CIT L     +DL G +I+  I   IG L KLT+L
Sbjct  78   AICELTQLSGVTLSDWEGISGEIPACITNLPAMRHVDLVGNKISGTIPANIGNLAKLTVL  137

Query  325  NLADNQISGVIPTPLS  372
            NLADNQISG IP  ++
Sbjct  138  NLADNQISGAIPASIA  153


 Score = 44.7 bits (104),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N LTG +P  IG+L M+SR LL
Sbjct  149  PASIARLTSLTHLDLRNNGLTGVIPVYIGRLKMLSRVLL  187



>emb|CDY06385.1| BnaC05g31450D [Brassica napus]
Length=365

 Score = 74.7 bits (182),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS + +ADWK ISG IP CIT L     LDL G QI+  I   IG  ++L +LN
Sbjct  98   ICDLARLSAITIADWKGISGEIPTCITRLPFLRTLDLIGNQISGGIPNDIGRPHRLAVLN  157

Query  328  LADNQISGVIPTPLST  375
            +ADN+ISG IP  L+ 
Sbjct  158  VADNRISGSIPKSLTN  173


 Score = 46.6 bits (109),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ NL SL HLDL +N ++G +P + G+LTM+SRALL
Sbjct  168  PKSLTNLSSLMHLDLRNNLISGVIPPDFGRLTMLSRALL  206



>ref|XP_009125872.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Brassica 
rapa]
Length=372

 Score = 76.6 bits (187),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL +LS + L+DW+ ISG IP CIT L     +DL G +I+  I   IG L KLT+LN
Sbjct  106  ICKLTQLSGVTLSDWEGISGAIPACITNLPAMRHVDLVGNKISGVIPANIGNLAKLTVLN  165

Query  328  LADNQISGVIPTPLS  372
            LADNQISG IP  ++
Sbjct  166  LADNQISGAIPASIA  180


 Score = 44.7 bits (104),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N LTG +P  IG+L M+SR LL
Sbjct  176  PASIARLTSLTHLDLRNNGLTGVIPVYIGRLKMLSRVLL  214



>ref|XP_010419853.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Camelina 
sativa]
Length=372

 Score = 77.4 bits (189),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS +I+ADWK ISG IP CI  L     +DL G +I+  I   IG L +L +LN
Sbjct  106  ICKLTRLSGIIIADWKGISGGIPSCIAKLPFLRHIDLVGNKISGVIPANIGMLLRLKVLN  165

Query  328  LADNQISGVIP  360
            LADNQISGVIP
Sbjct  166  LADNQISGVIP  176


 Score = 43.9 bits (102),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL
Sbjct  176  PPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRVLL  214


 Score = 44.3 bits (103),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +1

Query  163  RLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQ  342
            RL  L LAD   ISG IPP IT L++   LDL    I+  I   IG L  L+ + L+ N+
Sbjct  160  RLKVLNLAD-NQISGVIPPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRVLLSGNK  218

Query  343  ISGVIPTPLS  372
            ISG IP  L+
Sbjct  219  ISGQIPESLT  228


 Score = 30.8 bits (68),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L++S N+LTG +P + GK+++++
Sbjct  224  PESLTRIYRLADLEISMNRLTGSIPVSFGKMSVLA  258



>ref|XP_006289832.1| hypothetical protein CARUB_v10003437mg [Capsella rubella]
 gb|EOA22730.1| hypothetical protein CARUB_v10003437mg [Capsella rubella]
Length=373

 Score = 77.8 bits (190),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS +ILADWK ISG IP CI  L     +DL G +I+  I   IG L +L +LN
Sbjct  107  ICKLTRLSGIILADWKGISGGIPSCIANLPFLRHIDLVGNKISGVIPANIGMLLRLKVLN  166

Query  328  LADNQISGVIP  360
            LADNQISGVIP
Sbjct  167  LADNQISGVIP  177


 Score = 43.1 bits (100),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL
Sbjct  177  PPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRLLL  215


 Score = 45.4 bits (106),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +1

Query  163  RLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQ  342
            RL  L LAD   ISG IPP IT L++   LDL    I+  I   IG L  L+ L L+ N+
Sbjct  161  RLKVLNLAD-NQISGVIPPSITRLTSLAHLDLRNNNISGVIPRDIGRLKMLSRLLLSGNK  219

Query  343  ISGVIPTPLS  372
            ISG IP  L+
Sbjct  220  ISGQIPESLT  229


 Score = 32.3 bits (72),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L+LS N+LTG +P++ GK+++++
Sbjct  225  PESLTRIYRLADLELSLNRLTGSIPASFGKMSVLA  259



>ref|XP_007131991.1| hypothetical protein PHAVU_011G057600g [Phaseolus vulgaris]
 gb|ESW03985.1| hypothetical protein PHAVU_011G057600g [Phaseolus vulgaris]
Length=525

 Score = 72.4 bits (176),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS+LI+ DW+ ISG IPPCI+ LS   I+DLTG +I+  +   IG L  LT+L+
Sbjct  263  ICKLTYLSSLIITDWQGISGEIPPCISTLSFLRIIDLTGNRISGTLPADIGKLLHLTLLS  322

Query  328  LADNQISGVIPTPLS  372
             ADN I+G IP  L+
Sbjct  323  GADNLIAGEIPVTLT  337


 Score = 46.2 bits (108),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ-RQWR*PVQAALHRRQR  524
            P ++  L SL HLDL +NK++G +P N+G+L M+SRALL   Q   P+ A++    R
Sbjct  333  PVTLTRLTSLMHLDLRNNKISGPIPLNVGQLQMLSRALLSGNQISGPIPASICHIYR  389



>ref|XP_003555428.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Glycine 
max]
Length=240

 Score = 67.0 bits (162),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C ++ L+TL++ADWK I+G I  C+TAL +  ILDL G ++   I   +  L+ LT+L+
Sbjct  102  ICDINTLTTLVVADWKDIAGEIHACVTALPSLRILDLIGNKLFGEIPVNVDKLSHLTVLD  161

Query  328  LADNQISGVIPT  363
            LADN ++G IPT
Sbjct  162  LADNTLNGKIPT  173


 Score = 50.1 bits (118),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P  I  LGSLKHLDL++N+L  E+P + G L M+SR LL R 
Sbjct  172  PTFITRLGSLKHLDLNNNQLCSEIPEDFGNLAMLSRMLLNRN  213



>ref|XP_004507136.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cicer 
arietinum]
Length=375

 Score = 79.0 bits (193),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +C L +LS++ ++DWK ISG+IP CIT L    ILDL+G  IT  I   IG L +LT+
Sbjct  100  SSICNLTQLSSITISDWKGISGNIPECITTLRFLQILDLSGNFITGKIPYNIGSLTELTV  159

Query  322  LNLADNQISGVIPT  363
            LNLADN ISG IPT
Sbjct  160  LNLADNHISGNIPT  173


 Score = 38.1 bits (87),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P +++NL +L  LDL  N + G +P NIG+L  ++R  L
Sbjct  172  PTTVINLNNLMQLDLRHNAIEGPIPGNIGRLKRLNRVFL  210



>ref|XP_002871534.1| hypothetical protein ARALYDRAFT_909242 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47793.1| hypothetical protein ARALYDRAFT_909242 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score = 73.2 bits (178),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS +I+ADWK ISG IP CI  L     LDL G +I+  I   IG L +L +LN
Sbjct  105  ICKLTRLSGIIIADWKGISGGIPSCIENLPFLRHLDLVGNKISGVIPANIGKLLRLKVLN  164

Query  328  LADNQISGVIP  360
            LADN + GVIP
Sbjct  165  LADNHLYGVIP  175


 Score = 43.1 bits (100),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL
Sbjct  175  PPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLL  213



>gb|ACU27355.1| polygalacturonase inhibiting protein [Panax ginseng]
Length=366

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  166  LSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQI  345
            L    +ADWK ISG IP CIT L    ILDL G +I   I   IG L++LT+LN+ADN I
Sbjct  108  LEVSTMADWKGISGPIPSCITYLPYLRILDLIGNRINGQIPADIGRLSRLTVLNVADNNI  167

Query  346  SGVIPTPLST  375
            +G IP  ++ 
Sbjct  168  TGWIPRSIAN  177


 Score = 50.4 bits (119),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI NL SL HLDL +N++ G +P N GKL M+SRALL 
Sbjct  172  PRSIANLSSLMHLDLRNNQIRGTIPRNFGKLRMLSRALLS  211



>ref|XP_006399780.1| hypothetical protein EUTSA_v10013835mg [Eutrema salsugineum]
 gb|ESQ41233.1| hypothetical protein EUTSA_v10013835mg [Eutrema salsugineum]
Length=377

 Score = 72.4 bits (176),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS +I+ADW+ ISG IP CI  L     +DL G +I+  I   IG L++L +LN
Sbjct  111  ICKLTHLSGIIIADWQGISGVIPSCIANLLFMRHIDLVGNKISGVIPANIGKLHRLRVLN  170

Query  328  LADNQISGVIPTPLS  372
            LADNQISG IP+ ++
Sbjct  171  LADNQISGGIPSSIT  185


 Score = 42.7 bits (99),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N ++G +P ++G+L M+SR LL
Sbjct  181  PSSITRLTSLSHLDLRNNYISGVIPRDMGRLKMLSRVLL  219



>ref|XP_003539410.2| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Glycine 
max]
Length=355

 Score = 77.8 bits (190),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L +LS++ ++DWK ISG+IPPCIT L    ILDL+G  I   I + IG L +LT+LN
Sbjct  94   ICNLTQLSSITISDWKGISGNIPPCITKLPLLQILDLSGNLIHGQIPSDIGRLTQLTMLN  153

Query  328  LADNQISGVIPTPL  369
            LADN ISG IP  L
Sbjct  154  LADNHISGKIPNSL  167


 Score = 37.0 bits (84),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P+S+V+L +L  LDL +N + G +P ++G+L  ++RALL
Sbjct  164  PNSLVHLSNLMQLDLRNNAIQGPIPMDLGRLKKLNRALL  202



>gb|KHN24357.1| DNA-damage-repair/toleration protein DRT100 [Glycine soja]
Length=189

 Score = 67.8 bits (164),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C +D L+TL++ADWK I+  IP CITAL +  ILDL G +++  I   +   + LT+L
Sbjct  77   AICGIDTLTTLVVADWKDIAKEIPACITALPSHRILDLIGNKLSGEIPADVSKFSCLTVL  136

Query  325  NLADNQISGVIPTPLSTW  378
            NL DN +S  IPT + TW
Sbjct  137  NLTDNALSDKIPTSI-TW  153


 Score = 47.0 bits (110),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P SI  LGSLKHL+L++N+L GE+  + G L M+SR LL R
Sbjct  148  PTSITWLGSLKHLNLNNNQLCGEILKDFGNLVMLSRMLLTR  188



>ref|XP_006595269.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Glycine 
max]
Length=174

 Score = 67.4 bits (163),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C +D L+TL++ADWK I+  IP CITAL +  ILDL G +++  I   +   + LT+LN
Sbjct  63   ICGIDTLTTLVVADWKDIAKEIPACITALPSHRILDLIGNKLSGEIPADVSKFSCLTVLN  122

Query  328  LADNQISGVIPTPLSTW  378
            L DN +S  IPT + TW
Sbjct  123  LTDNALSDKIPTSI-TW  138


 Score = 47.4 bits (111),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P SI  LGSLKHL+L++N+L GE+  + G L M+SR LL R 
Sbjct  133  PTSITWLGSLKHLNLNNNQLCGEILKDFGNLVMLSRMLLTRN  174



>gb|AAK64162.1| unknown protein [Arabidopsis thaliana]
Length=371

 Score = 70.9 bits (172),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS +I+ADWK ISG IP CI  L     LDL G + +  I   IG L +L +LN
Sbjct  105  ICKLTRLSGIIIADWKGISGVIPSCIENLPFLRHLDLVGNKFSGVIPANIGKLLRLKVLN  164

Query  328  LADNQISGVIP  360
            LADN + GVIP
Sbjct  165  LADNHLYGVIP  175


 Score = 43.1 bits (100),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL 
Sbjct  175  PPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLS  214



>gb|AAM65656.1| leucine rich repeat protein, putative [Arabidopsis thaliana]
Length=371

 Score = 70.9 bits (172),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS +I+ADWK ISG IP CI  L     LDL G + +  I   IG L +L +LN
Sbjct  105  ICKLTRLSGIIIADWKGISGVIPSCIENLPFLRHLDLVGNKFSGVIPANIGKLLRLKVLN  164

Query  328  LADNQISGVIP  360
            LADN + GVIP
Sbjct  165  LADNHLYGVIP  175


 Score = 43.1 bits (100),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL 
Sbjct  175  PPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLS  214



>emb|CDX91155.1| BnaC02g04420D [Brassica napus]
Length=346

 Score = 70.1 bits (170),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L +LS + L+DW+ ISG IP CIT L     +DL G +I+  I   IG L KLT+LN
Sbjct  80   ICELTQLSGVTLSDWEGISGAIPACITNLLAVRHVDLVGNKISGEIPANIGNLLKLTVLN  139

Query  328  LADNQISGVIP  360
            LADN ISG IP
Sbjct  140  LADNLISGAIP  150


 Score = 44.3 bits (103),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L SL HLDL +N LTG +P  IG+L M+SR LL
Sbjct  150  PPSIARLTSLTHLDLRNNGLTGVIPVYIGRLKMLSRVLL  188



>ref|NP_196798.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 emb|CAB88258.1| putative protein [Arabidopsis thaliana]
 gb|AAP40500.1| putative leucine rich repeat protein [Arabidopsis thaliana]
 gb|AED91833.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=371

 Score = 70.9 bits (172),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL RLS +I+ADWK ISG IP CI  L     LDL G + +  I   IG L +L +LN
Sbjct  105  ICKLTRLSGIIIADWKGISGVIPSCIENLPFLRHLDLVGNKFSGVIPANIGKLLRLKVLN  164

Query  328  LADNQISGVIP  360
            LADN + GVIP
Sbjct  165  LADNHLYGVIP  175


 Score = 43.1 bits (100),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI  L SL HLDL +N ++G +P +IG+L M+SR LL 
Sbjct  175  PPSITRLVSLSHLDLRNNNISGVIPRDIGRLKMVSRVLLS  214



>ref|XP_003537957.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Glycine 
max]
Length=387

 Score = 72.4 bits (176),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS++I+ DW+ ISG IP CIT+L    I+DLTG +I   + + IG L  LT+L+
Sbjct  125  ICKLTHLSSIIITDWQGISGEIPRCITSLFFLRIIDLTGNRIAGTLPSNIGRLRHLTLLS  184

Query  328  LADNQISGVIPTPLST  375
             ADN I+G+IP  L+ 
Sbjct  185  AADNVIAGIIPPSLTN  200


 Score = 41.2 bits (95),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P S+ N+  L HLDL +N++ G +P ++G+L M+SR LL 
Sbjct  195  PPSLTNVTGLMHLDLRNNRIFGPIPRSLGRLQMLSRVLLS  234



>ref|XP_004507113.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cicer 
arietinum]
Length=369

 Score = 72.0 bits (175),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL +LS++ + DW  ISG IP CIT+L+   I+DLTG QI+  + + IG L  L+ L+
Sbjct  102  ICKLTQLSSISITDWNGISGEIPSCITSLAFLRIIDLTGNQISGTLPSDIGKLRHLSRLS  161

Query  328  LADNQISGVIPTPLST  375
            +ADN I+G IP  LS 
Sbjct  162  VADNVITGYIPRSLSN  177


 Score = 40.8 bits (94),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ-RQWR*PVQAALHRRQR  524
            P S+ N+  L HLDL +N+++G +P N G L  + RALL   +   P+  ++ R  R
Sbjct  172  PRSLSNVTGLTHLDLRNNRISGSIPMNFGNLQNLGRALLSGNKLSGPIPGSISRIYR  228



>emb|CDY69775.1| BnaAnng31490D [Brassica napus]
Length=377

 Score = 70.9 bits (172),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL  LS +I+ADW+ ISG IP CIT +     LDL G +I+  I   IG L KL +L
Sbjct  110  ALCKLTHLSGIIIADWEGISGVIPSCITNILAMRHLDLVGNKISGVIPANIGKLVKLRVL  169

Query  325  NLADNQISGVIP  360
            NLADN+ISG IP
Sbjct  170  NLADNKISGGIP  181


 Score = 42.4 bits (98),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L  L HLDL +N L+G +P +IG+L M+SR LL
Sbjct  181  PPSITRLTMLSHLDLVNNNLSGVIPGDIGRLKMLSRVLL  219


 Score = 43.1 bits (100),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL +L  L LAD K ISG IPP IT L+    LDL    ++  I   IG L  L+ + 
Sbjct  160  IGKLVKLRVLNLADNK-ISGGIPPSITRLTMLSHLDLVNNNLSGVIPGDIGRLKMLSRVL  218

Query  328  LADNQISGVIPTPLS  372
            L  N++SG IP  L+
Sbjct  219  LTGNKLSGQIPESLT  233


 Score = 32.3 bits (72),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L+LS N++TG +P+++GK+++++
Sbjct  229  PESLTRIYRLADLELSMNRITGSIPTSMGKMSVLA  263



>emb|CDY68308.1| BnaA10g30080D [Brassica napus]
Length=374

 Score = 71.2 bits (173),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS +I+ADW+ ISG IP C+T L     LDL G +I+  I   IG L KL +LN
Sbjct  108  ICKLTHLSGIIIADWEGISGVIPSCVTNLLAMRHLDLVGNKISGVIPASIGKLMKLRVLN  167

Query  328  LADNQISGVIP  360
            LADN++SG IP
Sbjct  168  LADNKLSGGIP  178


 Score = 41.2 bits (95),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L  L HLDL +N L G +P +IG+L M+SR LL
Sbjct  178  PPSITRLTMLAHLDLMNNNLYGVIPGDIGRLKMLSRVLL  216


 Score = 41.2 bits (95),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL +L  L LAD K +SG IPP IT L+    LDL    +   I   IG L  L+ + 
Sbjct  157  IGKLMKLRVLNLADNK-LSGGIPPSITRLTMLAHLDLMNNNLYGVIPGDIGRLKMLSRVL  215

Query  328  LADNQISGVIPTPLS  372
            L  N++SG IP  L+
Sbjct  216  LTGNKLSGQIPESLT  230


 Score = 30.4 bits (67),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L+L  N++TG +P+++GK+++++
Sbjct  226  PESLTRIYRLADLELGMNRITGTIPASMGKMSVLA  260



>ref|XP_009121823.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Brassica 
rapa]
Length=374

 Score = 71.2 bits (173),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL  LS +I+ADW+ ISG IP C+T L     LDL G +I+  I   IG L KL +L
Sbjct  107  AICKLTHLSGIIIADWEGISGVIPSCVTNLLAMRHLDLVGNKISGVIPASIGKLMKLRVL  166

Query  325  NLADNQISGVIP  360
            NLADN++SG IP
Sbjct  167  NLADNKLSGGIP  178


 Score = 41.2 bits (95),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI  L  L HLDL +N L G +P +IG+L M+SR LL
Sbjct  178  PPSITRLTMLAHLDLMNNNLYGVIPGDIGRLKMLSRVLL  216


 Score = 41.2 bits (95),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL +L  L LAD K +SG IPP IT L+    LDL    +   I   IG L  L+ + 
Sbjct  157  IGKLMKLRVLNLADNK-LSGGIPPSITRLTMLAHLDLMNNNLYGVIPGDIGRLKMLSRVL  215

Query  328  LADNQISGVIPTPLS  372
            L  N++SG IP  L+
Sbjct  216  LTGNKLSGQIPESLT  230


 Score = 30.4 bits (67),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L+L  N++TG +P+++GK+++++
Sbjct  226  PESLTRIYRLADLELGMNRITGPIPASMGKMSVLA  260



>ref|XP_003592471.1| DNA-damage-repair/toleration protein DRT100, partial [Medicago 
truncatula]
Length=361

 Score = 67.0 bits (162),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL +LS++ + DW  ISG IP CI++LS   I+DL G + +  I + IG L  L  L+
Sbjct  102  ICKLTKLSSITITDWNGISGEIPKCISSLSFLRIIDLAGNRFSGNIPSDIGKLRHLNRLS  161

Query  328  LADNQISGVIPTPLST  375
            +ADN I+G IP  L+ 
Sbjct  162  IADNVITGGIPRSLTN  177


 Score = 43.9 bits (102),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ-RQWR*PVQAALHRRQR  524
            P S+ NL SL HLD+ +N+++G +P   G+L  + RALL   Q   P+  ++ R +R
Sbjct  172  PRSLTNLTSLTHLDIRNNRISGYIPMGFGRLQYLGRALLSGNQLHGPIPGSISRIKR  228



>gb|ACJ86289.1| unknown [Medicago truncatula]
 gb|AFK38697.1| unknown [Medicago truncatula]
 gb|KEH30249.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=367

 Score = 67.0 bits (162),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL +LS++ + DW  ISG IP CI++LS   I+DL G + +  I + IG L  L  L+
Sbjct  102  ICKLTKLSSITITDWNGISGEIPKCISSLSFLRIIDLAGNRFSGNIPSDIGKLRHLNRLS  161

Query  328  LADNQISGVIPTPLST  375
            +ADN I+G IP  L+ 
Sbjct  162  IADNVITGGIPRSLTN  177


 Score = 43.9 bits (102),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ-RQWR*PVQAALHRRQR  524
            P S+ NL SL HLD+ +N+++G +P   G+L  + RALL   Q   P+  ++ R +R
Sbjct  172  PRSLTNLTSLTHLDIRNNRISGYIPMGFGRLQYLGRALLSGNQLHGPIPGSISRIKR  228



>ref|XP_003540709.2| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Glycine 
max]
Length=388

 Score = 72.4 bits (176),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS++I+ DW+ ISG IP CIT+LS   I+DLTG +I+  +   IG L  LT+L+
Sbjct  126  ICKLTYLSSIIITDWQGISGEIPRCITSLSFLRIIDLTGNRISGTLPADIGRLQYLTLLS  185

Query  328  LADNQISGVIPTPLST  375
             ADN I+G IP  L++
Sbjct  186  AADNVIAGEIPPSLTS  201


 Score = 38.5 bits (88),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P S+ ++  L +LDL +N+++G +P ++G+L M+SR LL
Sbjct  196  PPSLTSVTGLMYLDLRNNQISGPIPQSLGRLQMLSRVLL  234



>ref|XP_002513458.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF48861.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=366

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 8/106 (8%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +CKL+RLS+L +ADWK ISG IP CIT+L    ILDL G +I+  I   IG L++LT+
Sbjct  100  SSICKLERLSSLTIADWKGISGEIPRCITSLPFLRILDLIGNKISGDIPADIGRLHRLTV  159

Query  322  LNLADNQISGVIPTPLSTWEA------*STWISAPISSPGNSHRIS  441
            LN+ADN ISG IP  L+   +       +  IS P+  P + HR++
Sbjct  160  LNVADNLISGEIPRSLTNLSSLMHLDLRNNRISGPL--PRDFHRLT  203



>ref|XP_010445380.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Camelina 
sativa]
Length=238

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             VC L  L++ ILADWK I+G IPPC+ +L++  ILDL G +IT  I   I  L+KL +L
Sbjct  8    AVCDLSALTSFILADWKGITGEIPPCVNSLASLRILDLNGNKITGEIHAEISKLSKLAVL  67

Query  325  NLADNQISGVIPTPLST  375
            NLA+NQISG I   L++
Sbjct  68   NLAENQISGEILASLTS  84


 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             VC L  L++ ILADWK I+G IPPC+ +L++  ILDL G +IT  I   I  L+KL +L
Sbjct  103  AVCDLSALTSFILADWKGITGEIPPCVNSLASLRILDLNGNKITGEIHAEISKLSKLAVL  162

Query  325  NLADNQISGVIPTPLST  375
            NLA+NQISG I   L++
Sbjct  163  NLAENQISGEILASLTS  179



>emb|CAD56505.1| polygalacturonase inhibitor-like protein [Cicer arietinum]
Length=322

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL RLS++ +ADWK ISG IP CIT+L    I+DL G +I+S I + IG L++LT+L
Sbjct  55   AICKLTRLSSITVADWKNISGEIPRCITSLPFLRIIDLIGNRISSTIPSDIGRLHRLTVL  114

Query  325  NLADNQISGVIPTPLSTWEA  384
            N+ADN ISG IP  L+   +
Sbjct  115  NVADNAISGNIPPSLTNLRS  134


 Score = 49.7 bits (117),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L +AD  AISG+IPP +T L +   LD+   QI+ PI    G L  L+   
Sbjct  105  IGRLHRLTVLNVAD-NAISGNIPPSLTNLRSLMHLDIRNNQISGPIPKDFGRLPMLSRAL  163

Query  328  LADNQISGVIPTPLS  372
            L+ N+ISG IP  +S
Sbjct  164  LSGNKISGPIPDSIS  178


 Score = 32.7 bits (73),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI  +  L  LDLS N+++G +P ++GK+ ++S
Sbjct  174  PDSISRIYRLADLDLSRNQVSGPIPESLGKMAVLS  208



>ref|XP_004486948.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Cicer 
arietinum]
Length=371

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +CKL RLS++ +ADWK ISG IP CIT+L    I+DL G +I+S I + IG L++LT+L
Sbjct  104  AICKLTRLSSITVADWKNISGEIPRCITSLPFLRIIDLIGNRISSTIPSDIGRLHRLTVL  163

Query  325  NLADNQISGVIPTPLSTWEA  384
            N+ADN ISG IP  L+   +
Sbjct  164  NVADNAISGNIPPSLTNLRS  183


 Score = 49.3 bits (116),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L +AD  AISG+IPP +T L +   LD+   QI+ PI    G L  L+   
Sbjct  154  IGRLHRLTVLNVAD-NAISGNIPPSLTNLRSLMHLDIRNNQISGPIPKDFGRLPMLSRAL  212

Query  328  LADNQISGVIPTPLS  372
            L+ N+ISG IP  +S
Sbjct  213  LSGNKISGPIPDSIS  227


 Score = 32.7 bits (73),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI  +  L  LDLS N+++G +P ++GK+ ++S
Sbjct  223  PDSISRIYRLADLDLSRNQVSGPIPESLGKMAVLS  257



>ref|XP_003597454.1| DNA-damage-repair/toleration protein DRT100 [Medicago truncatula]
 gb|AES67705.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=375

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             +C L+RLS+  +ADWK ISG IP CI++L    I+DL G ++T  I T IG L +LT+L
Sbjct  107  AICHLNRLSSFTVADWKGISGEIPRCISSLPFLRIIDLIGNRLTGTIPTDIGKLQRLTVL  166

Query  325  NLADNQISGVIPTPLSTWEA  384
            N+ADN ISG IP  L+   +
Sbjct  167  NIADNAISGNIPRSLTNLRS  186


 Score = 47.4 bits (111),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T + KL RL+ L +AD  AISG+IP  +T L +   LD+   QI+ PI    G L  L+ 
Sbjct  155  TDIGKLQRLTVLNIAD-NAISGNIPRSLTNLRSLMHLDIRNNQISGPIPNDFGRLPMLSR  213

Query  322  LNLADNQISGVIPTPLS  372
              L+ N++SG IP  +S
Sbjct  214  ALLSGNKLSGPIPESIS  230


 Score = 33.1 bits (74),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI  +  L  LDLS N+++G +P ++GK+ ++S
Sbjct  226  PESISRIYRLADLDLSRNQVSGPIPESLGKMAVLS  260



>gb|KEH30247.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=357

 Score = 57.4 bits (137),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  196  AISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPL  369
             ISG+IP CIT L    I+DL+G  I+  I   IG L +LT+LNLADN ISG IPT L
Sbjct  100  GISGNIPGCITTLDFLQIIDLSGNVISGKIPYDIGRLTQLTVLNLADNHISGRIPTTL  157


 Score = 39.7 bits (91),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P ++VNL +L  LDL +N + G +P NIG+L  ++RALL
Sbjct  154  PTTLVNLFNLMQLDLHNNAIGGPIPGNIGRLKKLNRALL  192



>ref|XP_009121824.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Brassica 
rapa]
Length=373

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 8/103 (8%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS + + DW+ ISG IP CIT L     LDL G +I+  I   IG L KL +LN
Sbjct  107  LCKLTHLSGVTITDWEGISGVIPNCITNLLAMRHLDLAGNKISGVIPANIGKLTKLRVLN  166

Query  328  LADNQISGVIP------TPLSTWEA*STWISAPISSPGNSHRI  438
            LADN+ISGVIP      T LS  +  + +IS  I  PG+  R+
Sbjct  167  LADNKISGVIPPSITRLTSLSHLDLRNNYISGVI--PGDIGRL  207


 Score = 45.8 bits (107),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL +L  L LAD K ISG IPP IT L++   LDL    I+  I   IG L  L+ + 
Sbjct  156  IGKLTKLRVLNLADNK-ISGVIPPSITRLTSLSHLDLRNNYISGVIPGDIGRLKMLSRVL  214

Query  328  LADNQISGVIPTPL  369
            L  N+ISG IP  L
Sbjct  215  LTGNRISGQIPESL  228


 Score = 28.9 bits (63),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L+L  N++TG +P ++GK+++++
Sbjct  225  PESLPRIYRLADLELGMNRMTGTIPVSLGKMSVLA  259



>emb|CDY69275.1| BnaCnng62760D [Brassica napus]
Length=374

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 8/103 (8%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS + + DW+ ISG IP C T L     LDL G +I+  I   IG L KL +LN
Sbjct  108  LCKLTHLSGITITDWEGISGVIPSCFTNLLAMRHLDLAGNKISGDIPANIGKLMKLRVLN  167

Query  328  LADNQISGVIP------TPLSTWEA*STWISAPISSPGNSHRI  438
            LADN+ISGVIP      T LS  +  + +IS  I  PG+  R+
Sbjct  168  LADNKISGVIPPSITRLTSLSHLDLRNNYISGVI--PGDIGRL  208


 Score = 45.8 bits (107),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL +L  L LAD K ISG IPP IT L++   LDL    I+  I   IG L  L+ + 
Sbjct  157  IGKLMKLRVLNLADNK-ISGVIPPSITRLTSLSHLDLRNNYISGVIPGDIGRLKMLSRVL  215

Query  328  LADNQISGVIPTPLS  372
            L  N+ISG IP  L+
Sbjct  216  LTGNRISGQIPESLT  230


 Score = 31.2 bits (69),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L+L  N++TG +P+++GK+++++
Sbjct  226  PESLTRIYRLADLELGMNRITGAIPTSLGKMSVLA  260



>emb|CBN79590.1| LRR-GTPase of the ROCO family [Ectocarpus siliculosus]
Length=1527

 Score = 57.8 bits (138),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            L +L++L L   K ++G IPP +  L+    LDLTG Q+T  I   +G LNKLT LNL++
Sbjct  164  LTKLTSLFLRSNK-LTGPIPPELGKLAALESLDLTGNQLTGAIPAQLGDLNKLTALNLSN  222

Query  337  NQISGVIP  360
            NQ+SG IP
Sbjct  223  NQLSGPIP  230


 Score = 36.6 bits (83),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P  +  LG++K LDL  NKL+G +P  +G LT ++   L+
Sbjct  230  PPEVGKLGAVKQLDLWGNKLSGPIPKELGALTKLASLFLR  269



>ref|XP_003609928.1| DNA-damage-repair/toleration protein DRT100 [Medicago truncatula]
 gb|AES92125.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=366

 Score = 52.0 bits (123),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 15/74 (20%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RLS++ ++DWK ISG+IP  +               I+  I   IG L +L +LN
Sbjct  108  ICNLTRLSSITVSDWKGISGNIPWIL---------------ISGKIPYDIGRLTQLMVLN  152

Query  328  LADNQISGVIPTPL  369
            LADN ISG IPT L
Sbjct  153  LADNHISGRIPTTL  166


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P ++VNL +L  LDL +N + G +P NIG+L  ++RA L
Sbjct  163  PTTLVNLFNLMQLDLRNNAIGGPIPGNIGQLKKLNRAFL  201


 Score = 43.5 bits (101),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L +L  L LAD   ISG IP  +  L N   LDL    I  PI   IG L KL    
Sbjct  142  IGRLTQLMVLNLAD-NHISGRIPTTLVNLFNLMQLDLRNNAIGGPIPGNIGQLKKLNRAF  200

Query  328  LADNQISGVIPTPLST  375
            L+ N+I+G IP  +S 
Sbjct  201  LSHNRINGRIPRSISN  216


 Score = 31.6 bits (70),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P SI N+  L  LDLS N+L+G +P ++G++ ++
Sbjct  211  PRSISNIYGLADLDLSLNRLSGPIPFSLGQMPVL  244



>emb|CAA47109.2| DRT 100 [Arabidopsis thaliana]
Length=395

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             VC L  L++L+LADWK I+G IPPCIT+L +  ILDL G+Q             KL +L
Sbjct  102  AVCDLTALTSLVLADWKGITGEIPPCITSLMSLRILDLAGQQDHRGDSRGKRQTLKLAVL  161

Query  325  NLADNQISGVIPT  363
            NL +NQ+SG IP 
Sbjct  162  NLPENQMSGEIPA  174



>ref|WP_013306123.1| hypothetical protein [Maribacter sp. HTCC2170]
 ref|YP_003862356.1| hypothetical protein FB2170_07319 [Maribacter sp. HTCC2170]
 gb|EAQ99746.1| hypothetical protein FB2170_07319 [Maribacter sp. HTCC2170]
Length=294

 Score = 47.4 bits (111),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T + +   L  L LA + ++SG IP  IT L N  IL L    ++  I   IG L  L I
Sbjct  80   TSINQFKHLKILNLA-FNSLSGQIPTEITNLKNLKILRLGKNNLSGVIPERIGYLRSLVI  138

Query  322  LNLADNQISGVIPTPLST  375
            L+  DN +SG IPT +  
Sbjct  139  LDFFDNDLSGTIPTSIGN  156


 Score = 42.7 bits (99),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI NLG+L+ L+L +N++ GE+P++IGKL  ++R +L
Sbjct  175  PKSIGNLGNLEGLELGNNRIEGEIPASIGKLERLNRLIL  213



>ref|XP_010661012.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Vitis vinifera]
Length=717

 Score = 50.8 bits (120),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            + E S   +  L  L+ LIL+    +SG I   I +L+   ILDL+  Q+T PI   IG 
Sbjct  78   IGEVSELNLSSLPSLNFLILSR-MGLSGSISDQIGSLTKLTILDLSHNQLTDPIPHQIGS  136

Query  304  LNKLTILNLADNQISGVIP  360
            L KLT L+L DNQ++G IP
Sbjct  137  LTKLTHLDLFDNQLTGPIP  155


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            PH I +L  L HLDLSSN+LT  LP  IG LT ++
Sbjct  155  PHQIGSLTKLIHLDLSSNQLTDSLPHQIGTLTELT  189


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +1

Query  211  IPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPLST  375
            IP  I +L+    LDL   Q+T PI   IG L KL  L+L+ NQ++  +P  + T
Sbjct  130  IPHQIGSLTKLTHLDLFDNQLTGPIPHQIGSLTKLIHLDLSSNQLTDSLPHQIGT  184


 Score = 37.4 bits (85),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            PH I  L  L +L +SSN+LTG +PS++G+LT ++
Sbjct  179  PHQIGTLTELTYLHVSSNELTGPIPSSLGRLTKLT  213



>emb|CDY53975.1| BnaA10g30070D [Brassica napus]
Length=373

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 59/103 (57%), Gaps = 8/103 (8%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +CKL  LS + + DW+ ISG IP CIT L     LDL G +I+  I   IG L KL +L 
Sbjct  107  LCKLTHLSGVTITDWEGISGVIPNCITNLLAMRHLDLAGNKISGVIPANIGKLTKLRVLT  166

Query  328  LADNQISGVIP------TPLSTWEA*STWISAPISSPGNSHRI  438
            LADN++SG IP      T LS  +  + +IS  I  PG+  R+
Sbjct  167  LADNKLSGGIPPSITRLTSLSHLDLRNNYISGVI--PGDIGRL  207


 Score = 47.0 bits (110),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL +L  L LAD K +SG IPP IT L++   LDL    I+  I   IG L  L+ + 
Sbjct  156  IGKLTKLRVLTLADNK-LSGGIPPSITRLTSLSHLDLRNNYISGVIPGDIGRLKMLSRVL  214

Query  328  LADNQISGVIPTPLS  372
            L  N+ISG IP  L+
Sbjct  215  LTGNRISGQIPESLT  229


 Score = 30.0 bits (66),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  +  L  L+L  N++TG +P ++GK+++++
Sbjct  225  PESLTRIYRLADLELGMNRITGTIPVSLGKMSVLA  259



>gb|KCW56179.1| hypothetical protein EUGRSUZ_I01928 [Eucalyptus grandis]
Length=652

 Score = 50.1 bits (118),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RL+ L L+ +  +SG +PPC+  L+    L+L G ++  PI   +G L +L  L 
Sbjct  97   ICALSRLALLDLS-YNFLSGELPPCLGNLTMLETLELEGNELRGPIPPELGTLKRLVWLF  155

Query  328  LADNQISGVIPT  363
            L +N ++G IP+
Sbjct  156  LGNNNLNGTIPS  167


 Score = 39.3 bits (90),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P  I NL SL HLDLSSN  +GE+P   G LT +
Sbjct  191  PSEIGNLKSLAHLDLSSNNFSGEIPVEFGHLTAL  224


 Score = 41.2 bits (95),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADW--KAISGHIPPCITALSNFCILDLTGKQ-ITSPILTY  294
            ++ FS     +  RL+ L   D    ++SG IPP I  LS    L L G Q ++  + + 
Sbjct  353  LNNFSGEIPVEFGRLTALYHLDLHNNSLSGTIPPSIGNLSTLTYLYLQGNQFLSGSVPSE  412

Query  295  IG*LNKLTILNLADNQISGVIP  360
            IG L  L +L+L+ N  SG IP
Sbjct  413  IGNLKSLAVLDLSLNNFSGEIP  434


 Score = 33.9 bits (76),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P SI NL SL  LDLS N  +GE+P   G+L  +
Sbjct  458  PPSIGNLKSLAELDLSLNNFSGEIPVEFGRLPAL  491



>ref|XP_010271504.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nelumbo nucifera]
Length=647

 Score = 44.7 bits (104),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +1

Query  127  SEFSFTCVCKLDRLSTLILADWKA--ISGHIPPCITALSNFCILDLTGKQITSPILTYIG  300
            +E S      + +L +L   D  A  +SG IPP I  L     +DL+  QIT  I   IG
Sbjct  197  NELSGGIPSSVGKLVSLAKLDLHANNLSGSIPPAIGRLKKLKYVDLSENQITGSIPPSIG  256

Query  301  *LNKLTILNLADNQISGVIPT  363
             L++L IL L  NQ++G IP+
Sbjct  257  GLSQLVILYLNQNQMTGRIPS  277


 Score = 43.1 bits (100),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI NL SL+   LS N+LTG LP++IGKL  + R +L+
Sbjct  276  PSSIANLASLQFCRLSENRLTGPLPASIGKLPSIQRLILE  315



>gb|KCW56528.1| hypothetical protein EUGRSUZ_I02256 [Eucalyptus grandis]
Length=516

 Score = 47.8 bits (112),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RL+ L L+   ++SG +PPC+  L+    LDL   Q+  PI   +G L +L  L 
Sbjct  97   ICALSRLARLDLSG-NSLSGELPPCLGNLTMLEELDLQHNQLRGPIPPELGTLKRLVRLF  155

Query  328  LADNQISGVIPT  363
            L  N ++G IP+
Sbjct  156  LGYNNLNGTIPS  167


 Score = 39.3 bits (90),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P  I NL SL HLDLSSN  +GE+P   G LT +
Sbjct  191  PSEIGNLKSLAHLDLSSNNFSGEIPVEFGHLTAL  224


 Score = 37.4 bits (85),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 36/73 (49%), Gaps = 0/73 (0%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +  L  L+ L L+D + +SG +P  I  L +   LDL+    +  I    G L  L  
Sbjct  167  SSIGNLSNLTYLYLSDNQFLSGSVPSEIGNLKSLAHLDLSSNNFSGEIPVEFGHLTALID  226

Query  322  LNLADNQISGVIP  360
            L L ++ +SG IP
Sbjct  227  LYLDNDSLSGTIP  239


 Score = 33.1 bits (74),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P SI NL  L  LDLS N  +GE+P   G LT +
Sbjct  239  PPSIGNLKRLAELDLSLNNFSGEIPIEFGHLTAL  272



>ref|XP_006296911.1| hypothetical protein CARUB_v10012903mg [Capsella rubella]
 gb|EOA29809.1| hypothetical protein CARUB_v10012903mg [Capsella rubella]
Length=964

 Score = 48.5 bits (114),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 42/78 (54%), Gaps = 1/78 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +  L  L+TL L      SG IP  I  LSN   LDL+  + +  IL  IG L +LT 
Sbjct  184  SFIGNLFHLTTLTLG-VSGFSGQIPSWIGNLSNLNTLDLSYNRFSGQILPSIGNLTQLTS  242

Query  322  LNLADNQISGVIPTPLST  375
            LNL+ NQ SG IP+ +  
Sbjct  243  LNLSMNQFSGEIPSSIEN  260


 Score = 38.1 bits (87),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI NL  L +LDLS N L GE+PS+ G L  ++  L+
Sbjct  255  PSSIENLSQLTYLDLSINNLVGEIPSSFGNLNQLASLLV  293



>gb|KGN58605.1| hypothetical protein Csa_3G698220 [Cucumis sativus]
Length=180

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = -3

Query  365  GVGMTPEI*LSARLRMVSLLSYPM*VKMGLVICFPVRSRMQKFERAVMQGGMWPEMAFQS  186
              G+ PEI  S RL  V    +P+   +  +I FP RS  ++    V   G+ P++ FQS
Sbjct  50   DAGILPEIAFSPRLSRVRRFKFPISEGISPLILFPTRSITRRLLSFVKHFGISPDIPFQS  109

Query  185  ARIRVLRRSSLQ  150
            A  R++R SSLQ
Sbjct  110  ATTRIVRLSSLQ  121


 Score = 39.3 bits (90),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -1

Query  472  SNARLIMVSFPIFDGSSPVSLLELRSRCFKLPRLTMEWG  356
            SNARL + +FP  DG SPV  L LRS C +LP  T++ G
Sbjct  14   SNARLNICNFPKSDGISPVIRLFLRSNCVRLPIFTIDAG  52



>ref|XP_010113397.1| Receptor-like protein kinase 2 [Morus notabilis]
 gb|EXC35404.1| Receptor-like protein kinase 2 [Morus notabilis]
Length=547

 Score = 48.1 bits (113),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T + KL+ L+ L L   K  SG IP  I  L +   LDL+  QI+  I   +G L++L +
Sbjct  105  TSIVKLNLLTKLDLHGNK-FSGSIPYSIGELKSLKYLDLSENQISGSIPKSVGGLSELVL  163

Query  322  LNLADNQISGVIPTPLS  372
            L L  NQISG IP+ +S
Sbjct  164  LYLNQNQISGRIPSSIS  180


 Score = 38.1 bits (87),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI  LGSL    LS NK++G LP++IGKL+ + R +L+
Sbjct  176  PSSISGLGSLYLCRLSENKISGNLPNSIGKLSNLRRLILE  215



>emb|CDX70023.1| BnaA10g23720D [Brassica napus]
Length=836

 Score = 45.4 bits (106),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  178  ILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVI  357
            IL     +SG IP  ++ L+N   LDL+G  +T  I   IG   KL  LNLA+N +SG I
Sbjct  244  ILLSNNHLSGEIPSSLSRLTNLTNLDLSGNSLTGSIPEEIGHSPKLQGLNLANNHLSGHI  303

Query  358  P  360
            P
Sbjct  304  P  304


 Score = 39.7 bits (91),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ NL  L H+DLS NKLTGELPS + K+  +    +Q+
Sbjct  328  PASLGNLKELTHMDLSFNKLTGELPSELSKMLNLVGIYIQQ  368



>ref|NP_198058.1| receptor like protein 53 [Arabidopsis thaliana]
 gb|AAD48937.1|AF160760_5 similar to disease resistance proteins; contains similarity ot 
Pfam family PF00560 - Leucine Rich Repeat; score=166.7, E=4e-46, 
N=24 [Arabidopsis thaliana]
 gb|AED93645.1| receptor like protein 53 [Arabidopsis thaliana]
Length=957

 Score = 48.5 bits (114),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +  L  L+TL L+ +    G I   I  LS+   LDL+    +  IL  IG L++LT 
Sbjct  115  SSIRNLHFLTTLDLS-FNDFKGQITSSIENLSHLTYLDLSSNHFSGQILNSIGNLSRLTY  173

Query  322  LNLADNQISGVIPT  363
            LNL DNQ SG  P+
Sbjct  174  LNLFDNQFSGQAPS  187


 Score = 36.6 bits (83),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI NL  L  LDLS N+  G+ PS+IG L+ ++
Sbjct  186  PSSICNLSHLTFLDLSYNRFFGQFPSSIGGLSHLT  220


 Score = 41.6 bits (96),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
              +  L RL+ L L D    SG  P  I  LS+   LDL+  +      + IG L+ LT 
Sbjct  163  NSIGNLSRLTYLNLFD-NQFSGQAPSSICNLSHLTFLDLSYNRFFGQFPSSIGGLSHLTT  221

Query  322  LNLADNQISGVIPT  363
            L+L  N+ SG IP+
Sbjct  222  LSLFSNKFSGQIPS  235


 Score = 35.8 bits (81),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI NL +L  LDLS+N  +G++PS IG L+ ++
Sbjct  234  PSSIGNLSNLTTLDLSNNNFSGQIPSFIGNLSQLT  268



>ref|NP_001043950.1| Os01g0694100 [Oryza sativa Japonica Group]
 dbj|BAF05864.1| Os01g0694100, partial [Oryza sativa Japonica Group]
Length=717

 Score = 45.1 bits (105),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T +  ++ L  L L++   +SG IP  IT L++   L+L   Q+ SPI + IG LN+L +
Sbjct  120  TQITSMNNLQELNLSN-NTLSGTIPVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQV  178

Query  322  LNLADNQISGVIPTPLSTWE  381
            + L+ N +S  I  P+S W 
Sbjct  179  VVLSQNSLSSTI--PISLWH  196


 Score = 38.1 bits (87),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ +L  L  LDLS N L+G LP+++GKLT +++  L R
Sbjct  191  PISLWHLQKLIELDLSQNSLSGSLPADVGKLTAITKMDLSR  231


 Score = 20.4 bits (41),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  48   PSTIKKLTNLVL  83
            PST+ KLTNL++
Sbjct  95   PSTLAKLTNLLM  106


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
            CV  L  L  + +AD   I+G IP  +  L+N  +L L G Q++  I T I  +N L  L
Sbjct  72   CVGNLSTLIEIFVADNNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQEL  131

Query  325  NLADNQISGVIPTPLS  372
            NL++N +SG IP  ++
Sbjct  132  NLSNNTLSGTIPVEIT  147



>dbj|BAG92989.1| unnamed protein product [Oryza sativa Japonica Group]
Length=697

 Score = 45.1 bits (105),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T +  ++ L  L L++   +SG IP  IT L++   L+L   Q+ SPI + IG LN+L +
Sbjct  100  TQITSMNNLQELNLSN-NTLSGTIPVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQV  158

Query  322  LNLADNQISGVIPTPLSTWE  381
            + L+ N +S  I  P+S W 
Sbjct  159  VVLSQNSLSSTI--PISLWH  176


 Score = 38.1 bits (87),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ +L  L  LDLS N L+G LP+++GKLT +++  L R
Sbjct  171  PISLWHLQKLIELDLSQNSLSGSLPADVGKLTAITKMDLSR  211


 Score = 20.4 bits (41),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  48  PSTIKKLTNLVL  83
           PST+ KLTNL++
Sbjct  75  PSTLAKLTNLLM  86


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
            CV  L  L  + +AD   I+G IP  +  L+N  +L L G Q++  I T I  +N L  L
Sbjct  52   CVGNLSTLIEIFVADNNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQEL  111

Query  325  NLADNQISGVIPTPLS  372
            NL++N +SG IP  ++
Sbjct  112  NLSNNTLSGTIPVEIT  127



>ref|XP_009405286.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Musa acuminata subsp. malaccensis]
Length=898

 Score = 54.3 bits (129),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +1

Query  190  WKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPL  369
            +  ++G+IPP I+ALSN   LDLT  + T  I   IG +  L  LN++ NQISG IP  L
Sbjct  112  YNQLNGNIPPTISALSNLVSLDLTANRFTGRIPVDIGSMKALQFLNISQNQISGPIPPSL  171

Query  370  ST  375
            S 
Sbjct  172  SN  173


 Score = 30.4 bits (67),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P S+ NL  L  + L  NK+TG +P  +G+L  +
Sbjct  168  PPSLSNLSRLTEMQLEDNKITGVIPEELGRLAKL  201


 Score = 39.3 bits (90),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +1

Query  199  ISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPLST  375
            ISG IPP ++ LS    + L   +IT  I   +G L KL  L L  NQ++G IP  L  
Sbjct  163  ISGPIPPSLSNLSRLTEMQLEDNKITGVIPEELGRLAKLIYLELGANQLTGSIPPSLGN  221


 Score = 32.3 bits (72),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIG  443
            P  + NL +L HL LS+N LTG +PS++G
Sbjct  240  PRELGNLINLAHLSLSNNSLTGRIPSSVG  268



>gb|EEE55227.1| hypothetical protein OsJ_03104 [Oryza sativa Japonica Group]
Length=1027

 Score = 45.1 bits (105),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 3/80 (4%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T +  ++ L  L L++   +SG IP  IT L++   L+L   Q+ SPI + IG LN+L +
Sbjct  430  TQITSMNNLQELNLSN-NTLSGTIPVEITGLTSLVKLNLANNQLVSPIPSTIGSLNQLQV  488

Query  322  LNLADNQISGVIPTPLSTWE  381
            + L+ N +S  I  P+S W 
Sbjct  489  VVLSQNSLSSTI--PISLWH  506


 Score = 38.1 bits (87),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ +L  L  LDLS N L+G LP+++GKLT +++  L R
Sbjct  501  PISLWHLQKLIELDLSQNSLSGSLPADVGKLTAITKMDLSR  541


 Score = 20.4 bits (41),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 8/12 (67%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = +3

Query  48   PSTIKKLTNLVL  83
            PST+ KLTNL++
Sbjct  405  PSTLAKLTNLLM  416


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +1

Query  145  CVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
            CV  L  L  + +AD   I+G IP  +  L+N  +L L G Q++  I T I  +N L  L
Sbjct  382  CVGNLSTLIEIFVADNNRITGSIPSTLAKLTNLLMLSLRGNQLSGMIPTQITSMNNLQEL  441

Query  325  NLADNQISGVIPTPLS  372
            NL++N +SG IP  ++
Sbjct  442  NLSNNTLSGTIPVEIT  457



>emb|CDY36314.1| BnaA01g31040D [Brassica napus]
Length=987

 Score = 48.5 bits (114),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +  L  L++L+L+ W   +G IP  I  LS+   LDL    ++  I + IG L+ LT 
Sbjct  126  SSIGNLSHLTSLVLS-WNHFTGFIPSSIVDLSSLTFLDLAMNHLSGQIPSLIGNLSHLTF  184

Query  322  LNLADNQISGVIPTPL  369
            L+L+ N ISG IP+ +
Sbjct  185  LDLSLNHISGQIPSSI  200


 Score = 35.8 bits (81),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSR  464
            P SI NL  L +LDL  N+++G++PS++G L  ++R
Sbjct  197  PSSIGNLSHLTNLDLFYNQISGQIPSSVGNLYKLTR  232


 Score = 46.2 bits (108),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +1

Query  109  LIWRVVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPIL  288
            L W   + F  + +  L  L+ L LA    +SG IP  I  LS+   LDL+   I+  I 
Sbjct  139  LSWNHFTGFIPSSIVDLSSLTFLDLA-MNHLSGQIPSLIGNLSHLTFLDLSLNHISGQIP  197

Query  289  TYIG*LNKLTILNLADNQISGVIPT  363
            + IG L+ LT L+L  NQISG IP+
Sbjct  198  SSIGNLSHLTNLDLFYNQISGQIPS  222


 Score = 30.0 bits (66),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+ NL  L  L LS N + GE+PS+ G L  ++
Sbjct  221  PSSVGNLYKLTRLGLSVNNIVGEIPSSFGNLNHLT  255



>emb|CDP13963.1| unnamed protein product [Coffea canephora]
Length=852

 Score = 48.9 bits (115),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL TL  + + A++G +P  ++ LSN  +L+L    +   I   +  L KL++LN
Sbjct  302  IGRLSRLRTLDFS-YNALNGSLPAALSNLSNLVVLNLESNHLDHQIPAAVNKLQKLSVLN  360

Query  328  LADNQISGVIPT  363
            L +NQ +G IP 
Sbjct  361  LRNNQFAGPIPA  372


 Score = 35.4 bits (80),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P ++ N+  L  +DLS NK +GE+P++IG L  +S
Sbjct  371  PATVGNISFLTQVDLSQNKFSGEIPASIGDLPNLS  405



>gb|EYU27469.1| hypothetical protein MIMGU_mgv1a026753mg, partial [Erythranthe 
guttata]
Length=678

 Score = 43.1 bits (100),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWK-AISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLT  318
            T V  L++L +L L  W+ A+ G +P  +       ++DL+   +T PI   IG L+KL 
Sbjct  270  TSVGGLEKLESLFL--WQNALVGTVPSELGNCRELKVMDLSENLLTGPIPVTIGKLSKLE  327

Query  319  ILNLADNQISGVIPTPLST  375
             L L+ NQ+SG IP  ++ 
Sbjct  328  ELQLSVNQLSGTIPNEITN  346


 Score = 40.8 bits (94),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQWR  488
            P+ I N  SL HL++ +N ++GE+P+NIGKLT ++   L   W+
Sbjct  341  PNEITNCTSLTHLEVDNNGISGEIPANIGKLTSLT---LFFAWK  381



>ref|XP_006470750.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Citrus sinensis]
Length=649

 Score = 48.5 bits (114),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            +S+ +F+C   L+ L+         ++G IPP I+ALS    LDL+  ++T  I + IG 
Sbjct  112  LSQLNFSCFPNLENLTFQSFP----LAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGN  167

Query  304  LNKLTILNLADNQISGVIPTPLST  375
            L  L  LN++ N ++G +P+ L +
Sbjct  168  LRNLVYLNISKNILTGTVPSTLGS  191


 Score = 35.4 bits (80),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  I NL +L  LDL +N L G +PS +G+LT ++   L R
Sbjct  210  PQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSR  250



>ref|XP_009122355.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Brassica 
rapa]
Length=1233

 Score = 44.3 bits (103),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  178  ILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVI  357
            IL     +SG IP  ++ L+N   LDL+G  +T  I   +G   KL  LNLA+N +SG I
Sbjct  609  ILLSNNHLSGEIPSSLSRLTNLTNLDLSGNSLTGSIPEELGHSPKLQGLNLANNHLSGHI  668

Query  358  P  360
            P
Sbjct  669  P  669


 Score = 39.7 bits (91),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ NL  L H+DLS NKLTGELPS + K+  +    +Q+
Sbjct  693  PASLGNLKELTHMDLSFNKLTGELPSELSKMLNLVGIYIQQ  733



>ref|XP_006446084.1| hypothetical protein CICLE_v10017805mg [Citrus clementina]
 gb|ESR59324.1| hypothetical protein CICLE_v10017805mg [Citrus clementina]
Length=644

 Score = 48.5 bits (114),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            +S+ +F+C   L+ L+         ++G IPP I+ALS    LDL+  ++T  I + IG 
Sbjct  98   LSQLNFSCFPNLENLTFQSFP----LAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGN  153

Query  304  LNKLTILNLADNQISGVIPTPLST  375
            L  L  LN++ N ++G +P+ L +
Sbjct  154  LRNLVYLNISKNILTGTVPSTLGS  177


 Score = 35.4 bits (80),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  I NL +L  LDL +N L G +PS +G+LT ++   L R
Sbjct  196  PQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSR  236



>gb|KDO64793.1| hypothetical protein CISIN_1g042931mg, partial [Citrus sinensis]
Length=471

 Score = 48.5 bits (114),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            +S+ +F+C   L+ L+         ++G IPP I+ALS    LDL+  ++T  I + IG 
Sbjct  123  LSQLNFSCFPNLENLTFQSFP----LAGSIPPEISALSKLQRLDLSSNRLTGSIPSEIGN  178

Query  304  LNKLTILNLADNQISGVIPTPLST  375
            L  L  LN++ N ++G +P+ L +
Sbjct  179  LRNLVYLNISKNILTGTVPSTLGS  202


 Score = 35.4 bits (80),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  I NL +L  LDL +N L G +PS +G+LT ++   L R
Sbjct  221  PQEIGNLKNLMELDLGTNSLIGPIPSTLGRLTNLNYMSLSR  261



>ref|XP_007021418.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12943.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=960

 Score = 50.1 bits (118),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = +1

Query  112  IWRVVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILT  291
             W  + EF    +  L  L+ L L++ + I G IP  +  LS    LDL+  Q+ S I  
Sbjct  122  FWCRIPEF----IGSLTELTYLALSNSRFI-GPIPSKLGNLSRLVTLDLSSNQLGSSIPE  176

Query  292  YIG*LNKLTILNLADNQISGVIPTPLST  375
            +IG L KLTILNL+++Q++G IP  L  
Sbjct  177  FIGSLTKLTILNLSESQLTGPIPFQLGN  204


 Score = 33.9 bits (76),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 20/41 (49%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  + NL  L  LDLSSN+  G +P   G L  M    L R
Sbjct  199  PFQLGNLSKLVSLDLSSNQFIGSIPETFGNLVAMRALTLSR  239


 Score = 37.0 bits (84),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRAL  470
            PH I  L +++ LDLS NKL+G LP  + K T M++ +
Sbjct  679  PHQICGLNNIQILDLSVNKLSGTLPRCLNKFTSMAQDM  716


 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (51%), Gaps = 1/67 (1%)
 Frame = +1

Query  160  DRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADN  339
            D L  L LA+   +SG IP  I +L    +L L     + P  + +G    L  L+ +DN
Sbjct  589  DSLKALNLAE-NNLSGSIPRSIGSLIRLQMLSLRSNSFSGPFPSSLGNCWGLKFLDFSDN  647

Query  340  QISGVIP  360
            ++SG IP
Sbjct  648  KLSGNIP  654



>emb|CBJ26389.1| LRR-GTPase of the ROCO family [Ectocarpus siliculosus]
Length=1168

 Score = 47.0 bits (110),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            L RL TL L D   ++G IP  +  LS    L L+  Q++ PI + +G L  L +LNL++
Sbjct  92   LSRLETLWLDD-NNLTGPIPSELGHLSALKKLYLSRNQLSGPISSELGKLTALVLLNLSN  150

Query  337  NQISGVIPTPL  369
            NQ+SG IP  L
Sbjct  151  NQLSGHIPRQL  161


 Score = 36.6 bits (83),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSR-ALLQRQWR*PVQAALHR  515
            P  + +LG+LK LDLS NKL G +P  +GKL  +    L + Q   P+   L R
Sbjct  158  PRQLGDLGALKTLDLSYNKLEGPIPPALGKLAALRELNLGENQLSGPIPVELGR  211



>emb|CBN80251.1| Putative leucine rich repeat protein [Ectocarpus siliculosus]
Length=770

 Score = 45.4 bits (106),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 1/72 (1%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            L  L  L L + K ++G IPP + ALS   +L L   ++T PI   +G L  L  LNL +
Sbjct  116  LSELQVLALHNNK-LTGRIPPELGALSELQVLALINNKLTGPIPPELGKLAALATLNLQN  174

Query  337  NQISGVIPTPLS  372
            NQ++G IP  L 
Sbjct  175  NQLTGPIPPELG  186


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 31/54 (57%), Gaps = 1/54 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSR-ALLQRQWR*PVQAALHR  515
            P  + NLG+L  LDL +NKL+G +P  +GKL  +   +L + Q   P+   L R
Sbjct  206  PPELGNLGALTALDLDANKLSGPIPPALGKLAALQDLSLYRNQLSGPIPVELGR  259


 Score = 41.2 bits (95),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +1

Query  154  KLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLA  333
            KL  L  LIL     +SG IPP +  L+    L L G Q++  I   +G L++L +L L 
Sbjct  67   KLTALEALILGR-NNLSGPIPPALGKLAALQTLYLEGNQLSGRIPPELGALSELQVLALH  125

Query  334  DNQISGVIPTPLST  375
            +N+++G IP  L  
Sbjct  126  NNKLTGRIPPELGA  139


 Score = 30.8 bits (68),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P  +  L +L  L+L +N+LTG +P  +GKLT +
Sbjct  158  PPELGKLAALATLNLQNNQLTGPIPPELGKLTAL  191



>emb|CDP09573.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 6/46 (13%)
 Frame = +3

Query  342  NLRCH------PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            N+R H      P S+ NL +L+ LDLSSN+LTGE+P NI  LT +S
Sbjct  75   NIRDHRDNGQIPSSVGNLKNLESLDLSSNQLTGEIPENISSLTFLS  120


 Score = 39.3 bits (90),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +1

Query  202  SGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIP  360
            +G IP  +  L N   LDL+  Q+T  I   I  L  L+ LNL+ NQ+ G IP
Sbjct  10   NGQIPSSVGNLKNLESLDLSSNQLTGEIPENISSLTFLSFLNLSHNQLVGRIP  62



>ref|XP_009780958.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Nicotiana sylvestris]
Length=1097

 Score = 45.1 bits (105),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VCKL  LS L L       G IPP I    N   LDL+G   T  +   IG L KL   N
Sbjct  481  VCKLRNLSALELGQ-NTFGGLIPPEIGNCQNLQRLDLSGNYFTHELPNEIGNLQKLVTFN  539

Query  328  LADNQISGVIP  360
            ++ N ++G +P
Sbjct  540  VSSNLLTGQVP  550


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 31/57 (54%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL-QRQWR*PVQAALHRRQR  524
            P  I+   +L+ LDLS N   G +P  IGKL  + R L+ + ++   + AAL R  R
Sbjct  550  PPKILKCKALQRLDLSKNSFCGTVPDEIGKLAQLERLLVSENKFYGKIPAALGRLSR  606



>ref|XP_010272486.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nelumbo nucifera]
Length=610

 Score = 49.7 bits (117),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query  106  RLIWRVVSEFSFTCVCKLDRLSTLILADWKA--ISGHIPPCITALSNFCILDLTGKQITS  279
            R ++   ++ + T   ++  LS L + +  +  I G IPP I+  S+  +LDLT  QI+ 
Sbjct  107  RFLYLQNNKLAGTLPDRIGALSRLQVVNISSNLIEGPIPPNISRCSDLMVLDLTSNQISG  166

Query  280  PILTYIG*LNKLTILNLADNQISGVIP  360
             I   +G L+ L ILNL  NQ+SG IP
Sbjct  167  GIPPELGALSNLQILNLNKNQLSGTIP  193


 Score = 33.5 bits (75),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSR  464
            P SI NL SL  L+L++N L G +PSN+G+L  + +
Sbjct  193  PPSIGNLSSLTTLNLATNSLGGLIPSNLGRLQNLKK  228


 Score = 50.8 bits (120),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  154  KLDRLSTLILADWKA--ISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
             + R S L++ D  +  ISG IPP + ALSN  IL+L   Q++  I   IG L+ LT LN
Sbjct  147  NISRCSDLMVLDLTSNQISGGIPPELGALSNLQILNLNKNQLSGTIPPSIGNLSSLTTLN  206

Query  328  LADNQISGVIPTPLSTWE  381
            LA N + G+IP+ L   +
Sbjct  207  LATNSLGGLIPSNLGRLQ  224


 Score = 29.3 bits (64),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIG  443
            P  + N+ SL    L+SN+L G++PS+ G
Sbjct  241  PQPLYNISSLVFFALASNRLWGKIPSDFG  269



>ref|NP_001068106.2| Os11g0565000 [Oryza sativa Japonica Group]
 gb|ABA94376.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ18761.1| hypothetical protein OsJ_34287 [Oryza sativa Japonica Group]
 dbj|BAH00967.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28469.2| Os11g0565000 [Oryza sativa Japonica Group]
Length=949

 Score = 42.4 bits (98),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 0/75 (0%)
 Frame = +1

Query  151  CKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNL  330
            C L    +   A   + SG+ P  +   +    LDL+  + +  + T+IG  NKL  L L
Sbjct  592  CSLMSRVSFFRASNNSFSGNFPSFLQGWTKLSFLDLSWNKFSGTLPTWIGNFNKLEFLQL  651

Query  331  ADNQISGVIPTPLST  375
              N  SG IP  ++ 
Sbjct  652  KHNMFSGSIPDSITN  666


 Score = 40.4 bits (93),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P SI NLG L HLDL+SN L+G LP ++  LT M
Sbjct  661  PDSITNLGKLSHLDLASNGLSGPLPQHLSNLTGM  694



>ref|XP_003568841.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g26540 [Brachypodium distachyon]
Length=932

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query  154  KLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLA  333
            +L RLS L+L +   +SG +PP I   ++      +G  I   I   IG L  L+ L+LA
Sbjct  241  RLPRLSKLLLIN-NGLSGQLPPEIGNCTSLDRFRASGNHIAGAIPAEIGMLTSLSFLDLA  299

Query  334  DNQISGVIPTPLS  372
             N++SG +P+ +S
Sbjct  300  SNRLSGALPSEIS  312


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  381  SLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            SL++LDLS N +TG LPS+IGKLT +++ +L
Sbjct  341  SLQYLDLSYNVITGALPSDIGKLTSLTKLVL  371



>ref|XP_006399210.1| hypothetical protein EUTSA_v10012465mg [Eutrema salsugineum]
 gb|ESQ40663.1| hypothetical protein EUTSA_v10012465mg [Eutrema salsugineum]
Length=1266

 Score = 42.7 bits (99),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  199  ISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPT  363
            +SG IP  ++ L+N   L+L+G  +T  I   +G   KL  LNLA+NQ++G IP 
Sbjct  640  LSGQIPASLSRLTNLTKLELSGNVLTGSIPEEMGHSPKLQGLNLANNQLNGHIPE  694


 Score = 39.7 bits (91),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGK-LTMMSRALLQRQWR*PVQAAL  509
            P S+ NL  L H+DLS NKL+GELPS + + L ++   + Q  +  P++  L
Sbjct  717  PSSLGNLKELTHMDLSFNKLSGELPSELSQMLNLVGLYIQQNMFSGPIEDLL  768



>ref|XP_009387278.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=854

 Score = 50.4 bits (119),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +1

Query  190  WKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPL  369
            +  + G IP  I+ALS    LDLT  Q TS I   +G + +L  L+L+ NQ+ G IP  L
Sbjct  112  YNQLGGAIPSAISALSRLVFLDLTSNQFTSKIPVGMGSMKELRFLSLSQNQMVGAIPPSL  171

Query  370  STW  378
            S +
Sbjct  172  SNF  174


 Score = 32.0 bits (71),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P  +  L  L++LD+  N+L+G +PS++G LT +
Sbjct  192  PKELGRLQELRYLDIGVNRLSGSIPSSLGNLTRL  225



>emb|CDP06297.1| unnamed protein product [Coffea canephora]
Length=430

 Score = 49.3 bits (116),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL TL  + + A++G +P  ++ LSN  +L+L    +   I   +  L KL++LN
Sbjct  164  IGRLSRLRTLDFS-YNALNGSLPAALSNLSNLVVLNLESNHLDHQIPAAVNKLQKLSVLN  222

Query  328  LADNQISGVIPT  363
            L +NQ +G IP 
Sbjct  223  LRNNQFAGPIPA  234


 Score = 33.5 bits (75),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P  + N+  L  +DLS NK +GE+P++IG L  +S
Sbjct  233  PAIVGNISFLTQVDLSQNKFSGEIPASIGDLPNLS  267



>ref|XP_007046768.1| Leucine-rich repeat receptor-like protein kinase family protein 
[Theobroma cacao]
 gb|EOX90925.1| Leucine-rich repeat receptor-like protein kinase family protein 
[Theobroma cacao]
Length=645

 Score = 43.1 bits (100),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  199  ISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPLS  372
            +SG +P  I  L N   LDL+  QIT  I   IG L+ L +L L  NQI+G IP+ +S
Sbjct  221  LSGSLPTTIGKLKNLKSLDLSENQITGSIPKTIGGLSALELLYLNQNQITGCIPSSIS  278


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +3

Query  351  CHPHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            C P SI  L SL+   +S NKLTG LP +IG+L  + R +LQ
Sbjct  272  CIPSSISGLISLQFCRISENKLTGSLPPSIGELPNIQRLILQ  313


 Score = 43.9 bits (102),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            L  L  L L++ K + G +PP +  LS+  +L L   Q+T  I       ++L  L L++
Sbjct  110  LSFLQVLDLSNLKNLKGPMPPELGKLSHLTLLFLDSNQLTGSIPVTFKHFSRLEKLYLSN  169

Query  337  NQISGVIPTPL  369
            N+ISGVIP+P+
Sbjct  170  NKISGVIPSPV  180


 Score = 30.4 bits (67),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P +I  L  L  LD+  NKL+G LP+ IGKL
Sbjct  202  PATIGKLVLLAKLDIHGNKLSGSLPTTIGKL  232



>gb|KHM99087.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=983

 Score = 50.8 bits (120),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L  L +LIL  W  +SG IPP I  LSN   +DLT   I+  I T I  L  L +L 
Sbjct  137  IGELQNLKSLIL-QWNQLSGTIPPTIGRLSNLVRVDLTENSISGTIPTSITNLTNLELLQ  195

Query  328  LADNQISGVIPT  363
             ++N++SG IP+
Sbjct  196  FSNNRLSGSIPS  207


 Score = 31.6 bits (70),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P SI +L +L   ++  N+++G +PSNIG LT +
Sbjct  206  PSSIGDLVNLTVFEIDDNRISGSIPSNIGNLTKL  239


 Score = 39.7 bits (91),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL  LS L L ++  +SG IP  I  L N   L L   Q++  I   IG L+ L  ++
Sbjct  113  MMKLASLSILNL-EYNKLSGSIPEEIGELQNLKSLILQWNQLSGTIPPTIGRLSNLVRVD  171

Query  328  LADNQISGVIPTPLST  375
            L +N ISG IPT ++ 
Sbjct  172  LTENSISGTIPTSITN  187


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI NL +L+ L  S+N+L+G +PS+IG L  ++
Sbjct  182  PTSITNLTNLELLQFSNNRLSGSIPSSIGDLVNLT  216



>ref|XP_008669002.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Zea mays]
 tpg|DAA36373.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1159

 Score = 46.2 bits (108),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +1

Query  184  ADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPT  363
            A    ISG +PP +   SN  +L+L+G Q+T  I + +  L +L  L+L+ NQ SG IP 
Sbjct  593  ASHNHISGELPPELANCSNLTVLELSGNQLTGSIPSDLSRLGELEELDLSYNQFSGKIPP  652

Query  364  PLST  375
             +S 
Sbjct  653  EISN  656


 Score = 35.8 bits (81),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P SI NL  L+ LDLSSN LTG +P+++ ++
Sbjct  675  PASIANLSKLQTLDLSSNNLTGSIPASLAQI  705



>emb|CAN79070.1| hypothetical protein VITISV_031965 [Vitis vinifera]
Length=661

 Score = 48.1 bits (113),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + + +L +L+ L L   K I G IP  I +L+    LDL+  Q+T PIL  IG L +LT 
Sbjct  233  SSLGRLTKLTHLDLYCNKLI-GSIPHQIGSLTKLTHLDLSSNQLTGPILNQIGTLIELTY  291

Query  322  LNLADNQISGVIPTPL  369
            L  + N+++GVIP+ L
Sbjct  292  LEFSGNELTGVIPSSL  307


 Score = 33.9 bits (76),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLT-MMSRALLQRQ  482
            PH I  L  L +L +S N+LTG +PS++G LT ++S  L + Q
Sbjct  328  PHQIGTLTELTYLHISGNELTGAMPSSLGCLTKLISLDLCKNQ  370


 Score = 45.4 bits (106),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  196  AISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPLST  375
             ++G I   I +L+   ILDL+  Q+T PI   IG L KLT L+L+ NQ++G IP  + T
Sbjct  106  GLNGSISDQIGSLTKLTILDLSHNQLTDPIPHQIGSLTKLTHLDLSFNQLTGPIPHQIGT  165


 Score = 35.8 bits (81),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  L  L HLDLS N+LTG +P  IG LT ++
Sbjct  184  PSSLGRLTKLTHLDLSFNQLTGPIPHQIGTLTELT  218


 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  211  IPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPL  369
            IP  I +L+    LDL+  Q+T PI   IG L +LT LNL+ N ++ VIP+ L
Sbjct  135  IPHQIGSLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLNLSSNVLTDVIPSSL  187


 Score = 33.9 bits (76),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            PH I  L  L +L LSSN LT  +PS++G+LT ++
Sbjct  208  PHQIGTLTELTYLPLSSNVLTDVIPSSLGRLTKLT  242


 Score = 37.4 bits (85),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  211  IPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPL  369
            IP  +  L+    LDL+  Q+T PI   IG L +LT L L+ N ++ VIP+ L
Sbjct  183  IPSSLGRLTKLTHLDLSFNQLTGPIPHQIGTLTELTYLPLSSNVLTDVIPSSL  235


 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            PH I +L  L HLDLSSN+LTG + + IG L  ++
Sbjct  256  PHQIGSLTKLTHLDLSSNQLTGPILNQIGTLIELT  290


 Score = 37.4 bits (85),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +  L +L+ L L+ +  ++G IP  I  L+    L+L+   +T  I + +G L KLT L+
Sbjct  139  IGSLTKLTHLDLS-FNQLTGPIPHQIGTLTELTYLNLSSNVLTDVIPSSLGRLTKLTHLD  197

Query  328  LADNQISGVIPTPLST  375
            L+ NQ++G IP  + T
Sbjct  198  LSFNQLTGPIPHQIGT  213


 Score = 34.3 bits (77),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P S+  L  L HLDL  NKL G +P  IG LT ++
Sbjct  232  PSSLGRLTKLTHLDLYCNKLIGSIPHQIGSLTKLT  266



>ref|XP_006404790.1| hypothetical protein EUTSA_v10000033mg [Eutrema salsugineum]
 gb|ESQ46243.1| hypothetical protein EUTSA_v10000033mg [Eutrema salsugineum]
Length=956

 Score = 42.7 bits (99),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + +  L +L++L L      SG IP  I  L     LDL+  Q +  I + IG L++LT 
Sbjct  220  SSIGNLSQLTSLNLYS-NQFSGQIPSSIGNLPLLTSLDLSSNQFSGQIPSSIGNLSQLTS  278

Query  322  LNLADNQISGVIPT  363
            L L+ NQ SG IP+
Sbjct  279  LYLSSNQFSGQIPS  292


 Score = 39.7 bits (91),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P SI NL  L  LDLSSN+ +G++PS+I KL+ +    L+R
Sbjct  291  PSSIGNLSFLTSLDLSSNQFSGQIPSSIKKLSHLKTLFLRR  331


 Score = 37.4 bits (85),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P SI NL  L  LDLSSN+ +G++PS+IG L+ ++   L
Sbjct  243  PSSIGNLPLLTSLDLSSNQFSGQIPSSIGNLSQLTSLYL  281


 Score = 35.4 bits (80),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +1

Query  190  WKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPT  363
            +   SG IP  I  LS    LDL+  Q +  I + IG L++LT LNL  NQ SG IP+
Sbjct  187  FNQFSGQIPSSIGNLSLLTSLDLSLNQFSGQIPSSIGNLSQLTSLNLYSNQFSGQIPS  244



>ref|XP_002457354.1| hypothetical protein SORBIDRAFT_03g005920 [Sorghum bicolor]
 gb|EES02474.1| hypothetical protein SORBIDRAFT_03g005920 [Sorghum bicolor]
Length=972

 Score = 42.0 bits (97),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 44/89 (49%), Gaps = 5/89 (6%)
 Frame = +1

Query  103  QRLIWRVVSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSP  282
             RL  R+  E  +    +L  L  L L +  + +G IP  +  +S+ C LDL   ++   
Sbjct  162  NRLHGRIPVELGY----RLKSLQWLSLEN-NSFTGAIPVSVANISSLCCLDLGSNKLEGQ  216

Query  283  ILTYIG*LNKLTILNLADNQISGVIPTPL  369
            I    G +  L +L+L DN ISGV+P  L
Sbjct  217  IPPEFGSMEGLKLLSLFDNNISGVLPHSL  245


 Score = 40.0 bits (92),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIG  443
            PHS+ NL  LKH+DLS N L+G +P+++G
Sbjct  242  PHSLYNLSMLKHMDLSKNMLSGSIPADVG  270



>ref|WP_030001877.1| hypothetical protein, partial [Marinimicrobia bacterium SCGC 
AAA003-E22]
Length=751

 Score = 43.9 bits (102),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L  L++L+L  +  ++G IP  I  L+N   L L   Q+T  I + IG L  LT L+
Sbjct  389  IGQLTNLTSLVLP-YNQLTGEIPSEIGNLTNLISLHLQDNQLTGEIPSEIGQLTNLTHLS  447

Query  328  LADNQISGVIPTPLSTWE  381
            L  NQ++G IP+ +  WE
Sbjct  448  LHYNQLTGEIPSEI--WE  463


 Score = 38.1 bits (87),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P  I NL SL +L LSSN+L GE+PS I +LT ++   L
Sbjct  482  PSEIGNLDSLTYLYLSSNELIGEIPSEIWELTNLTELYL  520


 Score = 43.5 bits (101),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T +  L  L++L L  +  ++G IP  I  L+N   L L   Q+   I   IG L  LTI
Sbjct  531  TEIENLINLTSLSLR-FTLLTGEIPSEIGQLTNLTYLWLDNNQLIGEIPVEIGNLTNLTI  589

Query  322  LNLADNQISGVIPTPLS  372
            L L+ NQ+SG IPT +S
Sbjct  590  LELSGNQLSGEIPTEIS  606


 Score = 32.0 bits (71),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIG  443
            P  I NL +L+ L+L  N+LTGE+PS IG
Sbjct  626  PSEIGNLINLEKLELHHNQLTGEIPSEIG  654


 Score = 39.7 bits (91),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +1

Query  190  WKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPL  369
            +  ++G IP  I  L+N   L L   Q+T  I + IG L  L  L+L DNQ++G IP+ +
Sbjct  378  YNQLTGEIPSEIGQLTNLTSLVLPYNQLTGEIPSEIGNLTNLISLHLQDNQLTGEIPSEI  437


 Score = 35.0 bits (79),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P  I  L +L HL L  N+LTGE+PS I +LT ++   L
Sbjct  434  PSEIGQLTNLTHLSLHYNQLTGEIPSEIWELTNLTSLFL  472


 Score = 37.0 bits (84),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +1

Query  193  KAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPL  369
              ++G IPP I  L N   + L   Q++  I   I  L  LT LNL  NQ+SG IP+ +
Sbjct  7    SGLTGEIPPQIGDLVNLTSVRLYDNQLSGQIPIEIFNLTNLTRLNLHTNQLSGEIPSEI  65


 Score = 36.2 bits (82),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSR-ALLQRQW  485
            P  +  L SL  + +SSN+LTGE+PS IG L+ +S  ++ Q Q+
Sbjct  86   PIELWGLNSLTTISISSNQLTGEIPSEIGNLSNLSYLSIFQNQF  129


 Score = 40.0 bits (92),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 3/78 (4%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L  L+ L L  +  ++G IP  I  L+N   L L   Q+T  I + IG L+ LT L 
Sbjct  437  IGQLTNLTHLSLH-YNQLTGEIPSEIWELTNLTSLFLYSNQLTGEIPSEIGNLDSLTYLY  495

Query  328  LADNQISGVIPTPLSTWE  381
            L+ N++ G IP+ +  WE
Sbjct  496  LSSNELIGEIPSEI--WE  511


 Score = 31.6 bits (70),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  I NL +L  L L    LTGE+PS IG+LT ++   L  
Sbjct  530  PTEIENLINLTSLSLRFTLLTGEIPSEIGQLTNLTYLWLDN  570



>ref|XP_002267269.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=643

 Score = 44.7 bits (104),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = +1

Query  127  SEFSFTCVCKLDRLSTLILADWKA--ISGHIPPCITALSNFCILDLTGKQITSPILTYIG  300
            ++FS +    + +L  L   D     ISG IPP I  L +   LDL+   IT  + + +G
Sbjct  193  NQFSGSVPSSIGKLVLLTKLDVHGNRISGSIPPGIGKLKSLKYLDLSENGITGSLPSSLG  252

Query  301  *LNKLTILNLADNQISGVIPTPLS  372
             L++L +L L  NQI+G IP+ +S
Sbjct  253  GLSELVLLYLNHNQITGSIPSSIS  276


 Score = 37.4 bits (85),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQ  476
            P SI  L SL+   LS N +TG LP++IGKL+ + R +L+
Sbjct  272  PSSISGLSSLQFCRLSENGITGGLPASIGKLSKIQRLILE  311



>emb|CDP11438.1| unnamed protein product [Coffea canephora]
Length=902

 Score = 47.4 bits (111),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +1

Query  196  AISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLADNQISGVIPTPLST  375
             +SG IPP I  L     L L G ++T PI T +G L  LT+L+L  NQ+SG IP  L  
Sbjct  262  GLSGSIPPEIGKLKKLQSLSLWGNKLTGPIPTSLGNLRDLTLLHLYRNQLSGSIPEELGN  321


 Score = 34.7 bits (78),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL  473
            P    NL +L  LDLSSN++ GE+P  +GKL  +   LL
Sbjct  342  PPEFGNLPNLGALDLSSNQIAGEIPKELGKLKSIQWLLL  380



>gb|EAY77539.1| hypothetical protein OsI_32579 [Oryza sativa Indica Group]
Length=1098

 Score = 44.3 bits (103),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L L+ +  ++GHIP  +  L+    L +    ++ PI   IG L  L +L 
Sbjct  130  ISELQRLTMLDLS-YNNLTGHIPASVGNLTMITELSIHQNMVSGPIPKEIGMLANLQLLQ  188

Query  328  LADNQISGVIPTPLST  375
            L++N +SG IPT L+ 
Sbjct  189  LSNNTLSGEIPTTLAN  204


 Score = 37.7 bits (86),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  +  L +L++L L  NKLTGE+P+ IG LT M +  L R
Sbjct  223  PPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFR  263


 Score = 44.3 bits (103),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 38/75 (51%), Gaps = 1/75 (1%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            +  L  LIL     ISG IP  +  L+    LDL+  QI   I    G L  L +L+L +
Sbjct  325  ISNLQNLILHS-NQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEE  383

Query  337  NQISGVIPTPLSTWE  381
            NQISG IP  L  ++
Sbjct  384  NQISGSIPKSLGNFQ  398


 Score = 31.6 bits (70),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNI  440
            P    N+ ++  LDL+SN L+G+LP+NI
Sbjct  415  PQEFGNITNMVELDLASNSLSGQLPANI  442


 Score = 40.4 bits (93),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 37/73 (51%), Gaps = 1/73 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T +  L  L T  L D   +SG +PP +  L+N   L L   ++T  I T IG L K+  
Sbjct  200  TTLANLTNLDTFYL-DGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIK  258

Query  322  LNLADNQISGVIP  360
            L L  NQI G IP
Sbjct  259  LYLFRNQIIGSIP  271


 Score = 33.9 bits (76),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  I NL  L  L L+ NKL G LP+ +G LTM++   L  
Sbjct  271  PPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHE  311



>ref|XP_010023353.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X2 [Eucalyptus grandis]
Length=1000

 Score = 47.4 bits (111),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L  L+ + +++     G +P CIT L +   L + G  +T PI + +G    LT LN
Sbjct  491  ICQLSNLTVVDVSN-NQFGGGLPTCITNLGSLQKLKMQGNLLTGPIPSSVGPWADLTELN  549

Query  328  LADNQISGVIPTPL  369
            L++N+++G IP  L
Sbjct  550  LSNNRLTGSIPAQL  563


 Score = 34.7 bits (78),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTM  455
            P  + +L  L++LDLS N L+GE+P  + KLT+
Sbjct  560  PAQLGDLPVLRYLDLSGNSLSGEIPRELAKLTL  592



>gb|AAL31654.1|AC079179_9 Putative protein kinase [Oryza sativa]
 gb|AAM08708.1|AC116601_1 Putative protein kinase [Oryza sativa Japonica Group]
 gb|AAP51897.1| Leucine Rich Repeat family protein [Oryza sativa Japonica Group]
 gb|EAZ15139.1| hypothetical protein OsJ_30556 [Oryza sativa Japonica Group]
Length=1098

 Score = 44.3 bits (103),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L L+ +  ++GHIP  +  L+    L +    ++ PI   IG L  L +L 
Sbjct  130  ISELQRLTMLDLS-YNNLTGHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQ  188

Query  328  LADNQISGVIPTPLST  375
            L++N +SG IPT L+ 
Sbjct  189  LSNNTLSGEIPTTLAN  204


 Score = 37.7 bits (86),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  +  L +L++L L  NKLTGE+P+ IG LT M +  L R
Sbjct  223  PPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFR  263


 Score = 44.3 bits (103),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 38/75 (51%), Gaps = 1/75 (1%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            +  L  LIL     ISG IP  +  L+    LDL+  QI   I    G L  L +L+L +
Sbjct  325  ISNLQNLILHS-NQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEE  383

Query  337  NQISGVIPTPLSTWE  381
            NQISG IP  L  ++
Sbjct  384  NQISGSIPKSLGNFQ  398


 Score = 31.6 bits (70),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNI  440
            P    N+ ++  LDL+SN L+G+LP+NI
Sbjct  415  PQEFGNITNMVELDLASNSLSGQLPANI  442


 Score = 40.4 bits (93),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 37/73 (51%), Gaps = 1/73 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T +  L  L T  L D   +SG +PP +  L+N   L L   ++T  I T IG L K+  
Sbjct  200  TTLANLTNLDTFYL-DGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIK  258

Query  322  LNLADNQISGVIP  360
            L L  NQI G IP
Sbjct  259  LYLFRNQIIGSIP  271


 Score = 33.9 bits (76),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  I NL  L  L L+ NKL G LP+ +G LTM++   L  
Sbjct  271  PPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHE  311



>ref|XP_010023354.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 isoform X3 [Eucalyptus grandis]
 gb|KCW59610.1| hypothetical protein EUGRSUZ_H02353 [Eucalyptus grandis]
Length=999

 Score = 47.4 bits (111),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L  L+ + +++     G +P CIT L +   L + G  +T PI + +G    LT LN
Sbjct  491  ICQLSNLTVVDVSN-NQFGGGLPTCITNLGSLQKLKMQGNLLTGPIPSSVGPWADLTELN  549

Query  328  LADNQISGVIPTPL  369
            L++N+++G IP  L
Sbjct  550  LSNNRLTGSIPAQL  563


 Score = 34.7 bits (78),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTM  455
            P  + +L  L++LDLS N L+GE+P  + KLT+
Sbjct  560  PAQLGDLPVLRYLDLSGNSLSGEIPRELAKLTL  592



>ref|XP_002460722.1| hypothetical protein SORBIDRAFT_02g033810 [Sorghum bicolor]
 gb|EER97243.1| hypothetical protein SORBIDRAFT_02g033810 [Sorghum bicolor]
Length=1255

 Score = 48.1 bits (113),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 0/72 (0%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            L  L  L L D   +SG IP  +  L N  +L L    +T PI   +G L+ LT LNL  
Sbjct  143  LSALQVLRLGDNPGLSGAIPDALGKLGNLTVLGLASCNLTGPIPASLGRLDALTALNLQQ  202

Query  337  NQISGVIPTPLS  372
            N +SG IP  L+
Sbjct  203  NALSGPIPRGLA  214


 Score = 33.5 bits (75),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSR  464
            P  +  L SL+ L L+ N+LTG +P  +G+LT + +
Sbjct  210  PRGLAGLASLQVLSLAGNQLTGAIPPELGRLTGLQK  245


 Score = 43.9 bits (102),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +1

Query  154  KLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLA  333
            +LD L+ L L    A+SG IP  +  L++  +L L G Q+T  I   +G L  L  LNL 
Sbjct  191  RLDALTALNLQQ-NALSGPIPRGLAGLASLQVLSLAGNQLTGAIPPELGRLTGLQKLNLG  249

Query  334  DNQISGVIPTPL  369
            +N + G IP  L
Sbjct  250  NNSLVGTIPPEL  261


 Score = 30.8 bits (68),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P ++  L  ++ +DLS N L+G LP+ +G+L
Sbjct  282  PRTLAALSRVRTIDLSGNMLSGALPAKLGRL  312



>ref|NP_001064062.2| Os10g0119200 [Oryza sativa Japonica Group]
 dbj|BAF25976.2| Os10g0119200 [Oryza sativa Japonica Group]
Length=1092

 Score = 44.3 bits (103),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +L RL+ L L+ +  ++GHIP  +  L+    L +    ++ PI   IG L  L +L 
Sbjct  130  ISELQRLTMLDLS-YNNLTGHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQ  188

Query  328  LADNQISGVIPTPLST  375
            L++N +SG IPT L+ 
Sbjct  189  LSNNTLSGEIPTTLAN  204


 Score = 37.7 bits (86),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  +  L +L++L L  NKLTGE+P+ IG LT M +  L R
Sbjct  223  PPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIKLYLFR  263


 Score = 44.3 bits (103),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 38/75 (51%), Gaps = 1/75 (1%)
 Frame = +1

Query  157  LDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLAD  336
            +  L  LIL     ISG IP  +  L+    LDL+  QI   I    G L  L +L+L +
Sbjct  325  ISNLQNLILHS-NQISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEE  383

Query  337  NQISGVIPTPLSTWE  381
            NQISG IP  L  ++
Sbjct  384  NQISGSIPKSLGNFQ  398


 Score = 31.6 bits (70),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNI  440
            P    N+ ++  LDL+SN L+G+LP+NI
Sbjct  415  PQEFGNITNMVELDLASNSLSGQLPANI  442


 Score = 40.0 bits (92),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 37/73 (51%), Gaps = 1/73 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            T +  L  L T  L D   +SG +PP +  L+N   L L   ++T  I T IG L K+  
Sbjct  200  TTLANLTNLDTFYL-DGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMIK  258

Query  322  LNLADNQISGVIP  360
            L L  NQI G IP
Sbjct  259  LYLFRNQIIGSIP  271


 Score = 33.9 bits (76),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P  I NL  L  L L+ NKL G LP+ +G LTM++   L  
Sbjct  271  PPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHE  311



>ref|XP_008778616.1| PREDICTED: receptor-like protein kinase 5 [Phoenix dactylifera]
Length=731

 Score = 55.8 bits (133),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 4/80 (5%)
 Frame = +1

Query  136  SFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKL  315
            S T + +L RLS      W  ISG IPP I+ L     L+L+  Q+T  I   IG L  L
Sbjct  199  SMTGLSQLQRLSL----GWNEISGEIPPAISTLKALTALNLSHNQLTGEIPASIGSLPVL  254

Query  316  TILNLADNQISGVIPTPLST  375
              L+L+ NQ+SGVIPT +  
Sbjct  255  DTLDLSANQLSGVIPTAIGN  274


 Score = 25.8 bits (55),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELP  431
            P +I NL  L  L+LSSN+L+GE+P
Sbjct  269  PTAIGNL-RLNALNLSSNQLSGEIP  292



>gb|KCW59611.1| hypothetical protein EUGRSUZ_H02353 [Eucalyptus grandis]
Length=906

 Score = 47.0 bits (110),  Expect(2) = 5e-07, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C+L  L+ + +++     G +P CIT L +   L + G  +T PI + +G    LT LN
Sbjct  491  ICQLSNLTVVDVSN-NQFGGGLPTCITNLGSLQKLKMQGNLLTGPIPSSVGPWADLTELN  549

Query  328  LADNQISGVIPTPL  369
            L++N+++G IP  L
Sbjct  550  LSNNRLTGSIPAQL  563


 Score = 34.7 bits (78),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTM  455
            P  + +L  L++LDLS N L+GE+P  + KLT+
Sbjct  560  PAQLGDLPVLRYLDLSGNSLSGEIPRELAKLTL  592



>ref|XP_006428844.1| hypothetical protein CICLE_v10011222mg [Citrus clementina]
 gb|ESR42084.1| hypothetical protein CICLE_v10011222mg [Citrus clementina]
Length=672

 Score = 48.5 bits (114),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +  L  L++L L   K ++GHIP  +  L++  ILDL+  Q+ S I   IG  + L+ L+
Sbjct  289  IVNLKNLTSLSLGGNK-LTGHIPSTLGRLTSLQILDLSSNQLHSSIPLVIGNFSALSYLD  347

Query  328  LADNQISGVIPTPLS  372
            L+DN+I G+IP  L+
Sbjct  348  LSDNRICGIIPDELT  362


 Score = 33.1 bits (74),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P  +  L  LK+L+LSSN L+G++P  IGKL
Sbjct  358  PDELTKLSHLKYLNLSSNLLSGQIPFAIGKL  388



>ref|XP_006428843.1| hypothetical protein CICLE_v10011222mg [Citrus clementina]
 gb|ESR42083.1| hypothetical protein CICLE_v10011222mg [Citrus clementina]
Length=679

 Score = 48.5 bits (114),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +  L  L++L L   K ++GHIP  +  L++  ILDL+  Q+ S I   IG  + L+ L+
Sbjct  296  IVNLKNLTSLSLGGNK-LTGHIPSTLGRLTSLQILDLSSNQLHSSIPLVIGNFSALSYLD  354

Query  328  LADNQISGVIPTPLS  372
            L+DN+I G+IP  L+
Sbjct  355  LSDNRICGIIPDELT  369


 Score = 33.1 bits (74),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P  +  L  LK+L+LSSN L+G++P  IGKL
Sbjct  365  PDELTKLSHLKYLNLSSNLLSGQIPFAIGKL  395



>gb|KDO48083.1| hypothetical protein CISIN_1g0097712mg, partial [Citrus sinensis]
Length=434

 Score = 48.5 bits (114),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +  L  L++L L   K ++GHIP  +  L++  ILDL+  Q+ S I   IG  + L+ L+
Sbjct  296  IVNLKNLTSLSLGGNK-LTGHIPSTLGRLTSLQILDLSSNQLHSSIPLVIGNFSALSYLD  354

Query  328  LADNQISGVIPTPLS  372
            L+DN+I G+IP  L+
Sbjct  355  LSDNRICGIIPDELT  369


 Score = 32.7 bits (73),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P  +  L  LK+L+LSSN L+G++P  IGKL
Sbjct  365  PDELTKLSHLKYLNLSSNLLSGQIPFAIGKL  395


 Score = 37.4 bits (85),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 38/84 (45%), Gaps = 4/84 (5%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            +   +F+C   L  L          +SG IP  I +LSN   + L    +T  I   IG 
Sbjct  92   LGRLNFSCFPNLQYLD----LGSNNLSGSIPSQIDSLSNLTYIYLYENNLTGTIPKEIGS  147

Query  304  LNKLTILNLADNQISGVIPTPLST  375
            L  L +L+L  N ++G IP  + +
Sbjct  148  LRNLEVLDLGSNNLNGTIPIEIGS  171


 Score = 33.1 bits (74),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P  I +L +L+ LDLSSNKL+G +P  IG L
Sbjct  197  PIEIESLRNLQWLDLSSNKLSGTIPKEIGSL  227



>ref|XP_009373339.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460 [Pyrus x bretschneideri]
Length=885

 Score = 48.9 bits (115),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            TC  +++ L     A W  + G +PP IT   +  +LDL   +++  I   +G L+ L +
Sbjct  287  TCSERMEYLD----ASWNELDGEVPPSITNCRSLKVLDLGYNRLSGSIPEVLGNLDTLVV  342

Query  322  LNLADNQISGVIPTPLST  375
            + L++N ISG IP  L++
Sbjct  343  IELSNNSISGTIPESLAS  360


 Score = 32.3 bits (72),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            PH I N   L+ LD+S N L GE+P  +  +T +
Sbjct  379  PHDIRNCMFLRELDVSGNALEGEIPQGLYNMTYL  412



>ref|XP_009599479.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Nicotiana tomentosiformis]
Length=1097

 Score = 42.7 bits (99),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 34/71 (48%), Gaps = 1/71 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            VCKL  LS L L         IPP I    N   LDL+G   T  +   IG L KL   N
Sbjct  481  VCKLRNLSALELGQ-NTFGSLIPPEIGNCQNLQRLDLSGNYFTHELPNEIGNLQKLVTFN  539

Query  328  LADNQISGVIP  360
            ++ N ++G +P
Sbjct  540  VSSNLLTGQVP  550


 Score = 38.9 bits (89),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 31/57 (54%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALL-QRQWR*PVQAALHRRQR  524
            P  I+   +L+ LDLS N   G +P  IGKL  + R L+ + ++   + AAL R  R
Sbjct  550  PRKILQCKALQRLDLSKNSFIGAIPDEIGKLAQLERLLVSENKFSGKLPAALGRLSR  606



>ref|NP_001235554.1| receptor protein kinase-like protein [Glycine max]
 gb|ACM89602.1| receptor protein kinase-like protein [Glycine max]
Length=983

 Score = 50.1 bits (118),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + +   L +LIL  W  +SG IPP I  LSN   +DLT   I+  I T I  L  L +L 
Sbjct  137  IGEFQNLKSLIL-QWNQLSGTIPPTIGRLSNLVRVDLTENSISGTIPTSITNLTNLELLQ  195

Query  328  LADNQISGVIPT  363
             ++N++SG IP+
Sbjct  196  FSNNRLSGSIPS  207


 Score = 31.6 bits (70),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P SI +L +L   ++  N+++G +PSNIG LT +
Sbjct  206  PSSIGDLVNLTVFEIDDNRISGSIPSNIGNLTKL  239


 Score = 38.5 bits (88),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            + KL  LS L L ++  +SG IP  I    N   L L   Q++  I   IG L+ L  ++
Sbjct  113  MMKLASLSILNL-EYNKLSGSIPEEIGEFQNLKSLILQWNQLSGTIPPTIGRLSNLVRVD  171

Query  328  LADNQISGVIPTPLST  375
            L +N ISG IPT ++ 
Sbjct  172  LTENSISGTIPTSITN  187


 Score = 33.9 bits (76),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P SI NL +L+ L  S+N+L+G +PS+IG L  ++
Sbjct  182  PTSITNLTNLELLQFSNNRLSGSIPSSIGDLVNLT  216



>gb|KCW56526.1| hypothetical protein EUGRSUZ_I02251 [Eucalyptus grandis]
Length=790

 Score = 46.2 bits (108),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +C L RL+ L L++  +++G +PPC+  L +  +L +   QI+  I   +G L +LT L 
Sbjct  106  ICTLSRLTYLDLSN-NSLAGKLPPCVQNLISLEVLRIDHNQISGSIPPKLGNLERLTNLY  164

Query  328  LADNQISGVIP  360
            L  N +SGV+P
Sbjct  165  LQFNALSGVVP  175


 Score = 35.0 bits (79),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 0/42 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQRQ  482
            P  + NL  L  +DLS N   G +PS IG LT ++R  LQ  
Sbjct  199  PLELENLTKLNVVDLSCNNFIGPIPSFIGNLTSLTRLYLQEN  240



>gb|KDO48084.1| hypothetical protein CISIN_1g0097712mg, partial [Citrus sinensis]
Length=427

 Score = 48.5 bits (114),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  148  VCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILN  327
            +  L  L++L L   K ++GHIP  +  L++  ILDL+  Q+ S I   IG  + L+ L+
Sbjct  289  IVNLKNLTSLSLGGNK-LTGHIPSTLGRLTSLQILDLSSNQLHSSIPLVIGNFSALSYLD  347

Query  328  LADNQISGVIPTPLS  372
            L+DN+I G+IP  L+
Sbjct  348  LSDNRICGIIPDELT  362


 Score = 32.7 bits (73),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P  +  L  LK+L+LSSN L+G++P  IGKL
Sbjct  358  PDELTKLSHLKYLNLSSNLLSGQIPFAIGKL  388


 Score = 37.4 bits (85),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 38/84 (45%), Gaps = 4/84 (5%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*  303
            +   +F+C   L  L          +SG IP  I +LSN   + L    +T  I   IG 
Sbjct  92   LGRLNFSCFPNLQYLD----LGSNNLSGSIPSQIDSLSNLTYIYLYENNLTGTIPKEIGS  147

Query  304  LNKLTILNLADNQISGVIPTPLST  375
            L  L +L+L  N ++G IP  + +
Sbjct  148  LRNLEVLDLGSNNLNGTIPIEIGS  171


 Score = 33.1 bits (74),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKL  449
            P  I +L +L+ LDLSSNKL+G +P  IG L
Sbjct  190  PIEIESLRNLQWLDLSSNKLSGTIPKEIGSL  220



>ref|XP_009387282.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=261

 Score = 49.7 bits (117),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (51%), Gaps = 4/81 (5%)
 Frame = +1

Query  133  FSFTCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNK  312
              F+ +  L RL+      +  + G IPP I+ALS    LD T  Q  S I   IG + +
Sbjct  97   LDFSALGSLLRLNL----SYNQLGGAIPPTISALSRLVSLDFTSNQFRSKIPVGIGSMKE  152

Query  313  LTILNLADNQISGVIPTPLST  375
            L  L+L+ NQ+ G IP  LS 
Sbjct  153  LRFLSLSQNQMVGAIPPSLSN  173


 Score = 31.6 bits (70),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMM  458
            P  +  L  L +LD+  N+L+G +PSN+G LT +
Sbjct  192  PKELGRLHELMYLDIGVNRLSGSIPSNLGNLTKL  225



>ref|XP_006436574.1| hypothetical protein CICLE_v10030632mg [Citrus clementina]
 gb|ESR49814.1| hypothetical protein CICLE_v10030632mg [Citrus clementina]
Length=981

 Score = 45.8 bits (107),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +1

Query  151  CKLDRLSTLILADW--KAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTIL  324
             ++ RL  L+  D     ++GHIPP +  LS   IL+L+   +   + + +G L +LT L
Sbjct  151  SEMGRLRNLVHLDLSNNHLTGHIPPTLGRLSKLKILNLSSNSLVGNVPSTLGHLTQLTTL  210

Query  325  NLADNQISGVIP  360
             +A NQI+G IP
Sbjct  211  AIASNQINGSIP  222


 Score = 35.4 bits (80),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P +I +L  L+ LDLS NKL G +PS++G LT ++
Sbjct  246  PSTIGHLKRLRILDLSQNKLVGPIPSSVGPLTQLT  280


 Score = 42.0 bits (97),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +1

Query  154  KLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTILNLA  333
             L+RL+ L L++ K + G IP  +  L+   +LDL+  ++  PI + I  L  LT L+L 
Sbjct  347  HLNRLTDLDLSENKLV-GPIPSSVGHLNFLQVLDLSNNKLEGPIPSTIASLVNLTYLSLQ  405

Query  334  DNQISGVIPTPL  369
            DN ++G IP+ L
Sbjct  406  DNNLTGPIPSTL  417


 Score = 33.1 bits (74),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMS  461
            P ++ +L  L +LDLS NKL G +PS++G L  + 
Sbjct  414  PSTLGHLDRLTYLDLSENKLVGPIPSSVGHLNFLQ  448


 Score = 43.5 bits (101),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +1

Query  142  TCVCKLDRLSTLILADWKAISGHIPPCITALSNFCILDLTGKQITSPILTYIG*LNKLTI  321
            + V  L+ L  L L++ K + G IP  I +L N   L L    +T PI + +G L++LT 
Sbjct  367  SSVGHLNFLQVLDLSNNK-LEGPIPSTIASLVNLTYLSLQDNNLTGPIPSTLGHLDRLTY  425

Query  322  LNLADNQISGVIPT  363
            L+L++N++ G IP+
Sbjct  426  LDLSENKLVGPIPS  439


 Score = 28.9 bits (63),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLT  452
            P S+ +L  L+ LDL +NKL G +PS I  L 
Sbjct  438  PSSVGHLNFLQVLDLPNNKLEGPIPSTIASLV  469



>ref|XP_006357362.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Solanum tuberosum]
Length=1026

 Score = 43.9 bits (102),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = +1

Query  124  VSEFSFTCVCKLDRLSTLILADW--KAISGHIPPCITALSNFCILDLTGKQITSPILTYI  297
            +++ S T   ++ +L+ L+  D     ISG IPP I++L+    L + G Q+   I   I
Sbjct  131  MNQLSGTIPPEIGKLANLVYLDLSVNHISGTIPPQISSLTKLETLHIFGNQLNGSIPREI  190

Query  298  G*LNKLTILNLADNQISGVIPTPLST  375
            G L  LT L L+ N +SG IP  L  
Sbjct  191  GRLRSLTDLALSSNFLSGSIPASLGN  216


 Score = 37.4 bits (85),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  357  PHSIVNLGSLKHLDLSSNKLTGELPSNIGKLTMMSRALLQR  479
            P S+ NL +L  L L +NKL+G +PS IGKL  +  A + R
Sbjct  211  PASLGNLNNLSFLYLYNNKLSGSIPSEIGKLVNLVEAYISR  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1851063916768