BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34638_g1_i1 len=1383 path=[1361:0-1382]

Length=1383
                                                                      Score     E

ref|XP_009769768.1|  PREDICTED: serine/threonine-protein kinase A...    526   0.0      
gb|AAP03880.2|  Avr9/Cf-9 induced kinase 1                              523   6e-180   Nicotiana tabacum [American tobacco]
ref|XP_009610758.1|  PREDICTED: putative receptor-like protein ki...    522   1e-179   
ref|XP_006342386.1|  PREDICTED: putative receptor-like protein ki...    515   9e-177   
ref|XP_004243705.1|  PREDICTED: serine/threonine-protein kinase A...    514   1e-176   
ref|XP_006355769.1|  PREDICTED: putative receptor-like protein ki...    511   6e-176   
ref|XP_004239317.1|  PREDICTED: putative receptor-like protein ki...    506   6e-174   
emb|CDP03082.1|  unnamed protein product                                506   3e-173   
ref|XP_009596087.1|  PREDICTED: serine/threonine-protein kinase A...    505   6e-173   
ref|XP_009777205.1|  PREDICTED: serine/threonine-protein kinase A...    504   2e-172   
ref|XP_010533019.1|  PREDICTED: serine/threonine-protein kinase A...    502   2e-171   
ref|XP_004507998.1|  PREDICTED: putative receptor-like protein ki...    504   2e-171   
ref|XP_007154576.1|  hypothetical protein PHAVU_003G130400g             503   2e-171   
gb|KHN12282.1|  Serine/threonine-protein kinase                         500   1e-170   
gb|KDO73907.1|  hypothetical protein CISIN_1g012832mg                   499   1e-170   
ref|XP_003542362.1|  PREDICTED: putative receptor-like protein ki...    499   2e-170   
ref|XP_008242244.1|  PREDICTED: serine/threonine-protein kinase A...    499   2e-170   
ref|XP_003533786.2|  PREDICTED: serine/threonine-protein kinase A...    499   3e-170   
ref|XP_004488084.1|  PREDICTED: putative receptor-like protein ki...    499   4e-170   
ref|XP_006452809.1|  hypothetical protein CICLE_v10008248mg             498   6e-170   
ref|XP_007203720.1|  hypothetical protein PRUPE_ppa019028mg             496   6e-170   
ref|XP_006474726.1|  PREDICTED: serine/threonine-protein kinase A...    498   9e-170   
ref|XP_011094012.1|  PREDICTED: serine/threonine-protein kinase A...    496   1e-169   
ref|NP_001238581.1|  kinase-like protein                                497   2e-169   
ref|XP_003547504.1|  PREDICTED: serine/threonine-protein kinase A...    497   2e-169   
ref|XP_010090162.1|  Serine/threonine-protein kinase                    496   2e-169   
ref|XP_004287640.1|  PREDICTED: putative receptor-like protein ki...    496   3e-169   
ref|XP_006381619.1|  kinase family protein                              496   4e-169   
ref|XP_009359732.1|  PREDICTED: serine/threonine-protein kinase A...    496   9e-169   
ref|XP_008337855.1|  PREDICTED: serine/threonine-protein kinase A...    496   1e-168   
gb|KHN06069.1|  Serine/threonine-protein kinase                         495   1e-168   
ref|XP_010047471.1|  PREDICTED: serine/threonine-protein kinase A...    494   1e-168   
gb|KEH32432.1|  receptor-like kinase                                    497   1e-168   
ref|XP_002516271.1|  Protein kinase APK1B, chloroplast precursor,...    494   3e-168   Ricinus communis
ref|XP_011046009.1|  PREDICTED: serine/threonine-protein kinase A...    493   5e-168   
ref|XP_007012630.1|  Kinase superfamily protein                         493   8e-168   
ref|XP_010049350.1|  PREDICTED: serine/threonine-protein kinase A...    492   1e-167   
ref|XP_002277991.1|  PREDICTED: serine/threonine-protein kinase A...    491   2e-167   Vitis vinifera
gb|KHG27920.1|  hypothetical protein F383_06954                         491   3e-167   
ref|XP_010666301.1|  PREDICTED: serine/threonine-protein kinase A...    491   4e-167   
ref|XP_004144034.1|  PREDICTED: serine/threonine-protein kinase A...    489   6e-167   
ref|XP_010049411.1|  PREDICTED: serine/threonine-protein kinase A...    490   6e-167   
gb|KFK39885.1|  hypothetical protein AALP_AA3G301300                    489   1e-166   
ref|NP_178651.1|  RPM1-induced protein kinase                           489   4e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488785.1|  PREDICTED: serine/threonine-protein kinase A...    488   5e-166   
ref|XP_002885808.1|  hypothetical protein ARALYDRAFT_899389             488   9e-166   
ref|XP_010467109.1|  PREDICTED: serine/threonine-protein kinase A...    487   2e-165   
ref|XP_010488784.1|  PREDICTED: serine/threonine-protein kinase A...    487   2e-165   
ref|XP_011078207.1|  PREDICTED: serine/threonine-protein kinase A...    483   7e-165   
ref|XP_003595279.1|  Kinase-like protein                                488   1e-164   
ref|XP_010412805.1|  PREDICTED: serine/threonine-protein kinase A...    484   2e-164   
ref|XP_006297624.1|  hypothetical protein CARUB_v10013644mg             484   2e-164   
ref|XP_010541992.1|  PREDICTED: serine/threonine-protein kinase A...    481   3e-163   
gb|KHG16004.1|  hypothetical protein F383_02714                         480   9e-163   
gb|KDP33918.1|  hypothetical protein JCGZ_07489                         479   2e-162   
ref|XP_006396126.1|  hypothetical protein EUTSA_v10002520mg             478   4e-162   
gb|KHG00343.1|  hypothetical protein F383_18271                         478   6e-162   
ref|XP_009124269.1|  PREDICTED: serine/threonine-protein kinase A...    476   2e-161   
ref|XP_009762767.1|  PREDICTED: putative receptor-like protein ki...    476   5e-161   
ref|XP_010273843.1|  PREDICTED: serine/threonine-protein kinase A...    476   5e-161   
gb|EPS67912.1|  hypothetical protein M569_06861                         471   2e-160   
gb|KFK22322.1|  hypothetical protein AALP_AAs55656U000100               473   2e-160   
ref|XP_006395963.1|  hypothetical protein EUTSA_v10004211mg             473   5e-160   
ref|XP_004141072.1|  PREDICTED: putative receptor-like protein ki...    468   3e-159   
ref|XP_008459841.1|  PREDICTED: serine/threonine-protein kinase A...    468   4e-159   
ref|XP_004157966.1|  PREDICTED: putative receptor-like protein ki...    466   5e-159   
gb|KGN60504.1|  hypothetical protein Csa_2G000130                       468   5e-159   
ref|XP_006282611.1|  hypothetical protein CARUB_v10004829mg             469   6e-159   
emb|CDY33401.1|  BnaA07g04380D                                          469   2e-158   
ref|XP_009102353.1|  PREDICTED: serine/threonine-protein kinase A...    469   2e-158   
emb|CDY65349.1|  BnaCnng46760D                                          469   2e-158   
ref|XP_010450389.1|  PREDICTED: serine/threonine-protein kinase A...    468   4e-158   
gb|EYU28327.1|  hypothetical protein MIMGU_mgv1a006430mg                467   6e-158   
ref|XP_011019325.1|  PREDICTED: serine/threonine-protein kinase A...    467   7e-158   
ref|XP_010435442.1|  PREDICTED: serine/threonine-protein kinase A...    467   7e-158   
ref|NP_001234561.1|  auxin-regulated dual specificity cytosolic k...    468   7e-158   
ref|XP_006357404.1|  PREDICTED: putative receptor-like protein ki...    467   1e-157   
ref|XP_010440738.1|  PREDICTED: serine/threonine-protein kinase A...    466   1e-157   
ref|XP_009612481.1|  PREDICTED: putative receptor-like protein ki...    467   1e-157   
ref|XP_002309457.2|  hypothetical protein POPTR_0006s23590g             465   3e-157   Populus trichocarpa [western balsam poplar]
ref|XP_009599916.1|  PREDICTED: putative receptor-like protein ki...    466   4e-157   
ref|XP_011072653.1|  PREDICTED: putative receptor-like protein ki...    465   6e-157   
ref|XP_002280196.1|  PREDICTED: serine/threonine-protein kinase A...    464   1e-156   Vitis vinifera
ref|XP_009409118.1|  PREDICTED: serine/threonine-protein kinase A...    462   2e-156   
ref|XP_010261848.1|  PREDICTED: serine/threonine-protein kinase A...    464   2e-156   
ref|XP_002868426.1|  hypothetical protein ARALYDRAFT_355547             462   6e-156   
ref|XP_011036441.1|  PREDICTED: putative receptor-like protein ki...    459   1e-154   
ref|XP_008778596.1|  PREDICTED: serine/threonine-protein kinase A...    458   1e-154   
ref|XP_009390860.1|  PREDICTED: serine/threonine-protein kinase A...    458   2e-154   
emb|CDO97843.1|  unnamed protein product                                460   2e-154   
ref|XP_011035727.1|  PREDICTED: putative receptor-like protein ki...    458   2e-154   
dbj|BAD94092.1|  serine/threonine protein kinase-like                   459   4e-154   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198408.2|  Ser/Thr protein kinase ACIK1b                         459   4e-154   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO45889.1|  receptor-like protein kinase                           454   6e-154   
ref|XP_009419910.1|  PREDICTED: serine/threonine-protein kinase A...    456   7e-154   
dbj|BAB09992.1|  serine/threonine protein kinase-like                   457   7e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006369136.1|  hypothetical protein POPTR_0001s16810g             457   9e-154   
ref|XP_006361336.1|  PREDICTED: putative receptor-like protein ki...    455   1e-153   
ref|XP_002516154.1|  Protein kinase APK1A, chloroplast precursor,...    456   2e-153   Ricinus communis
gb|KHN20154.1|  Putative receptor-like protein kinase                   453   2e-153   
ref|XP_002304131.1|  hypothetical protein POPTR_0003s06450g             455   3e-153   Populus trichocarpa [western balsam poplar]
ref|NP_001235224.1|  Avr9/Cf-9 induced kinase                           449   3e-153   
ref|XP_002521318.1|  Protein kinase APK1B, chloroplast precursor,...    455   4e-153   Ricinus communis
gb|KDP34015.1|  hypothetical protein JCGZ_07586                         454   5e-153   
ref|XP_010917227.1|  PREDICTED: serine/threonine-protein kinase A...    454   8e-153   
ref|XP_009390859.1|  PREDICTED: serine/threonine-protein kinase A...    453   1e-152   
gb|EYU21319.1|  hypothetical protein MIMGU_mgv1a006343mg                453   1e-152   
gb|KDP40693.1|  hypothetical protein JCGZ_24692                         454   2e-152   
gb|KHG06741.1|  hypothetical protein F383_33276                         452   2e-152   
ref|XP_008782588.1|  PREDICTED: serine/threonine-protein kinase A...    453   3e-152   
ref|XP_006849707.1|  hypothetical protein AMTR_s00024p00242070          451   5e-152   
ref|XP_004252518.1|  PREDICTED: putative receptor-like protein ki...    451   5e-152   
ref|XP_010937336.1|  PREDICTED: serine/threonine-protein kinase A...    452   7e-152   
ref|XP_008802464.1|  PREDICTED: serine/threonine-protein kinase A...    451   7e-152   
ref|XP_009402133.1|  PREDICTED: serine/threonine-protein kinase A...    450   1e-151   
ref|XP_007012454.1|  Root-specific kinase 1                             449   3e-151   
ref|XP_007161127.1|  hypothetical protein PHAVU_001G044900g             447   4e-151   
ref|XP_006452974.1|  hypothetical protein CICLE_v10010608mg             448   5e-151   
ref|XP_010939901.1|  PREDICTED: serine/threonine-protein kinase A...    449   8e-151   
ref|XP_002272911.2|  PREDICTED: serine/threonine-protein kinase A...    448   1e-150   Vitis vinifera
gb|KHN05281.1|  Serine/threonine-protein kinase                         446   2e-150   
ref|XP_003544585.2|  PREDICTED: putative receptor-like protein ki...    446   2e-150   
ref|XP_010932408.1|  PREDICTED: serine/threonine-protein kinase A...    447   2e-150   
emb|CAN77773.1|  hypothetical protein VITISV_021885                     446   9e-150   Vitis vinifera
gb|KDO73664.1|  hypothetical protein CISIN_1g040050mg                   444   1e-149   
ref|XP_010086797.1|  Putative receptor-like protein kinase              446   2e-149   
ref|XP_009408404.1|  PREDICTED: serine/threonine-protein kinase A...    446   2e-149   
ref|XP_009403379.1|  PREDICTED: serine/threonine-protein kinase A...    445   3e-149   
ref|XP_003588903.1|  Protein kinase 2B                                  441   1e-148   
ref|XP_004501421.1|  PREDICTED: putative receptor-like protein ki...    440   2e-148   
ref|XP_009414115.1|  PREDICTED: serine/threonine-protein kinase A...    442   4e-148   
ref|XP_010098385.1|  Serine/threonine-protein kinase                    441   4e-148   
ref|XP_006474675.1|  PREDICTED: putative receptor-like protein ki...    441   5e-148   
ref|XP_003603231.1|  Kinase-like protein                                439   5e-148   
ref|XP_003527759.1|  PREDICTED: serine/threonine-protein kinase A...    438   1e-147   
ref|XP_004498840.1|  PREDICTED: putative receptor-like protein ki...    438   2e-147   
ref|XP_003523655.1|  PREDICTED: serine/threonine-protein kinase A...    437   2e-147   
ref|XP_004305755.1|  PREDICTED: putative receptor-like protein ki...    440   3e-147   
gb|KHN32159.1|  Serine/threonine-protein kinase                         437   5e-147   
gb|KHG16114.1|  hypothetical protein F383_07817                         438   6e-147   
ref|XP_004303452.1|  PREDICTED: serine/threonine-protein kinase A...    436   4e-146   
gb|ABR16273.1|  unknown                                                 436   5e-146   Picea sitchensis
ref|XP_010548490.1|  PREDICTED: serine/threonine-protein kinase A...    435   1e-145   
ref|XP_007216399.1|  hypothetical protein PRUPE_ppa022600mg             434   7e-145   
ref|XP_003528552.1|  PREDICTED: putative receptor-like protein ki...    434   1e-144   
ref|XP_009375471.1|  PREDICTED: putative receptor-like protein ki...    433   1e-144   
ref|XP_008220586.1|  PREDICTED: serine/threonine-protein kinase A...    431   2e-144   
ref|XP_007136897.1|  hypothetical protein PHAVU_009G083300g             429   5e-144   
ref|XP_008228357.1|  PREDICTED: putative receptor-like protein ki...    432   6e-144   
ref|XP_010685306.1|  PREDICTED: putative receptor-like protein ki...    430   8e-144   
ref|XP_006362327.1|  PREDICTED: serine/threonine-protein kinase A...    430   1e-143   
ref|XP_007024642.1|  Kinase superfamily protein                         431   1e-143   
ref|XP_002461008.1|  hypothetical protein SORBIDRAFT_02g039110          430   2e-143   Sorghum bicolor [broomcorn]
ref|XP_007223042.1|  hypothetical protein PRUPE_ppa006919mg             428   2e-143   
gb|KDP40692.1|  hypothetical protein JCGZ_24691                         428   3e-143   
ref|XP_004245036.1|  PREDICTED: serine/threonine-protein kinase A...    428   9e-143   
ref|XP_003558674.1|  PREDICTED: serine/threonine-protein kinase A...    428   1e-142   
ref|XP_004249015.1|  PREDICTED: serine/threonine-protein kinase A...    427   1e-142   
ref|XP_006294280.1|  hypothetical protein CARUB_v10023277mg             427   1e-142   
ref|XP_006353843.1|  PREDICTED: serine/threonine-protein kinase A...    427   2e-142   
ref|XP_008653340.1|  PREDICTED: serine/threonine-protein kinase A...    428   2e-142   
ref|XP_010931422.1|  PREDICTED: serine/threonine-protein kinase A...    426   2e-142   
ref|XP_009600575.1|  PREDICTED: serine/threonine-protein kinase A...    427   2e-142   
ref|XP_004985497.1|  PREDICTED: serine/threonine-protein kinase A...    427   2e-142   
ref|NP_180197.1|  root-specific kinase 1                                426   3e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003547753.1|  PREDICTED: putative receptor-like protein ki...    427   3e-142   
ref|XP_009800306.1|  PREDICTED: serine/threonine-protein kinase A...    427   3e-142   
ref|XP_011018915.1|  PREDICTED: serine/threonine-protein kinase A...    426   4e-142   
ref|XP_010064028.1|  PREDICTED: putative receptor-like protein ki...    427   4e-142   
ref|XP_009362909.1|  PREDICTED: serine/threonine-protein kinase A...    425   5e-142   
ref|XP_009410482.1|  PREDICTED: serine/threonine-protein kinase A...    425   6e-142   
ref|XP_009801690.1|  PREDICTED: serine/threonine-protein kinase A...    426   6e-142   
ref|XP_009410484.1|  PREDICTED: serine/threonine-protein kinase A...    424   7e-142   
ref|XP_009606105.1|  PREDICTED: serine/threonine-protein kinase A...    426   7e-142   
ref|XP_008451160.1|  PREDICTED: serine/threonine-protein kinase A...    421   8e-142   
ref|XP_006842637.1|  hypothetical protein AMTR_s00077p00187600          425   8e-142   
ref|XP_009606106.1|  PREDICTED: serine/threonine-protein kinase A...    424   9e-142   
ref|XP_008244257.1|  PREDICTED: serine/threonine-protein kinase A...    425   9e-142   
ref|XP_008442306.1|  PREDICTED: serine/threonine-protein kinase A...    425   1e-141   
ref|XP_004160326.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    424   1e-141   
ref|XP_002265437.1|  PREDICTED: serine/threonine-protein kinase A...    425   1e-141   Vitis vinifera
ref|XP_008342636.1|  PREDICTED: putative receptor-like protein ki...    426   2e-141   
ref|XP_004137666.1|  PREDICTED: serine/threonine-protein kinase A...    424   2e-141   
ref|XP_010044463.1|  PREDICTED: serine/threonine-protein kinase A...    424   2e-141   
ref|XP_008370313.1|  PREDICTED: serine/threonine-protein kinase A...    424   2e-141   
ref|XP_009370852.1|  PREDICTED: serine/threonine-protein kinase A...    424   2e-141   
ref|XP_007205277.1|  hypothetical protein PRUPE_ppa006509mg             424   2e-141   
gb|AFK33487.1|  unknown                                                 424   4e-141   
ref|XP_010278903.1|  PREDICTED: serine/threonine-protein kinase A...    423   4e-141   
ref|NP_001140687.1|  uncharacterized LOC100272762                       423   4e-141   Zea mays [maize]
ref|XP_006602747.1|  PREDICTED: serine/threonine-protein kinase A...    424   5e-141   
ref|XP_009414114.1|  PREDICTED: serine/threonine-protein kinase A...    425   5e-141   
gb|AFW64652.1|  putative protein kinase superfamily protein             421   6e-141   
ref|XP_007140016.1|  hypothetical protein PHAVU_008G077200g             423   6e-141   
ref|XP_006368257.1|  kinase family protein                              422   7e-141   
ref|NP_001149711.1|  serine/threonine-protein kinase NAK                422   7e-141   Zea mays [maize]
ref|XP_006381288.1|  hypothetical protein POPTR_0006s11430g             422   8e-141   
emb|CAQ58633.1|  ATP binding / serine-threonine kinase                  422   8e-141   Vitis vinifera
ref|XP_003534620.1|  PREDICTED: serine/threonine-protein kinase A...    423   8e-141   
ref|XP_008804652.1|  PREDICTED: serine/threonine-protein kinase A...    422   8e-141   
ref|XP_004510479.1|  PREDICTED: putative receptor-like protein ki...    424   8e-141   
ref|XP_009337171.1|  PREDICTED: serine/threonine-protein kinase A...    422   1e-140   
ref|XP_002519978.1|  Protein kinase APK1B, chloroplast precursor,...    426   1e-140   Ricinus communis
ref|XP_010922837.1|  PREDICTED: serine/threonine-protein kinase A...    421   1e-140   
ref|XP_011018376.1|  PREDICTED: serine/threonine-protein kinase A...    422   1e-140   
ref|XP_010553184.1|  PREDICTED: serine/threonine-protein kinase A...    422   1e-140   
ref|XP_011006228.1|  PREDICTED: serine/threonine-protein kinase A...    422   1e-140   
ref|XP_007032291.1|  Kinase superfamily protein isoform 2               421   1e-140   
ref|XP_002872982.1|  kinase family protein                              421   1e-140   
ref|XP_004492609.1|  PREDICTED: serine/threonine-protein kinase A...    422   1e-140   
ref|XP_010922836.1|  PREDICTED: serine/threonine-protein kinase A...    421   2e-140   
ref|XP_010424023.1|  PREDICTED: serine/threonine-protein kinase A...    421   2e-140   
ref|XP_003623694.1|  Protein kinase 2B                                  422   2e-140   
ref|NP_195722.2|  serine/threonine-protein kinase                       421   2e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KDP39727.1|  hypothetical protein JCGZ_02747                         421   2e-140   
ref|XP_006662686.1|  PREDICTED: serine/threonine-protein kinase A...    421   2e-140   
ref|XP_002450171.1|  hypothetical protein SORBIDRAFT_05g001450          421   2e-140   Sorghum bicolor [broomcorn]
ref|XP_009383280.1|  PREDICTED: serine/threonine-protein kinase A...    421   2e-140   
ref|XP_008388407.1|  PREDICTED: serine/threonine-protein kinase A...    421   3e-140   
ref|XP_010429651.1|  PREDICTED: serine/threonine-protein kinase A...    421   3e-140   
ref|XP_009381351.1|  PREDICTED: serine/threonine-protein kinase A...    421   3e-140   
gb|KFK24698.1|  hypothetical protein AALP_AA8G013200                    420   3e-140   
ref|XP_006429669.1|  hypothetical protein CICLE_v10011776mg             421   4e-140   
gb|ACN35685.1|  unknown                                                 421   4e-140   Zea mays [maize]
ref|XP_006649093.1|  PREDICTED: serine/threonine-protein kinase A...    422   4e-140   
gb|EYU26700.1|  hypothetical protein MIMGU_mgv1a006846mg                421   4e-140   
ref|XP_006398549.1|  hypothetical protein EUTSA_v10013688mg             420   4e-140   
ref|XP_010244204.1|  PREDICTED: serine/threonine-protein kinase A...    421   4e-140   
ref|XP_006279336.1|  hypothetical protein CARUB_v10012732mg             420   4e-140   
ref|XP_002880775.1|  root-specific kinase 1                             420   6e-140   
ref|XP_009337839.1|  PREDICTED: serine/threonine-protein kinase A...    420   7e-140   
ref|NP_001049156.1|  Os03g0179400                                       420   7e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579009.1|  PREDICTED: serine/threonine-protein kinase A...    420   7e-140   
gb|KDP21817.1|  hypothetical protein JCGZ_00604                         421   8e-140   
dbj|BAK05812.1|  predicted protein                                      419   8e-140   
gb|KGN58674.1|  hypothetical protein Csa_3G727920                       424   9e-140   
ref|XP_010417417.1|  PREDICTED: serine/threonine-protein kinase A...    420   9e-140   
ref|XP_008393577.1|  PREDICTED: serine/threonine-protein kinase A...    419   1e-139   
ref|XP_011077494.1|  PREDICTED: serine/threonine-protein kinase A...    420   1e-139   
ref|XP_003572269.1|  PREDICTED: serine/threonine-protein kinase A...    422   1e-139   
emb|CDP06356.1|  unnamed protein product                                420   1e-139   
ref|XP_008802984.1|  PREDICTED: serine/threonine-protein kinase A...    419   2e-139   
ref|XP_010693043.1|  PREDICTED: serine/threonine-protein kinase A...    420   2e-139   
ref|XP_007135433.1|  hypothetical protein PHAVU_010G129000g             420   2e-139   
ref|NP_001064525.1|  Os10g0395000                                       417   3e-139   Oryza sativa Japonica Group [Japonica rice]
gb|KDO46394.1|  hypothetical protein CISIN_1g014736mg                   418   3e-139   
ref|XP_009140739.1|  PREDICTED: serine/threonine-protein kinase A...    419   3e-139   
ref|NP_001065612.1|  Os11g0121400                                       418   4e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004302496.1|  PREDICTED: serine/threonine-protein kinase A...    418   4e-139   
gb|EPS64243.1|  hypothetical protein M569_10538                         417   4e-139   
ref|XP_003577860.1|  PREDICTED: serine/threonine-protein kinase A...    417   5e-139   
ref|XP_007040918.1|  Kinase superfamily protein                         418   5e-139   
ref|XP_002519898.1|  receptor serine-threonine protein kinase, pu...    418   5e-139   Ricinus communis
ref|XP_008377919.1|  PREDICTED: serine/threonine-protein kinase A...    417   5e-139   
emb|CDY68189.1|  BnaCnng57950D                                          416   5e-139   
gb|EEC68754.1|  hypothetical protein OsI_37277                          417   5e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_009133583.1|  PREDICTED: serine/threonine-protein kinase A...    417   9e-139   
emb|CDX83496.1|  BnaA03g20100D                                          417   1e-138   
ref|XP_004964946.1|  PREDICTED: serine/threonine-protein kinase A...    418   1e-138   
ref|XP_004958293.1|  PREDICTED: serine/threonine-protein kinase A...    418   1e-138   
ref|XP_010112273.1|  Serine/threonine-protein kinase                    417   1e-138   
ref|XP_006432865.1|  hypothetical protein CICLE_v10003320mg             417   2e-138   
dbj|BAJ94670.1|  predicted protein                                      417   2e-138   
ref|XP_004954103.1|  PREDICTED: serine/threonine-protein kinase A...    417   2e-138   
ref|XP_007032290.1|  Kinase superfamily protein isoform 1               416   2e-138   
ref|XP_006408732.1|  hypothetical protein EUTSA_v10002290mg             416   3e-138   
ref|XP_002441774.1|  hypothetical protein SORBIDRAFT_08g002100          415   4e-138   Sorghum bicolor [broomcorn]
gb|EYU26701.1|  hypothetical protein MIMGU_mgv1a006846mg                416   4e-138   
ref|XP_010933044.1|  PREDICTED: serine/threonine-protein kinase A...    415   4e-138   
ref|XP_006586718.1|  PREDICTED: serine/threonine-protein kinase A...    416   4e-138   
ref|NP_001240045.1|  serine/threonine-protein kinase At5g01020-like     415   5e-138   
ref|XP_003516498.1|  PREDICTED: serine/threonine-protein kinase A...    415   7e-138   
ref|NP_001066022.2|  Os12g0121100                                       413   7e-138   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52663.1|  hypothetical protein OsJ_35037                          415   7e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388437.1|  PREDICTED: serine/threonine-protein kinase A...    415   8e-138   
ref|XP_006426670.1|  hypothetical protein CICLE_v10025595mg             415   1e-137   
gb|EAZ24810.1|  hypothetical protein OsJ_08589                          415   1e-137   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87739.1|  hypothetical protein OsI_09153                          415   1e-137   Oryza sativa Indica Group [Indian rice]
ref|XP_008651532.1|  PREDICTED: serine/threonine-protein kinase A...    415   2e-137   
ref|XP_007161128.1|  hypothetical protein PHAVU_001G044900g             411   3e-137   
ref|XP_007158107.1|  hypothetical protein PHAVU_002G124700g             413   4e-137   
ref|XP_003612555.1|  Protein kinase 2B                                  413   4e-137   
ref|XP_002265959.2|  PREDICTED: serine/threonine-protein kinase A...    413   5e-137   
dbj|BAK03276.1|  predicted protein                                      413   6e-137   
ref|XP_003578188.1|  PREDICTED: serine/threonine-protein kinase A...    414   6e-137   
ref|XP_002303478.1|  kinase family protein                              412   7e-137   
ref|XP_011027996.1|  PREDICTED: serine/threonine-protein kinase A...    412   7e-137   
ref|XP_004512358.1|  PREDICTED: serine/threonine-protein kinase A...    412   1e-136   
gb|EYU37458.1|  hypothetical protein MIMGU_mgv1a006653mg                412   1e-136   
gb|EMT28350.1|  Putative serine/threonine-protein kinase NAK            412   1e-136   
ref|XP_003561556.1|  PREDICTED: serine/threonine-protein kinase A...    413   2e-136   
ref|XP_004956941.1|  PREDICTED: serine/threonine-protein kinase A...    412   3e-136   
ref|XP_008238029.1|  PREDICTED: serine/threonine-protein kinase A...    410   3e-136   
ref|XP_002438022.1|  hypothetical protein SORBIDRAFT_10g006630          411   4e-136   
ref|XP_006854242.1|  hypothetical protein AMTR_s00048p00230600          409   7e-136   
gb|EMT16881.1|  Putative serine/threonine-protein kinase NAK            410   1e-135   
ref|XP_006465910.1|  PREDICTED: putative receptor-like protein ki...    410   1e-135   
ref|XP_003627303.1|  Kinase-like protein                                411   1e-135   
emb|CAB99493.1|  protein kinase-like protein                            409   1e-135   
ref|NP_001130591.1|  uncharacterized LOC100191690                       411   2e-135   
emb|CDP16592.1|  unnamed protein product                                409   2e-135   
ref|XP_002454653.1|  hypothetical protein SORBIDRAFT_04g034840          410   2e-135   
gb|EAY88776.1|  hypothetical protein OsI_10252                          410   2e-135   
ref|XP_010685307.1|  PREDICTED: putative receptor-like protein ki...    410   2e-135   
ref|XP_010056140.1|  PREDICTED: serine/threonine-protein kinase A...    408   3e-135   
gb|EEC75449.1|  hypothetical protein OsI_11987                          409   3e-135   
dbj|BAK01570.1|  predicted protein                                      410   3e-135   
gb|ACG28007.1|  protein kinase APK1B                                    409   5e-135   
gb|AAP12978.1|  putative serine/threonine protein kinase                409   5e-135   
ref|XP_011082139.1|  PREDICTED: serine/threonine-protein kinase A...    408   5e-135   
gb|AAO13471.1|  Putative serine/threonine protein kinase                408   7e-135   
ref|XP_002444473.1|  hypothetical protein SORBIDRAFT_07g022410          409   9e-135   
ref|XP_008451906.1|  PREDICTED: serine/threonine-protein kinase A...    406   1e-134   
ref|XP_004300399.1|  PREDICTED: serine/threonine-protein kinase A...    407   1e-134   
ref|XP_007211110.1|  hypothetical protein PRUPE_ppa024820mg             406   1e-134   
gb|EMT26195.1|  Putative serine/threonine-protein kinase NAK            407   2e-134   
gb|EAZ44891.1|  hypothetical protein OsJ_29532                          406   2e-134   
ref|NP_001050336.1|  Os03g0407900                                       409   2e-134   
gb|AFW85410.1|  putative protein kinase superfamily protein             407   3e-134   
gb|EEC82434.1|  hypothetical protein OsI_26847                          407   3e-134   
ref|NP_001060256.1|  Os07g0613500                                       407   4e-134   
ref|XP_006661281.1|  PREDICTED: serine/threonine-protein kinase A...    405   4e-134   
ref|XP_006651097.1|  PREDICTED: serine/threonine-protein kinase A...    404   4e-134   
ref|XP_004149002.1|  PREDICTED: serine/threonine-protein kinase A...    405   7e-134   
ref|XP_010677528.1|  PREDICTED: serine/threonine-protein kinase A...    405   7e-134   
emb|CAN69043.1|  hypothetical protein VITISV_022341                     404   7e-134   
ref|XP_006651489.1|  PREDICTED: serine/threonine-protein kinase A...    409   7e-134   
gb|KHN41751.1|  Serine/threonine-protein kinase                         405   9e-134   
ref|XP_002462457.1|  hypothetical protein SORBIDRAFT_02g025910          406   1e-133   
ref|XP_002464678.1|  hypothetical protein SORBIDRAFT_01g023180          399   2e-133   
gb|EAZ09264.1|  hypothetical protein OsI_31537                          405   2e-133   
ref|NP_001063288.1|  Os09g0442100                                       405   2e-133   
ref|XP_001758139.1|  predicted protein                                  404   3e-133   
ref|XP_010537625.1|  PREDICTED: putative receptor-like protein ki...    404   5e-133   
ref|XP_009343208.1|  PREDICTED: serine/threonine-protein kinase A...    402   1e-132   
ref|XP_003559971.1|  PREDICTED: serine/threonine-protein kinase A...    402   1e-132   
ref|XP_006408733.1|  hypothetical protein EUTSA_v10002210mg             402   1e-132   
gb|AET04401.2|  receptor Serine/Threonine kinase                        400   1e-132   
ref|XP_008351966.1|  PREDICTED: probable receptor-like protein ki...    397   2e-132   
emb|CDY72324.1|  BnaCnng77100D                                          397   2e-132   
ref|XP_010245739.1|  PREDICTED: serine/threonine-protein kinase A...    400   2e-132   
ref|XP_009801603.1|  PREDICTED: serine/threonine-protein kinase A...    401   2e-132   
dbj|BAJ90477.1|  predicted protein                                      402   3e-132   
ref|XP_002445600.1|  hypothetical protein SORBIDRAFT_07g022400          402   4e-132   
ref|XP_010050427.1|  PREDICTED: serine/threonine-protein kinase A...    398   4e-132   
ref|XP_006661741.1|  PREDICTED: serine/threonine-protein kinase A...    399   4e-132   
gb|AGW45463.1|  kinase-like protein                                     398   4e-132   
ref|XP_001776496.1|  predicted protein                                  400   4e-132   
ref|XP_008373497.1|  PREDICTED: serine/threonine-protein kinase A...    400   5e-132   
ref|XP_004984060.1|  PREDICTED: serine/threonine-protein kinase A...    401   5e-132   
ref|XP_010245737.1|  PREDICTED: serine/threonine-protein kinase A...    401   7e-132   
ref|XP_002888882.1|  predicted protein                                  400   7e-132   
ref|XP_010245738.1|  PREDICTED: serine/threonine-protein kinase A...    401   8e-132   
ref|XP_004983114.1|  PREDICTED: serine/threonine-protein kinase A...    398   8e-132   
ref|XP_011089173.1|  PREDICTED: probable receptor-like protein ki...    398   8e-132   
ref|XP_009598888.1|  PREDICTED: serine/threonine-protein kinase A...    399   9e-132   
ref|XP_003570518.1|  PREDICTED: serine/threonine-protein kinase A...    399   1e-131   
ref|XP_009104852.1|  PREDICTED: putative receptor-like protein ki...    398   1e-131   
ref|XP_008450497.1|  PREDICTED: serine/threonine-protein kinase A...    396   1e-131   
ref|XP_006655891.1|  PREDICTED: serine/threonine-protein kinase A...    399   1e-131   
ref|XP_009376055.1|  PREDICTED: probable receptor-like protein ki...    397   2e-131   
emb|CDX72925.1|  BnaC06g33730D                                          400   2e-131   
gb|AFW68830.1|  putative protein kinase superfamily protein             397   2e-131   
ref|XP_009339196.1|  PREDICTED: probable receptor-like protein ki...    397   2e-131   
ref|XP_006390647.1|  hypothetical protein EUTSA_v10018537mg             400   2e-131   
ref|NP_177398.1|  putative receptor-like protein kinase                 399   2e-131   
emb|CAQ58609.1|  ATP binding / kinase/ protein kinase/ protein se...    398   2e-131   
gb|EMT28626.1|  Putative serine/threonine-protein kinase NAK            399   3e-131   
dbj|BAK01485.1|  predicted protein                                      399   3e-131   
gb|EEE59233.1|  hypothetical protein OsJ_11215                          398   3e-131   
ref|NP_176353.1|  putative receptor-like cytoplasmic kinase             398   4e-131   
ref|XP_008450489.1|  PREDICTED: serine/threonine-protein kinase A...    396   4e-131   
ref|XP_008681384.1|  PREDICTED: uncharacterized LOC100272518 isof...    397   4e-131   
ref|XP_002963908.1|  hypothetical protein SELMODRAFT_79963              395   5e-131   
ref|XP_004294946.1|  PREDICTED: probable receptor-like protein ki...    396   5e-131   
ref|XP_002988311.1|  hypothetical protein SELMODRAFT_127709             395   6e-131   
emb|CDP18581.1|  unnamed protein product                                395   1e-130   
ref|XP_007205337.1|  hypothetical protein PRUPE_ppa007026mg             395   2e-130   
ref|XP_004246044.1|  PREDICTED: serine/threonine-protein kinase A...    396   2e-130   
ref|XP_010928727.1|  PREDICTED: serine/threonine-protein kinase A...    395   2e-130   
ref|XP_004163061.1|  PREDICTED: serine/threonine-protein kinase A...    393   2e-130   
ref|XP_008221745.1|  PREDICTED: probable receptor-like protein ki...    394   3e-130   
ref|NP_001239855.1|  probable receptor-like protein kinase At5g56...    394   3e-130   
gb|AFW76641.1|  putative protein kinase superfamily protein             396   3e-130   
ref|NP_001057083.1|  Os06g0202900                                       395   3e-130   
gb|ACU18671.1|  unknown                                                 394   3e-130   
ref|XP_010536824.1|  PREDICTED: probable receptor-like protein ki...    394   3e-130   
ref|XP_007159552.1|  hypothetical protein PHAVU_002G247100g             394   3e-130   
ref|XP_006301468.1|  hypothetical protein CARUB_v10021890mg             396   4e-130   
ref|XP_006363868.1|  PREDICTED: serine/threonine-protein kinase A...    395   5e-130   
ref|XP_004152853.1|  PREDICTED: serine/threonine-protein kinase A...    393   5e-130   
emb|CDY49854.1|  BnaA02g16030D                                          395   6e-130   
ref|XP_009419222.1|  PREDICTED: probable receptor-like protein ki...    392   7e-130   
ref|XP_007014087.1|  Kinase superfamily protein isoform 2               393   7e-130   
gb|ABR16311.1|  unknown                                                 395   7e-130   
ref|XP_010428142.1|  PREDICTED: putative receptor-like protein ki...    395   8e-130   
gb|KFK41680.1|  hypothetical protein AALP_AA2G158900                    395   9e-130   
emb|CDX68261.1|  BnaA07g23010D                                          393   9e-130   
ref|XP_002523402.1|  Protein kinase APK1B, chloroplast precursor,...    393   1e-129   
ref|XP_006391990.1|  hypothetical protein EUTSA_v10023477mg             394   1e-129   
ref|XP_009371832.1|  PREDICTED: serine/threonine-protein kinase A...    394   1e-129   
emb|CDY65019.1|  BnaCnng45720D                                          393   1e-129   
ref|XP_006659472.1|  PREDICTED: putative receptor-like protein ki...    395   1e-129   
ref|XP_010418127.1|  PREDICTED: serine/threonine-protein kinase A...    394   2e-129   
ref|XP_008789617.1|  PREDICTED: serine/threonine-protein kinase A...    392   2e-129   
ref|XP_010471281.1|  PREDICTED: putative receptor-like protein ki...    394   2e-129   
ref|XP_007160211.1|  hypothetical protein PHAVU_002G302300g             392   2e-129   
ref|XP_004503560.1|  PREDICTED: serine/threonine-protein kinase A...    392   2e-129   
ref|XP_009398617.1|  PREDICTED: serine/threonine-protein kinase A...    393   2e-129   
ref|XP_008384377.1|  PREDICTED: probable receptor-like protein ki...    392   2e-129   
ref|XP_004503561.1|  PREDICTED: serine/threonine-protein kinase A...    392   3e-129   
ref|XP_009127940.1|  PREDICTED: putative receptor-like protein ki...    394   3e-129   
emb|CDX96417.1|  BnaA07g30280D                                          394   3e-129   
ref|XP_003524997.1|  PREDICTED: probable receptor-like protein ki...    392   3e-129   
ref|XP_008681383.1|  PREDICTED: uncharacterized LOC100272518 isof...    393   3e-129   
ref|XP_009105915.1|  PREDICTED: putative receptor-like protein ki...    394   3e-129   
ref|XP_010032848.1|  PREDICTED: probable receptor-like protein ki...    391   3e-129   
ref|XP_010032847.1|  PREDICTED: probable receptor-like protein ki...    391   3e-129   
ref|XP_010228588.1|  PREDICTED: serine/threonine-protein kinase A...    394   3e-129   
ref|XP_010473366.1|  PREDICTED: serine/threonine-protein kinase A...    393   4e-129   
ref|XP_006302292.1|  hypothetical protein CARUB_v10020339mg             393   4e-129   
emb|CBI24068.3|  unnamed protein product                                394   4e-129   
gb|KFK40688.1|  hypothetical protein AALP_AA2G028500                    392   5e-129   
ref|XP_007014086.1|  Kinase superfamily protein isoform 1               393   5e-129   
ref|NP_001061968.1|  Os08g0457400                                       394   5e-129   
gb|ABR18367.1|  unknown                                                 394   6e-129   
gb|AAA81538.1|  serine/threonine protein kinase                         392   6e-129   
ref|XP_010540703.1|  PREDICTED: serine/threonine-protein kinase A...    392   7e-129   
gb|KHN06478.1|  Putative receptor-like protein kinase                   390   8e-129   
ref|XP_006658806.1|  PREDICTED: serine/threonine-protein kinase A...    390   8e-129   
ref|XP_007222079.1|  hypothetical protein PRUPE_ppa007540mg             390   9e-129   
gb|KHN48075.1|  Putative receptor-like protein kinase                   390   9e-129   
ref|XP_011089708.1|  PREDICTED: probable receptor-like protein ki...    390   9e-129   
ref|XP_010032846.1|  PREDICTED: probable receptor-like protein ki...    390   9e-129   
ref|XP_009623825.1|  PREDICTED: probable receptor-like protein ki...    390   1e-128   
ref|XP_010108963.1|  putative receptor-like protein kinase              394   1e-128   
ref|XP_006850988.1|  hypothetical protein AMTR_s00025p00212270          395   1e-128   
ref|XP_004973617.1|  PREDICTED: serine/threonine-protein kinase A...    394   1e-128   
ref|XP_010917721.1|  PREDICTED: probable receptor-like protein ki...    389   1e-128   
ref|XP_010416008.1|  PREDICTED: putative receptor-like protein ki...    392   2e-128   
ref|XP_010227886.1|  PREDICTED: serine/threonine-protein kinase A...    392   2e-128   
ref|XP_002886527.1|  hypothetical protein ARALYDRAFT_475168             391   2e-128   
ref|XP_010656713.1|  PREDICTED: serine/threonine-protein kinase A...    392   2e-128   
ref|XP_010416007.1|  PREDICTED: putative receptor-like protein ki...    392   2e-128   
ref|XP_006646050.1|  PREDICTED: probable receptor-like protein ki...    391   2e-128   
ref|XP_010651398.1|  PREDICTED: probable receptor-like protein ki...    387   3e-128   
ref|NP_001235470.1|  serine/threonine protein kinase-like protein       392   3e-128   
ref|XP_006580500.1|  PREDICTED: serine/threonine-protein kinase A...    389   3e-128   
ref|XP_003525321.1|  PREDICTED: serine/threonine-protein kinase A...    389   4e-128   
ref|XP_008647231.1|  PREDICTED: serine/threonine-protein kinase A...    389   5e-128   
emb|CDY26353.1|  BnaA03g60290D                                          390   6e-128   
ref|XP_004228947.1|  PREDICTED: probable receptor-like protein ki...    388   6e-128   
ref|XP_009618425.1|  PREDICTED: serine/threonine-protein kinase A...    390   6e-128   
ref|XP_011025119.1|  PREDICTED: probable receptor-like protein ki...    388   6e-128   
ref|XP_009785799.1|  PREDICTED: probable receptor-like protein ki...    388   6e-128   
ref|XP_009124635.1|  PREDICTED: serine/threonine-protein kinase A...    389   8e-128   
emb|CAN77488.1|  hypothetical protein VITISV_020249                     388   8e-128   
dbj|BAK00266.1|  predicted protein                                      389   9e-128   
ref|XP_006345242.1|  PREDICTED: serine/threonine-protein kinase A...    387   9e-128   
ref|XP_010931968.1|  PREDICTED: probable receptor-like protein ki...    390   9e-128   
emb|CDY47586.1|  BnaA01g22720D                                          389   1e-127   
ref|XP_009786277.1|  PREDICTED: serine/threonine-protein kinase A...    390   1e-127   
ref|XP_004252070.1|  PREDICTED: serine/threonine-protein kinase A...    387   1e-127   
ref|XP_006345243.1|  PREDICTED: serine/threonine-protein kinase A...    387   1e-127   
ref|XP_008223936.1|  PREDICTED: serine/threonine-protein kinase A...    389   1e-127   
ref|XP_006359196.1|  PREDICTED: probable receptor-like protein ki...    387   1e-127   
emb|CAN82003.1|  hypothetical protein VITISV_023198                     390   1e-127   
ref|XP_008223935.1|  PREDICTED: serine/threonine-protein kinase A...    389   1e-127   
gb|KEH21307.1|  Serine/Threonine kinase family protein                  387   1e-127   
ref|XP_008462296.1|  PREDICTED: putative receptor-like protein ki...    389   2e-127   
ref|NP_001050171.1|  Os03g0364400                                       389   2e-127   
emb|CBW30202.1|  Protein kinase APK1B                                   389   2e-127   
ref|XP_008797332.1|  PREDICTED: probable receptor-like protein ki...    386   2e-127   
ref|XP_006842103.1|  hypothetical protein AMTR_s00078p00087780          390   2e-127   
ref|XP_010276402.1|  PREDICTED: probable receptor-like protein ki...    387   2e-127   
ref|XP_009392754.1|  PREDICTED: serine/threonine-protein kinase A...    389   2e-127   
ref|XP_004141814.1|  PREDICTED: putative receptor-like protein ki...    387   2e-127   
gb|ABK24429.1|  unknown                                                 390   2e-127   
ref|XP_010915102.1|  PREDICTED: probable receptor-like protein ki...    390   3e-127   
ref|XP_008781710.1|  PREDICTED: serine/threonine-protein kinase A...    388   3e-127   
gb|AFW73727.1|  putative protein kinase superfamily protein             388   3e-127   
ref|XP_002285747.1|  PREDICTED: probable receptor-like protein ki...    386   3e-127   
ref|XP_010915105.1|  PREDICTED: probable receptor-like protein ki...    390   3e-127   
ref|XP_010931806.1|  PREDICTED: probable receptor-like protein ki...    390   3e-127   
dbj|BAK02435.1|  predicted protein                                      388   5e-127   
ref|XP_010931889.1|  PREDICTED: probable receptor-like protein ki...    389   5e-127   
ref|XP_010103098.1|  putative receptor-like protein kinase              385   7e-127   
ref|XP_009370036.1|  PREDICTED: serine/threonine-protein kinase A...    385   8e-127   
ref|XP_009345283.1|  PREDICTED: serine/threonine-protein kinase A...    384   8e-127   
ref|XP_009104830.1|  PREDICTED: serine/threonine-protein kinase A...    386   9e-127   
ref|XP_008793500.1|  PREDICTED: probable receptor-like protein ki...    388   1e-126   
ref|XP_008781709.1|  PREDICTED: serine/threonine-protein kinase A...    387   1e-126   
gb|EMT24219.1|  Protein kinase APK1A, chloroplastic                     386   1e-126   
gb|KGN45483.1|  hypothetical protein Csa_7G449430                       386   2e-126   
ref|XP_009345282.1|  PREDICTED: serine/threonine-protein kinase A...    386   2e-126   
ref|XP_003551987.1|  PREDICTED: probable receptor-like protein ki...    388   2e-126   
ref|XP_004984290.1|  PREDICTED: serine/threonine-protein kinase A...    386   2e-126   
ref|XP_009370035.1|  PREDICTED: serine/threonine-protein kinase A...    386   2e-126   
ref|XP_009772201.1|  PREDICTED: probable receptor-like protein ki...    387   2e-126   
gb|EMT00388.1|  Protein kinase APK1B, chloroplastic                     386   3e-126   



>ref|XP_009769768.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
sylvestris]
Length=442

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/294 (84%), Positives = 270/294 (92%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  80   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGT--QGHREWLTEVIFLGQLRHPH  137

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLL YEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  138  LVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIAVGAAKGLAFLHEA  197

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  198  EKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTG  257

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DKTRP REQNLVDWARPQLKDPRKL RIMDPRL+G
Sbjct  258  HLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQNLVDWARPQLKDPRKLRRIMDPRLEG  317

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            +YSE+GA+KAAL++Y+CLS R  ARP MS VVK LEPLKDYK++  +TF+Y+AP
Sbjct  318  LYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTLEPLKDYKDISNMTFVYIAP  371



>gb|AAP03880.2| Avr9/Cf-9 induced kinase 1 [Nicotiana tabacum]
Length=442

 Score =   523 bits (1347),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 245/294 (83%), Positives = 269/294 (91%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  80   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGT--QGHREWLTEVIFLGQLRHPH  137

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLL YEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  138  LVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIAVGAAKGLAFLHEA  197

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  198  EKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTG  257

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DKTRP REQNLVDWARPQLKDPRKL RIMDPRL+G
Sbjct  258  HLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQNLVDWARPQLKDPRKLRRIMDPRLEG  317

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            +YSE+GA+KAAL++Y+CLS R  ARP MS VVK LEPLKDYK++  + F+Y+AP
Sbjct  318  LYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTLEPLKDYKDISNMIFVYIAP  371



>ref|XP_009610758.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
tomentosiformis]
Length=438

 Score =   522 bits (1344),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 244/294 (83%), Positives = 269/294 (91%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  80   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGT--QGHREWLTEVIFLGQLRHPH  137

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLL YEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  138  LVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  197

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  198  EKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTG  257

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DKTRP REQNL DWARPQLKDPRKL RIMDPRL+G
Sbjct  258  HLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQNLADWARPQLKDPRKLRRIMDPRLEG  317

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            +YSE+GA+KAAL++Y+CLS R  ARP M+ VVK LEPLKDYK++  +TF+Y+AP
Sbjct  318  LYSEEGAQKAALVAYQCLSHRPKARPEMTSVVKTLEPLKDYKDISNMTFVYIAP  371



>ref|XP_006342386.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=439

 Score =   515 bits (1326),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 244/296 (82%), Positives = 266/296 (90%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPG-LKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHP  178
            F+GEGGFG VHKGF+DDKLRP  +KAQPVA+K LD D    QGHREWLTEV+ LGQLRHP
Sbjct  85   FIGEGGFGPVHKGFIDDKLRPNAIKAQPVAVKNLDLDGT--QGHREWLTEVIFLGQLRHP  142

Query  179  HVVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHG  358
            H+VKLIGYCCEED RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH 
Sbjct  143  HLVKLIGYCCEEDNRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIAIGAAKGLAFLHE  202

Query  359  AEKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
            A+KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMT
Sbjct  203  AKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMT  262

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHLTAASDVYSFGVVLLELLTGR+S+DK RP REQNLVDWARPQLKDPRKL RIMDPRL+
Sbjct  263  GHLTAASDVYSFGVVLLELLTGRRSVDKGRPHREQNLVDWARPQLKDPRKLRRIMDPRLE  322

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            GMYSE+G +KAAL++Y+CLS R  ARP MS VV  LEPLKDY++  MVTF+Y APT
Sbjct  323  GMYSEEGVQKAALVAYQCLSNRPKARPDMSNVVTTLEPLKDYEDNSMVTFVYTAPT  378



>ref|XP_004243705.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Solanum 
lycopersicum]
Length=434

 Score =   514 bits (1325),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 244/296 (82%), Positives = 266/296 (90%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPG-LKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHP  178
            F+GEGGFG VHKGF+DDKLRP  +KAQPVA+K LD D    QGHREWLTEV+ LGQLRHP
Sbjct  82   FIGEGGFGPVHKGFIDDKLRPNAIKAQPVAVKNLDLDGS--QGHREWLTEVIFLGQLRHP  139

Query  179  HVVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHG  358
            H+VKLIGYCCEED RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH 
Sbjct  140  HLVKLIGYCCEEDNRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIAIGAAKGLAFLHE  199

Query  359  AEKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
            A+KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMT
Sbjct  200  AKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMT  259

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHLTAASDVYSFGVVLLELLTGR+S+DK RP REQNLVDWARPQLKDPRKL RIMDPRL+
Sbjct  260  GHLTAASDVYSFGVVLLELLTGRRSVDKGRPHREQNLVDWARPQLKDPRKLRRIMDPRLE  319

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            GMYSE+G +KAAL++Y+CLS R  ARP MS VV  LEPLKDY++  MVTF+Y APT
Sbjct  320  GMYSEEGVQKAALVAYQCLSHRPKARPDMSNVVTTLEPLKDYEDNSMVTFVYTAPT  375



>ref|XP_006355769.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=412

 Score =   511 bits (1317),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 240/294 (82%), Positives = 266/294 (90%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  77   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGT--QGHREWLTEVIFLGQLRHPH  134

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLL YEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  135  LVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  194

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  195  EKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTG  254

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DK+RP REQNL DWARPQLKD RKL RI+DPRL+G
Sbjct  255  HLTAASDVYSFGVVLLELLTGRRSVDKSRPNREQNLADWARPQLKDARKLGRIIDPRLEG  314

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            +YSE+G +KAAL++Y+CLS R  ARP MS VVK LE LKDYK++  +TF+Y+AP
Sbjct  315  LYSEEGVQKAALVAYQCLSHRPKARPDMSTVVKTLETLKDYKDISTMTFVYIAP  368



>ref|XP_004239317.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Solanum 
lycopersicum]
Length=408

 Score =   506 bits (1304),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 264/294 (90%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLK QPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  76   FLGEGGFGPVHKGFIDDKLRPGLKPQPVAVKFLDLDGT--QGHREWLTEVIFLGQLRHPH  133

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  134  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  193

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  194  EKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYLMTG  253

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASD+YSFGVVLLELLTGR+S+DKTRP REQNL DWARPQLKD RKL R++DPRL+G
Sbjct  254  HLTAASDIYSFGVVLLELLTGRRSVDKTRPNREQNLADWARPQLKDARKLARVIDPRLEG  313

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            +YS +G +KAA ++Y+CLS R  ARP M+ VVK LE LKDYK++  +TF+Y+AP
Sbjct  314  LYSSEGVQKAAYVAYQCLSHRPKARPDMTTVVKTLETLKDYKDISTMTFVYIAP  367



>emb|CDP03082.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   506 bits (1303),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 237/294 (81%), Positives = 261/294 (89%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGH+EWLTEV+ LGQLRHP+
Sbjct  81   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLD--GSQGHKEWLTEVIFLGQLRHPN  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+ RMKIA+GAAKGLAFLH A
Sbjct  139  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSARMKIALGAAKGLAFLHEA  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  199  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DKTRP REQNL DWARP LKD RKL RIMDPRL+G
Sbjct  259  HLTAASDVYSFGVVLLELLTGRRSVDKTRPSREQNLADWARPMLKDSRKLSRIMDPRLEG  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            MYSE+GA++AA L+Y CLS R   RP MS++VK LEPLKDY +  + TF+Y  P
Sbjct  319  MYSEEGAQQAAALAYHCLSHRPKNRPNMSDIVKTLEPLKDYNDTSIGTFVYTVP  372



>ref|XP_009596087.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   505 bits (1300),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 241/294 (82%), Positives = 263/294 (89%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  83   FIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS--QGHREWLTEVIFLGQLRHPH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  141  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  201  KKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DK RP REQNLVDWARPQLKDPRKL RIMDPRL+G
Sbjct  261  HLTAASDVYSFGVVLLELLTGRRSVDKNRPHREQNLVDWARPQLKDPRKLRRIMDPRLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE-VPMVTFLYVA  880
            MYSE+G + AAL++Y+CLS R  ARP MS VVK LEPL +Y +   MVTF+Y A
Sbjct  321  MYSEEGIQNAALVAYQCLSHRPKARPDMSTVVKTLEPLMNYDDSSSMVTFVYRA  374



>ref|XP_009777205.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
sylvestris]
Length=436

 Score =   504 bits (1297),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 240/294 (82%), Positives = 262/294 (89%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQL HPH
Sbjct  84   FIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS--QGHREWLTEVIFLGQLSHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  202  KKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DK RP REQNLVDWARPQLKDPRKL RIMDPRL+G
Sbjct  262  HLTAASDVYSFGVVLLELLTGRRSVDKNRPHREQNLVDWARPQLKDPRKLRRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE-VPMVTFLYVA  880
            MYSE+G + AAL++Y+CLS R  ARP MS VVK LEPL +Y +   MVTF+Y A
Sbjct  322  MYSEEGIQNAALVAYQCLSHRPKARPDMSTVVKTLEPLMNYDDSSSMVTFVYTA  375



>ref|XP_010533019.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=451

 Score =   502 bits (1292),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 237/295 (80%), Positives = 261/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFGQVHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQL+HP+
Sbjct  89   FLGEGGFGQVHKGFIDDKLRPGLKAQPVAVKNLDPDGL--QGHREWLTEVIFLGQLKHPN  146

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYE+MPRGSLENQLFRR SASLPWATRMKIA GAAKGL FLH A
Sbjct  147  LVKLIGYCCEDEHRLLVYEFMPRGSLENQLFRRYSASLPWATRMKIAHGAAKGLQFLHEA  206

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  207  EKPVIYRDFKASNILLDSDYMAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  266

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R PR+QNLVDWARP L DPRKL RIMDPRL+G
Sbjct  267  HLTARSDVYSFGVVLLELLTGRRSVDKKRSPRQQNLVDWARPMLNDPRKLSRIMDPRLEG  326

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV VL+ LK+YK++PM  F++  P+
Sbjct  327  QYSETGARKAAALAYQCLSHRPKHRPNMSAVVAVLDDLKNYKDIPMGPFVFTVPS  381



>ref|XP_004507998.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=505

 Score =   504 bits (1297),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/295 (80%), Positives = 261/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDK+RPGL+ QPVA+K LD D    QGH+EWLTEVV LGQLRHPH
Sbjct  90   FLGEGGFGPVHKGFIDDKVRPGLEPQPVAVKLLDLDGS--QGHKEWLTEVVFLGQLRHPH  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEY+PRGSLENQLFRR SASLPW+TRMKIA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEEEHRLLVYEYLPRGSLENQLFRRYSASLPWSTRMKIAVGAAKGLAFLHDA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  208  KKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGR+S+DK RPPREQNLV+WARP L DPRKL RIMDPRL+G
Sbjct  268  HLTAMSDVYSFGVVLLEILTGRRSVDKVRPPREQNLVEWARPVLNDPRKLSRIMDPRLEG  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RPTMS VV  LEPL+D+ ++P+  F+Y  P 
Sbjct  328  QYSEMGARKAAALAYQCLSHRPRNRPTMSNVVNTLEPLQDFDDIPIGPFVYTVPN  382



>ref|XP_007154576.1| hypothetical protein PHAVU_003G130400g [Phaseolus vulgaris]
 gb|ESW26570.1| hypothetical protein PHAVU_003G130400g [Phaseolus vulgaris]
Length=480

 Score =   503 bits (1294),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 238/295 (81%), Positives = 261/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL+AQPVA+K LD D    QGHREWLTEVV LGQLRH H
Sbjct  83   FLGEGGFGPVHKGFIDDKLRPGLEAQPVAVKLLDLDGS--QGHREWLTEVVFLGQLRHQH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEY+PRGSLENQLFRR +ASL W+TRMKIA GAAKGLAFLH A
Sbjct  141  LVKLIGYCCEEEHRLLVYEYLPRGSLENQLFRRFTASLTWSTRMKIAAGAAKGLAFLHEA  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  201  KKPVIYRDFKASNILLDSDYDAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGR+S+DK RPPREQNLV+WARP L DPRKL RIMDPRL+G
Sbjct  261  HLTAMSDVYSFGVVLLEILTGRRSVDKGRPPREQNLVEWARPVLNDPRKLSRIMDPRLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE+GARKAA L+Y+CLS R   RP MS VV VLEPLKD+ +VP+  F+Y  PT
Sbjct  321  QYSEEGARKAAALAYQCLSHRPRNRPLMSTVVSVLEPLKDFDDVPIGPFVYTVPT  375



>gb|KHN12282.1| Serine/threonine-protein kinase [Glycine soja]
Length=463

 Score =   500 bits (1288),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 262/294 (89%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLR GLKAQPVA+K LD D    QGH+EWLTEVV LGQLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLRHGLKAQPVAVKLLDLD--GSQGHKEWLTEVVFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R+LVYEY+PRGSLENQLFRR SASLPW+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRRFSASLPWSTRMKIAVGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEY+MTG
Sbjct  202  EKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RPPREQNLV+WARP L D RKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPPREQNLVEWARPMLNDSRKLSRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE G +KAA L+Y+CLS R  +RP+MS VVK LEPL+D+ ++P+ TF+Y AP
Sbjct  322  QYSEMGTKKAAALAYQCLSHRPRSRPSMSTVVKTLEPLQDFDDIPIGTFVYTAP  375



>gb|KDO73907.1| hypothetical protein CISIN_1g012832mg [Citrus sinensis]
Length=455

 Score =   499 bits (1286),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/296 (79%), Positives = 262/296 (89%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL+AQPVA+K LD +    QGHREWLTEV+ LGQLRHPH
Sbjct  85   FLGEGGFGAVHKGFIDDKLRPGLQAQPVAVKNLDLEGL--QGHREWLTEVIFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHDA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLELL+GRKS+DK+RP REQ+LV+WARP L D RKL RIMDPRL+G
Sbjct  263  HLTSMSDVYSFGVVLLELLSGRKSVDKSRPQREQSLVEWARPMLNDARKLGRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RPTMS VVK LEPLKD+  ++ + TF++  PT
Sbjct  323  QYSETGARKAAALAYQCLSHRPKQRPTMSTVVKTLEPLKDFDDDIAIGTFVFTVPT  378



>ref|XP_003542362.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
isoform 1 [Glycine max]
 gb|KHN07896.1| Putative receptor-like protein kinase [Glycine soja]
Length=451

 Score =   499 bits (1285),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 236/294 (80%), Positives = 260/294 (88%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL+AQPVA+K LD D    QGH+EWLTEVV LGQLRHPH
Sbjct  80   FLGEGGFGPVHKGFIDDKLRPGLEAQPVAVKLLDLDGS--QGHKEWLTEVVFLGQLRHPH  137

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEY+PRGSLENQLFRR +ASLPW+TRMKIA GAAKGLAFLH A
Sbjct  138  LVKLIGYCCEEEHRLLVYEYLPRGSLENQLFRRYTASLPWSTRMKIAAGAAKGLAFLHEA  197

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  198  KKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  257

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WARP L D RKL RIMDPRL+G
Sbjct  258  HLTAMSDVYSFGVVLLELLTGRRSVDKGRPQREQNLVEWARPALNDSRKLGRIMDPRLEG  317

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE GARKAA L+Y+CLS R  +RP MS VV VLEPL+D+ +VP+  F+Y  P
Sbjct  318  QYSEVGARKAAALAYQCLSHRPRSRPLMSTVVNVLEPLQDFDDVPIGPFVYTVP  371



>ref|XP_008242244.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
Length=444

 Score =   499 bits (1284),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/295 (79%), Positives = 261/295 (88%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL AQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLRPGLTAQPVAVKLLDLDGS--QGHREWLTEVIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  202  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WA+P L +PRKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPHREQNLVEWAKPMLNEPRKLSRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+C+S R   RP +S+VVK+LEPLKD+ ++P + F+Y  PT
Sbjct  322  QYSEIGARKAAALAYQCISHRPKQRPKISDVVKILEPLKDFDDIP-IAFVYTVPT  375



>ref|XP_003533786.2| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=463

 Score =   499 bits (1285),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 234/294 (80%), Positives = 262/294 (89%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLR GLKAQPVA+K L+ D    QGH+EWLTEVV LGQLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLRHGLKAQPVAVKLLNLD--GSQGHKEWLTEVVFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R+LVYEY+PRGSLENQLFRR SASLPW+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRRFSASLPWSTRMKIAVGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEY+MTG
Sbjct  202  EKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RPPREQNLV+WARP L D RKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPPREQNLVEWARPMLNDSRKLSRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE G +KAA L+Y+CLS R  +RP+MS VVK LEPL+D+ ++P+ TF+Y AP
Sbjct  322  QYSEMGTKKAAALAYQCLSHRPRSRPSMSTVVKTLEPLQDFDDIPIGTFVYTAP  375



>ref|XP_004488084.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=460

 Score =   499 bits (1284),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 232/294 (79%), Positives = 262/294 (89%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLR GLKAQPVA+K LD +  + QGH+EWLTEVV LGQL HPH
Sbjct  89   FLGEGGFGPVHKGFIDDKLRYGLKAQPVAVKLLDLE--SKQGHKEWLTEVVVLGQLTHPH  146

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEY+PRGSLENQLFRR SASLPW+TRMKIA+GAAKGLAFLH A
Sbjct  147  LVKLIGYCCEDEHRLLVYEYLPRGSLENQLFRRFSASLPWSTRMKIAVGAAKGLAFLHEA  206

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+IFRDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  207  EKPVIFRDFKASNILLDSDYNPKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTG  266

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DK RPPREQNLVDWARP L D RK+ ++MDP+L+G
Sbjct  267  HLTAKSDVYSFGVVLLELLTGRKSVDKNRPPREQNLVDWARPMLNDSRKISKLMDPKLEG  326

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE G +KAA L+++CLS R  +RPTMS VVK+LEPL+D+ ++PM  F+Y AP
Sbjct  327  QYSEMGTKKAASLAFQCLSHRPKSRPTMSNVVKILEPLQDFDDIPMGPFVYHAP  380



>ref|XP_006452809.1| hypothetical protein CICLE_v10008248mg [Citrus clementina]
 gb|ESR66049.1| hypothetical protein CICLE_v10008248mg [Citrus clementina]
Length=456

 Score =   498 bits (1282),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 235/296 (79%), Positives = 262/296 (89%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL+AQPVA+K LD +    QGHREWLTEV+ LGQLRHPH
Sbjct  85   FLGEGGFGAVHKGFIDDKLRPGLQAQPVAVKNLDLEGL--QGHREWLTEVIFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHDA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLELL+GRKS+DK+RP REQ+LV+WARP L D RKL RIMDPRL+G
Sbjct  263  HLTSMSDVYSFGVVLLELLSGRKSVDKSRPQREQSLVEWARPMLNDARKLGRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RPTMS VVK LEPLKD+  ++ + TF++  PT
Sbjct  323  QYSETGARKAAALAYQCLSHRPKQRPTMSTVVKTLEPLKDFDDDIAIGTFVFTVPT  378



>ref|XP_007203720.1| hypothetical protein PRUPE_ppa019028mg, partial [Prunus persica]
 gb|EMJ04919.1| hypothetical protein PRUPE_ppa019028mg, partial [Prunus persica]
Length=391

 Score =   496 bits (1276),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 233/295 (79%), Positives = 260/295 (88%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL AQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  47   FLGEGGFGPVHKGFIDDKLRPGLTAQPVAVKLLDLDGS--QGHREWLTEVIFLGQLRHPH  104

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  105  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  164

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  165  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  224

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WA+P L +PRKL RIMDPRL+G
Sbjct  225  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPHREQNLVEWAKPMLNEPRKLSRIMDPRLEG  284

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+C+S R   RP + +VVK+LEPLKD+ ++P + F+Y  PT
Sbjct  285  QYSEIGARKAAALAYQCISHRPKQRPKICDVVKILEPLKDFDDIP-IAFVYTVPT  338



>ref|XP_006474726.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Citrus 
sinensis]
Length=455

 Score =   498 bits (1281),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 234/296 (79%), Positives = 261/296 (88%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL+AQPVA+K LD +    QGHREWLTEV+ LGQLRHPH
Sbjct  85   FLGEGGFGAVHKGFIDDKLRPGLQAQPVAVKNLDLEGL--QGHREWLTEVIFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHDA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLELL+GRKS+DK+RP REQ+LV+WARP L D RKL RIMDPRL+G
Sbjct  263  HLTSMSDVYSFGVVLLELLSGRKSVDKSRPQREQSLVEWARPMLNDARKLGRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VVK LEPLKD+  ++ + TF++  PT
Sbjct  323  QYSETGARKAAALAYQCLSHRPKQRPAMSTVVKTLEPLKDFDDDIAIGTFVFTVPT  378



>ref|XP_011094012.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Sesamum 
indicum]
Length=431

 Score =   496 bits (1278),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 234/295 (79%), Positives = 259/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRH H
Sbjct  89   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS--QGHREWLTEVIFLGQLRHAH  146

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPWA RMKIA+GAAKGLAFLH A
Sbjct  147  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRFSVSLPWAARMKIALGAAKGLAFLHEA  206

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEY+MTG
Sbjct  207  EKPVIYRDFKGSNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYVMTG  266

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGRKS+DK+RP REQNLV+WARP LK+PRKL R+MDPRL+G
Sbjct  267  HLTAASDVYSFGVVLLELLTGRKSVDKSRPHREQNLVEWARPMLKNPRKLSRVMDPRLEG  326

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             Y E GA+ AA L+Y+CLS R   RPTM+EV+KVLEPLKD  ++ + TF++   T
Sbjct  327  QYPEIGAQNAAALAYQCLSHRPKLRPTMNEVIKVLEPLKDLNDIQVGTFVFAVST  381



>ref|NP_001238581.1| kinase-like protein [Glycine max]
 gb|ACM89494.1| kinase-like protein [Glycine max]
 gb|KHN17726.1| Putative receptor-like protein kinase [Glycine soja]
Length=456

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 235/294 (80%), Positives = 259/294 (88%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL+AQPVA+K LD D    QGH+EWLTEVV LGQLRHPH
Sbjct  80   FLGEGGFGPVHKGFIDDKLRPGLEAQPVAVKLLDLDGS--QGHKEWLTEVVFLGQLRHPH  137

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEY+PRGSLENQLFRR +ASLPW+TRMKIA GAAKGLAFLH A
Sbjct  138  LVKLIGYCCEEEHRLLVYEYLPRGSLENQLFRRYTASLPWSTRMKIAAGAAKGLAFLHEA  197

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  198  KKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  257

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WAR  L D RKL RIMDPRL+G
Sbjct  258  HLTAMSDVYSFGVVLLELLTGRRSVDKGRPQREQNLVEWARSALNDSRKLSRIMDPRLEG  317

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE GARKAA L+Y+CLS R  +RP MS VV VLEPL+D+ +VP+  F+Y  P
Sbjct  318  QYSEVGARKAAALAYQCLSHRPRSRPLMSTVVNVLEPLQDFDDVPIGPFVYTVP  371



>ref|XP_003547504.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=458

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/294 (80%), Positives = 260/294 (88%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLR GLKAQPVA+K LD D    QGH+EWLTEVV LGQLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLRHGLKAQPVAVKLLDLDGS--QGHKEWLTEVVFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R+LVYEY+PRGSLENQLFRR SASL W+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRRFSASLSWSTRMKIAVGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILL SDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  202  EKPVIYRDFKASNILLGSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RPPREQNLV+WARP L D RKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPPREQNLVEWARPMLNDSRKLSRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE G +KAA L+Y+CLS R  +RP+MS VVK LEPL+D+ ++P+ TF+Y AP
Sbjct  322  QYSEMGTKKAAALAYQCLSHRPRSRPSMSTVVKTLEPLQDFDDIPIGTFVYTAP  375



>ref|XP_010090162.1| Serine/threonine-protein kinase [Morus notabilis]
 gb|EXB38959.1| Serine/threonine-protein kinase [Morus notabilis]
Length=452

 Score =   496 bits (1278),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 233/295 (79%), Positives = 260/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGFVDDK+RPGLKAQPVA+K LD D    QGH+EWLTEV+ LGQLRHP+
Sbjct  85   FLGEGGFGPVHKGFVDDKIRPGLKAQPVAVKLLDLD--GSQGHKEWLTEVIFLGQLRHPY  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+ RMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSARMKIALGAAKGLAFLHEA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGD+THVSTRVMGTQGYAAPEY+MTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE++TGR+S+DK+RP REQNLV+WARP L DPRKL RIMDPRL+G
Sbjct  263  HLTAMSDVYSFGVVLLEMITGRRSVDKSRPTREQNLVEWARPMLCDPRKLGRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RPTMS VV+ LEPLKD+ +V +  F+Y  PT
Sbjct  323  QYSETGARKAAALAYQCLSHRPKQRPTMSTVVETLEPLKDFDDVAIAPFVYTVPT  377



>ref|XP_004287640.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Fragaria vesca subsp. vesca]
Length=451

 Score =   496 bits (1277),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 235/295 (80%), Positives = 258/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG VHKGF+DDKLRPGL AQPVA+K LD D    QGHREWLTEV+ LGQLRH H
Sbjct  85   FIGEGGFGPVHKGFIDDKLRPGLAAQPVAVKFLDLD--GSQGHREWLTEVMFLGQLRHAH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCC ++ RLLVYEYMPRGSLENQLFRR SASLPW+TRMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCVDEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WARP L +PRKL RIMDPRL+G
Sbjct  263  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPHREQNLVEWARPMLNEPRKLSRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP M EVVK LEPLKD+ ++P+  F+Y  PT
Sbjct  323  QYSEMGARKAAALAYQCLSHRPKQRPKMCEVVKTLEPLKDFDDIPIGPFVYTVPT  377



>ref|XP_006381619.1| kinase family protein [Populus trichocarpa]
 gb|ERP59416.1| kinase family protein [Populus trichocarpa]
Length=456

 Score =   496 bits (1277),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 234/295 (79%), Positives = 258/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  85   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS--QGHREWLAEVIFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+ R KIA+GAAKGLAFLH +
Sbjct  143  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSARTKIAVGAAKGLAFLHES  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEG DTHVSTRVMGTQGYAAPEYIMTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGSDTHVSTRVMGTQGYAAPEYIMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLELLTGR+S+DK+RP REQNLV+WARP L DPRKL RIMDPRL+G
Sbjct  263  HLTSRSDVYSFGVVLLELLTGRRSVDKSRPQREQNLVEWARPMLNDPRKLGRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RPTMS VV  L+PLKD+++VP+  F+Y  PT
Sbjct  323  QYSETGARKAAELAYQCLSHRPKHRPTMSIVVNTLDPLKDFEDVPIGPFVYTVPT  377



>ref|XP_009359732.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=479

 Score =   496 bits (1277),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 235/295 (80%), Positives = 259/295 (88%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL AQPVA+K LD D    QGHREWLTEVV LGQLRHPH
Sbjct  85   FLGEGGFGPVHKGFIDDKLRPGLAAQPVAVKLLDLDGT--QGHREWLTEVVFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGD+THVSTRVMGTQGYAAPEYIMTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WARP L +PRKL RIMDPRL+G
Sbjct  263  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPQREQNLVEWARPMLNEPRKLSRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+++CLS R   RP +SEVVK LEPLKD+ ++P   F+Y  P+
Sbjct  323  QYSELGARKAAALAFQCLSHRPKQRPKISEVVKTLEPLKDFDDIPFA-FVYTVPS  376



>ref|XP_008337855.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Malus domestica]
Length=479

 Score =   496 bits (1276),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 235/295 (80%), Positives = 259/295 (88%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL AQPVA+K LD D    QGHREWLTEVV LGQLRHPH
Sbjct  85   FLGEGGFGPVHKGFIDDKLRPGLAAQPVAVKLLDLDGT--QGHREWLTEVVFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGD+THVSTRVMGTQGYAAPEYIMTG
Sbjct  203  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WARP L +PRKL RIMDPRL+G
Sbjct  263  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPQREQNLVEWARPMLNEPRKLSRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+++CLS R   RP +SEVVK LEPLKD+ ++P   F+Y  P+
Sbjct  323  QYSELGARKAAALAFQCLSHRPKQRPKISEVVKTLEPLKDFDDIPFA-FVYTVPS  376



>gb|KHN06069.1| Serine/threonine-protein kinase [Glycine soja]
Length=460

 Score =   495 bits (1274),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/294 (79%), Positives = 260/294 (88%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLR GLKAQPVA+K LD D    QGH+EWLTEVV LGQLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLRHGLKAQPVAVKLLDLDGS--QGHKEWLTEVVFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R+LVYEY+PRGSLENQLFRR SASL W+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRRFSASLSWSTRMKIAVGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILL SDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  202  EKPVIYRDFKASNILLGSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RPPREQNLV+WARP L D RKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSVDKNRPPREQNLVEWARPMLNDSRKLSRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE G +KAA L+++CLS R  +RP+MS VVK LEPL+D+ ++P+ TF+Y AP
Sbjct  322  QYSEMGTKKAAALAFQCLSHRPRSRPSMSTVVKTLEPLQDFDDIPIGTFVYTAP  375



>ref|XP_010047471.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Eucalyptus 
grandis]
 gb|KCW79393.1| hypothetical protein EUGRSUZ_C00802 [Eucalyptus grandis]
Length=441

 Score =   494 bits (1272),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/294 (79%), Positives = 259/294 (88%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG VHKGF+DDKLRPGLK QPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  83   FIGEGGFGPVHKGFIDDKLRPGLKVQPVAVKLLDLDGL--QGHREWLTEVIFLGQLRHPH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+ RMKIA+GAAKGLAFLH A
Sbjct  141  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSARMKIALGAAKGLAFLHEA  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  201  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP REQ L +WARP L+DPRKL RIMDPRL+G
Sbjct  261  HLTAMSDVYSFGVVLLELLTGRKSVDKTRPAREQKLAEWARPMLRDPRKLGRIMDPRLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE GARKAA ++Y+CLS R   RPT+  VV+ LEPL+D+ ++PM TF++  P
Sbjct  321  QYSEAGARKAAEVAYQCLSHRPKQRPTVGTVVETLEPLQDFNDLPMGTFVFTFP  374



>gb|KEH32432.1| receptor-like kinase [Medicago truncatula]
Length=514

 Score =   497 bits (1279),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/295 (79%), Positives = 257/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDK+R GL+ QPVA+K LD D    QGHREWLTEVV LGQLRH H
Sbjct  90   FLGEGGFGPVHKGFIDDKVRAGLEPQPVAVKLLDLDGT--QGHREWLTEVVFLGQLRHQH  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEY+PRGSLENQLF+R S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEEEHRLLVYEYLPRGSLENQLFKRYSTSLPWSTRMKIAVGAAKGLAFLHDA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFK SNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  208  KKPVIYRDFKGSNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RPPREQNLV+WARP L D RKL RIMDPRL+G
Sbjct  268  HLTAMSDVYSFGVVLLELLTGRRSVDKVRPPREQNLVEWARPVLNDARKLSRIMDPRLEG  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RPTMS VV  LEPLKD+ ++P+  F+Y  PT
Sbjct  328  QYSEMGARKAAALAYQCLSHRPRNRPTMSTVVNTLEPLKDFDDIPIGPFVYTVPT  382



>ref|XP_002516271.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF46273.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=451

 Score =   494 bits (1271),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 233/295 (79%), Positives = 256/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  85   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREWLTEVIFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH +
Sbjct  143  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHES  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EK +I+RDFKASNILLDSDY AKLSDFGLAKDGP+G DTHVSTRVMGTQGYAAPEYIMTG
Sbjct  203  EKSVIYRDFKASNILLDSDYNAKLSDFGLAKDGPQGSDTHVSTRVMGTQGYAAPEYIMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK+RP REQ L +WARP L DPRKL RIMDPRL+G
Sbjct  263  HLTAMSDVYSFGVVLLELLTGRRSVDKSRPQREQKLAEWARPMLNDPRKLGRIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y CLS R   RP MS VVK LE  KD++++P+  F+Y  PT
Sbjct  323  QYSETGARKAAALAYLCLSHRPKQRPIMSIVVKTLESFKDFEDIPVGPFVYTVPT  377



>ref|XP_011046009.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
 ref|XP_011016671.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
Length=454

 Score =   493 bits (1270),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 256/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  83   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS--QGHREWLAEVIFLGQLRHPH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+ R KIA+GAAKGLAFLH +
Sbjct  141  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSARTKIAVGAAKGLAFLHES  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEG DTHVSTRVMGTQGYAAPEYIMTG
Sbjct  201  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGSDTHVSTRVMGTQGYAAPEYIMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLELLTGR+S+DK+RP REQNL +WARP L DPRKL RIMDPRL+G
Sbjct  261  HLTSRSDVYSFGVVLLELLTGRRSVDKSRPQREQNLAEWARPMLNDPRKLSRIMDPRLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RPTMS VV  L+PL D+++VP+  F+Y  PT
Sbjct  321  QYSETGARKAAALAYQCLSHRPKLRPTMSIVVSTLDPLMDFEDVPIGPFVYTVPT  375



>ref|XP_007012630.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY30249.1| Kinase superfamily protein [Theobroma cacao]
Length=448

 Score =   493 bits (1268),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 259/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDK+RPGLKAQPVA+K LD +    QGHREWLTEV+ L QLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKVRPGLKAQPVAVKLLDLEGL--QGHREWLTEVIFLAQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPWATRMKIA+GAAKGLA+LH A
Sbjct  142  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWATRMKIALGAAKGLAYLHQA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTG
Sbjct  202  DKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK+R  REQNL +WARP L DPRKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSLDKSRSQREQNLAEWARPMLNDPRKLGRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS+VV  LEPL+D +++P+  F+Y  PT
Sbjct  322  QYSEMGARKAAALAYQCLSHRPKQRPKMSDVVSTLEPLQDSEDIPIGPFVYTVPT  376



>ref|XP_010049350.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Eucalyptus 
grandis]
 gb|KCW81895.1| hypothetical protein EUGRSUZ_C03262 [Eucalyptus grandis]
Length=450

 Score =   492 bits (1267),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 230/294 (78%), Positives = 256/294 (87%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLG+GGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQLRHPH
Sbjct  86   FLGQGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGM--QGHREWLTEVILLGQLRHPH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLFRR +A+LPW+ RMKIA+GAAKGLAFLH A
Sbjct  144  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYAATLPWSARMKIAVGAAKGLAFLHEA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  204  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DK RP REQNL +WARP L D +KL R+MDPRL+G
Sbjct  264  HLTAMSDVYSFGVVLLELLTGRKSVDKNRPHREQNLAEWARPMLNDSKKLSRLMDPRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE GARKAA L+Y+CLS R   RPTMS VVK LEPLK++ ++P   F+Y  P
Sbjct  324  QYSESGARKAATLAYQCLSHRPKMRPTMSTVVKTLEPLKNFDDIPSGPFVYTVP  377



>ref|XP_002277991.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 emb|CBI27806.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   491 bits (1265),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 236/295 (80%), Positives = 261/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQLRHPH
Sbjct  85   FIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVIFLGQLRHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSD+  KLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  203  EKPVIYRDFKASNILLDSDHTPKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP REQNL +WARPQL D RKL RIMDPRL+G
Sbjct  263  HLTAMSDVYSFGVVLLELLTGRRSVDKTRPNREQNLAEWARPQLNDSRKLARIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GA+ AA L+Y+CLS R   RPTMS VVK LEPL+DY E+P+ TF+Y  P+
Sbjct  323  QYSEAGAQSAAALAYQCLSHRPKHRPTMSTVVKTLEPLQDYNEIPVGTFVYTVPS  377



>gb|KHG27920.1| hypothetical protein F383_06954 [Gossypium arboreum]
Length=443

 Score =   491 bits (1264),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 259/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQ VA+K LD +    QGHREWLTEV+ L QLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLRPGLKAQSVAVKLLDLEGL--QGHREWLTEVIFLAQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPWATRMKIA+GAAKGLA+LH A
Sbjct  142  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWATRMKIALGAAKGLAYLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAK GPEGDDTHVSTRVMGT+GYAAPEY+MTG
Sbjct  202  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKGGPEGDDTHVSTRVMGTEGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R PREQNLV+WARP L D RKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSLDKKRSPREQNLVEWARPILNDARKLGRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLSQR   RP M +VV +LEPL+DY+++P+ +F+Y  P 
Sbjct  322  QYSEMGARKAAALAYQCLSQRPKQRPKMCDVVGILEPLQDYEDIPIGSFVYTVPN  376



>ref|XP_010666301.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   491 bits (1264),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 233/296 (79%), Positives = 261/296 (88%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDK+RPGLKAQPVA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  95   FLGEGGFGPVHKGFIDDKIRPGLKAQPVAVKILDLDGT--QGHREWLAEVIVLGQLRHPH  152

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYEYMPRGSLENQLFRR SASLPW TR+KIA+GAAKGLAFLH A
Sbjct  153  LVKLIGYCCEDEHRVLVYEYMPRGSLENQLFRRFSASLPWLTRLKIALGAAKGLAFLHEA  212

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKPII+RDFKASNILLDSD+  KLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  213  EKPIIYRDFKASNILLDSDFTPKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  272

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELLTGR+S+DK RPPREQNL +WARPQL+  R+L R+MDPRL+ 
Sbjct  273  HLTAASDVYSFGVVLLELLTGRRSMDKNRPPREQNLAEWARPQLQSQRRLTRLMDPRLES  332

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVAPT  886
             YSEDGA+KAALL+Y+CLS R  +RPTMS VVK LEPL +   ++P   F+Y AP+
Sbjct  333  QYSEDGAQKAALLAYQCLSHRPKSRPTMSVVVKTLEPLLNLVHDIPSGPFVYTAPS  388



>ref|XP_004144034.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
sativus]
 ref|XP_004161115.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
sativus]
 gb|KGN66304.1| hypothetical protein Csa_1G597020 [Cucumis sativus]
Length=421

 Score =   489 bits (1259),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 231/294 (79%), Positives = 263/294 (89%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLR PH
Sbjct  84   FIGEGGFGPVYKGFIDDKLRPGLKAQPVAVKLLDLDGT--QGHREWLTEVIFLGQLRDPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYEYMPRGSLENQLFRR S SL W+TRMKIA+GAAKGLAFLHGA
Sbjct  142  LVKLIGYCCEDEHRVLVYEYMPRGSLENQLFRRFSVSLSWSTRMKIALGAAKGLAFLHGA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GDDTHVSTRVMGT+GYAAPEYIMTG
Sbjct  202  EKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPDGDDTHVSTRVMGTEGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S++K+RP REQNLV++ARP L D RKL RIMD RL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSLEKSRPHREQNLVEYARPMLMDNRKLSRIMDTRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE GARKAA L+Y+CLS R   RPTM+EVVK+LEPLKDY+++P+ TF++  P
Sbjct  322  QYSETGARKAATLAYQCLSHRPKQRPTMNEVVKILEPLKDYQDMPIGTFVFEMP  375



>ref|XP_010049411.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Eucalyptus 
grandis]
 gb|KCW81961.1| hypothetical protein EUGRSUZ_C03327 [Eucalyptus grandis]
Length=450

 Score =   490 bits (1262),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 228/294 (78%), Positives = 257/294 (87%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLG+GGFG VHKGF+D+KLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQLRHPH
Sbjct  86   FLGQGGFGPVHKGFIDEKLRPGLKAQPVAVKLLDLEGM--QGHREWLTEVILLGQLRHPH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLFRR +A+LPW+ RMKIA+GAAKGLAFLH A
Sbjct  144  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYAATLPWSARMKIAVGAAKGLAFLHEA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  204  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS++K RP REQNL +WARP L D +KL R+MDPRL+G
Sbjct  264  HLTAMSDVYSFGVVLLELLTGRKSVEKNRPHREQNLAEWARPMLNDSKKLSRLMDPRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YSE GARKAA L+Y+CLS R   RPTMS VVK LEPLK++ ++P+  F+Y  P
Sbjct  324  QYSESGARKAATLAYQCLSHRPKMRPTMSTVVKTLEPLKNFDDIPIGPFVYTVP  377



>gb|KFK39885.1| hypothetical protein AALP_AA3G301300 [Arabis alpina]
Length=460

 Score =   489 bits (1260),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 255/295 (86%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGFVDDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFVDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA G+ FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGVQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L D RKL RIMDPRL+G
Sbjct  270  HLTARSDVYSFGVVLLELLTGRRSVDKKRTSREQNLVDWARPMLNDARKLARIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE+GARKAA L+Y+CLS R   RP+MS VV +L  LKDY ++PM TF+Y  P 
Sbjct  330  QYSENGARKAAALAYQCLSHRPKNRPSMSTVVSILNDLKDYNDIPMGTFVYTVPN  384



>ref|NP_178651.1| RPM1-induced protein kinase [Arabidopsis thaliana]
 gb|AAC95171.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL07094.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM45011.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC05986.1| RPM1-induced protein kinase [Arabidopsis thaliana]
Length=462

 Score =   489 bits (1258),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+G
Sbjct  270  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  330  QYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPN  384



>ref|XP_010488785.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Camelina sativa]
Length=449

 Score =   488 bits (1256),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 230/295 (78%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  69   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  126

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  127  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  186

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  187  KNPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  246

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SD+YSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+G
Sbjct  247  HLTARSDIYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEG  306

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  307  QYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPN  361



>ref|XP_002885808.1| hypothetical protein ARALYDRAFT_899389 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62067.1| hypothetical protein ARALYDRAFT_899389 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   488 bits (1256),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+G
Sbjct  270  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLCRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  330  QYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPN  384



>ref|XP_010467109.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=465

 Score =   487 bits (1254),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/295 (78%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  KNPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SD+YSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+G
Sbjct  270  HLTARSDIYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  330  QYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPN  384



>ref|XP_010488784.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Camelina sativa]
Length=472

 Score =   487 bits (1254),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/295 (78%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  KNPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SD+YSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+G
Sbjct  270  HLTARSDIYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  330  QYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPN  384



>ref|XP_011078207.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Sesamum 
indicum]
Length=406

 Score =   483 bits (1244),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 229/295 (78%), Positives = 260/295 (88%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLG+GGFG VHKGF+DDK+RPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRH +
Sbjct  84   FLGQGGFGPVHKGFIDDKMRPGLKAQPVAVKLLDLDGA--QGHREWLTEVIFLGQLRHRN  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRFSVSLPWSTRMKIALGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSDY AKLSDFGLAK+GPEGD+THVSTR+MGT GYAAPEYIMTG
Sbjct  202  EKPVIYRDFKTSNILLDSDYTAKLSDFGLAKNGPEGDNTHVSTRIMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLELL GRKS+DK+RP REQNL +WARP LK+PRKL R+MDPRL+G
Sbjct  262  HLTAASDVYSFGVVLLELLAGRKSVDKSRPHREQNLAEWARPMLKNPRKLSRVMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTF-LYVAP  883
             YSE GA+KAA ++++CLS R   RPTMS+V+KVLEPLKD  ++   TF L V+P
Sbjct  322  QYSEIGAQKAAAIAHRCLSHRPKLRPTMSQVIKVLEPLKDLDDIQTGTFVLAVSP  376



>ref|XP_003595279.1| Kinase-like protein [Medicago truncatula]
 gb|AES65530.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=543

 Score =   488 bits (1256),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/293 (78%), Positives = 259/293 (88%), Gaps = 2/293 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LG GGFG VHKGF+DDK+RPGLKAQ VA+K LD +  + QGH+EWLTEVV LGQLR PH+
Sbjct  85   LGAGGFGPVHKGFIDDKVRPGLKAQSVAVKLLDLE--SKQGHKEWLTEVVVLGQLRDPHL  142

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYC E++ RLLVYEY+PRGSLENQLFRR SASLPW+TRMKIA+GAAKGLAFLH AE
Sbjct  143  VKLIGYCIEDEHRLLVYEYLPRGSLENQLFRRFSASLPWSTRMKIAVGAAKGLAFLHEAE  202

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+IFRDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEY+MTGH
Sbjct  203  QPVIFRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTGH  262

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKS+DK RP REQNLVDWARP L D RK+ +IMDP+L+G 
Sbjct  263  LTAKSDVYSFGVVLLELLTGRKSVDKNRPQREQNLVDWARPMLIDSRKISKIMDPKLEGQ  322

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            YSE GA+KAA L+Y+CLS R  +RPTMS VVK+LEPL+D+ ++P+  F+Y  P
Sbjct  323  YSEMGAKKAASLAYQCLSHRPKSRPTMSNVVKILEPLQDFDDIPIGPFVYTVP  375



>ref|XP_010412805.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Camelina sativa]
 ref|XP_010412812.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Camelina sativa]
Length=472

 Score =   484 bits (1247),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/295 (78%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV  LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVTFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  KNPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SD+YSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+G
Sbjct  270  HLTARSDIYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV +L  LKDY ++ M TF Y  P 
Sbjct  330  QYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIAMGTFTYTVPN  384



>ref|XP_006297624.1| hypothetical protein CARUB_v10013644mg [Capsella rubella]
 gb|EOA30522.1| hypothetical protein CARUB_v10013644mg [Capsella rubella]
Length=464

 Score =   484 bits (1246),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/295 (78%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  93   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  151  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  211  KNPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SD+YSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+G
Sbjct  271  HLTARSDIYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEG  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R   RP MS VV +L  LK+Y ++PM TF Y  P 
Sbjct  331  QYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKEYNDIPMGTFTYTVPN  385



>ref|XP_010541992.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=442

 Score =   481 bits (1237),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 236/295 (80%), Positives = 256/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFGQVHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+CLGQL+HP+
Sbjct  88   FLGEGGFGQVHKGFIDDKLRPGLKAQPVAVKNLDPDGL--QGHREWLTEVICLGQLKHPN  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLENQLFRR S SLPW TRMKIA GAAKGL FLH A
Sbjct  146  LVKLIGYCCEEEHRLLVYEFMPRGSLENQLFRRYSVSLPWTTRMKIAHGAAKGLQFLHEA  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKPII+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  206  EKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  265

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RI DPRL+G
Sbjct  266  HLTARSDVYSFGVVLLELLTGRRSVDKKRSQREQNLVDWARPMLNDPRKLSRITDPRLEG  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             +S  GARKAA L+Y CLS R   RPTMS VV VL+ +KDYK++PM  F+Y   +
Sbjct  326  QFSVAGARKAAALAYNCLSHRPKNRPTMSSVVAVLDDVKDYKDIPMGPFVYTVSS  380



>gb|KHG16004.1| hypothetical protein F383_02714 [Gossypium arboreum]
Length=462

 Score =   480 bits (1235),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 225/295 (76%), Positives = 255/295 (86%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DD LRPGL+AQPVA+K LD +    QGHREWLTEVV L QL HPH
Sbjct  90   FLGEGGFGPVHKGFIDDNLRPGLEAQPVAVKLLDLEGL--QGHREWLTEVVFLAQLSHPH  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYMPRGSLENQLF + S  LPW+TRMKIA+GAAKGLA+LH A
Sbjct  148  LVKLIGYCCEDEHRLLVYEYMPRGSLENQLFAKYSVPLPWSTRMKIALGAAKGLAYLHEA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGD THVSTRVMGT+GYAAPEYIMTG
Sbjct  208  EKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDKTHVSTRVMGTRGYAAPEYIMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK+R PREQNL +WARP L + R+L RIMDP+L+G
Sbjct  268  HLTAMSDVYSFGVVLLELLTGRRSLDKSRSPREQNLAEWARPMLNESRRLARIMDPKLEG  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R+  RP MS+VV +LEPL DY+E  + TF+Y  PT
Sbjct  328  QYSETGARKAAALAYQCLSHRAKQRPKMSDVVNILEPLLDYEETSVGTFVYTVPT  382



>gb|KDP33918.1| hypothetical protein JCGZ_07489 [Jatropha curcas]
Length=471

 Score =   479 bits (1234),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/295 (78%), Positives = 261/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LGQLRHPH
Sbjct  84   FIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREWLTEVIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TR+KIA+GAAKGLAFLH +
Sbjct  142  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRIKIALGAAKGLAFLHES  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEG DTHVSTRVMGTQGYAAPEYIMTG
Sbjct  202  EKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGSDTHVSTRVMGTQGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVL+ELLTGR+S+DK+RP REQ L++WARP L D RKL RIMDPRL+G
Sbjct  262  HLTSMSDVYSFGVVLVELLTGRRSVDKSRPQREQKLIEWARPMLNDSRKLGRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            MYSE GA++AA L+Y+CLS R   RPTMS V+K+LEPL + K++P+ TF+Y  PT
Sbjct  322  MYSEAGAQQAAALAYQCLSHRPKHRPTMSTVIKILEPLMESKDIPVGTFVYTVPT  376



>ref|XP_006396126.1| hypothetical protein EUTSA_v10002520mg [Eutrema salsugineum]
 gb|ESQ36905.1| hypothetical protein EUTSA_v10002520mg [Eutrema salsugineum]
Length=462

 Score =   478 bits (1231),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 230/295 (78%), Positives = 249/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGFVDDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFVDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L D RKL RIMDPRL+G
Sbjct  270  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDARKLCRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE  A+KAA L+Y CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  330  QYSEIAAKKAASLAYLCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPN  384



>gb|KHG00343.1| hypothetical protein F383_18271 [Gossypium arboreum]
Length=451

 Score =   478 bits (1229),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 234/295 (79%), Positives = 257/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ L +LRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVIFLAELRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPWATRMKIA+GAAKGLA+LH A
Sbjct  142  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWATRMKIALGAAKGLAYLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  202  EKPVIYRDFKASNILLDSDYNGKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R PREQNLV+WARP L D RKL RIMDPRL+G
Sbjct  262  HLTAMSDVYSFGVVLLELLTGRRSVDKNRCPREQNLVEWARPMLNDARKLGRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE  ARKAA L+Y+CLS R   RP MS+VVK LEPL+D ++V +  F+Y  PT
Sbjct  322  QYSETAARKAAALAYQCLSHRPKQRPKMSDVVKTLEPLQDDEDVLVGPFVYTVPT  376



>ref|XP_009124269.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
 emb|CDX74646.1| BnaA04g07430D [Brassica napus]
Length=450

 Score =   476 bits (1225),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/296 (77%), Positives = 254/296 (86%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEV+ LG+L+HP+
Sbjct  93   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREWLTEVIFLGKLKHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLE+QLFRR S SLPW TRMKIA GAAKGL FLH A
Sbjct  151  LVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSISLPWLTRMKIAHGAAKGLQFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+ 
Sbjct  271  HLTAKSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLGRIMDPRLED  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CLS R N RP +S VV  L+ +KDY  ++P+ TF Y   +
Sbjct  331  QYSETGARKAAALAYQCLSYRPNRRPCISTVVSALQDIKDYGDDIPIGTFTYTVSS  386



>ref|XP_009762767.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
sylvestris]
Length=461

 Score =   476 bits (1224),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/295 (75%), Positives = 259/295 (88%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLG+GGFG VHKGF+DDK++PGLKAQPVA+K LD D   +QGH+EWLTEVV LGQLRHPH
Sbjct  96   FLGKGGFGPVHKGFIDDKIKPGLKAQPVAVKLLDLD--GNQGHQEWLTEVVFLGQLRHPH  153

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+QRLLVYEYM RG+LEN LF R S+ LPW+TR+KIA+GAAKGLAFLHG 
Sbjct  154  LVKLIGYCWEEEQRLLVYEYMARGNLENHLFSRYSSCLPWSTRIKIAVGAAKGLAFLHGE  213

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  214  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  273

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLEL+TGR ++DK RP RE+NLVDWARP L+D  KL RIMDPRL+G
Sbjct  274  HLTSKSDVYSFGVVLLELITGRPAMDKNRPIRERNLVDWARPMLRDSHKLDRIMDPRLEG  333

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            +YS +GA+K A L+Y+CLS +  +RPTMS VVK LEP+ + K++P+  F+YV P+
Sbjct  334  LYSTEGAKKVAALAYQCLSHQPRSRPTMSNVVKSLEPVSELKDIPIGPFVYVVPS  388



>ref|XP_010273843.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nelumbo 
nucifera]
Length=481

 Score =   476 bits (1225),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 225/295 (76%), Positives = 256/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKL+PGLKAQPVA+K ++ +    QGHREWLTEV+ LGQLRHPH
Sbjct  84   FLGEGGFGPVHKGFIDDKLKPGLKAQPVAVKLMNLEGT--QGHREWLTEVIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM RGSLENQLFRR SASLPW TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEDEHRLLVYEYMVRGSLENQLFRRYSASLPWLTRMKIALGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGT GYAAPEY+MTG
Sbjct  202  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDETHVSTRVMGTHGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R PREQ+LVDW RP L D RKL RIMDPRL+G
Sbjct  262  HLTAKSDVYSFGVVLLELLTGRRSVDKNRGPREQSLVDWGRPLLNDVRKLDRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA KA  L++KCLS+   +RPTMS VV+ LE ++   ++P+ TF+Y+APT
Sbjct  322  QYSVKGAMKAGALAFKCLSRNPKSRPTMSSVVETLELIQKLDDIPVGTFVYIAPT  376



>gb|EPS67912.1| hypothetical protein M569_06861, partial [Genlisea aurea]
Length=391

 Score =   471 bits (1213),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/291 (76%), Positives = 258/291 (89%), Gaps = 2/291 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREWLTEVV LGQLRH +
Sbjct  77   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLD--GGQGHREWLTEVVFLGQLRHRN  134

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TRMKIA+GAAKGL FLH A
Sbjct  135  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRFSVSLPWSTRMKIAIGAAKGLGFLHEA  194

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+IFRDFKASNILLDSD+ AKLSDFGLAKDGP+GDDTHVSTR++GT GYAAPEYI+TG
Sbjct  195  ENPVIFRDFKASNILLDSDFTAKLSDFGLAKDGPDGDDTHVSTRILGTHGYAAPEYILTG  254

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTAASDVYSFGVVLLEL+TGRKS+DK+RP REQNLV+WA+P LK+PR+L R++DPRL+G
Sbjct  255  HLTAASDVYSFGVVLLELITGRKSVDKSRPSREQNLVEWAKPMLKNPRRLPRVIDPRLEG  314

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLY  874
             Y E GA+KAA L+Y+CLSQR   RPT+ +V+++LE LKD  ++ + T+++
Sbjct  315  QYPEAGAQKAAELAYQCLSQRPKLRPTIRQVIQILETLKDLDDMQIGTYVF  365



>gb|KFK22322.1| hypothetical protein AALP_AAs55656U000100 [Arabis alpina]
Length=428

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 225/296 (76%), Positives = 255/296 (86%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DD+LRPGLKAQPVA+K LD D    QGHREWLTEVV LGQL+HP+
Sbjct  81   FLGEGGFGPVHKGFIDDRLRPGLKAQPVAVKLLDLDGL--QGHREWLTEVVFLGQLKHPN  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYE+MPRGSLE+QLFRR S SLPW+TRMKIA GAAKGL FLH A
Sbjct  139  LVKLIGYCCEDEHRLLVYEFMPRGSLESQLFRRYSVSLPWSTRMKIAHGAAKGLQFLHEA  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGTQGYAAPEYIMTG
Sbjct  199  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S++K R  REQNLVDWARP L +PRKL RIMDPRL+G
Sbjct  259  HLTAKSDVYSFGVVLLELLTGRRSVNKKRATREQNLVDWARPMLNEPRKLGRIMDPRLEG  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             +SE GARKAA L+Y+CLS R   RP +S VV +L+ +K Y  ++P+ TF Y   +
Sbjct  319  QFSESGARKAAALAYQCLSYRPKNRPCISTVVSILQDIKAYNDDIPIGTFTYTVSS  374



>ref|XP_006395963.1| hypothetical protein EUTSA_v10004211mg [Eutrema salsugineum]
 gb|ESQ33249.1| hypothetical protein EUTSA_v10004211mg [Eutrema salsugineum]
Length=448

 Score =   473 bits (1216),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 230/297 (77%), Positives = 256/297 (86%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLR GLKAQPVA+K LD D    QGHREWLTEV+ LG+L+HP+
Sbjct  92   FLGEGGFGPVHKGFIDDKLRLGLKAQPVAVKLLDLDGF--QGHREWLTEVIFLGKLKHPN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLE+QLFRR S SLPW TRMKIA GAAKGL FLH A
Sbjct  150  LVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSISLPWLTRMKIAHGAAKGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDS+Y AKLSDFGLAKDGPEGD+THVSTRVMGTQGYAAPEYIMTG
Sbjct  210  EKPVIYRDFKASNILLDSNYTAKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L DPRKL RIMDPRL+ 
Sbjct  270  HLTAKSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLGRIMDPRLED  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLY-VAPT  886
             YSE GARKAA L+Y+CLS R   RP +S VV VL+ +KDY  ++P+ TF Y VAP+
Sbjct  330  QYSETGARKAAALAYQCLSYRPKNRPCISNVVSVLQEIKDYSDDIPIGTFTYTVAPS  386



>ref|XP_004141072.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cucumis sativus]
Length=360

 Score =   468 bits (1203),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 219/292 (75%), Positives = 252/292 (86%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGF+DD LRPGL  QPVAIK LD D    QGHREWLTEV+ LGQL+H H
Sbjct  61   FLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDGT--QGHREWLTEVIFLGQLKHAH  118

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYEYMPRGSLENQLF++ S  LPW+TRMKIA+GAAKGLAFLH A
Sbjct  119  LVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLPWSTRMKIALGAAKGLAFLHEA  178

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASN+LLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGT GYAAPEYIMTG
Sbjct  179  DKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNTHVSTRVMGTHGYAAPEYIMTG  238

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S++K+   R+QNL +WARP L DPRKL RI+DPRL+G
Sbjct  239  HLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEWARPMLNDPRKLSRIIDPRLEG  298

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YSE GA+KAA L+Y+CLS R   RP+MS VVKVLEPLKD+ ++   TF+Y 
Sbjct  299  QYSEMGAQKAASLAYQCLSHRPKQRPSMSSVVKVLEPLKDFDDISSGTFVYT  350



>ref|XP_008459841.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
melo]
Length=385

 Score =   468 bits (1204),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 220/292 (75%), Positives = 252/292 (86%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGF+DD LRPGL  QPVAIK LD D    QGHREWLTEV+ LGQL+H H
Sbjct  86   FLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDGT--QGHREWLTEVIFLGQLKHAH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYEYMPRGSLENQLF++ S  LPW+TRMKIA+GAAKGLAFLH A
Sbjct  144  LVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLPWSTRMKIALGAAKGLAFLHEA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASN+LLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGT GYAAPEYIMTG
Sbjct  204  DKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNTHVSTRVMGTHGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S++K+   R+QNL +WARP L DPRKL RI+DPRL+G
Sbjct  264  HLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEWARPMLNDPRKLSRIIDPRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YSE GA+KAA L+Y+CLS R   RPTMS VVKVLEPLKD+ ++   TF+Y 
Sbjct  324  QYSEMGAQKAASLAYQCLSHRPKQRPTMSAVVKVLEPLKDFDDISSGTFVYT  375



>ref|XP_004157966.1| PREDICTED: putative receptor-like protein kinase At1g72540-like, 
partial [Cucumis sativus]
Length=338

 Score =   466 bits (1199),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/292 (75%), Positives = 252/292 (86%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGF+DD LRPGL  QPVAIK LD D    QGHREWLTEV+ LGQL+H H
Sbjct  39   FLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDGT--QGHREWLTEVIFLGQLKHAH  96

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYEYMPRGSLENQLF++ S  LPW+TRMKIA+GAAKGLAFLH A
Sbjct  97   LVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLPWSTRMKIALGAAKGLAFLHEA  156

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASN+LLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGT GYAAPEYIMTG
Sbjct  157  DKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNTHVSTRVMGTHGYAAPEYIMTG  216

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S++K+   R+QNL +WARP L DPRKL RI+DPRL+G
Sbjct  217  HLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEWARPMLNDPRKLSRIIDPRLEG  276

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YSE GA+KAA L+Y+CLS R   RP+MS VVKVLEPLKD+ ++   TF+Y 
Sbjct  277  QYSEMGAQKAASLAYQCLSHRPKQRPSMSSVVKVLEPLKDFDDISSGTFVYT  328



>gb|KGN60504.1| hypothetical protein Csa_2G000130 [Cucumis sativus]
Length=385

 Score =   468 bits (1203),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/292 (75%), Positives = 252/292 (86%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGF+DD LRPGL  QPVAIK LD D    QGHREWLTEV+ LGQL+H H
Sbjct  86   FLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDGT--QGHREWLTEVIFLGQLKHAH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYEYMPRGSLENQLF++ S  LPW+TRMKIA+GAAKGLAFLH A
Sbjct  144  LVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLPWSTRMKIALGAAKGLAFLHEA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASN+LLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGT GYAAPEYIMTG
Sbjct  204  DKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNTHVSTRVMGTHGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S++K+   R+QNL +WARP L DPRKL RI+DPRL+G
Sbjct  264  HLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEWARPMLNDPRKLSRIIDPRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YSE GA+KAA L+Y+CLS R   RP+MS VVKVLEPLKD+ ++   TF+Y 
Sbjct  324  QYSEMGAQKAASLAYQCLSHRPKQRPSMSSVVKVLEPLKDFDDISSGTFVYT  375



>ref|XP_006282611.1| hypothetical protein CARUB_v10004829mg [Capsella rubella]
 gb|EOA15509.1| hypothetical protein CARUB_v10004829mg [Capsella rubella]
Length=440

 Score =   469 bits (1208),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 226/296 (76%), Positives = 253/296 (85%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREW+TEV+CLG+L+HP+
Sbjct  82   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREWMTEVMCLGKLKHPN  139

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLE+QLFRR S  LPW+TR+KIA  AAKGL FLH A
Sbjct  140  LVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSLPLPWSTRLKIAYEAAKGLQFLHEA  199

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GD THVSTRVMGTQGYAAPEYIMTG
Sbjct  200  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDATHVSTRVMGTQGYAAPEYIMTG  259

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQ+LVDWARP L D RKL RIMDPRL+ 
Sbjct  260  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQSLVDWARPMLNDARKLRRIMDPRLED  319

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE-VPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDYKE +P+ TF Y  PT
Sbjct  320  QYSEAGARKAATLAYQCLRYRPKTRPDISMVVSVLQDIKDYKEDIPIGTFTYTVPT  375



>emb|CDY33401.1| BnaA07g04380D [Brassica napus]
Length=457

 Score =   469 bits (1207),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGFVDDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFVDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP LKD RKL RIMDPRL+G
Sbjct  270  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLKDARKLDRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GA+KAA L+Y CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  330  QYSETGAKKAAALAYLCLSHRPKNRPCMSTVVSILNDLKDYNDIPMGTFTYTVPN  384



>ref|XP_009102353.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
Length=457

 Score =   469 bits (1206),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGFVDDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFVDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP LKD RKL RIMDPRL+G
Sbjct  270  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLKDARKLDRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GA+KAA L+Y CLS R   RP MS VV +L  LKDY ++PM TF Y  P 
Sbjct  330  QYSETGAKKAAALAYLCLSHRPKNRPCMSTVVSILNDLKDYNDIPMGTFTYTVPN  384



>emb|CDY65349.1| BnaCnng46760D [Brassica napus]
Length=457

 Score =   469 bits (1206),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGFVDDKLRPGLKAQPVA+K LD +    QGHREWLTEV+ LGQL+H +
Sbjct  92   FLGEGGFGPVHKGFVDDKLRPGLKAQPVAVKLLDLEGL--QGHREWLTEVMFLGQLKHKN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ R LVYE+MPRGSLENQLFRR SASLPW+TRMKIA GAA GL FLH A
Sbjct  150  LVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  210  ENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP LKD RKL RIMDPRL+G
Sbjct  270  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLKDARKLDRIMDPRLEG  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GA+KAA L+Y CLS R   RP MS VV +L+ LKDY ++PM TF Y  P 
Sbjct  330  QYSETGAKKAAALAYLCLSHRPKNRPCMSTVVSILDDLKDYNDIPMGTFTYTVPN  384



>ref|XP_010450389.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=447

 Score =   468 bits (1203),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 252/296 (85%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREW+TEV+CLG+L+HP+
Sbjct  93   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREWMTEVMCLGKLKHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLE+QLFRR S  LPW+TR+KIA  AAKGL FLH A
Sbjct  151  LVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSLPLPWSTRLKIAYEAAKGLQFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GD THVSTRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDATHVSTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQ+LVDWARP L D RKL RIMDPRL+ 
Sbjct  271  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQSLVDWARPMLNDARKLGRIMDPRLED  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDY  ++P+ TF Y  PT
Sbjct  331  QYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYNDDIPIGTFTYTVPT  386



>gb|EYU28327.1| hypothetical protein MIMGU_mgv1a006430mg [Erythranthe guttata]
Length=444

 Score =   467 bits (1202),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 228/294 (78%), Positives = 258/294 (88%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG+VHKGFVDDK+RPGLKAQPVA+K +D D    QGHREWLTEV+ LGQLRH H
Sbjct  86   FLGEGGFGKVHKGFVDDKIRPGLKAQPVAVKAMDPD--GKQGHREWLTEVIFLGQLRHAH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR S SLPW+TR+KIA+GAAKGLAFLH +
Sbjct  144  LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRFSVSLPWSTRIKIAIGAAKGLAFLHES  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
             KP+I+RDFKASNILLDSDY +KLSDFGLAKDGPEGD+THVSTRVMGT+GYAAPEYIMTG
Sbjct  204  AKPVIYRDFKASNILLDSDYTSKLSDFGLAKDGPEGDETHVSTRVMGTEGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ASDVYSFGV+LLELLTGRKS+DK R  REQ L +WARP LK+PRKL R MDPRL+G
Sbjct  264  HLTSASDVYSFGVLLLELLTGRKSVDKNRSYREQILAEWARPMLKNPRKLIRAMDPRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVA  880
             Y E  A++AA L+Y+CLS R   RPTMSEVVKVLE LKD+  EV M TF++V+
Sbjct  324  QYPERAAQEAAALAYRCLSHRPKLRPTMSEVVKVLESLKDFDNEVSMGTFVFVS  377



>ref|XP_011019325.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Populus 
euphratica]
 ref|XP_011019326.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Populus 
euphratica]
Length=449

 Score =   467 bits (1202),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 221/295 (75%), Positives = 254/295 (86%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDK+RPGL AQPVA+K LD D    QGH+EW+ E++ LGQLRH H
Sbjct  82   LLGEGGFGPVYKGFVDDKVRPGLDAQPVAVKSLDLDGL--QGHKEWMAEIIFLGQLRHSH  139

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRR SA+LPW+TRMKIA+GAAKGLAFLH +
Sbjct  140  LVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRYSAALPWSTRMKIALGAAKGLAFLHES  199

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFK+SNILLDSDY AKLSDFGLAKDGPEG++THV+TRVMGTQGYAAPEYIMTG
Sbjct  200  DKPVIYRDFKSSNILLDSDYTAKLSDFGLAKDGPEGEETHVTTRVMGTQGYAAPEYIMTG  259

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+D TRP REQ+LV+WARP LKD  KL RIMDPRL+G
Sbjct  260  HLTTMSDVYSFGVVLLELLTGKRSMDNTRPGREQSLVEWARPLLKDASKLDRIMDPRLEG  319

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+KAA L+YKCLS     RP MS VV+VLE L+D+ E  +  F+Y+ PT
Sbjct  320  QYSTKGAQKAAALAYKCLSHHPKPRPMMSYVVEVLESLQDFDETFIQPFVYIVPT  374



>ref|XP_010435442.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=447

 Score =   467 bits (1201),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 252/296 (85%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHREW+TEV+CLG+L+HP+
Sbjct  93   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREWMTEVMCLGKLKHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLE+QLFRR S  LPW+TR+KIA  AAKGL FLH A
Sbjct  151  LVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSLPLPWSTRLKIAYEAAKGLQFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GD THVSTRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDATHVSTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQ+LVDWARP L D RKL RIMDPRL+ 
Sbjct  271  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQSLVDWARPMLNDARKLGRIMDPRLED  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDY  ++P+ TF Y  PT
Sbjct  331  QYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYNDDIPIGTFTYTVPT  386



>ref|NP_001234561.1| auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum]
 gb|AAK62821.1|AF332960_1 auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum]
 gb|ACZ71039.1| auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum]
Length=464

 Score =   468 bits (1203),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 219/295 (74%), Positives = 255/295 (86%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLG+GGFG VHKGF+DDK++PGL AQPVA+K LD D   +QGH+EWLTEVV LGQLRH H
Sbjct  90   FLGKGGFGPVHKGFIDDKIKPGLDAQPVAVKLLDLD--GNQGHQEWLTEVVFLGQLRHHH  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+QRLLVYEYM RG+LE+QLF R S+ LPW TR+KI +GAAKGLAFLHG 
Sbjct  148  LVKLIGYCWEEEQRLLVYEYMARGNLEDQLFSRYSSCLPWLTRIKIMVGAAKGLAFLHGE  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  208  EKPVIYRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLEL+TGR+++DK RP +E+ LVDWARP L+DP KL RIMDPRL+G
Sbjct  268  HLTSKSDVYSFGVVLLELITGRRAMDKKRPLKERILVDWARPMLRDPHKLDRIMDPRLEG  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+K A L+Y+CLS    +RPTMS +VK+LEP+ D K++PM  F+YV P+
Sbjct  328  QYSTQGAKKVAALAYQCLSHHPRSRPTMSNIVKILEPVLDMKDIPMGPFVYVVPS  382



>ref|XP_006357404.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=464

 Score =   467 bits (1202),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 219/295 (74%), Positives = 256/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLG+GGFG VHKGF+DDK++PGL AQPVA+K LD D   +QGH+EWLTEVV LGQLRH H
Sbjct  90   FLGKGGFGPVHKGFIDDKIKPGLDAQPVAVKLLDLD--GNQGHQEWLTEVVFLGQLRHHH  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+QRLLVYEYM RG+LE+QLF R S+ LPW TR+KI +GAAKGLAFLHG 
Sbjct  148  LVKLIGYCWEEEQRLLVYEYMARGNLEDQLFSRYSSCLPWLTRIKIMVGAAKGLAFLHGE  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  208  EKPVIYRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLEL+TGR+++DK RP +E+ LVDWARP L+DP KL RIMDPRL+G
Sbjct  268  HLTSKSDVYSFGVVLLELITGRQAMDKKRPLKERILVDWARPMLRDPHKLDRIMDPRLEG  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+K A L+Y+CLS +  +RPTMS +VK+LEP+ D K++PM  F+YV P+
Sbjct  328  QYSTQGAKKVAALAYQCLSHQPRSRPTMSNIVKILEPVLDMKDIPMGPFVYVVPS  382



>ref|XP_010440738.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=447

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 223/296 (75%), Positives = 252/296 (85%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGL+AQPVA+K LD D    QGHREW+TEV+CLG+L+HP+
Sbjct  93   FLGEGGFGPVHKGFIDDKLRPGLQAQPVAVKLLDLDGL--QGHREWMTEVMCLGKLKHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLE+QLFRR S  LPW+TR+KIA  AAKGL FLH A
Sbjct  151  LVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSLPLPWSTRLKIAYEAAKGLQFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GD THVSTRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDATHVSTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQ+LVDWARP L D RKL RIMDPRL+ 
Sbjct  271  HLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQSLVDWARPMLNDARKLGRIMDPRLED  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDY  ++P+ TF Y  PT
Sbjct  331  QYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYNDDIPIGTFTYTVPT  386



>ref|XP_009612481.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
tomentosiformis]
Length=460

 Score =   467 bits (1201),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 258/295 (87%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLG+GGFG VHKGF+DDK++PGLKAQPVA+K LD D   +QGH+EWLTEVV LGQLRHPH
Sbjct  95   FLGKGGFGPVHKGFIDDKIKPGLKAQPVAVKLLDLD--GNQGHQEWLTEVVFLGQLRHPH  152

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKL+GYC E++QR+LVYEYM RG+LENQLF R S+ LPW+TR+KIA+GAAKGLAFLHG 
Sbjct  153  LVKLMGYCWEDEQRILVYEYMARGNLENQLFSRYSSCLPWSTRIKIAVGAAKGLAFLHGE  212

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  213  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  272

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT+ SDVYSFGVVLLEL+TGR ++DK+R  RE+NLVDWARP L+D  KL RIMD RL+G
Sbjct  273  HLTSKSDVYSFGVVLLELITGRPAMDKSRHIRERNLVDWARPMLRDSHKLDRIMDSRLEG  332

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GA+K A L+Y+CLS +  +RPTMS VVK LEP+ + K++P+  F+YV P+
Sbjct  333  QYSTEGAKKVAALAYQCLSHQPRSRPTMSNVVKALEPVLELKDIPIGPFVYVVPS  387



>ref|XP_002309457.2| hypothetical protein POPTR_0006s23590g [Populus trichocarpa]
 gb|EEE92980.2| hypothetical protein POPTR_0006s23590g [Populus trichocarpa]
Length=444

 Score =   465 bits (1197),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 220/295 (75%), Positives = 253/295 (86%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKLRPGL AQPVA+K LD D    QGH+EW+ E++ LGQLRH H
Sbjct  79   LLGEGGFGPVYKGFVDDKLRPGLDAQPVAVKSLDLDGL--QGHKEWMAEIIFLGQLRHSH  136

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V+LIGYCCEEDQRLLVYEYMPRGSLENQLFRR SA+LPW+TRMKIA+GAAKGLAFLH +
Sbjct  137  LVRLIGYCCEEDQRLLVYEYMPRGSLENQLFRRYSAALPWSTRMKIALGAAKGLAFLHES  196

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFK+SNILLDSDY AKLSDFGLAKDGPEG++THV+TRVMGTQGYAAPEYIMTG
Sbjct  197  DKPVIYRDFKSSNILLDSDYTAKLSDFGLAKDGPEGEETHVTTRVMGTQGYAAPEYIMTG  256

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+D TRP REQ+LV+WARP LKD  KL RIMDPRL+G
Sbjct  257  HLTTMSDVYSFGVVLLELLTGKRSMDNTRPGREQSLVEWARPLLKDASKLDRIMDPRLEG  316

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+KAA L+YKCLS     RP MS VV+VLE L+ + E  +  F+Y+ PT
Sbjct  317  QYSTKGAQKAAALAYKCLSHHPKPRPMMSHVVEVLESLQGFDETFIQPFVYIVPT  371



>ref|XP_009599916.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
tomentosiformis]
Length=465

 Score =   466 bits (1199),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 220/295 (75%), Positives = 254/295 (86%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDK++PGLKAQPVA+K LD +    QGH EWLTEVV LGQLRHP+
Sbjct  93   FLGEGGFGPVHKGFIDDKIKPGLKAQPVAVKLLDLE--GSQGHLEWLTEVVLLGQLRHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++QRLLVYEYM RG+LENQLFRR S+SLPW TRM IA+ AAKGLAFLHG 
Sbjct  151  LVKLIGYCWEDEQRLLVYEYMARGNLENQLFRRCSSSLPWLTRMNIAVDAAKGLAFLHGE  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG DTHV+TRVMGT GYAAPEY+MTG
Sbjct  211  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGSDTHVTTRVMGTYGYAAPEYMMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            +LT+ SDVYSFGVVLLELLTGR+ IDK RP REQNLV+WARP LKD  KL RIMDPRL+G
Sbjct  271  YLTSKSDVYSFGVVLLELLTGRQVIDKKRPSREQNLVEWARPFLKDSHKLDRIMDPRLEG  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+K   L+Y+CLSQ+  +RPTM+ VVK+LEP+ D K++P+  F+YV P+
Sbjct  331  QYSTQGAKKVVALTYQCLSQQPKSRPTMTNVVKILEPILDLKDIPIGPFVYVVPS  385



>ref|XP_011072653.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Sesamum 
indicum]
Length=450

 Score =   465 bits (1196),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 214/295 (73%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGFVDDK RPGL+AQPVA+K LD D   DQGHREWLTEVV LGQLRHP+
Sbjct  84   FLGEGGFGPVHKGFVDDKCRPGLEAQPVAVKLLDHD--GDQGHREWLTEVVLLGQLRHPN  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM RG+LEN LFRR S+ LPW TRMKIA+GAAKGLAFLHG 
Sbjct  142  LVKLIGYCCEDEHRLLVYEYMARGNLENHLFRRYSSPLPWLTRMKIAIGAAKGLAFLHGE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSD  AKLSDFGLAKDGPEGDDTHVSTR+MGT GYAAPEY+MTG
Sbjct  202  EKPVIYRDFKTSNILLDSDCNAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  +DVYSFGVVLLELLTG++++DK RP REQNLV+WA+P LKD  KL R+MDPRL+G
Sbjct  262  HLTTMNDVYSFGVVLLELLTGKRAMDKKRPAREQNLVEWAKPYLKDHHKLDRLMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +G +K A L+++CL+    +RP+M  V+K+LEP+  Y ++P   F+Y+APT
Sbjct  322  QYSSEGTKKVAALAHQCLNHYPKSRPSMKHVIKILEPILKYTDIPAGPFIYIAPT  376



>ref|XP_002280196.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 ref|XP_010648396.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 ref|XP_010648397.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
Length=440

 Score =   464 bits (1193),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 214/294 (73%), Positives = 254/294 (86%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+D+KLRP LKAQPVA+K LD D    QGHREWL E++ LGQLRHPH
Sbjct  84   LLGEGGFGPVYKGFIDEKLRPKLKAQPVAVKLLDLDGL--QGHREWLAEIIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLL+YEYM RGSLENQLFRR SA+LPW+ RMKI  GAAKGLAFLH  
Sbjct  142  LVKLIGYCCEDEHRLLIYEYMARGSLENQLFRRYSAALPWSARMKILFGAAKGLAFLHEG  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLD DY AKLSDFGLAKDGPEGD+THVSTR+MGT GYAAPEYIMTG
Sbjct  202  DKPVIYRDFKASNILLDPDYTAKLSDFGLAKDGPEGDETHVSTRIMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLE+++G++S+DKTRP REQNLV+WARP LKDPRKL R++D RL+G
Sbjct  262  HLTTMSDVYSFGVVLLEVISGKRSMDKTRPSREQNLVEWARPMLKDPRKLDRVIDSRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            ++S  GA+KAA L+YKCLS ++ ARP MS+VVK+LEPL+D+ +  +  F+YV P
Sbjct  322  LFSTKGAQKAAELAYKCLSHQAKARPAMSDVVKILEPLQDFDDTVISPFVYVVP  375



>ref|XP_009409118.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=431

 Score =   462 bits (1190),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDK++PGLKAQ VA+K LD +    QGH+EWLTEVV LGQLRH H
Sbjct  83   FLGEGGFGPVYKGFVDDKVKPGLKAQAVAVKVLDLE--GSQGHKEWLTEVVFLGQLRHSH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYE+M RGSLEN LF+R  ASLPW+TR+KIA+GAAKGLAFLH  
Sbjct  141  LVKLIGYCCEDEHRLLVYEFMTRGSLENHLFKRYFASLPWSTRLKIAIGAAKGLAFLHDI  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGPEGD+THVSTR+MGTQGYAAPEYI+TG
Sbjct  201  EKPVIYRDFKASNILLDSDYEVKLSDFGLAKDGPEGDETHVSTRIMGTQGYAAPEYILTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVY FGVVLLELLTGR+S+DK RP REQNLV+WARP L DPRKL RIMDP L G
Sbjct  261  HLTVKSDVYGFGVVLLELLTGRRSVDKKRPSREQNLVEWARPCLNDPRKLNRIMDPGLCG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YSE GA+KAA ++YKCLS    +RP MS +V+ LEPL D K++P+  F+YV P 
Sbjct  321  QYSEQGAQKAAAVAYKCLSHHPKSRPQMSAIVETLEPLLDVKDMPIAPFVYVVPA  375



>ref|XP_010261848.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=478

 Score =   464 bits (1194),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 220/296 (74%), Positives = 253/296 (85%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKGF+DDKLRPGLKAQ VA+K LD +    QGHREWL EV+ LGQLRHP+
Sbjct  83   ILGEGGFGPVHKGFIDDKLRPGLKAQAVAVKLLDLEGL--QGHREWLAEVIFLGQLRHPN  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM RGSLENQLFRR SASLPW+TR+KIA+GAAKGL FLH A
Sbjct  141  LVKLIGYCCEDEHRLLVYEYMVRGSLENQLFRRYSASLPWSTRIKIALGAAKGLQFLHEA  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGTQGYAAPEY+MTG
Sbjct  201  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYVMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVV LE+LTGR+S+DK R PREQNLV+WARP L D RKL RIMDP+L+G
Sbjct  261  HLTKMSDVYSFGVVFLEMLTGRRSMDKNRGPREQNLVEWARPLLNDSRKLERIMDPKLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVAPT  886
             YS  GA+KAA L+Y+CLS    +RPTM  VVK LE ++ Y  ++P+  F+Y+AP+
Sbjct  321  QYSNKGAQKAAALAYQCLSHNPKSRPTMGIVVKTLELIQTYNNDIPIGPFVYIAPS  376



>ref|XP_002868426.1| hypothetical protein ARALYDRAFT_355547 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44685.1| hypothetical protein ARALYDRAFT_355547 [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   462 bits (1189),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 221/296 (75%), Positives = 250/296 (84%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DD+LRPGLKAQPVA+K LD D    QGHREW+TEV+CLG+L+HP+
Sbjct  93   FLGEGGFGPVHKGFIDDRLRPGLKAQPVAVKLLDLDGL--QGHREWMTEVMCLGKLKHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLE+QLFRR S  LPW TR+KIA  AAKGL FLH A
Sbjct  151  LVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLKIAYEAAKGLQFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+D  R  R++ LV+WARP L D RKL RIMDPRL+ 
Sbjct  271  HLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLED  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDYK ++P+  F Y  PT
Sbjct  331  QYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGVFTYTVPT  386



>ref|XP_011036441.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Populus 
euphratica]
Length=449

 Score =   459 bits (1180),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 214/295 (73%), Positives = 249/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG V+KGF+DDKLRPGLKAQPVA+K LD D    QGHREWL E++ LGQL+H H
Sbjct  77   YLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKVLDLD--GSQGHREWLAEIIFLGQLKHRH  134

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCEE+ RLLVYEY+ RG+LE++LF R SA+LPW TR+KIA+G AKGLAFLH  
Sbjct  135  LVNLIGYCCEEEHRLLVYEYIERGNLEDKLFNRYSAALPWLTRLKIAVGTAKGLAFLHEE  194

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASN+LLDSDY AKLSDFGLA DGPEGDDTHV+T VMGT+GYAAPEYIMTG
Sbjct  195  EKPVIYRDFKASNVLLDSDYNAKLSDFGLAMDGPEGDDTHVTTPVMGTEGYAAPEYIMTG  254

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDV+SFGVVLLELLTGR+S+DK RP REQNLV WARPQLKDPRKL +IMDPRL+G
Sbjct  255  HLTTMSDVFSFGVVLLELLTGRRSVDKNRPNREQNLVKWARPQLKDPRKLCQIMDPRLEG  314

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+Y+CLS    +RPTM  VVK LEPL    ++P+  F+Y+ P 
Sbjct  315  QYSTEGARKAAALAYQCLSHHPKSRPTMRTVVKTLEPLLALTDIPIGPFVYIVPN  369



>ref|XP_008778596.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=439

 Score =   458 bits (1179),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 211/292 (72%), Positives = 252/292 (86%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V KGF+DDKLRPGLKAQ VA+K LD +    QGHREWL EVV LGQL HPH
Sbjct  85   FIGSGGFGPVFKGFIDDKLRPGLKAQTVAVKSLDLEGT--QGHREWLAEVVFLGQLEHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+++RLLVYEYM RGSLEN LF++I ASLPW+TR+KIA+GAAKGL FLH A
Sbjct  143  LVKLIGYCCEDERRLLVYEYMARGSLENHLFKKILASLPWSTRIKIAVGAAKGLTFLHEA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILL+SDY AKLSDFGLAKDGPEG+DTHV+TRVMGTQGYAAPEY+MTG
Sbjct  203  QKPVIYRDFKASNILLNSDYTAKLSDFGLAKDGPEGEDTHVTTRVMGTQGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP REQNLV+WARP LK+  KL R+MDP L+G
Sbjct  263  HLTAKSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVEWARPFLKNANKLGRVMDPHLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
            +YS  GA+KAA ++Y+CLS    +RP M ++V+ LEPL ++ ++P+ TF+Y 
Sbjct  323  LYSTKGAQKAAAVAYQCLSHSPKSRPQMRDIVEELEPLLNFNDIPLGTFVYT  374



>ref|XP_009390860.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   458 bits (1178),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 214/295 (73%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V++GFVD+K++PGLK+QPVA+K LD D    QGH+EWL EV+ LG+LRHPH
Sbjct  78   FLGEGGFGPVYRGFVDEKVKPGLKSQPVAVKLLDLD--GGQGHKEWLAEVLVLGRLRHPH  135

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLEN LF+R    LPW  R++IA+GAAKGL FLH +
Sbjct  136  LVKLIGYCCEEEHRLLVYEFMPRGSLENHLFKRYYTPLPWLARLRIAVGAAKGLGFLHDS  195

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY+A+LSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  196  DKPVIYRDFKASNILLDSDYKARLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  255

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+ +DK RP REQNLV+WARP L DPRKLYRIMDP L+G
Sbjct  256  HLTAKSDVYSFGVVLLELLTGRRCVDKARPSREQNLVEWARPCLSDPRKLYRIMDPGLEG  315

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA++AA + Y+CLSQ   +RP MS +V+ LEPL D  +V + TF+YVAP 
Sbjct  316  QYSTQGAQRAAAVVYQCLSQSPKSRPHMSAIVEALEPLLDMNDVLLGTFVYVAPV  370



>emb|CDO97843.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   460 bits (1183),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 255/295 (86%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDD+ RPGLKAQPVA+K LD +    QG+REWLTEV+ LGQLRHPH
Sbjct  84   FLGEGGFGPVYKGFVDDRTRPGLKAQPVAVKLLDLEGT--QGYREWLTEVIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+  RLLVYEYM RG+LENQLFRR S SLPW TR++IA GAA+GLAFLHG 
Sbjct  142  LVKLIGYCCEDQHRLLVYEYMARGNLENQLFRRFSISLPWLTRIEIAAGAARGLAFLHGE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK+SNILLDSDY AKLSDFGLAKDGPEGDDTHV+TRVMGT GYAAPEYIMTG
Sbjct  202  EKPVIYRDFKSSNILLDSDYTAKLSDFGLAKDGPEGDDTHVTTRVMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++++DK+RP REQNLV+WARP LKD  K+ +IMDP+LDG
Sbjct  262  HLTTRSDVYSFGVVLLELLTGKRAVDKSRPSREQNLVEWARPLLKDLHKIDKIMDPKLDG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAP  883
             YS +GA+KAA L+Y+CLS R+ +RPTM  VVK+L+ + D K ++P+  F+Y+ P
Sbjct  322  QYSSEGAKKAATLAYQCLSHRARSRPTMDGVVKMLDNILDLKDDIPVGPFVYIVP  376



>ref|XP_011035727.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Populus 
euphratica]
Length=450

 Score =   458 bits (1179),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG V+KGF+DDKLRPGLKAQPVA+K LD D    QGHREWL EV+ LGQL+H H
Sbjct  78   YLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKALDPD--GSQGHREWLAEVIFLGQLKHRH  135

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEY+ RG+LE++LF R SA+LPW TR+KIA+GAAKGLAFLH  
Sbjct  136  LVNLIGYCCEDEHRLLVYEYVERGNLEDKLFCRYSAALPWLTRLKIAVGAAKGLAFLHEE  195

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASN+LLDSDY AKLSDFGLA DGPEGDDTH++T VMGT+GYAAPEYIMTG
Sbjct  196  EKPVIYRDFKASNVLLDSDYNAKLSDFGLATDGPEGDDTHITTCVMGTEGYAAPEYIMTG  255

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDV+SFGVVLLELLTGR+S+DK  P REQNLV WARPQLKDPRKL +IMDPRL+G
Sbjct  256  HLTTMSDVFSFGVVLLELLTGRRSLDKNLPNREQNLVKWARPQLKDPRKLEQIMDPRLEG  315

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+Y+CLS  S +RPTMS VV+ LE L D  + P  TF+Y+ PT
Sbjct  316  QYSTEGARKAAGLAYQCLSHHSKSRPTMSTVVRTLEQLLDLTDTPTGTFVYIVPT  370



>dbj|BAD94092.1| serine/threonine protein kinase-like [Arabidopsis thaliana]
Length=494

 Score =   459 bits (1181),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 221/296 (75%), Positives = 248/296 (84%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHRE++TEV+CLG+L+HP+
Sbjct  81   FLGEGGFGLVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREFMTEVMCLGKLKHPN  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE  RLLVYE+MPRGSLE+QLFRR S  LPW TR+ IA  AAKGL FLH A
Sbjct  139  LVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEA  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKPII+RDFKASNILLDSDY AKLSDFGLAKDGP+GDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  199  EKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+D  R  R++ LV+WARP L D RKL RIMDPRL+ 
Sbjct  259  HLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLED  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDYK ++P+  F Y  PT
Sbjct  319  QYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTVPT  374



>ref|NP_198408.2| Ser/Thr protein kinase ACIK1b [Arabidopsis thaliana]
 gb|AED93983.1| Ser/Thr protein kinase ACIK1b [Arabidopsis thaliana]
Length=494

 Score =   459 bits (1181),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 221/296 (75%), Positives = 248/296 (84%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHRE++TEV+CLG+L+HP+
Sbjct  81   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREFMTEVMCLGKLKHPN  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE  RLLVYE+MPRGSLE+QLFRR S  LPW TR+ IA  AAKGL FLH A
Sbjct  139  LVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEA  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKPII+RDFKASNILLDSDY AKLSDFGLAKDGP+GDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  199  EKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+D  R  R++ LV+WARP L D RKL RIMDPRL+ 
Sbjct  259  HLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLED  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDYK ++P+  F Y  PT
Sbjct  319  QYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTVPT  374



>dbj|BAO45889.1| receptor-like protein kinase [Acacia mangium]
Length=382

 Score =   454 bits (1169),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 213/293 (73%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKGF DDKLR GLKAQPVA+KRLD      QGHREWL E++ LGQL+HPH
Sbjct  84   LLGEGGFGPVHKGFFDDKLRRGLKAQPVAVKRLDLSGL--QGHREWLAEIIFLGQLQHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+ RLLVYEYMPRGSLENQLFRR SA LPW+TRMKIA+GAAKGLAFLH  
Sbjct  142  LVKLIGYCYEEEHRLLVYEYMPRGSLENQLFRRYSAVLPWSTRMKIALGAAKGLAFLHEV  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG++THV+TRVMGTQGYAAPEY+MTG
Sbjct  202  DKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEETHVTTRVMGTQGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYS+GVVLLELLTG++ +DK RP +E +LV+WARP L+DP+KLYR++DPRL+G
Sbjct  262  HLTTKSDVYSYGVVLLELLTGKRVVDKNRPSKEHSLVEWARPMLRDPKKLYRVIDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
             +   GARK A L+YKCLS   N RP MS+VV +LE L+ + +V +  F+YVA
Sbjct  322  QFPARGARKVAALAYKCLSHHPNPRPAMSDVVAILETLQGFDDVFIGPFVYVA  374



>ref|XP_009419910.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=439

 Score =   456 bits (1174),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 210/295 (71%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V+KG++DDKLRPGLK   VA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  77   FIGSGGFGPVYKGYIDDKLRPGLKEPHVAVKSLDLDGL--QGHREWLAEVIFLGQLRHPH  134

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYEYMPRGSLEN LF+R+ ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  135  LVKLIGYCCEDEHRMLVYEYMPRGSLENHLFKRLLASLPWSTRLKIAVGAAKGLAFLHEA  194

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY  KLSDFGLAKDGP+GD+THV+TRVMGT+GYAAPEY++TG
Sbjct  195  EKPVIYRDFKASNILLDSDYTVKLSDFGLAKDGPQGDNTHVTTRVMGTRGYAAPEYVLTG  254

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELL GR+ +DKTRP R++NLVDWARP L +  K+ R+MDP LDG
Sbjct  255  HLTAKSDVYSFGVVLLELLAGRRCVDKTRPNRQKNLVDWARPYLNNSDKISRVMDPNLDG  314

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+KAA ++YKCLS    +RP M+ VV+ LEPL +  +VP+ +F+YVAPT
Sbjct  315  QYSSKGAQKAAAIAYKCLSHNPKSRPNMTTVVETLEPLLNLSDVPVGSFVYVAPT  369



>dbj|BAB09992.1| serine/threonine protein kinase-like [Arabidopsis thaliana]
Length=464

 Score =   457 bits (1177),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 221/296 (75%), Positives = 248/296 (84%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDKLRPGLKAQPVA+K LD D    QGHRE++TEV+CLG+L+HP+
Sbjct  93   FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL--QGHREFMTEVMCLGKLKHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE  RLLVYE+MPRGSLE+QLFRR S  LPW TR+ IA  AAKGL FLH A
Sbjct  151  LVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKPII+RDFKASNILLDSDY AKLSDFGLAKDGP+GDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  211  EKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+D  R  R++ LV+WARP L D RKL RIMDPRL+ 
Sbjct  271  HLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIMDPRLED  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YSE GARKAA L+Y+CL  R   RP +S VV VL+ +KDYK ++P+  F Y  PT
Sbjct  331  QYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTVPT  386



>ref|XP_006369136.1| hypothetical protein POPTR_0001s16810g [Populus trichocarpa]
 gb|ERP65705.1| hypothetical protein POPTR_0001s16810g [Populus trichocarpa]
Length=450

 Score =   457 bits (1175),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG V+KGF+DDKLRPGLKAQPVA+K LD D    QGHREWL EV+ LGQL+H H
Sbjct  78   YLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKALDPD--GSQGHREWLAEVIFLGQLKHRH  135

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEY+ RG+LE++LF R SA+LPW TR+KIA+GAAKGLAFLH  
Sbjct  136  LVNLIGYCCEDEHRLLVYEYVERGNLEDKLFYRYSAALPWLTRLKIAVGAAKGLAFLHEE  195

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASN+LLDSDY AKLSDFGLA DGPEGD TH++T VMGT+GYAAPEYIMTG
Sbjct  196  EKPVIYRDFKASNVLLDSDYNAKLSDFGLATDGPEGDRTHITTPVMGTEGYAAPEYIMTG  255

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDV+SFGVVLLELLTGR+S+DK  P REQNLV WARPQLKDPRKL +IMDPRL+G
Sbjct  256  HLTTMSDVFSFGVVLLELLTGRRSVDKNLPNREQNLVKWARPQLKDPRKLEQIMDPRLEG  315

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+Y+CLS  S +RPTMS VV+ LE L D  + P  TF+Y+ PT
Sbjct  316  QYSTEGARKAAGLAYQCLSHHSKSRPTMSTVVRTLEQLLDLTDTPTGTFVYIVPT  370



>ref|XP_006361336.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=424

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG VHKGF+DDK++ GL AQPVA+K LD +   DQGH EWLTEVV LGQLRHP+
Sbjct  85   FLGEGGFGPVHKGFIDDKIKYGLDAQPVAVKLLDLE--GDQGHIEWLTEVVLLGQLRHPN  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E+ QRLLVYEYM RG+LENQLFRR S+SLPW TRMKIA  AAKGLAFLHG 
Sbjct  143  LVKLIGYCWEDKQRLLVYEYMARGNLENQLFRRCSSSLPWLTRMKIARDAAKGLAFLHGE  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG DTHV+TRVMGT GYAAPEY+MTG
Sbjct  203  KKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGSDTHVTTRVMGTYGYAAPEYMMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            +LT  SDVYS+GVVLLELLTGR++IDK R  REQNLV+WA+P L+D  KL RIMDPRL+G
Sbjct  263  YLTTRSDVYSYGVVLLELLTGRQAIDKKRASREQNLVEWAKPFLRDSHKLERIMDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+K A L+Y+CLS +  +RPTMS VVK+LEP+ D K++P+ +F+YV P+
Sbjct  323  EYSSQGAKKVATLAYQCLSHQPKSRPTMSNVVKILEPILDLKDIPIGSFVYVVPS  377



>ref|XP_002516154.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF46156.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=448

 Score =   456 bits (1173),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKLRPGL AQPVA+K LD D    QGH+EW+ E++ LGQLRH H
Sbjct  83   LLGEGGFGPVYKGFVDDKLRPGLAAQPVAVKSLDLDGL--QGHKEWMAEIIFLGQLRHQH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EEDQRLLVYEYMPRGSLENQLFRR SA+LPW+ RMKIA+GAAKGLAFLH  
Sbjct  141  LVKLIGYCSEEDQRLLVYEYMPRGSLENQLFRRYSAALPWSARMKIALGAAKGLAFLHET  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+I+RDFK+SNILLDSDY AKLSDFGLAKDGP+G++THV+TRVMGTQGYAAPEY+MTG
Sbjct  201  DPPVIYRDFKSSNILLDSDYIAKLSDFGLAKDGPDGEETHVTTRVMGTQGYAAPEYVMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVL+ELLTGR+S+D TRP R+QN+V+WARP LKD  KL RI+DPRL+G
Sbjct  261  HLTTMSDVYSFGVVLIELLTGRRSMDDTRPGRDQNIVEWARPLLKDLNKLDRIIDPRLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+KAA L+YKCLS     RPTMS VVKVLE L+D+ +  +  F+Y+ P 
Sbjct  321  QYSSSGAQKAAALAYKCLSHHPKPRPTMSYVVKVLESLQDFDDTFLAPFVYIVPN  375



>gb|KHN20154.1| Putative receptor-like protein kinase [Glycine soja]
Length=386

 Score =   453 bits (1166),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 253/292 (87%), Gaps = 2/292 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KGFVDDKLR GLKAQ VA+KRLD D    QGHREWL E++ LGQLRHPH+
Sbjct  87   LGEGGFGPVYKGFVDDKLRSGLKAQTVAVKRLDLDGL--QGHREWLAEIIFLGQLRHPHL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYC E++ RLL+YEYMPRGSLENQLFRR SA++PW+TRMKIA+GAAKGLAFLH A+
Sbjct  145  VKLIGYCYEDEHRLLMYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEAD  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            KP+I+RDFKASNILLDSD+ AKLSDFGLAKDGPEG+DTHV+TR+MGTQGYAAPEYIMTGH
Sbjct  205  KPVIYRDFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LT  SDVYS+GVVLLELLTGR+ +DK+R    ++LV+WARP L+D +K+Y I+D RL+G 
Sbjct  265  LTTKSDVYSYGVVLLELLTGRRVVDKSRSNEGKSLVEWARPLLRDQKKVYNIIDRRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            +   GA K A+L++KCLS   NARPTMS+V+KVLEPL+DY +V +  F+YVA
Sbjct  325  FPMKGAMKVAMLAFKCLSHHPNARPTMSDVIKVLEPLQDYDDVFIGPFVYVA  376



>ref|XP_002304131.1| hypothetical protein POPTR_0003s06450g [Populus trichocarpa]
 gb|EEE79110.1| hypothetical protein POPTR_0003s06450g [Populus trichocarpa]
Length=434

 Score =   455 bits (1170),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 213/295 (72%), Positives = 248/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG V+KGF+DDKLRPGLKAQPVA+K LD D    QGHREWL E++ LGQL+H H
Sbjct  77   YLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKVLDLDGS--QGHREWLAEIIFLGQLKHRH  134

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYC EE+ RLLVYEY+ RGSLEN+LF R SA+LPW TR+KIA+G AKGLAFLH  
Sbjct  135  LVNLIGYCGEEEHRLLVYEYIERGSLENKLFNRYSAALPWLTRLKIAVGTAKGLAFLHEE  194

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASN+LL+SDY AKLSDFGLA DGPEGDDTHV+T VMGT+GYAAPEYIMTG
Sbjct  195  EKPVIYRDFKASNVLLESDYNAKLSDFGLAMDGPEGDDTHVTTPVMGTEGYAAPEYIMTG  254

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDV+SFGVVLLEL+TGR+S+DK RP REQNLV WARPQLKDPRKL +IMDPRL+G
Sbjct  255  HLTTMSDVFSFGVVLLELITGRRSVDKNRPNREQNLVKWARPQLKDPRKLDQIMDPRLEG  314

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+Y+CLS    +RPTM  VVK LEPL    ++P+  F+Y+ P 
Sbjct  315  QYSSEGARKAAALAYQCLSHHPKSRPTMRTVVKTLEPLLALTDIPIGPFVYIVPN  369



>ref|NP_001235224.1| Avr9/Cf-9 induced kinase [Glycine max]
 gb|ACM89553.1| Avr9/Cf-9 induced kinase [Glycine max]
Length=301

 Score =   449 bits (1156),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 212/293 (72%), Positives = 253/293 (86%), Gaps = 2/293 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKLR GLKAQ VA+KRLD D    QGHREWL E++ LGQLRHPH
Sbjct  1    MLGEGGFGPVYKGFVDDKLRSGLKAQTVAVKRLDLDGL--QGHREWLAEIIFLGQLRHPH  58

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ RLL+YEYMPRGSLENQLFRR SA++PW+TRMKIA+GAAKGLAFLH A
Sbjct  59   LVKLIGYCYEDEHRLLMYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEA  118

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSD+ AKLSDFGLAKDGPEG+DTHV+TR+MGTQGYAAPEYIMTG
Sbjct  119  DKPVIYRDFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTG  178

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYS+GVVLLELLTGR+ +DK+R    ++LV+WARP L+D +K+Y I+D RL+G
Sbjct  179  HLTTKSDVYSYGVVLLELLTGRRVVDKSRSNEGKSLVEWARPLLRDQKKVYNIIDRRLEG  238

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
             +   GA K A+L++KCLS   NARPTMS+V+KVLEPL+DY +V +  F+YVA
Sbjct  239  QFPMKGAMKVAMLAFKCLSHHPNARPTMSDVIKVLEPLQDYDDVFIGPFVYVA  291



>ref|XP_002521318.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF40986.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=455

 Score =   455 bits (1171),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 210/295 (71%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG V+KGF+ DKLRPGLKAQ VA+K LD D    QGHREWL EV+ LGQL+HPH
Sbjct  82   YLGEGGFGAVYKGFITDKLRPGLKAQSVAVKALDLD--GSQGHREWLAEVIFLGQLKHPH  139

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+LEN LF+R SA+LPW TR+KIA+GAAKGLAFLH  
Sbjct  140  LVNLIGYCCEDEHRLLVYEYMERGNLENLLFKRYSAALPWLTRLKIALGAAKGLAFLHEE  199

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASN+LLD+D+ AKLSDFGLA DGP+GD++H+STRVMGT+GYAAPEYIMTG
Sbjct  200  EKPVIYRDFKASNVLLDADFNAKLSDFGLATDGPQGDESHISTRVMGTEGYAAPEYIMTG  259

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDV+SFGVVLLELLTGR+S+DK RP REQNLV WARP LKD  KL  IMDPRL+G
Sbjct  260  HLTAMSDVFSFGVVLLELLTGRRSVDKNRPSREQNLVKWARPLLKDHHKLDLIMDPRLEG  319

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+Y+CLS    +RP+M+ VVK LE L +  ++PM TF+Y+ P+
Sbjct  320  QYSTEGARKAAALAYQCLSHHCKSRPSMTSVVKTLESLLELNDIPMGTFVYIVPS  374



>gb|KDP34015.1| hypothetical protein JCGZ_07586 [Jatropha curcas]
Length=441

 Score =   454 bits (1169),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 216/294 (73%), Positives = 250/294 (85%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDKLRPGLKAQPVA+K LD D    QGH+EW+ E++ LGQLRHPH
Sbjct  83   LLGEGGFGPVYKGFIDDKLRPGLKAQPVAVKSLDLDGM--QGHKEWMAEIIFLGQLRHPH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRR SA+LPW+TRMKIA+ AAKGLAFLH +
Sbjct  141  LVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRYSAALPWSTRMKIALEAAKGLAFLHES  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+IFRDFK SNILLDSDY AKLSDFGLAKDGPEG++THV+TRVMGTQGYAAPEY+MTG
Sbjct  201  DKPVIFRDFKTSNILLDSDYTAKLSDFGLAKDGPEGEETHVTTRVMGTQGYAAPEYVMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+D TR  REQ+LV+  RP LKD  KL RI+DPRL+G
Sbjct  261  HLTTMSDVYSFGVVLLELLTGKRSMDDTRLGREQSLVECTRPLLKDQHKLDRIIDPRLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             +  +GA+KAA L+YKCLS     RPTMS VVKVLE L+D+ +     F+Y+ P
Sbjct  321  QFPYNGAQKAAALAYKCLSHNPKGRPTMSCVVKVLESLQDFDDTFSAPFVYIVP  374



>ref|XP_010917227.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=437

 Score =   454 bits (1167),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 214/293 (73%), Positives = 249/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V KGF+DDKLRPGLKAQ VA+K LD +    QGHREWL EVV LGQL HPH
Sbjct  85   FIGSGGFGPVFKGFIDDKLRPGLKAQTVAVKSLDLEGT--QGHREWLAEVVFLGQLEHPH  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYM RGSLEN LF+RI ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEEEHRLLVYEYMARGSLENHLFKRILASLPWSTRIKIAVGAAKGLAFLHEA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG+DTHV+TRVMGTQGYAAPEY+MTG
Sbjct  203  QKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEDTHVTTRVMGTQGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK RP REQNLV+WARP LK+  KL R MDP L+G
Sbjct  263  HLTAKSDVYSFGVVLLELLTGRRSVDKNRPSREQNLVEWARPLLKNSNKLCRFMDPNLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            +YS  GA+KAA ++Y+CLS    +RP M ++V  LEPL ++ ++P+  F+Y A
Sbjct  323  LYSTKGAQKAAAVAYQCLSHSPKSRPHMRDIVGDLEPLLNWVDIPIGPFVYTA  375



>ref|XP_009390859.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 251/297 (85%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V++GFVD+K++PGLK+QPVA+K LD D    QGH+EWL EV+ LG+LRHPH
Sbjct  78   FLGEGGFGPVYRGFVDEKVKPGLKSQPVAVKLLDLD--GGQGHKEWLAEVLVLGRLRHPH  135

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYE+MPRGSLEN LF+R    LPW  R++IA+GAAKGL FLH +
Sbjct  136  LVKLIGYCCEEEHRLLVYEFMPRGSLENHLFKRYYTPLPWLARLRIAVGAAKGLGFLHDS  195

Query  362  EKPIIFRDFKASNILLDS--DYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIM  535
            +KP+I+RDFKASNILLDS  DY+A+LSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIM
Sbjct  196  DKPVIYRDFKASNILLDSFQDYKARLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIM  255

Query  536  TGHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRL  715
            TGHLTA SDVYSFGVVLLELLTGR+ +DK RP REQNLV+WARP L DPRKLYRIMDP L
Sbjct  256  TGHLTAKSDVYSFGVVLLELLTGRRCVDKARPSREQNLVEWARPCLSDPRKLYRIMDPGL  315

Query  716  DGMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            +G YS  GA++AA + Y+CLSQ   +RP MS +V+ LEPL D  +V + TF+YVAP 
Sbjct  316  EGQYSTQGAQRAAAVVYQCLSQSPKSRPHMSAIVEALEPLLDMNDVLLGTFVYVAPV  372



>gb|EYU21319.1| hypothetical protein MIMGU_mgv1a006343mg [Erythranthe guttata]
Length=447

 Score =   453 bits (1166),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 250/297 (84%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKL-RPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHP  178
            FLGEGGFG VHKGFV +   RPGL+AQPVA+K LD D   DQGHREWLTEVV LGQLRHP
Sbjct  85   FLGEGGFGPVHKGFVSETAGRPGLEAQPVAVKLLDLD--GDQGHREWLTEVVLLGQLRHP  142

Query  179  HVVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHG  358
            H+VKLIGYCCE++QRLLVYEYM RG+LEN LFRR ++SLPW TRMKIA+GAAKGLAFLHG
Sbjct  143  HLVKLIGYCCEDEQRLLVYEYMTRGNLENHLFRRYTSSLPWLTRMKIAVGAAKGLAFLHG  202

Query  359  AEKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
             EKP+I+RDFK SNILLDSDY AKLSDFGLAKDGPEGDDTHVSTR+MGT GYAAPEYIMT
Sbjct  203  EEKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMT  262

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKD-PRKLYRIMDPRL  715
            GHLTA +DVYSFGVVLLELLTG++++DK RP REQNLV+WA+P LKD   K+ R++DP L
Sbjct  263  GHLTAMNDVYSFGVVLLELLTGKRAMDKARPAREQNLVEWAKPYLKDHHHKIERLIDPTL  322

Query  716  DGMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            +  YS  GA+K A L+ +CLS     RPTMS VV++LE + +Y ++P   F+YVAPT
Sbjct  323  EDQYSSQGAKKVASLANQCLSHNPKYRPTMSHVVRILESILEYSDIPAGPFVYVAPT  379



>gb|KDP40693.1| hypothetical protein JCGZ_24692 [Jatropha curcas]
Length=461

 Score =   454 bits (1167),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/294 (72%), Positives = 247/294 (84%), Gaps = 2/294 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KGF+ DKLRPGLKAQ VA+K LD D    QGHREWL EV+ LGQL+HPHV
Sbjct  85   LGEGGFGTVYKGFITDKLRPGLKAQSVAVKVLDLD--GSQGHREWLAEVIFLGQLKHPHV  142

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            V LIGYCCE++ RLLVYEYM RG+LE QLF+R SA+LPW TR+KIA+ AAKGLAFLH  E
Sbjct  143  VNLIGYCCEDEHRLLVYEYMERGNLETQLFKRYSAALPWLTRLKIAIEAAKGLAFLHEEE  202

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            K +I+RDFKASN+LLDSDY AKLSDFGLA DGP+GDDTH++TRVMGT+GYAAPEYIMTGH
Sbjct  203  KTVIYRDFKASNVLLDSDYNAKLSDFGLATDGPQGDDTHITTRVMGTEGYAAPEYIMTGH  262

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LT  SDV+SFGVVLLELLTGR+S+DK RP REQNLV WARP L+D  KL +IMDPRL+G 
Sbjct  263  LTTMSDVFSFGVVLLELLTGRRSLDKNRPTREQNLVKWARPFLRDHHKLDQIMDPRLEGQ  322

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            YS +GARKAA L+Y+CLS    +RPTMS VVK+LEPL +  ++P+  F+YV  +
Sbjct  323  YSTEGARKAAALAYQCLSHHCKSRPTMSAVVKILEPLLELNDIPVGPFVYVVSS  376



>gb|KHG06741.1| hypothetical protein F383_33276 [Gossypium arboreum]
Length=422

 Score =   452 bits (1162),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKLRPGLKAQPVA+K LD D    QGHREWL E++ LGQLRHPH
Sbjct  86   LLGEGGFGPVYKGFVDDKLRPGLKAQPVAVKTLDLDGL--QGHREWLAEIIFLGQLRHPH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ RLLVYEYMPRGSLENQLFRR SA+LPW+TRMKIA+ AAKGLAFLH A
Sbjct  144  LVKLIGYCYEDENRLLVYEYMPRGSLENQLFRRYSATLPWSTRMKIALEAAKGLAFLHEA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFK+SNILLDSDY  KLSDFGLAKDGPEG +THV+TRVMGTQGYAAPEYIMTG
Sbjct  204  DKPVIYRDFKSSNILLDSDYNCKLSDFGLAKDGPEGGETHVTTRVMGTQGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+D TRP REQ+LV+WARP L+DP++L R++DPRL+G
Sbjct  264  HLTTRSDVYSFGVVLLELLTGKRSMDNTRPSREQSLVEWARPLLRDPKRLDRVIDPRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+K A L+YKCLS     RPTM +VV VLE L+ +++  +  F+YV P 
Sbjct  324  QYSNKGAQKVAALAYKCLSHYPKPRPTMGDVVIVLESLQGFEDEFVGPFVYVVPN  378



>ref|XP_008782588.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=450

 Score =   453 bits (1165),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 213/292 (73%), Positives = 249/292 (85%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDK++PGLKAQ VA+K LD +    QGH+EWL EV+ LGQLRHPH
Sbjct  88   FLGEGGFGPVYKGFVDDKVKPGLKAQSVAVKLLDLE--GGQGHKEWLAEVIFLGQLRHPH  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+ RLLVYE+M RGSLEN LF+R  A LPW TR++IA+GAAKGLAFLH  
Sbjct  146  LVKLIGYCYEEEHRLLVYEFMARGSLENHLFKRFFAPLPWLTRLRIAVGAAKGLAFLHET  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  206  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  265

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK+RP REQNLV+WARP L D RKL RIM+P L+G
Sbjct  266  HLTAKSDVYSFGVVLLELLTGRRSVDKSRPSREQNLVEWARPCLNDARKLNRIMEPSLEG  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YS  GA+KAA ++Y+CLSQ   +RP MS +V++LEPL +  ++ +  F+Y 
Sbjct  326  QYSTKGAQKAAAVAYQCLSQNPKSRPQMSTIVEILEPLLEMDDITIGPFVYT  377



>ref|XP_006849707.1| hypothetical protein AMTR_s00024p00242070 [Amborella trichopoda]
 gb|ERN11288.1| hypothetical protein AMTR_s00024p00242070 [Amborella trichopoda]
Length=419

 Score =   451 bits (1160),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 213/293 (73%), Positives = 248/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKG++DDKLRPGLKAQ VA+K LD +    QGHREWL EV+ LGQLRHPH
Sbjct  78   LLGEGGFGPVHKGYIDDKLRPGLKAQAVAVKLLDLEGL--QGHREWLAEVIFLGQLRHPH  135

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKL+GYC E++ RLLVYE+MP+GSLEN LF+R S SLPWA R+KI +GAAKGLAFLH A
Sbjct  136  LVKLVGYCYEDEHRLLVYEFMPKGSLENHLFKRFSISLPWAIRLKITIGAAKGLAFLHEA  195

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEGD+THVSTRVMGT GYAAPEY+MTG
Sbjct  196  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDETHVSTRVMGTHGYAAPEYVMTG  255

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP REQ+LV+WARP L + +KL R+MDP LDG
Sbjct  256  HLTAKSDVYSFGVVLLELLTGRRSMDKTRPSREQSLVEWARPYLNNSKKLNRVMDPNLDG  315

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
             YS  GA+KAA L+Y+CLS     RP M +VV++LEP++D KE  +  F+Y A
Sbjct  316  QYSIKGAQKAAALAYQCLSHNPKNRPLMRQVVEILEPVQDLKEDIVGPFVYTA  368



>ref|XP_004252518.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Solanum 
lycopersicum]
Length=419

 Score =   451 bits (1160),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 214/295 (73%), Positives = 251/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V KGF+DDK++ GL AQPVA+K LD +   DQGH EWLTEVV LGQLRHP+
Sbjct  85   FLGEGGFGPVFKGFIDDKIKYGLDAQPVAVKLLDLE--GDQGHIEWLTEVVLLGQLRHPN  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E+ QRLLVYEYM RG+LENQLFRR S+SLPW TRMKIA+ AAKGLAFLHG 
Sbjct  143  LVKLIGYCWEDKQRLLVYEYMARGNLENQLFRRCSSSLPWLTRMKIALDAAKGLAFLHGE  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG DTHV+TRVMGT GYAAPEY+MTG
Sbjct  203  KKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGSDTHVTTRVMGTYGYAAPEYMMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            +LT  SDVYS+GVVLLELLTGR++IDK R  REQNLV+WA+P L+D  KL RI+DPRL+G
Sbjct  263  YLTTRSDVYSYGVVLLELLTGRQAIDKKRGSREQNLVEWAKPFLRDSHKLERIIDPRLEG  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GA+K A L+Y+CLS +  +RPTMS VVK LEP+ D K++P+ +F+YV P+
Sbjct  323  EYSTQGAKKVATLAYQCLSHQPKSRPTMSNVVKTLEPILDLKDIPIGSFVYVVPS  377



>ref|XP_010937336.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=450

 Score =   452 bits (1162),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 213/292 (73%), Positives = 246/292 (84%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KGFVDDK++PGLKAQ VA+K LD +    QGH EW  EV+ LGQLRHPH
Sbjct  88   FIGEGGFGPVYKGFVDDKVKPGLKAQSVAVKLLDLEGV--QGHMEWQAEVIFLGQLRHPH  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+ RLLVYE+M RGSLEN LF+R  A LPW TR+KIA+GAAKGL FLH A
Sbjct  146  LVKLIGYCYEEEHRLLVYEFMARGSLENHLFKRFFAPLPWLTRLKIAVGAAKGLVFLHEA  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG
Sbjct  206  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  265

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK+RP REQNLV+WARP L D RKL RIMDP L+G
Sbjct  266  HLTAKSDVYSFGVVLLELLTGRRSVDKSRPSREQNLVEWARPCLNDARKLNRIMDPSLEG  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YS  GA KAA ++Y+CLSQ   +RP MS +V++LEP+ +  ++P   F+Y 
Sbjct  326  QYSTKGALKAAAVAYQCLSQNPKSRPHMSTIVEILEPILEMDDIPTGPFVYT  377



>ref|XP_008802464.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=419

 Score =   451 bits (1159),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 249/292 (85%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVD+K++PGLKAQ VA+K LD +    QGH+EWL EV+ LGQLRHPH
Sbjct  88   FLGEGGFGPVYKGFVDEKVKPGLKAQSVAVKLLDLEGV--QGHKEWLAEVIFLGQLRHPH  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+  RLLVYE+M RGSLEN LF++  ASLPW TR+KIA+GAA+GLAFLH  
Sbjct  146  LVKLIGYCCEDKHRLLVYEFMARGSLENHLFKKYFASLPWLTRLKIAVGAARGLAFLHEM  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGT+GYAAPEYIMTG
Sbjct  206  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTEGYAAPEYIMTG  265

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP REQNLV+WARP L D RKL RIMDP L+G
Sbjct  266  HLTAKSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVEWARPCLNDARKLNRIMDPSLEG  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YS   A+KAA ++Y+CLS    +RP MS +V+ LEPL + +++P+  F+Y 
Sbjct  326  QYSTKCAQKAAAVAYQCLSHTPKSRPQMSTIVENLEPLLEMEDMPIGPFIYT  377



>ref|XP_009402133.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=427

 Score =   450 bits (1158),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 249/294 (85%), Gaps = 3/294 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            +G GGFG V+KGF+DD LRPGL AQ VA+K LD +    QGHREWL EV+ LGQLRHPH+
Sbjct  78   IGSGGFGPVYKGFIDDNLRPGLLAQHVAVKSLDLEGL--QGHREWLAEVIFLGQLRHPHL  135

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            V+LIGYCCE++QR+LVYEYM RGSLEN LF+R+ ASLPW+TR+KIA+GAAKGLAFLH AE
Sbjct  136  VRLIGYCCEDEQRMLVYEYMARGSLENHLFKRLLASLPWSTRIKIAVGAAKGLAFLHEAE  195

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            KP+I+RDFKASNILLDSDY AKLSDFGLAK+GP+GDDTHV+TRVMGT GYAAPEY+MTGH
Sbjct  196  KPVIYRDFKASNILLDSDYTAKLSDFGLAKNGPQGDDTHVTTRVMGTHGYAAPEYVMTGH  255

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELL+GR+S+DK RP RE+NLV+WARP L +P +L R+MDP L+G 
Sbjct  256  LTAKSDVYSFGVVLLELLSGRRSVDKNRPNREKNLVEWARPYLNNPNRLSRVMDPNLEGQ  315

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAP  883
            YS DGARKAA ++Y+CLS     RP M  VV+ LEP+ +  +VP+V  F+Y AP
Sbjct  316  YSTDGARKAAAVAYRCLSLSLKTRPNMRAVVEALEPVMELNDVPIVGPFVYTAP  369



>ref|XP_007012454.1| Root-specific kinase 1 [Theobroma cacao]
 gb|EOY30073.1| Root-specific kinase 1 [Theobroma cacao]
Length=434

 Score =   449 bits (1156),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 211/295 (72%), Positives = 253/295 (86%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDKLRPGLKAQPVA+K LD D    QGHREWL E++ LGQLRHPH
Sbjct  84   LLGEGGFGPVYKGFIDDKLRPGLKAQPVAVKALDLDGF--QGHREWLAEIIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKL+GYC EE+ RLLVYEYMPRGSLENQLFRR SA+LPW+TRMKIA+GAAKGLAFLH A
Sbjct  142  LVKLVGYCYEEENRLLVYEYMPRGSLENQLFRRYSAALPWSTRMKIALGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFK SNILLDSDY  KLSDFGLAKDGPEG++THV+TRV+GTQGYAAPEYIMTG
Sbjct  202  DKPVIYRDFKTSNILLDSDYNCKLSDFGLAKDGPEGEETHVTTRVIGTQGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+D TRP REQ+LV+WARP L+D ++L R++DPRL+G
Sbjct  262  HLTTMSDVYSFGVVLLELLTGKRSMDNTRPSREQSLVEWARPLLRDLKRLDRLIDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             +S  GA++ A L+YK LS R   RPTM +VVK+LE L+ +++  +  F+YV P+
Sbjct  322  QFSSKGAQRVAALAYKSLSHRPKPRPTMGDVVKILECLQGFEDEFVGPFVYVVPS  376



>ref|XP_007161127.1| hypothetical protein PHAVU_001G044900g [Phaseolus vulgaris]
 gb|ESW33121.1| hypothetical protein PHAVU_001G044900g [Phaseolus vulgaris]
Length=386

 Score =   447 bits (1151),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 211/293 (72%), Positives = 253/293 (86%), Gaps = 2/293 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKLRPGLKAQ VA+KRLD D    QGHREWL E++ LGQLRHPH
Sbjct  86   MLGEGGFGPVYKGFVDDKLRPGLKAQTVAVKRLDLDGL--QGHREWLAEIIFLGQLRHPH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ RLL+YEYMPRGSLENQLFRR SA++PW+TRMKIA+GAAKGLAFLH A
Sbjct  144  LVKLIGYCYEDENRLLMYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RD KASNILLDSD+ AKLSDFGLAKDGPEG+DT+V+TR+MGTQGYAAPEYIMTG
Sbjct  204  DKPVIYRDLKASNILLDSDFTAKLSDFGLAKDGPEGEDTYVTTRIMGTQGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYS+GVVLLELLTGR+ +DK+R    ++LV+WARP L+DP+ +Y I+D RL+G
Sbjct  264  HLTTKSDVYSYGVVLLELLTGRRVVDKSRSNGGKSLVEWARPLLRDPKIVYSIIDCRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
             +   GA K A+L++KCLS   NARPTMS+VVKVLEPL+D+ +V +  F+YVA
Sbjct  324  QFPMKGAMKVAMLAFKCLSPHPNARPTMSDVVKVLEPLQDFDDVFIGPFVYVA  376



>ref|XP_006452974.1| hypothetical protein CICLE_v10010608mg [Citrus clementina]
 gb|ESR66214.1| hypothetical protein CICLE_v10010608mg [Citrus clementina]
Length=418

 Score =   448 bits (1153),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 208/295 (71%), Positives = 252/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVD+KL+PGL+AQPVA+K LD D    QGH+EW+ E++ LGQLRHPH
Sbjct  84   LLGEGGFGPVYKGFVDEKLKPGLEAQPVAVKALDLDGT--QGHKEWMAEIIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+ RLLVYEYMPRGSL NQLFR  SA+LPW+TRMKIA+GAAKGLAFLHG 
Sbjct  142  LVKLIGYCWEEEYRLLVYEYMPRGSLHNQLFRSYSAALPWSTRMKIALGAAKGLAFLHGE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG++THV TRVMGTQGYAAPEY+MTG
Sbjct  202  DKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEETHVITRVMGTQGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++++D TRP REQ+L +WARP LK+PRKL R++DPR++G
Sbjct  262  HLTTMSDVYSFGVVLLELLTGKRAVDNTRPGREQSLAEWARPLLKEPRKLERLIDPRIEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             +   GA+KAA +++KCLS     RPTMS VV+VL+ L+D+++  +  F+YV P 
Sbjct  322  QFPIKGAQKAAAMAFKCLSHHPRHRPTMSYVVRVLDSLQDFQDSFVGPFVYVVPN  376



>ref|XP_010939901.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=442

 Score =   449 bits (1154),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 246/292 (84%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVD+K++PGLKAQ VA+K LD +    QGH+EWL EV+ LGQLRHPH
Sbjct  90   FLGEGGFGPVYKGFVDEKVKPGLKAQSVAVKLLDLEGV--QGHKEWLAEVIFLGQLRHPH  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+  RLLVYE+M RGSLEN LF++  ASLPW TR+KIA GAA+GL FLH  
Sbjct  148  LVKLIGYCCEDKHRLLVYEFMARGSLENHLFKKFLASLPWLTRLKIAAGAARGLTFLHET  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGT+GYAAPEYI+TG
Sbjct  208  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTEGYAAPEYILTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP REQNLV+WARP L D RKL RIMDP L G
Sbjct  268  HLTAKSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVEWARPCLNDARKLNRIMDPCLVG  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YS   A+KAA ++Y+CLSQ   +RP MS +VK LEPL +  ++P+  F+Y 
Sbjct  328  QYSTKCAQKAAAVAYQCLSQNPKSRPQMSTIVKTLEPLLEMDDMPIGPFIYT  379



>ref|XP_002272911.2| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 emb|CBI35860.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   448 bits (1153),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 210/294 (71%), Positives = 247/294 (84%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KG +D+K+RPG KAQ VA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  63   FLGEGGFGPVYKGVIDEKVRPGFKAQQVAVKVLDLD--GQQGHREWLAEVIFLGQLRHPH  120

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++QR+L+YEYM +G+LENQLFRR SASLPW TR+KIA+ AAKGLAFLH  
Sbjct  121  LVKLIGYCSEKEQRVLIYEYMAKGNLENQLFRRYSASLPWTTRVKIALEAAKGLAFLHEE  180

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+IFRDFKASNILLDSDY  KLSDFGLAKDGPEGD+THV+TRVMGT+GYAAPEYIMTG
Sbjct  181  ENPVIFRDFKASNILLDSDYTVKLSDFGLAKDGPEGDETHVTTRVMGTEGYAAPEYIMTG  240

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+S DK+RP REQNLV WA P LKDP+KL RI+DP+L+G
Sbjct  241  HLTTMSDVYSFGVVLLELLTGRRSTDKSRPSREQNLVGWALPFLKDPQKLKRIIDPKLEG  300

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            MYS +GA++ A+L+ +CLSQ++  RP MS VVK LE L D  +   + F+Y+ P
Sbjct  301  MYSTEGAKRVAMLANQCLSQKAKCRPRMSSVVKTLESLMDLADTGFMPFVYIVP  354



>gb|KHN05281.1| Serine/threonine-protein kinase [Glycine soja]
Length=389

 Score =   446 bits (1147),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 207/292 (71%), Positives = 252/292 (86%), Gaps = 2/292 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KGF+DDKLR GLKAQ +A+KRLD D    QGHREWL E++ LGQLRHPH+
Sbjct  90   LGEGGFGPVYKGFLDDKLRSGLKAQTIAVKRLDLDGL--QGHREWLAEIIFLGQLRHPHL  147

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYC E++ RLL+YEYMPRGSLENQLFR+ SA++PW+TRMKIA+GAAKGL FLH A+
Sbjct  148  VKLIGYCYEDEHRLLMYEYMPRGSLENQLFRKYSAAMPWSTRMKIALGAAKGLTFLHEAD  207

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            KP+I+RDFKASNILLDSD+ AKLSDFGLAKDGPEG+DTHV+TR+MGTQGYAAPEYIMTGH
Sbjct  208  KPVIYRDFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTGH  267

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LT  SDVYS+GVVLLELLTGR+ +DK++    ++LV+WARP L+D +K+Y I+D RL+G 
Sbjct  268  LTTKSDVYSYGVVLLELLTGRRVVDKSQSNGRKSLVEWARPLLRDQKKVYSIIDRRLEGQ  327

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            +   GA K A+L++KCLS   NARP+MS+VVKVLEPL+DY +V +  F+YVA
Sbjct  328  FPMKGAMKVAMLAFKCLSHHPNARPSMSDVVKVLEPLQDYDDVFIGPFVYVA  379



>ref|XP_003544585.2| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Glycine max]
Length=386

 Score =   446 bits (1146),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 207/292 (71%), Positives = 252/292 (86%), Gaps = 2/292 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KGF+DDKLR GLKAQ +A+KRLD D    QGHREWL E++ LGQLRHPH+
Sbjct  87   LGEGGFGPVYKGFLDDKLRSGLKAQTIAVKRLDLDGL--QGHREWLAEIIFLGQLRHPHL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYC E++ RLL+YEYMPRGSLENQLFR+ SA++PW+TRMKIA+GAAKGL FLH A+
Sbjct  145  VKLIGYCYEDEHRLLMYEYMPRGSLENQLFRKYSAAMPWSTRMKIALGAAKGLTFLHEAD  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            KP+I+RDFKASNILLDSD+ AKLSDFGLAKDGPEG+DTHV+TR+MGTQGYAAPEYIMTGH
Sbjct  205  KPVIYRDFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LT  SDVYS+GVVLLELLTGR+ +DK++    ++LV+WARP L+D +K+Y I+D RL+G 
Sbjct  265  LTTKSDVYSYGVVLLELLTGRRVVDKSQSNGRKSLVEWARPLLRDQKKVYSIIDRRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            +   GA K A+L++KCLS   NARP+MS+VVKVLEPL+DY +V +  F+YVA
Sbjct  325  FPMKGAMKVAMLAFKCLSHHPNARPSMSDVVKVLEPLQDYDDVFIGPFVYVA  376



>ref|XP_010932408.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=426

 Score =   447 bits (1150),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 250/293 (85%), Gaps = 2/293 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V+KGF+ D LRPGLKAQ VA+K LD +    QGHREWLTEV+ LGQLRHPH
Sbjct  68   FIGSGGFGPVYKGFIGDNLRPGLKAQTVAVKSLDLEGL--QGHREWLTEVIFLGQLRHPH  125

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V+LIGYCCE+++RLLVYEYM  GSLEN LF+R+  SLPW+TR+KIA+GAAKGLAFLHGA
Sbjct  126  LVRLIGYCCEDERRLLVYEYMEGGSLENHLFKRLLTSLPWSTRLKIAVGAAKGLAFLHGA  185

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLD DY AKLSDFGLAKDGPEG++THV+TRVMGT GYAAPEYIMTG
Sbjct  186  EKPVIYRDFKASNILLDLDYTAKLSDFGLAKDGPEGENTHVTTRVMGTLGYAAPEYIMTG  245

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+SIDK+RP REQNLV+W+RP LK+  KL RIMDP+L+G
Sbjct  246  HLTAKSDVYSFGVVLLELLTGRRSIDKSRPTREQNLVEWSRPYLKNADKLGRIMDPKLEG  305

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
             YS  GA++AA ++Y+CLSQ   +RP M ++V+ LEPL +  +VP+  F+Y  
Sbjct  306  QYSTKGAQRAAAVAYQCLSQSPKSRPHMRDIVETLEPLLNLNDVPIGLFVYTV  358



>emb|CAN77773.1| hypothetical protein VITISV_021885 [Vitis vinifera]
Length=438

 Score =   446 bits (1147),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 246/294 (84%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KG +D+K+RPG K Q VA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  63   FLGEGGFGPVYKGVIDEKVRPGFKDQQVAVKVLDLD--GQQGHREWLAEVIFLGQLRHPH  120

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++QR+L+YEYM +G+LENQLFRR SASLPW TR+KIA+ AAKGLAFLH  
Sbjct  121  LVKLIGYCSEKEQRVLIYEYMAKGNLENQLFRRYSASLPWTTRVKIALEAAKGLAFLHEE  180

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+IFRDFKASNILLDSDY  KLSDFGLAKDGPEGD+THV+TRVMGT+GYAAPEYIMTG
Sbjct  181  ENPVIFRDFKASNILLDSDYTVKLSDFGLAKDGPEGDETHVTTRVMGTEGYAAPEYIMTG  240

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+S DK+RP REQNLV WA P LKDP+KL RI+DP+L+G
Sbjct  241  HLTTMSDVYSFGVVLLELLTGRRSTDKSRPSREQNLVGWALPFLKDPQKLKRIIDPKLEG  300

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            MYS +GA++ A+L+ +CLSQ++  RP MS VVK LE L D  +   + F+Y+ P
Sbjct  301  MYSTEGAKRVAMLANQCLSQKAKCRPRMSSVVKTLESLMDLADTGFMPFVYIVP  354



>gb|KDO73664.1| hypothetical protein CISIN_1g040050mg, partial [Citrus sinensis]
Length=401

 Score =   444 bits (1143),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 208/295 (71%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVD+KL+PGL+AQPVA+K LD D    QGH+EW+ E++ LGQLRHPH
Sbjct  84   LLGEGGFGPVYKGFVDEKLKPGLEAQPVAVKALDLDGT--QGHKEWMAEIIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+ RLLVYEYMPRGSL NQLFR  SA+LPW+TRMKIA+GAAKGLAFLHG 
Sbjct  142  LVKLIGYCWEEEYRLLVYEYMPRGSLHNQLFRSYSAALPWSTRMKIALGAAKGLAFLHGE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG++THV TRVMGTQGYAAPEY+MTG
Sbjct  202  DKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEETHVITRVMGTQGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++++D TR  REQ+L +WARP LK+PRKL R++DPRL+G
Sbjct  262  HLTTMSDVYSFGVVLLELLTGKRAMDNTRLGREQSLAEWARPLLKEPRKLERLIDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             +   GA+KAA  ++KCLS     RPTMS VV+VL+ L+D+++  +  F+YV P 
Sbjct  322  QFPIKGAQKAAATAFKCLSHHPRHRPTMSYVVRVLDSLQDFQDSFVGPFVYVVPN  376



>ref|XP_010086797.1| Putative receptor-like protein kinase [Morus notabilis]
 gb|EXB23807.1| Putative receptor-like protein kinase [Morus notabilis]
Length=456

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 208/294 (71%), Positives = 246/294 (84%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFGQV+KGF+DDKLRPGL+AQ VA+K LD D    QGHREWL EV+ LGQL+HPH
Sbjct  84   FLGEGGFGQVYKGFIDDKLRPGLEAQSVAVKVLDLD--GKQGHREWLAEVIFLGQLKHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYE+MPRG+L+N+LF   SA+LPW  R++IA+GAAKGL FLH  
Sbjct  142  LVNLIGYCCEDEHRLLVYEFMPRGNLDNRLFESYSATLPWLRRLQIAVGAAKGLTFLHEE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILL+SD+ +KLSDFGLA DGPEGD++HV+TRVMGTQGYAAPEYIMTG
Sbjct  202  DKPVIYRDFKASNILLNSDFTSKLSDFGLAIDGPEGDESHVTTRVMGTQGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            H+T  SDV+SFGVVLLELLTGR+ +DKTRP REQNLVDWA+P LKD  K+ RIMDPRL+G
Sbjct  262  HVTTMSDVFSFGVVLLELLTGRRCLDKTRPNREQNLVDWAKPFLKDAHKVDRIMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YS +GARKAA L+Y CLSQ    RPTMS V+K LEPL D      + F+YV P
Sbjct  322  QYSSEGARKAATLAYHCLSQHPKCRPTMSFVIKTLEPLLDVTHDISIPFVYVVP  375



>ref|XP_009408404.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   446 bits (1146),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 250/295 (85%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V+KGF+DDKLRPGLKAQ VA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  81   FIGSGGFGPVYKGFIDDKLRPGLKAQQVAVKSLDLD--GQQGHREWLAEVIFLGQLRHPH  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ R+LVYE++PRGSLEN LF+R+ +SLPW+TR+KIA+GAAKGLAFLH A
Sbjct  139  LVKLIGYCCEDEHRMLVYEFVPRGSLENHLFKRLVSSLPWSTRLKIAVGAAKGLAFLHEA  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNIL+D+D+ AKL+DFGLAKDGP+GD+THV+TRVMGT GYAAPEY++TG
Sbjct  199  EKPVIYRDFKASNILIDTDHTAKLADFGLAKDGPQGDNTHVTTRVMGTHGYAAPEYVLTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELL GR+ +DK RP R++NLVDWARP L +  KL R+MDP LDG
Sbjct  259  HLTAKSDVYSFGVVLLELLAGRRCVDKNRPNRQKNLVDWARPYLTNADKLRRVMDPGLDG  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPM-VTFLYVAP  883
            +YS  GA+KAA ++YKCLS    +RP M  VV++LEPL +  +VP    F+YVAP
Sbjct  319  LYSTKGAQKAAAIAYKCLSHNPKSRPEMRTVVEMLEPLLNLNDVPFGGAFVYVAP  373



>ref|XP_009403379.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=439

 Score =   445 bits (1144),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 207/294 (70%), Positives = 248/294 (84%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V KG+VDDKLRPGLKAQ VA+K LD +    QGHREWL EV+ LGQLRHPH
Sbjct  84   FIGSGGFGPVFKGYVDDKLRPGLKAQHVAVKSLDLEGL--QGHREWLAEVIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            + KLIGYCCE++ R+LVYEYM RGSLEN LF+R+ ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  142  LAKLIGYCCEDEHRMLVYEYMARGSLENHLFKRLLASLPWSTRIKIAVGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+G++THV+TRVMGT+GYAAPEY++TG
Sbjct  202  EKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGEETHVTTRVMGTRGYAAPEYLLTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELL+GR+S+DK R  RE+NLV+WARPQL +P+KL R+MD  L+G
Sbjct  262  HLTAKSDVYSFGVVLLELLSGRRSVDKNRSNREKNLVEWARPQLNNPQKLSRVMDRNLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YS  GA+KAA ++YKCL+     RP M  VV+ LEPL +  +VP+  F+Y AP
Sbjct  322  QYSTKGAQKAAAVAYKCLNLNPKKRPDMRAVVETLEPLLEMNDVPIGPFVYTAP  375



>ref|XP_003588903.1| Protein kinase 2B [Medicago truncatula]
 gb|AES59154.1| kinase 1B [Medicago truncatula]
Length=388

 Score =   441 bits (1134),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 212/293 (72%), Positives = 249/293 (85%), Gaps = 3/293 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KGFVDDKLR GLKAQ VA+K LD D    QGHREWL E++ LGQL HPH+
Sbjct  88   LGEGGFGPVYKGFVDDKLRQGLKAQTVAVKCLDLDGL--QGHREWLAEIIFLGQLSHPHL  145

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYC E++ RLLVYEYMPRGSLENQLFRR SA++PW+TRMKIA+GAAKGLAFLH A+
Sbjct  146  VKLIGYCFEDEHRLLVYEYMPRGSLENQLFRRYSATMPWSTRMKIALGAAKGLAFLHEAD  205

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG++THV+TRVMGT GYAAPEYIMTGH
Sbjct  206  KPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEETHVTTRVMGTHGYAAPEYIMTGH  265

Query  545  LTAASDVYSFGVVLLELLTGRKSIDK-TRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            LT  SDVYS+GVVLLELLTGR+ +DK +   R +NLV+WARP L+D +KL+RI+D RL+G
Sbjct  266  LTTKSDVYSYGVVLLELLTGRRVVDKSSESSRGKNLVEWARPMLRDQKKLHRIIDRRLEG  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
             Y   GA K A+L++KCLS   N RP MS+VVKVLEPL+D+ +V +  F+YVA
Sbjct  326  QYPTKGALKVAMLAFKCLSHHPNPRPFMSDVVKVLEPLQDFDDVFIGPFVYVA  378



>ref|XP_004501421.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=385

 Score =   440 bits (1132),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 249/294 (85%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKLR GL+AQPVA+KRL+ D    QGHREWL E++ LGQLRHPH
Sbjct  88   LLGEGGFGPVYKGFVDDKLRHGLRAQPVAVKRLNLDG--SQGHREWLAEIIFLGQLRHPH  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+QRLLVYEYM RGSLENQLFRR SA+LPW+TRMKIA+GAAKGLAFLH  
Sbjct  146  LVKLIGYCCEEEQRLLVYEYMARGSLENQLFRRYSATLPWSTRMKIALGAAKGLAFLHET  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTR-VMGTQGYAAPEYIMT  538
            +KP+I+RDFKASNILLDSDY AKLSD GLAKDGP+G++THV+T  +MGT+GYAAPEYIM+
Sbjct  206  DKPVIYRDFKASNILLDSDYTAKLSDLGLAKDGPDGEETHVTTTCIMGTKGYAAPEYIMS  265

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHL+  SDVYS+GVVLLELLTG++ +DK+R  RE+NLV+WARP L+D RKL  I D RL+
Sbjct  266  GHLSTKSDVYSYGVVLLELLTGKRVLDKSRSNRERNLVEWARPILRDQRKLLHITDSRLE  325

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            G +   GA K A L+YKCLS   N RPTMS+VVK+LE L+D+ +V +  F+YVA
Sbjct  326  GQFPIKGALKVAALTYKCLSHHPNPRPTMSDVVKILESLQDFDDVIIGPFVYVA  379



>ref|XP_009414115.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   442 bits (1137),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 250/295 (85%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V+KG++D+KLRPGLKAQ VA+K LD D    QGHREWL EV+ LGQLRHP+
Sbjct  78   FVGSGGFGPVYKGYIDEKLRPGLKAQYVAVKSLDLD--GSQGHREWLAEVIFLGQLRHPN  135

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKL+GYCCE++ R+LVYE+MP GSLE+ +F+ + ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  136  LVKLVGYCCEDEHRMLVYEFMPGGSLESHIFKSLLASLPWSTRLKIAVGAAKGLAFLHEA  195

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILL+SDY AKLSDFGLAKDGP+GD+THV+TRVMGT GYAAPEY++TG
Sbjct  196  EKPVIYRDFKASNILLESDYTAKLSDFGLAKDGPQGDNTHVTTRVMGTHGYAAPEYVLTG  255

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+ +DK RP R++NLVDWARP L +  KL R+MDP LDG
Sbjct  256  HLTAKSDVYSFGVVLLELLTGRRCVDKNRPNRQKNLVDWARPYLNNADKLSRVMDPSLDG  315

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            +YS  GA++AA +++KCLSQ   +RP M  VV+ LEPL    +VP+  F+YVAPT
Sbjct  316  LYSTKGAQRAAAIAHKCLSQAPKSRPDMRSVVESLEPLLSLNDVPVGPFVYVAPT  370



>ref|XP_010098385.1| Serine/threonine-protein kinase [Morus notabilis]
 gb|EXB74909.1| Serine/threonine-protein kinase [Morus notabilis]
Length=430

 Score =   441 bits (1135),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 208/296 (70%), Positives = 248/296 (84%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVD+KLRPGL AQPVA+K LD D    QGHREWL E++ LGQLRHP+
Sbjct  84   LLGEGGFGPVYKGFVDEKLRPGLVAQPVAVKLLDLDGL--QGHREWLAEIIFLGQLRHPN  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVY+YM RGSLEN LFRR +A++PW+TRMKIA GAAKGLAFLH A
Sbjct  142  LVKLIGYCCEDEHRLLVYDYMARGSLENHLFRRFTAAMPWSTRMKIAFGAAKGLAFLHEA  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHV-STRVMGTQGYAAPEYIMT  538
            +KP+IFRDFK+SNILLD+DY  KLSDFGLAKDGPEG++TH+ +T + GTQGYAAPEYIMT
Sbjct  202  DKPVIFRDFKSSNILLDTDYTPKLSDFGLAKDGPEGEETHITTTHIFGTQGYAAPEYIMT  261

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHLT  SDVY +GVVLLELLTG++SID+ RP R+Q+LV+WARP LKDP+KL R MDPRL+
Sbjct  262  GHLTTKSDVYGYGVVLLELLTGKRSIDRNRPSRKQSLVEWARPLLKDPKKLDRFMDPRLE  321

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            G +S  GA++AALL+YKCLS     RPTM +VV +LEPL D  +     F+YVAPT
Sbjct  322  GQFSTKGAQRAALLAYKCLSNHPKCRPTMGDVVTILEPLLDLNDWFFEPFVYVAPT  377



>ref|XP_006474675.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Citrus sinensis]
Length=418

 Score =   441 bits (1133),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 249/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVD+KL+PGL+AQPVA+K LD D    QGH+EW+ E++ LGQLRHPH
Sbjct  84   LLGEGGFGPVYKGFVDEKLKPGLEAQPVAVKALDLDGT--QGHKEWMAEIIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EE+ RLLVY YMPRGSL NQLFR  SA+LPW+TRMKIA+GAAKGLAFLHG 
Sbjct  142  LVKLIGYCWEEEYRLLVYAYMPRGSLHNQLFRSYSAALPWSTRMKIALGAAKGLAFLHGE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNILLDSDY AKLSDFGLAKDGPEG++THV TRVMGTQGYAAPEY+MTG
Sbjct  202  DKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEETHVITRVMGTQGYAAPEYVMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++++D TR  REQ+L +WARP LK+PRKL R++DPRL+G
Sbjct  262  HLTTMSDVYSFGVVLLELLTGKRAMDNTRLGREQSLAEWARPLLKEPRKLERLIDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             +   GA+KAA  ++KCLS     RPTMS VV+VL+ L+D+++  +  F+YV P 
Sbjct  322  QFPIKGAQKAAATAFKCLSHHPRHRPTMSYVVRVLDSLQDFQDSFVGPFVYVVPN  376



>ref|XP_003603231.1| Kinase-like protein [Medicago truncatula]
 gb|AES73482.1| kinase 1B [Medicago truncatula]
Length=384

 Score =   439 bits (1130),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 249/294 (85%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKLR GLKAQP+A+KRL+ D    QGHREWL E++ LGQLRHPH
Sbjct  87   LLGEGGFGPVYKGFVDDKLRHGLKAQPIAVKRLNLD--GSQGHREWLAEIIFLGQLRHPH  144

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+QRLLVYEYM RGSLENQLFRR SA+LPW+TRMKIA+GAAKGLAFLH A
Sbjct  145  LVKLIGYCCEEEQRLLVYEYMTRGSLENQLFRRYSATLPWSTRMKIALGAAKGLAFLHEA  204

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTR-VMGTQGYAAPEYIMT  538
            +KP+I+RDFK SNILLDSDY AKLSD GLAKDGPEG++THV+T  +MGT+GYAAPEYIM+
Sbjct  205  DKPVIYRDFKTSNILLDSDYTAKLSDLGLAKDGPEGEETHVTTTCIMGTKGYAAPEYIMS  264

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHL+  SDVYS+GVVLLELLTG++ +DK+R  RE+NLV+WARP L+D RKL  I+DPRL+
Sbjct  265  GHLSTKSDVYSYGVVLLELLTGKRVVDKSRSNRERNLVEWARPILRDQRKLPHIIDPRLE  324

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            G +   GA K A L+YKCLS   N RP MS+VVK LE L+D+ ++ +  F+YVA
Sbjct  325  GQFPIKGALKVAALTYKCLSHHPNPRPNMSDVVKSLELLQDFDDMFIGPFVYVA  378



>ref|XP_003527759.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=374

 Score =   438 bits (1127),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 250/294 (85%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDKLRPGLKAQP+A+K+LD D    QGHREWL E++ LGQLRHPH
Sbjct  82   FLGEGGFGPVYKGFVDDKLRPGLKAQPLAVKQLDLDGL--QGHREWLAEIIFLGQLRHPH  139

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM RGSLENQL RR SA+LPW+TRMKIA+GAAKGLAFLH A
Sbjct  140  LVKLIGYCCEDEHRLLVYEYMARGSLENQLHRRYSAALPWSTRMKIALGAAKGLAFLHEA  199

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTR-VMGTQGYAAPEYIMT  538
            +KP+I+RDFK SNILLDSDY AKLSD GLAKDGPEG+ THV+T  +MGT+GYAAPEYIM+
Sbjct  200  DKPVIYRDFKTSNILLDSDYTAKLSDLGLAKDGPEGEATHVTTTCIMGTRGYAAPEYIMS  259

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHL+  SDVYS+GVVLLELLTGR+ +DK    REQ+LV+WARP L+D RKL+ I+DPRL+
Sbjct  260  GHLSTKSDVYSYGVVLLELLTGRRVVDKCGSNREQSLVEWARPLLRDQRKLHHIIDPRLE  319

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            G +   GA K A L+YKCLS+  N RP+MS+VVK+LE L+D+ +V +  F+YVA
Sbjct  320  GQFPMKGALKVAALTYKCLSRHPNPRPSMSDVVKILESLQDFDDVIIGPFVYVA  373



>ref|XP_004498840.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=387

 Score =   438 bits (1127),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 207/293 (71%), Positives = 251/293 (86%), Gaps = 3/293 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KGFVDDKLR GLKAQ VA+K LD D    QGHREWL E++ LGQLRHPH+
Sbjct  87   LGEGGFGPVYKGFVDDKLRQGLKAQTVAVKCLDLDGL--QGHREWLAEIIFLGQLRHPHL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYC E++ RLLVYEYMPRGSLENQLFRR SA++PW+TRMKIA+GAAKGLAFLH A+
Sbjct  145  VKLIGYCYEDEHRLLVYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEAD  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            KP+I+RDFKASN+LLDSDY AKLSDFGLAKDGPEG++THV+TR+MGT GYAAPEYIMTGH
Sbjct  205  KPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGEETHVTTRIMGTHGYAAPEYIMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKT-RPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            LT  SDVYS+GVVLLELLTG++ +DK+ +  R ++LV+WARP L+DP+KL+RI+D RL+G
Sbjct  265  LTTKSDVYSYGVVLLELLTGKRVVDKSLQSKRGKSLVEWARPMLRDPKKLHRIIDRRLEG  324

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
             +   GA K A+L++KCL    N RP+MS VVK+LEPL+D+ +V +  F+YVA
Sbjct  325  QFPMKGAIKVAMLAFKCLCHHPNPRPSMSNVVKILEPLQDFDDVFIGPFVYVA  377



>ref|XP_003523655.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
 gb|KHN29669.1| Serine/threonine-protein kinase [Glycine soja]
Length=380

 Score =   437 bits (1125),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 210/294 (71%), Positives = 249/294 (85%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDKLR GLKAQPVA+K+LD D    QGHREWL E++ LGQLRHPH
Sbjct  88   FLGEGGFGPVYKGFVDDKLRLGLKAQPVAVKQLDLDGL--QGHREWLAEIIFLGQLRHPH  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM RGSLENQL RR SA+LPW+TRMKIA+GAA+GLAFLH A
Sbjct  146  LVKLIGYCCEDEDRLLVYEYMARGSLENQLHRRYSAALPWSTRMKIALGAARGLAFLHEA  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTR-VMGTQGYAAPEYIMT  538
            +KP+I+RDFK SNILLDSDY AKLSD GLAKDGPEG+DTHV+T  +MGT+GYAAPEYIM+
Sbjct  206  DKPVIYRDFKTSNILLDSDYIAKLSDLGLAKDGPEGEDTHVTTTCIMGTRGYAAPEYIMS  265

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHL+  SDVYS+GVVLLELLTGR+ +D  RP RE++LV+WARP L+D RKLY I+DPRL+
Sbjct  266  GHLSTKSDVYSYGVVLLELLTGRRVVDMCRPNRERSLVEWARPLLRDQRKLYHIIDPRLE  325

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            G +   GA K A L+YKCLS   N RP+MS+VVK+LE L+D  +V +  F+YVA
Sbjct  326  GQFPMKGALKVAALTYKCLSHHPNPRPSMSDVVKILESLQDLDDVIIGPFVYVA  379



>ref|XP_004305755.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Fragaria vesca subsp. vesca]
Length=450

 Score =   440 bits (1131),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 249/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG+V+KGFVDDKLRPGL+AQPVA+K LD D    QGHREWL EV+ LGQL+HP+
Sbjct  86   YLGEGGFGKVYKGFVDDKLRPGLEAQPVAVKVLDLDGT--QGHREWLAEVIFLGQLKHPN  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEY+ RG+L+++LF+  S +LPW TR+KIA+GAAKGL+ LH  
Sbjct  144  LVNLIGYCCEDEHRLLVYEYLERGNLDHKLFKCYSGTLPWLTRIKIAIGAAKGLSCLHEE  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKPII+RDFKASNILLD DY AKLSD GLA DGPEGD+THV+TRVMGT GYAAPEYIMTG
Sbjct  204  EKPIIYRDFKASNILLDCDYTAKLSDLGLAIDGPEGDETHVTTRVMGTHGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+S+D++R  REQNLV+WA+P LKD  KL R+MD RL+G
Sbjct  264  HLTTMSDVYSFGVVLLELLTGRRSMDESRTFREQNLVEWAKPFLKDSHKLDRVMDQRLEG  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+++CLS    +RPTMS V+K LEPL + K++P+  F+YV PT
Sbjct  324  QYSTEGARKAAALAHQCLSHNPKSRPTMSTVIKTLEPLMNLKDIPIGPFVYVVPT  378



>gb|KHN32159.1| Serine/threonine-protein kinase [Glycine soja]
Length=374

 Score =   437 bits (1123),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 208/294 (71%), Positives = 250/294 (85%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDKLRPGLKAQP+A+K+LD D    QGHREWL +++ LGQLRHPH
Sbjct  82   FLGEGGFGPVYKGFVDDKLRPGLKAQPLAVKQLDLDGL--QGHREWLVKIIFLGQLRHPH  139

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM RGSLENQL RR SA+LPW+TRMKIA+GAAKGLAFLH A
Sbjct  140  LVKLIGYCCEDEHRLLVYEYMARGSLENQLHRRYSAALPWSTRMKIALGAAKGLAFLHEA  199

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTR-VMGTQGYAAPEYIMT  538
            +KP+I+RDFK SNILLDSDY AKLSD GLAKDGPEG+ THV+T  +MGT+GYAAPEYIM+
Sbjct  200  DKPVIYRDFKTSNILLDSDYTAKLSDLGLAKDGPEGEATHVTTTCIMGTRGYAAPEYIMS  259

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHL+  SDVYS+GVVLLELLTGR+ +DK    REQ+LV+WARP L+D RKL+ I+DPRL+
Sbjct  260  GHLSTKSDVYSYGVVLLELLTGRRVVDKCGSNREQSLVEWARPLLRDQRKLHHIIDPRLE  319

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            G +   GA K A L+YKCLS+  N RP+MS+VVK+LE L+D+ +V +  F+YVA
Sbjct  320  GQFPMKGALKVAALTYKCLSRHPNPRPSMSDVVKILESLQDFDDVIIGPFVYVA  373



>gb|KHG16114.1| hypothetical protein F383_07817 [Gossypium arboreum]
Length=415

 Score =   438 bits (1126),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 248/295 (84%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDKLRPGLKAQPVA+K LD      QGHREWL E++ LGQLRHPH
Sbjct  86   LLGEGGFGPVYKGFIDDKLRPGLKAQPVAVKALDLYGL--QGHREWLAEIIFLGQLRHPH  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC EED R+LVYEYMPRGSLENQLFRR SA LPW+ RMKIA+ AAKGLAFLH A
Sbjct  144  LVKLIGYCYEEDNRVLVYEYMPRGSLENQLFRRYSAPLPWSARMKIALAAAKGLAFLHEA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+IFRDFK+SNILLDSDY  KLSDFGLAKDGPEG+ THV+TRVMGTQGYAAPEYIMTG
Sbjct  204  DKPVIFRDFKSSNILLDSDYNCKLSDFGLAKDGPEGEQTHVTTRVMGTQGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+D +RP +EQ+LV+WARP L+DP+KL +++D RL+ 
Sbjct  264  HLTTMSDVYSFGVVLLELLTGKRSVDNSRPGQEQSLVEWARPLLRDPKKLDKLIDARLER  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             +S  GA+K A L+YKCLS +   RP+M +VVK+L+ ++ +++  +  F+YV P 
Sbjct  324  QFSNKGAQKVAALAYKCLSHQPKPRPSMGDVVKILDSVQGFEDEFVGPFVYVVPN  378



>ref|XP_004303452.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Fragaria 
vesca subsp. vesca]
Length=408

 Score =   436 bits (1120),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 209/297 (70%), Positives = 249/297 (84%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPG-LKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHP  178
             LGEGGFG V+KGFVDD LRPG LKAQPVA+K L+ D    QGHREWL E+V LGQLRHP
Sbjct  87   LLGEGGFGPVYKGFVDDNLRPGTLKAQPVAVKLLNLDGF--QGHREWLAELVFLGQLRHP  144

Query  179  HVVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHG  358
            ++VKLIGYCCEE+ RLLVYE++ RGSLE+QLFRR SA+LPW+TRMKIA+GA+KGLAFLH 
Sbjct  145  NIVKLIGYCCEEEHRLLVYEHIARGSLEDQLFRRYSAALPWSTRMKIAVGASKGLAFLHE  204

Query  359  AEKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
              +P+IFRDFK SN+L+DSDY AKLSDFGLAKDGPEG++THV TR++GTQGYAAPEY+ T
Sbjct  205  DHRPVIFRDFKTSNVLVDSDYTAKLSDFGLAKDGPEGEETHVVTRILGTQGYAAPEYLRT  264

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHLT  SDVYSFGVVLLELLTG++S+D+TR  REQ LV+WARP LKDPRKL RI+DPRL+
Sbjct  265  GHLTTKSDVYSFGVVLLELLTGKRSLDRTRRSREQCLVEWARPLLKDPRKLNRIIDPRLE  324

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVT-FLYVAPT  886
            G YS  GARKAA L+Y CLS    +RP M++VV +LE L+ + E  +   F+YVAP+
Sbjct  325  GQYSTKGARKAATLAYACLSNNPKSRPMMTDVVMILESLQGFNEALIYQPFVYVAPS  381



>gb|ABR16273.1| unknown [Picea sitchensis]
Length=440

 Score =   436 bits (1122),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 206/292 (71%), Positives = 243/292 (83%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK  PVA+K L+  K   QGHREWLTEV+ LGQL HPH
Sbjct  107  ILGEGGFGTVYKGYIDENVRAGLKPLPVAVKVLN--KNGFQGHREWLTEVIFLGQLSHPH  164

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPW+TRM IA+GAAKGLAFLHGA
Sbjct  165  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAAVPLPWSTRMMIALGAAKGLAFLHGA  224

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSDY AKLSDFGLAKDGP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  225  EKPVIYRDFKTSNILLDSDYAAKLSDFGLAKDGPQGDETHVSTRVMGTYGYAAPEYVMTG  284

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP RE NLVDWARP L D R+L +I+DPRL+G
Sbjct  285  HLTARSDVYSFGVVLLELLTGRRSVDKTRPNREHNLVDWARPLLNDKRRLLQIIDPRLEG  344

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYV  877
             YS  GA+KA  L+Y CL+Q   ARP M +VV+ LEPL++ K++   + +Y 
Sbjct  345  QYSMKGAQKACSLAYHCLNQNPKARPLMGDVVETLEPLQNRKDMVNASLMYT  396



>ref|XP_010548490.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=429

 Score =   435 bits (1118),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/280 (73%), Positives = 235/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVDDKL+PGL AQPVA+K LD      QGHREWL E++ LGQLRH H
Sbjct  98   MLGEGGFGPVYKGFVDDKLKPGLDAQPVAVKALDLH--GHQGHREWLAEIIFLGQLRHEH  155

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+CCEEDQRLLVYEYMPRGSLENQLFRR S +LPW TRMKIA+GAAKGLAFLH A
Sbjct  156  LVKLIGFCCEEDQRLLVYEYMPRGSLENQLFRRYSVTLPWPTRMKIALGAAKGLAFLHEA  215

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SN+LLDS Y AKLSDFGLAKDGPEG+DTHV+TRVMGTQGYAAPEYIMTG
Sbjct  216  EKPVIYRDFKTSNVLLDSSYNAKLSDFGLAKDGPEGEDTHVTTRVMGTQGYAAPEYIMTG  275

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLEL+TG++S+D  R  REQ+LV+WARP L+DPRKL RI+DPRL+G
Sbjct  276  HLTTMSDVYSFGVVLLELITGKRSMDNNRALREQSLVEWARPMLRDPRKLERIIDPRLEG  335

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y     +  A L++KCL  +   RP M EVV++L+ +K+
Sbjct  336  QYQAKPVQVVAALAHKCLGHQPKFRPHMGEVVRILQSMKE  375



>ref|XP_007216399.1| hypothetical protein PRUPE_ppa022600mg [Prunus persica]
 gb|EMJ17598.1| hypothetical protein PRUPE_ppa022600mg [Prunus persica]
Length=455

 Score =   434 bits (1116),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 245/295 (83%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG+V+KGF+DDKLRPGL+AQPVA+K LD D    QGHREWL EV+ LGQL+HP+
Sbjct  84   YLGEGGFGKVYKGFIDDKLRPGLEAQPVAVKVLDLD--GKQGHREWLAEVIFLGQLKHPN  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+LEN+LF+    +LPW TR+KIA+GAAKGL+ LH  
Sbjct  142  LVNLIGYCCEDEHRLLVYEYMERGNLENRLFKCYGGTLPWLTRIKIAIGAAKGLSSLHEE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EK +I+RDFKASNILLDSDY AKLSDFGLA DGPEGD+TH++T VMGT GYAAPEY+ TG
Sbjct  202  EKQVIYRDFKASNILLDSDYTAKLSDFGLAIDGPEGDETHITTCVMGTHGYAAPEYVKTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+S+D++R  REQNLV+W++P LKD  KL R+MDP L+G
Sbjct  262  HLTTMSDVYSFGVVLLELLTGRRSVDESRHGREQNLVEWSKPFLKDAHKLDRVMDPGLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+++CL+     RPTMS VVK LEPL D  ++P+  F+YV PT
Sbjct  322  QYSTEGARKAAALTHQCLNHNPKCRPTMSTVVKTLEPLMDLNDIPIGPFVYVVPT  376



>ref|XP_003528552.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Glycine max]
 gb|KHN01418.1| Putative receptor-like protein kinase [Glycine soja]
Length=463

 Score =   434 bits (1116),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 241/295 (82%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG+V KGF+DD L+PGLKAQ VA+K L+ D    QGHREWL EVV LGQL+H H
Sbjct  87   YLGEGGFGKVFKGFIDDNLKPGLKAQTVAVKALNLD--GKQGHREWLAEVVFLGQLKHRH  144

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+LE +LF+   A+LPW TR+KIA+GAAKGL FLH  
Sbjct  145  LVNLIGYCCEDEHRLLVYEYMERGNLEEKLFKGYLAALPWLTRIKIAIGAAKGLMFLHEE  204

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RD KASNILLD+DY AKLSDFGLA DGPE D TH++TRVMGT GYAAPEYIMTG
Sbjct  205  EKPVIYRDIKASNILLDADYNAKLSDFGLAIDGPEKDQTHITTRVMGTHGYAAPEYIMTG  264

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG+KS+DK RP REQ+LV+WARP LKD  KL RIMD RL+ 
Sbjct  265  HLTTMSDVYSFGVVLLELLTGKKSVDKKRPTREQDLVEWARPLLKDSHKLERIMDTRLED  324

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARK A L+Y+CLS  + ARPTM  VV+ LEPL + K++P+  F+YV P+
Sbjct  325  QYSTEGARKFAALAYQCLSHHAKARPTMRTVVRTLEPLLELKDIPVGPFVYVVPS  379



>ref|XP_009375471.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Pyrus 
x bretschneideri]
Length=456

 Score =   433 bits (1114),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 203/296 (69%), Positives = 244/296 (82%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFGQV+KGF+DDKLRPGL+AQPVA+K LD D    QGHREWL EV+ LGQL+HP+
Sbjct  84   YLGEGGFGQVYKGFIDDKLRPGLEAQPVAVKVLDLD--GKQGHREWLAEVIVLGQLKHPN  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE+D RLLVYEYM RG+L++ LF+R   +LPW TR+KIA+GAAKGL+ LH  
Sbjct  142  LVNLIGYCCEDDHRLLVYEYMERGNLDHHLFKRYGGTLPWLTRIKIAIGAAKGLSCLHEE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLD DY AKLSDFGLA DGPEGD+TH+ST VMGT GYAAPEY+ TG
Sbjct  202  EKPVIYRDFKTSNILLDLDYTAKLSDFGLAIDGPEGDETHISTHVMGTHGYAAPEYVKTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVY FGVVLLELLTGR+S+D++R  REQNLV+W++P LKD  KL  +MDPRL+G
Sbjct  262  HLTAMSDVYGFGVVLLELLTGRRSVDESRHGREQNLVEWSKPFLKDTHKLDSVMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDY-KEVPMVTFLYVAPT  886
             YS +GARKAA L+++CL+     RPTMS VVK LEPL D   ++P+  F+YV PT
Sbjct  322  QYSTEGARKAAALAHQCLNYNPKCRPTMSSVVKTLEPLMDLTNDIPIGPFVYVVPT  377



>ref|XP_008220586.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
 ref|XP_008220587.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
Length=394

 Score =   431 bits (1108),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/297 (72%), Positives = 251/297 (85%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V KGFVDDKLRPGLK QPVA+K LD D    QGHREWL E++ LGQLRHP+
Sbjct  93   LLGEGGFGPVFKGFVDDKLRPGLKPQPVAVKLLDLDGL--QGHREWLAELIFLGQLRHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYE+M RGSLENQLFR  S++LPW+ RMKIA+GAAKGLAFLH A
Sbjct  151  LVKLIGYCCEDEHRLLVYEFMARGSLENQLFRSYSSALPWSKRMKIAVGAAKGLAFLHEA  210

Query  362  E-KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
            + KP+IFRDFK SNILLDSDY AKLSDFGLAKDGPEG+DTH++TR++GTQGYAAPEYIMT
Sbjct  211  DHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKDGPEGEDTHITTRIIGTQGYAAPEYIMT  270

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            G LT  SDVYSFGVVLLELLTG++ ID TRP REQNLV+WA+P+LKDPRKL RI+DP ++
Sbjct  271  GRLTTKSDVYSFGVVLLELLTGKQCIDNTRPNREQNLVEWAKPRLKDPRKLDRIIDPTME  330

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAPT  886
            G YS  GARKAA L+Y CLS +   RP MS+VV +LEPL+++ E  +V  F+YVAP 
Sbjct  331  GQYSTRGARKAAALAYACLSHQPKNRPMMSDVVMILEPLQNFNEGLIVRPFVYVAPN  387



>ref|XP_007136897.1| hypothetical protein PHAVU_009G083300g [Phaseolus vulgaris]
 gb|ESW08891.1| hypothetical protein PHAVU_009G083300g [Phaseolus vulgaris]
Length=388

 Score =   429 bits (1104),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 205/294 (70%), Positives = 246/294 (84%), Gaps = 3/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGFVD+KLRP LKAQ VA+K+L+ D    QGHREWL E++ LGQLRHPH
Sbjct  91   LLGEGGFGPVYKGFVDNKLRPDLKAQSVAVKQLNLDGF--QGHREWLAEIIFLGQLRHPH  148

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE+ RLLVYEYM RGSLENQLFRR SA+LPW+TRMKIA+GAAKGLAFLH A
Sbjct  149  LVKLIGYCCEEEHRLLVYEYMARGSLENQLFRRYSAALPWSTRMKIALGAAKGLAFLHEA  208

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTR-VMGTQGYAAPEYIMT  538
            +KP+I+RDFK SNILLDSDY AKLSD GLAKDGPEG+DTH++T  +MGT+GYAAPEYIM+
Sbjct  209  DKPVIYRDFKTSNILLDSDYTAKLSDLGLAKDGPEGEDTHLTTTCIMGTRGYAAPEYIMS  268

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHL+  SDVYS+GVVLLELLTGR+ +DK RP RE++LV+WARP L+D RKL+ I+D RL+
Sbjct  269  GHLSTKSDVYSYGVVLLELLTGRRVVDKCRPNRERSLVEWARPLLRDQRKLHHIIDSRLE  328

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVA  880
            G +   GA K A L+YKCLS     RPTM +VVK+LE ++D+ +V    F+YVA
Sbjct  329  GQFPTKGALKVAALTYKCLSHHPYPRPTMGDVVKILESVQDFDDVIRGPFVYVA  382



>ref|XP_008228357.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Prunus 
mume]
Length=455

 Score =   432 bits (1110),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 244/295 (83%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +L EGGFG+V+KGF+DDKLRPGL+AQPVA+K LD D    QGHREWL EV+ LGQL+HP+
Sbjct  84   YLDEGGFGKVYKGFIDDKLRPGLEAQPVAVKVLDLD--GKQGHREWLAEVIFLGQLKHPN  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+LEN+LF+    +LPW TR+KIA+GAAKGL+ LH  
Sbjct  142  LVNLIGYCCEDEHRLLVYEYMERGNLENRLFKCYGGTLPWLTRIKIAIGAAKGLSSLHEE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EK +I+RDFKASNILLDSDY AKLSDFGLA DGPEGD+TH++T VMGT GYAAPEY+ TG
Sbjct  202  EKQVIYRDFKASNILLDSDYTAKLSDFGLAIDGPEGDETHITTCVMGTHGYAAPEYVRTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+S+D++R  REQNLV+W++P LKD  KL R+MDP L+G
Sbjct  262  HLTTMSDVYSFGVVLLELLTGRRSVDESRHGREQNLVEWSKPFLKDSHKLDRVMDPGLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+++CLS     RPTMS VVK LEPL D  ++P+  F+YV PT
Sbjct  322  QYSTEGARKAAALAHQCLSHNPKCRPTMSTVVKTLEPLMDLNDIPIGPFVYVVPT  376



>ref|XP_010685306.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Beta 
vulgaris subsp. vulgaris]
Length=427

 Score =   430 bits (1106),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 241/295 (82%), Gaps = 4/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KGF+DDKLRPGLKAQ VAIK LD +    QGH EWL EV+ LGQLRHPH
Sbjct  93   FIGEGGFGAVYKGFIDDKLRPGLKAQAVAIKVLDLE--GSQGHNEWLAEVIYLGQLRHPH  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE +QR+LVYEYM RG+L+NQLFRR+S +LPW TRMKIA+GAAKGLAFLH A
Sbjct  151  LVKLIGYCCENEQRVLVYEYMSRGNLDNQLFRRVSVALPWLTRMKIALGAAKGLAFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVST-RVMGTQGYAAPEYIMT  538
             KP+I RDFKA+NILLDS+++AKLSDFG A+DGPEGD +HV+T  ++GT+GY APEY+MT
Sbjct  211  NKPVILRDFKAANILLDSNFKAKLSDFGYARDGPEGDKSHVTTEHILGTKGYVAPEYVMT  270

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            GHLT  SDVYSFGVVLLE+LTG++ +DKTRP RE  LV+WARP LKD RK+  IMDPRLD
Sbjct  271  GHLTTMSDVYSFGVVLLEILTGKRCMDKTRPRREHCLVEWARPFLKDSRKIAMIMDPRLD  330

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            G YS  G +   +L+Y+CLS    +RPTMS VVK LEPL    ++P   F+YV P
Sbjct  331  GQYSVQGVKVTTMLAYQCLSHNPKSRPTMSTVVKTLEPLMVLNDIPG-HFVYVVP  384



>ref|XP_006362327.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Solanum 
tuberosum]
Length=426

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 236/279 (85%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  90   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFRR + SL WATRM IA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRRATVSLSWATRMMIALGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  208  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQNLVDWARP+L D RK+ +I+DPRLD 
Sbjct  268  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKMLQIIDPRLDN  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  328  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_007024642.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY27264.1| Kinase superfamily protein [Theobroma cacao]
Length=456

 Score =   431 bits (1108),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 240/295 (81%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG V+KGF+DD LRPGLKAQ VA+K LD D    QGHREWL EV+ LGQL+HPH
Sbjct  83   YLGEGGFGPVYKGFIDDNLRPGLKAQSVAVKVLDLD--GSQGHREWLAEVIFLGQLKHPH  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYC E++ RLLVYEYM RGSLE+QLF+R    LPW TR+KIA+G AKGLAFLH  
Sbjct  141  LVNLIGYCYEQEHRLLVYEYMARGSLEDQLFKRYGPPLPWLTRLKIAVGTAKGLAFLHEE  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLD  Y AK+SDFGLA DGPEG+ THV+T VMGT+GYAAPEYI TG
Sbjct  201  EKPVIYRDFKTSNILLDLAYNAKVSDFGLATDGPEGEATHVTTCVMGTEGYAAPEYITTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDV+SFGVVLLELLTGR+S+DK RP RE+NLV+WARP LKDP KL  IMD RL+G
Sbjct  261  HLTTMSDVFSFGVVLLELLTGRRSVDKARPGREKNLVEWARPLLKDPYKLDGIMDTRLEG  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARKAA L+Y+CLS    +RPTMS VVK LEPL D  ++P+  F+Y+ PT
Sbjct  321  QYSTEGARKAAALAYQCLSNHPKSRPTMSNVVKALEPLLDLTDIPIGPFVYIVPT  375



>ref|XP_002461008.1| hypothetical protein SORBIDRAFT_02g039110 [Sorghum bicolor]
 gb|EER97529.1| hypothetical protein SORBIDRAFT_02g039110 [Sorghum bicolor]
Length=439

 Score =   430 bits (1106),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 204/283 (72%), Positives = 238/283 (84%), Gaps = 2/283 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDD ++ GLK Q +A+K  D +    QGH+EWL EV+ LGQLRHP+
Sbjct  90   FLGEGGFGPVYKGFVDDGVKKGLKPQAIAVKLWDPEGA--QGHKEWLAEVIFLGQLRHPN  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKL+GYCCE++ RLLVYEYM  GSLEN LF++I A LPW+TR+ IA+GAAKGLAFLH A
Sbjct  148  LVKLVGYCCEDENRLLVYEYMEHGSLENHLFKQIPAVLPWSTRLNIAVGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  208  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGR+S+DKTRP REQNLVD+ARP LKDP +L RIMDP ++G
Sbjct  268  HLTAKSDVYSFGVVLLEILTGRRSVDKTRPSREQNLVDYARPCLKDPLRLARIMDPAMEG  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE  850
             YS   A+ AAL++Y+CLS     RP MS VV+ LEPL D  +
Sbjct  328  QYSARAAQSAALVAYRCLSSSPKNRPDMSAVVQALEPLLDLND  370



>ref|XP_007223042.1| hypothetical protein PRUPE_ppa006919mg [Prunus persica]
 gb|EMJ24241.1| hypothetical protein PRUPE_ppa006919mg [Prunus persica]
Length=390

 Score =   428 bits (1100),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/297 (72%), Positives = 250/297 (84%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V KGFVDDKLRPGLK QPVA+K LD D    QGHREWL E++ LGQLRHP+
Sbjct  93   LLGEGGFGPVFKGFVDDKLRPGLKPQPVAVKLLDLDGL--QGHREWLAELIFLGQLRHPN  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYE+M RGSLENQLFR  S++LPW+ RMKIA+GAAKGLAFLH A
Sbjct  151  LVKLIGYCCEDEHRLLVYEFMARGSLENQLFRSYSSALPWSKRMKIAVGAAKGLAFLHEA  210

Query  362  E-KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
            + KP+IFRDFK SNILLDSDY AKLSDFGLAKDGPEG+DTH++TR++GTQGYAAPEYIMT
Sbjct  211  DHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKDGPEGEDTHITTRIIGTQGYAAPEYIMT  270

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            G LT  SDVYSFGVVLLELLTG+  IDKTRP REQNLV+WA+P+LKDPRKL RI+DP ++
Sbjct  271  GRLTTKSDVYSFGVVLLELLTGKWCIDKTRPNREQNLVEWAKPRLKDPRKLDRIIDPTME  330

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAPT  886
            G YS  GARKAA L+Y CLS +   RP M +VV +LEPL+++ E  +V  F+YVAP 
Sbjct  331  GQYSTRGARKAAALAYACLSHQPKNRPMMRDVVMILEPLQNFNEGLIVRPFVYVAPN  387



>gb|KDP40692.1| hypothetical protein JCGZ_24691 [Jatropha curcas]
Length=401

 Score =   428 bits (1100),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 201/294 (68%), Positives = 237/294 (81%), Gaps = 2/294 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KGF+ DKLRPGLKAQ VA K LD D    QGHREWL EV+ LG+L+HPH+
Sbjct  85   LGEGGFGTVYKGFITDKLRPGLKAQSVAGKVLDLDGS--QGHREWLAEVIFLGRLKHPHL  142

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            V LIGYCCE++ RLLVYEYM RG+LE QLF + SA+LPW TR+KIA+GAAKGLAFLH  E
Sbjct  143  VNLIGYCCEDEHRLLVYEYMERGNLETQLFEKYSAALPWLTRLKIAIGAAKGLAFLHEEE  202

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            + + +RDFKASN+LLDSDY AKLSDFGLA DGP+GDDT ++TRVMGT+GYA  EYIMTGH
Sbjct  203  RTVTYRDFKASNVLLDSDYNAKLSDFGLATDGPQGDDTRITTRVMGTEGYAVSEYIMTGH  262

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LT  SD++SFGVVLLELLTGR+S+DK R  REQNLV WARP L D  KL +IMDPRL+G 
Sbjct  263  LTTTSDLFSFGVVLLELLTGRRSLDKNRTSREQNLVKWARPFLMDHHKLDQIMDPRLEGQ  322

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            YS +GARKAA L+Y CLS    +RPTMS VVK+LEPL +  ++P    +YV  +
Sbjct  323  YSTEGARKAAALAYHCLSHLFKSRPTMSSVVKILEPLLELNDIPAGPLVYVVSS  376



>ref|XP_004245036.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Solanum 
lycopersicum]
Length=437

 Score =   428 bits (1101),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 238/280 (85%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDK+RPGLKAQ VA+K LDTD    QGH+EWLTE++ LGQLRHPH
Sbjct  84   FLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGL--QGHKEWLTEIIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E+D RLLVYE++PRGSLENQLF + S +L W+ RMKIA+GAAKGLAFLH  
Sbjct  142  LVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEG  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNIL+DSDY AKLSDFGLAKDGPEGDDTHVSTR+MGT GYAAPEYIMTG
Sbjct  202  DKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+DK+R   E NLV+W RP L+DP+++ R+MD RL+ 
Sbjct  262  HLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLED  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y   GA+ AAL++YKCL+     RPTM +VVK+LE L+D
Sbjct  322  EYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQD  361



>ref|XP_003558674.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brachypodium 
distachyon]
Length=439

 Score =   428 bits (1100),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/295 (71%), Positives = 251/295 (85%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KG+VD+K++PGL+AQPVA+K LD +   +QGH EWLTEV+ LGQLR+PH
Sbjct  110  FIGEGGFGPVYKGYVDEKVKPGLRAQPVAVKLLDLEG--NQGHNEWLTEVIFLGQLRNPH  167

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ RLLVYE+M RGSLE  LF++ +ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  168  LVKLIGYCYEDEHRLLVYEFMTRGSLEKHLFKKYAASLPWSTRLKIAIGAAKGLAFLHEA  227

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFK SNILLDSDY+AKLSDFGLAKDGPE D+THVSTRVMGTQGYAAPEYIMTG
Sbjct  228  ENPVIYRDFKTSNILLDSDYKAKLSDFGLAKDGPEEDETHVSTRVMGTQGYAAPEYIMTG  287

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVY FGVVLLELLTGRKS+DK+RPPREQNLVDWARP L DPR+L R+MDP L G
Sbjct  288  HLTAKSDVYGFGVVLLELLTGRKSVDKSRPPREQNLVDWARPYLNDPRRLDRVMDPNLAG  347

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAP  883
             Y+   A+KAA ++Y+C+S    +RP MS VV+ LEPL   ++  +V  F+YVAP
Sbjct  348  QYAGRAAQKAAAVAYRCVSLNPKSRPHMSAVVEALEPLLALEDDGLVGPFVYVAP  402



>ref|XP_004249015.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Solanum 
lycopersicum]
Length=426

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRH +
Sbjct  90   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHSN  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFRR + SL WATRM IA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRRATVSLSWATRMMIALGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  208  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQNLVDWARP+L D RK+ +I+DPRLD 
Sbjct  268  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKMLQIIDPRLDN  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  328  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_006294280.1| hypothetical protein CARUB_v10023277mg [Capsella rubella]
 gb|EOA27178.1| hypothetical protein CARUB_v10023277mg [Capsella rubella]
Length=424

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 236/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDK++PGL+ QPVA+K LD      QGHREWL E++ LGQL + H
Sbjct  93   MLGEGGFGPVYKGFIDDKIKPGLEPQPVAVKALDLH--GHQGHREWLAEIIFLGQLSNKH  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+CCEE+QR+LVYEYMPRGSLENQLFRR S ++ W  RMKIA+GAAKGLAFLH A
Sbjct  151  LVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRNSVAMAWGIRMKIALGAAKGLAFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDS+Y AKLSDFGLAKDGPEG+ THV+TRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKTSNILLDSNYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  +DVYSFGVVLLEL+TGR+S+D TR  REQ+LV+WARP L+D RKL RI+DPRL+ 
Sbjct  271  HLTTMNDVYSFGVVLLELITGRRSMDNTRARREQSLVEWARPILRDQRKLERIIDPRLES  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y ++ A+  A L+YKCLSQ    RPTM EVVKVLE +++
Sbjct  331  QYKKEAAQVTAGLAYKCLSQHPKYRPTMCEVVKVLESIQE  370



>ref|XP_006353843.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Solanum tuberosum]
Length=433

 Score =   427 bits (1098),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 200/280 (71%), Positives = 239/280 (85%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDK+RPGLKAQ VA+K LDT+    QGH+EWLTE++ LGQLRHPH
Sbjct  84   FLGEGGFGPVYKGFVDDKVRPGLKAQIVAVKVLDTEGL--QGHKEWLTEIIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E+D RLLVYE++PRGSLENQ+F + S +L W+TRMKIA+GAAKGLAFLH  
Sbjct  142  LVKLIGYCWEDDNRLLVYEFLPRGSLENQIFGKFSITLSWSTRMKIALGAAKGLAFLHEG  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            +KP+I+RDFKASNIL+DSDY AKLSDFGLAKDGPEGDDTHVSTR+MGT GYAAPEYIMTG
Sbjct  202  DKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG++S+DK+R   E NLV+W RP L+DP+++ R+MD RL+ 
Sbjct  262  HLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRVARVMDRRLED  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y   GA+ AAL++YKCL+     RPTM +VVK+LE L+D
Sbjct  322  EYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQD  361



>ref|XP_008653340.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Zea 
mays]
 tpg|DAA63581.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=459

 Score =   428 bits (1101),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/296 (70%), Positives = 243/296 (82%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V++GFV D  + GLKAQ +A+K  D +    QGH+EWL EV+ LGQLRHP+
Sbjct  91   FLGEGGFGPVYRGFVADGAKKGLKAQAIAVKLWDPEGA--QGHKEWLAEVIFLGQLRHPN  148

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKL+GYCCE++ RLLVYEYM  GSLEN LF++I A LPW+TR+ IA+GAAKGLAFLH A
Sbjct  149  LVKLVGYCCEDEHRLLVYEYMEHGSLENHLFKQIPAVLPWSTRLNIAVGAAKGLAFLHDA  208

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLDSDY+AKLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTG
Sbjct  209  EKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTG  268

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGR+S+DKTRP REQNLVD+ARP LKDP +L RIMDP ++G
Sbjct  269  HLTAKSDVYSFGVVLLEILTGRRSVDKTRPSREQNLVDYARPCLKDPLRLGRIMDPAMEG  328

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD-YKEVPMVTFLYVAPT  886
             YS   A+ AAL++Y+CLS     RP MS VV+ LEPL D + +VP+    +  P 
Sbjct  329  QYSPRAAQSAALVAYRCLSASPKNRPDMSAVVRALEPLLDLHDDVPVAPLGHAGPV  384



>ref|XP_010931422.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=414

 Score =   426 bits (1096),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/278 (73%), Positives = 237/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAAKGLAFLH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSWATRMSIALGAAKGLAFLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGR+S+DKTRP +EQ+LVDWARP+L D RK+ +I+DPRL+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_009600575.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
tomentosiformis]
Length=439

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 237/280 (85%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDKLRPGLK Q VA+K LDTD    QGH+EWLTE++ LGQLRHPH
Sbjct  81   FLGEGGFGPVYKGFVDDKLRPGLKPQVVAVKVLDTDGL--QGHKEWLTEIIFLGQLRHPH  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E+D RLLVYE++PRGSLENQLF + S +L W+TRMKIA+GAAKGLAFLH  
Sbjct  139  LVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSTRMKIALGAAKGLAFLHEG  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNIL++SDY AKLSDFGLAKDGP GDDTHVSTR+MGT GYAAPEYIMTG
Sbjct  199  EKPVIYRDFKASNILINSDYTAKLSDFGLAKDGPAGDDTHVSTRIMGTHGYAAPEYIMTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLE+LTG++S+DK R   E NLV+W RP L+DP+K+ R+MD RL+G
Sbjct  259  HLTTMSDVYSFGVVLLEMLTGKRSLDKKRREGETNLVEWLRPYLRDPKKIARVMDRRLEG  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y   GA+ AAL++YKCLS     RPTM +VVK+LE L++
Sbjct  319  EYPIKGAQTAALVAYKCLSHYPKPRPTMDDVVKILETLQE  358



>ref|XP_004985497.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Setaria 
italica]
Length=425

 Score =   427 bits (1097),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/294 (71%), Positives = 246/294 (84%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KG+VDDK +PGL+AQPVA+K LD +    QGH EWLTEV+ LGQLRHPH
Sbjct  102  FIGEGGFGPVYKGYVDDKTKPGLRAQPVAVKLLDLE--GGQGHTEWLTEVIFLGQLRHPH  159

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            + KLIGYC EE+ RLLVYE+M RGSLE  LF++ +ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  160  LAKLIGYCYEEEHRLLVYEFMTRGSLEKHLFKKYAASLPWSTRLKIAIGAAKGLAFLHEA  219

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSDY+AKLSDFGLAKDGPE D+THVSTRVMGTQGYAAPEYIMTG
Sbjct  220  EKPVIYRDFKTSNILLDSDYKAKLSDFGLAKDGPEDDETHVSTRVMGTQGYAAPEYIMTG  279

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVY FGVVLLELLTGR+S+DK+RPPREQ+LV+WARP L D R+L R+MDP L G
Sbjct  280  HLTAKSDVYGFGVVLLELLTGRRSVDKSRPPREQSLVEWARPYLTDARRLDRVMDPNLAG  339

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YS   A+KAA ++++C+S    +RP MS VV  LEPL    + P+  F+YVAP
Sbjct  340  QYSARAAQKAAAVAHQCVSLNPKSRPHMSAVVDALEPLLALDDCPVGPFVYVAP  393



>ref|NP_180197.1| root-specific kinase 1 [Arabidopsis thaliana]
 gb|AAC14522.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC07819.1| root-specific kinase 1 [Arabidopsis thaliana]
Length=424

 Score =   426 bits (1096),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 236/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDK++PG++AQPVA+K LD      QGHREWL E++ LGQL + H
Sbjct  93   MLGEGGFGPVYKGFIDDKVKPGIEAQPVAVKALDLH--GHQGHREWLAEILFLGQLSNKH  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+CCEE+QR+LVYEYMPRGSLENQLFRR S ++ W  RMKIA+GAAKGLAFLH A
Sbjct  151  LVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRNSLAMAWGIRMKIALGAAKGLAFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSDY AKLSDFGLAKDGPEG+ THV+TRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  +DVYSFGVVLLEL+TG++S+D TR  REQ+LV+WARP L+D RKL RI+DPRL  
Sbjct  271  HLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQSLVEWARPMLRDQRKLERIIDPRLAN  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             +  + A+ AA L+YKCLSQ    RPTM EVVKVLE +++
Sbjct  331  QHKTEAAQVAASLAYKCLSQHPKYRPTMCEVVKVLESIQE  370



>ref|XP_003547753.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Glycine max]
 gb|KHN39624.1| Putative receptor-like protein kinase [Glycine soja]
Length=451

 Score =   427 bits (1098),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 239/295 (81%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG+V+KGF+DD L+ GLKAQ VA+K L+ D    QGHREWL EV+ LGQL+H H
Sbjct  87   YLGEGGFGKVYKGFIDDNLKRGLKAQTVAVKALNLD--GKQGHREWLAEVIFLGQLKHRH  144

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+LE +LF+   A+LPW TR+KIA+GAAKGL FLH  
Sbjct  145  LVNLIGYCCEDEHRLLVYEYMERGNLEEKLFKGYLAALPWLTRIKIAIGAAKGLMFLHEE  204

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RD KASNILLDSDY  KLSDFGLA DGPE D TH++T VMGT GYAAPEYIMTG
Sbjct  205  EKPVIYRDIKASNILLDSDYNPKLSDFGLAIDGPEKDQTHITTHVMGTHGYAAPEYIMTG  264

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG+KS+DK RP REQ+LV+WARP LKD  KL RIMD RL+ 
Sbjct  265  HLTTMSDVYSFGVVLLELLTGKKSVDKKRPTREQDLVEWARPLLKDSHKLERIMDTRLED  324

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARK A L+Y+CLS  + ARPTM  VV+ LEPL + K++P+  F+YV P+
Sbjct  325  QYSTEGARKFAALAYQCLSHHAKARPTMRTVVRTLEPLLELKDIPVGPFVYVVPS  379



>ref|XP_009800306.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
sylvestris]
Length=439

 Score =   427 bits (1097),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 237/280 (85%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG V+KGFVDDKLRPGLK Q VA+K LDTD    QGH+EWLTE++ LGQLRHPH
Sbjct  81   FLGEGGFGPVYKGFVDDKLRPGLKPQVVAVKVLDTDGL--QGHKEWLTEIIFLGQLRHPH  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ RLLVYE++PRGSLENQLF + S +L W+TRMKIA+GAAKGLAFLH  
Sbjct  139  LVKLIGYCWEDNNRLLVYEFLPRGSLENQLFGKFSITLSWSTRMKIALGAAKGLAFLHEG  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNIL++SDY AKLSDFGLAKDGP GDDTHVSTR+MGT GYAAPEYIMTG
Sbjct  199  EKPVIYRDFKASNILINSDYTAKLSDFGLAKDGPAGDDTHVSTRIMGTHGYAAPEYIMTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLE+LTG++S+DK R   E NLV+W RP L+DP+K+ R+MD RL+G
Sbjct  259  HLTTMSDVYSFGVVLLEMLTGKRSLDKKRREGETNLVEWLRPYLRDPKKIARVMDRRLEG  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y   GA+ AAL++YKCLS     RPTM +VVK+LE L++
Sbjct  319  EYPIKGAQTAALVAYKCLSHYPKPRPTMDDVVKILETLQE  358



>ref|XP_011018915.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
Length=427

 Score =   426 bits (1095),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHPH
Sbjct  90   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPH  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  208  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  268  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKLLQIIDPRLEN  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  328  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_010064028.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Eucalyptus 
grandis]
 gb|KCW71325.1| hypothetical protein EUGRSUZ_F04407 [Eucalyptus grandis]
Length=466

 Score =   427 bits (1099),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 198/294 (67%), Positives = 242/294 (82%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFG V+KG +D+ LRP +KAQ VA+K LD D    QGHREWL EV+ LGQLRHPH
Sbjct  84   YLGEGGFGIVYKGMIDEGLRPEMKAQVVAVKTLDLDGT--QGHREWLAEVIFLGQLRHPH  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVY+YM RG+LE+QLF++ S  LPW TR+KIA+GAAKGLA LH  
Sbjct  142  LVNLIGYCCEDEHRLLVYQYMERGNLEDQLFKKYSLPLPWLTRIKIAIGAAKGLACLHEE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASN+LLDSDY AKLSDFGLA DGP GD+THV+ RVMGT+GYAAPEYI TG
Sbjct  202  EKPVIYRDFKASNVLLDSDYNAKLSDFGLAVDGPLGDNTHVTARVMGTRGYAAPEYISTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLEL+TGR+S+D +RP RE++LV+WARP LKD  KL +I+DPRL+G
Sbjct  262  HLTTISDVYSFGVVLLELITGRRSVDMSRPTREKDLVNWARPMLKDTHKLDKIVDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
            +YS +GA+KA LL+++CLSQ    RPTM  VVK LE + D  ++P+ +FLY  P
Sbjct  322  LYSTEGAKKAVLLAHQCLSQNPKCRPTMQTVVKTLETIMDLDDIPVRSFLYTDP  375



>ref|XP_009362909.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=401

 Score =   425 bits (1092),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 209/297 (70%), Positives = 242/297 (81%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             +GEGGFG V KGFV DK+RPGLKAQPVA+K LD D    QGH+EWL E+V LGQLRHP+
Sbjct  89   LIGEGGFGPVFKGFVGDKVRPGLKAQPVAVKLLDLDGL--QGHKEWLAEIVFLGQLRHPN  146

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM  GSLENQLFR  S  LPW+ RMKIA+GAAKGLAFLH A
Sbjct  147  LVKLIGYCCEDEHRLLVYEYMAGGSLENQLFRSYSTPLPWSKRMKIAVGAAKGLAFLHEA  206

Query  362  E-KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
            + KP+IFRDFK SNILLDSDY AKLSDFGLAK+GPEG DTH++TR++GTQGYAAPEYIMT
Sbjct  207  DHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKNGPEGKDTHITTRIIGTQGYAAPEYIMT  266

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            G LT  SDVYSFGVVLLELLTG++ ID T P REQ LV+WA+P+LKDPRKL  I+DP ++
Sbjct  267  GCLTTKSDVYSFGVVLLELLTGKRCIDNTCPSREQKLVEWAKPRLKDPRKLDGIIDPMME  326

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAPT  886
            G YS  GARKAA L+Y CLS     RP MS+VV +LE L+D+ E  +V  F+YVAP 
Sbjct  327  GQYSIRGARKAAALAYSCLSHNPKRRPRMSDVVVILEGLQDFDEGLVVRPFVYVAPN  383



>ref|XP_009410482.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009410483.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   425 bits (1093),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 202/278 (73%), Positives = 235/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K LD D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLDKDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAAKGLAFLH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSWATRMSIALGAAKGLAFLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGR+S+DKTRP +EQ+LVDWARP+L D RKL +++DPRLD  
Sbjct  265  LTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWARPKLNDKRKLLQVLDPRLDDQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLS    ARP MS+VV+ L+PL+
Sbjct  325  YSVRAAQKACSLAYYCLSHNPKARPLMSDVVETLQPLQ  362



>ref|XP_009801690.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nicotiana 
sylvestris]
Length=427

 Score =   426 bits (1094),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  91   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  148

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  149  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATIPLSWATRMMIALGAAKGLAFLHNA  208

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  209  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  268

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQNLVDWARP+L D RK+ +I+DPRLD 
Sbjct  269  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKMLQIIDPRLDN  328

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  329  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  367



>ref|XP_009410484.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=391

 Score =   424 bits (1090),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/278 (73%), Positives = 235/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K LD D    QGHREWLTEV  LGQLRHP++
Sbjct  64   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLDKDG--HQGHREWLTEVNFLGQLRHPNL  121

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAAKGLAFLH AE
Sbjct  122  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSWATRMSIALGAAKGLAFLHNAE  181

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  182  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETHVSTRVMGTYGYAAPEYVMTGH  241

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGR+S+DKTRP +EQ+LVDWARP+L D RKL +++DPRLD  
Sbjct  242  LTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWARPKLNDKRKLLQVLDPRLDDQ  301

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLS    ARP MS+VV+ L+PL+
Sbjct  302  YSVRAAQKACSLAYYCLSHNPKARPLMSDVVETLQPLQ  339



>ref|XP_009606105.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   426 bits (1094),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  92   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  150  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATIPLSWATRMMIALGAAKGLAFLHNA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  210  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQNLVDWARP+L D RK+ +I+DPRLD 
Sbjct  270  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKMLQIIDPRLDN  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  330  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  368



>ref|XP_008451160.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Cucumis 
melo]
Length=306

 Score =   421 bits (1081),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 224/247 (91%), Gaps = 0/247 (0%)
 Frame = +2

Query  143  TEVVCLGQLRHPHVVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIA  322
            TEV+ LGQLRHPH+VKLIGYCCE++ R+LVYEYMPRGSLENQLFRR S SL W+TRMKIA
Sbjct  7    TEVIFLGQLRHPHLVKLIGYCCEDEHRVLVYEYMPRGSLENQLFRRFSVSLSWSTRMKIA  66

Query  323  MGAAKGLAFLHGAEKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMG  502
            +GAAKGLAFLHGAEKP+I+RDFKASNILLDSDY AKLSDFGLAKDGP+GDDTHVSTRVMG
Sbjct  67   LGAAKGLAFLHGAEKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPDGDDTHVSTRVMG  126

Query  503  TQGYAAPEYIMTGHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDP  682
            T+GYAAPEY+MTGHLTA SDVYSFGVVLLELLTGR+S+DKTRP REQNLV++ARP L D 
Sbjct  127  TEGYAAPEYVMTGHLTAMSDVYSFGVVLLELLTGRRSLDKTRPHREQNLVEYARPMLMDN  186

Query  683  RKLYRIMDPRLDGMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV  862
            RKL RIMD RL+G YSE GARKAA L+Y+CLS R   RPTM+EVVK+LEPLKDY+++P+ 
Sbjct  187  RKLSRIMDMRLEGQYSETGARKAAALAYQCLSHRPKQRPTMNEVVKILEPLKDYQDMPIG  246

Query  863  TFLYVAP  883
            TF++  P
Sbjct  247  TFVFEMP  253



>ref|XP_006842637.1| hypothetical protein AMTR_s00077p00187600 [Amborella trichopoda]
 gb|ERN04312.1| hypothetical protein AMTR_s00077p00187600 [Amborella trichopoda]
Length=415

 Score =   425 bits (1092),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 203/278 (73%), Positives = 236/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWL EV  LGQLRH ++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGL--QGHREWLAEVNFLGQLRHANL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ SA L WATRM IA+GAAKGLAFLHGAE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKASAPLSWATRMTIALGAAKGLAFLHGAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            KP+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  KPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGR+S+DKTRP +EQ+LVDWARP+L D RKL +++DPRL+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWARPKLNDKRKLLQVIDPRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSTRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_009606106.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X2 [Nicotiana tomentosiformis]
Length=412

 Score =   424 bits (1091),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  76   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  133

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  134  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATIPLSWATRMMIALGAAKGLAFLHNA  193

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  194  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  253

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQNLVDWARP+L D RK+ +I+DPRLD 
Sbjct  254  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKMLQIIDPRLDN  313

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  314  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  352



>ref|XP_008244257.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
Length=418

 Score =   425 bits (1092),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 202/283 (71%), Positives = 235/283 (83%), Gaps = 2/283 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  86   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W TRM IA+GAAKGLAFLH A
Sbjct  144  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWGTRMMIALGAAKGLAFLHNA  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  204  ERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP +EQNLVDWARP+L D RKL +I+DPRLD 
Sbjct  264  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLDN  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE  850
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+   E
Sbjct  324  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSCNE  366



>ref|XP_008442306.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Cucumis 
melo]
Length=426

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  92   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPWA RM IA+GAAKGLAFLH A
Sbjct  150  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLPWARRMMIALGAAKGLAFLHNA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  210  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKT+P +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  270  HLTARSDVYSFGVVLLELLTGRKSVDKTKPSKEQNLVDWARPKLNDKRKLLQIIDPRLES  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  330  QYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  368



>ref|XP_004160326.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
At5g01020-like [Cucumis sativus]
Length=426

 Score =   424 bits (1091),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  92   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPWA RM IA+GAAKGLAFLH A
Sbjct  150  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLPWARRMMIALGAAKGLAFLHNA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  210  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKT+P +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  270  HLTARSDVYSFGVVLLELLTGRKSVDKTKPSKEQNLVDWARPKLNDKRKLLQIIDPRLES  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  330  QYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  368



>ref|XP_002265437.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
Length=432

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 202/280 (72%), Positives = 236/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  90   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGF--QGHREWLTEVNFLGQLRHPN  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  208  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  268  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKLLQIIDPRLEN  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+D
Sbjct  328  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQD  367



>ref|XP_008342636.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Malus 
domestica]
Length=456

 Score =   426 bits (1094),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/296 (69%), Positives = 241/296 (81%), Gaps = 3/296 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LGEGGFGQV+KGF+DDKLRPGL+AQPVA+K LD D    QGHREWL EVV LGQL+HP+
Sbjct  84   YLGEGGFGQVYKGFIDDKLRPGLEAQPVAVKVLDLD--GKQGHREWLAEVVFLGQLKHPN  141

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+L++QLF+R   +LPW TR+KIA+GAAKGL+ LH  
Sbjct  142  LVNLIGYCCEDEYRLLVYEYMERGNLDHQLFKRYGGTLPWLTRIKIAIGAAKGLSCLHEE  201

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLD DY AKLSDFGLA DGPEGD+TH++TRVMGT GY APEY+ TG
Sbjct  202  EKPVIYRDFKTSNILLDLDYTAKLSDFGLAIDGPEGDETHITTRVMGTHGYTAPEYVKTG  261

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGRKS+D +R  REQNLV   +P LKD  KL R+MDPRL+G
Sbjct  262  HLTTMSDVYSFGVVLLELLTGRKSVDDSRHGREQNLVKRFKPFLKDSHKLDRMMDPRLEG  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYK-EVPMVTFLYVAPT  886
             YS  GARKAA L+++CLS     RPTMS VVK LEPL D   ++P+  F+Y+ PT
Sbjct  322  QYSTVGARKAAALAHQCLSHNPKCRPTMSSVVKTLEPLMDLTIDIPIGPFVYIVPT  377



>ref|XP_004137666.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
sativus]
Length=426

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  92   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPWA RM IA+GAAKGLAFLH A
Sbjct  150  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLPWARRMMIALGAAKGLAFLHNA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  210  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKT+P +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  270  HLTARSDVYSFGVVLLELLTGRKSVDKTKPSKEQNLVDWARPKLNDKRKLLQIIDPRLES  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  330  QYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  368



>ref|XP_010044463.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Eucalyptus 
grandis]
Length=425

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  88   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEED RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  146  LVKLIGYCCEEDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  206  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  265

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  266  HLTARSDVYSFGVVLLELLTGRKSFDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  326  QYSARAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  364



>ref|XP_008370313.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=419

 Score =   424 bits (1090),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/283 (72%), Positives = 235/283 (83%), Gaps = 2/283 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+  K   QGHREWLTEV  LGQLRHP+
Sbjct  88   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLN--KEGHQGHREWLTEVNFLGQLRHPN  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W TRM IA+GAAKGLAFLH A
Sbjct  146  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWGTRMMIALGAAKGLAFLHNA  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  206  ERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  265

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP REQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  266  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVDWARPKLNDKRKLLQIIDPRLEN  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE  850
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+   E
Sbjct  326  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSCNE  368



>ref|XP_009370852.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=419

 Score =   424 bits (1090),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/283 (71%), Positives = 235/283 (83%), Gaps = 2/283 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  88   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEG--HQGHREWLTEVNFLGQLRHPN  145

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W TRM IA+GAAKGLAFLH A
Sbjct  146  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWGTRMMIALGAAKGLAFLHNA  205

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  206  ERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  265

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP REQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  266  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVDWARPKLNDKRKLLQIIDPRLEN  325

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE  850
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+   E
Sbjct  326  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSCNE  368



>ref|XP_007205277.1| hypothetical protein PRUPE_ppa006509mg [Prunus persica]
 gb|EMJ06476.1| hypothetical protein PRUPE_ppa006509mg [Prunus persica]
Length=408

 Score =   424 bits (1089),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/283 (71%), Positives = 235/283 (83%), Gaps = 2/283 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  76   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  133

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W TRM IA+GAAKGLAFLH A
Sbjct  134  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWGTRMMIALGAAKGLAFLHNA  193

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  194  ERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  253

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP +EQNLVDWARP+L D RKL +I+DPRLD 
Sbjct  254  HLTARSDVYSFGVVLLELLTGRRSVDKTRPNKEQNLVDWARPKLNDKRKLLQIIDPRLDN  313

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE  850
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+   E
Sbjct  314  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSCNE  356



>gb|AFK33487.1| unknown [Medicago truncatula]
Length=437

 Score =   424 bits (1089),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 236/279 (85%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  96   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  153

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  154  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLTWATRMMIALGAAKGLAFLHNA  213

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFKASNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  214  ERPVIYRDFKASNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  273

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  274  HLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWARPKLNDKRKLLQIIDPRLEN  333

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  334  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  372



>ref|XP_010278903.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=410

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP+
Sbjct  83   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPN  140

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA GAAKGLAFLH A
Sbjct  141  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAAVPLSWATRMMIAFGAAKGLAFLHNA  200

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  201  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  260

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  261  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWARPKLNDKRKLLQIIDPRLEN  320

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  321  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  359



>ref|NP_001140687.1| uncharacterized LOC100272762 [Zea mays]
 gb|ACF78565.1| unknown [Zea mays]
 gb|ACF84379.1| unknown [Zea mays]
 gb|ACG32547.1| serine/threonine-protein kinase NAK [Zea mays]
 gb|ACN34214.1| unknown [Zea mays]
 gb|ACN34756.1| unknown [Zea mays]
 tpg|DAA39301.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=412

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/278 (72%), Positives = 233/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV CLGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNCLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPW TRM IA+GAAKGLA LH A+
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQ  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDQTHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP REQ+LVDWA P+L D R+L +I+DPRL+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A KA  L++ CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSARAAHKACSLAFYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_006602747.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
 gb|KHN40578.1| Serine/threonine-protein kinase [Glycine soja]
Length=441

 Score =   424 bits (1089),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 236/285 (83%), Gaps = 2/285 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  101  ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  158

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  159  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  218

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  219  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  278

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  279  HLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWARPKLNDKRKLLQIIDPRLEN  338

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVP  856
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+     P
Sbjct  339  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSSSVGP  383



>ref|XP_009414114.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=477

 Score =   425 bits (1092),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 204/328 (62%), Positives = 250/328 (76%), Gaps = 35/328 (11%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+G GGFG V+KG++D+KLRPGLKAQ VA+K LD D    QGHREWL EV+ LGQLRHP+
Sbjct  78   FVGSGGFGPVYKGYIDEKLRPGLKAQYVAVKSLDLD--GSQGHREWLAEVIFLGQLRHPN  135

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKL+GYCCE++ R+LVYE+MP GSLE+ +F+ + ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  136  LVKLVGYCCEDEHRMLVYEFMPGGSLESHIFKSLLASLPWSTRLKIAVGAAKGLAFLHEA  195

Query  362  EKPIIFRDFKASNILLDS---------------------------------DYRAKLSDF  442
            EKP+I+RDFKASNILL+S                                 DY AKLSDF
Sbjct  196  EKPVIYRDFKASNILLESVNFFDFERVKTKKSFCPHQCKLTSSHDDDLVSQDYTAKLSDF  255

Query  443  GLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAASDVYSFGVVLLELLTGRKSIDK  622
            GLAKDGP+GD+THV+TRVMGT GYAAPEY++TGHLTA SDVYSFGVVLLELLTGR+ +DK
Sbjct  256  GLAKDGPQGDNTHVTTRVMGTHGYAAPEYVLTGHLTAKSDVYSFGVVLLELLTGRRCVDK  315

Query  623  TRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGMYSEDGARKAALLSYKCLSQRSNARPT  802
             RP R++NLVDWARP L +  KL R+MDP LDG+YS  GA++AA +++KCLSQ   +RP 
Sbjct  316  NRPNRQKNLVDWARPYLNNADKLSRVMDPSLDGLYSTKGAQRAAAIAHKCLSQAPKSRPD  375

Query  803  MSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
            M  VV+ LEPL    +VP+  F+YVAPT
Sbjct  376  MRSVVESLEPLLSLNDVPVGPFVYVAPT  403



>gb|AFW64652.1| putative protein kinase superfamily protein [Zea mays]
Length=370

 Score =   421 bits (1082),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 233/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV CLGQLRHP++
Sbjct  47   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNCLGQLRHPNL  104

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPW TRM IA+GAAKGLA LH A+
Sbjct  105  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQ  164

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAKDGPEGD THVSTRVMGT GYAAPEY+MTGH
Sbjct  165  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGH  224

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP REQ+LVDWA P+L D R+L +I+DPRL+G 
Sbjct  225  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQ  284

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A K+  L++ CLSQ   ARP MS+VV+ L PL+
Sbjct  285  YSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPLQ  322



>ref|XP_007140016.1| hypothetical protein PHAVU_008G077200g [Phaseolus vulgaris]
 gb|ESW12010.1| hypothetical protein PHAVU_008G077200g [Phaseolus vulgaris]
Length=434

 Score =   423 bits (1088),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 235/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  94   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  151

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  152  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIAIGAAKGLAFLHNA  211

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  212  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  271

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  272  HLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWARPKLNDKRKLLQIIDPRLEN  331

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+ 
Sbjct  332  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  371



>ref|XP_006368257.1| kinase family protein [Populus trichocarpa]
 gb|ERP64826.1| kinase family protein [Populus trichocarpa]
Length=422

 Score =   422 bits (1086),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 236/287 (82%), Gaps = 2/287 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKG+VDD LR GLKAQ VA+K LD +    QGHREWL EV+ LGQLRHP+
Sbjct  97   LLGEGGFGTVHKGYVDDNLRQGLKAQAVAVKLLDIEGL--QGHREWLAEVIFLGQLRHPN  154

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE++RLLVYE+MPRGSLEN LF+RIS SLPW+TR+KIA+GAAKGLAFLHGA
Sbjct  155  LVKLIGYCCEEEERLLVYEFMPRGSLENHLFKRISVSLPWSTRLKIAIGAAKGLAFLHGA  214

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SN+LLDSD+  KLSDFGLAK GPEG DTHV+TRVMGT GYAAPEY+ TG
Sbjct  215  EKPVIYRDFKTSNVLLDSDFTVKLSDFGLAKMGPEGSDTHVTTRVMGTYGYAAPEYVSTG  274

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDV+SFGVVLLELLTGR++ DK+RP REQN++DWA+P L   R+L  I+DPRL G
Sbjct  275  HLTTKSDVFSFGVVLLELLTGRRATDKSRPKREQNIIDWAKPYLTSSRRLRCIIDPRLAG  334

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV  862
             YS  GA++ ALL+ +C+S     RP M  +V+ LE L+ YK++ + 
Sbjct  335  QYSVKGAKQMALLARQCVSLNPKDRPKMPSIVETLEALQHYKDMAVA  381



>ref|NP_001149711.1| serine/threonine-protein kinase NAK [Zea mays]
 gb|ACF85272.1| unknown [Zea mays]
 gb|ACG36476.1| serine/threonine-protein kinase NAK [Zea mays]
 gb|ACN28104.1| unknown [Zea mays]
 gb|AFW64653.1| putative protein kinase superfamily protein [Zea mays]
Length=410

 Score =   422 bits (1085),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 233/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV CLGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNCLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPW TRM IA+GAAKGLA LH A+
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQ  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAKDGPEGD THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP REQ+LVDWA P+L D R+L +I+DPRL+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A K+  L++ CLSQ   ARP MS+VV+ L PL+
Sbjct  325  YSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPLQ  362



>ref|XP_006381288.1| hypothetical protein POPTR_0006s11430g [Populus trichocarpa]
 gb|ERP59085.1| hypothetical protein POPTR_0006s11430g [Populus trichocarpa]
Length=414

 Score =   422 bits (1085),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  77   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  134

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  135  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  194

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  195  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  254

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  255  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKLLQIIDPRLEN  314

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  315  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  353



>emb|CAQ58633.1| ATP binding / serine-threonine kinase [Vitis vinifera]
Length=412

 Score =   422 bits (1085),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 236/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  70   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGF--QGHREWLTEVNFLGQLRHPN  127

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+CCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  128  LVKLIGHCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  187

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  188  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  247

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  248  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKLLQIIDPRLEN  307

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+D
Sbjct  308  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQD  347



>ref|XP_003534620.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Glycine 
max]
 gb|KHN29460.1| Serine/threonine-protein kinase [Glycine soja]
Length=432

 Score =   423 bits (1087),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 236/285 (83%), Gaps = 2/285 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  92   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  150  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  210  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  270  HLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWARPKLNDKRKLLQIIDPRLEN  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVP  856
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+     P
Sbjct  330  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSSSVGP  374



>ref|XP_008804652.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Phoenix 
dactylifera]
Length=414

 Score =   422 bits (1085),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 235/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAA+GLAFLH AE
Sbjct  145  VKLIGYCCEHDHRLLVYEFMFRGSLENHLFRKTAAPLSWATRMSIALGAAQGLAFLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GDDTHVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDDTHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTG++S+DKTRP +E +LVDWARP+L D RK+ +I+DPRL+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGQRSVDKTRPCKEHSLVDWARPKLNDKRKMLQIIDPRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_004510479.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=457

 Score =   424 bits (1089),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            FLGEGGFG+V+KGF+DDK RP L  Q VA+K L+ D    QGHREWL EV+ LGQL+H +
Sbjct  86   FLGEGGFGKVYKGFIDDKFRPALLPQVVAVKALNLD--GKQGHREWLAEVIFLGQLKHRN  143

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+LE +LF+   A+LPW TR+KIA+GAAKGLAFLH  
Sbjct  144  LVNLIGYCCEDEHRLLVYEYMERGNLEEKLFKAYLATLPWLTRIKIAIGAAKGLAFLHEE  203

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RD KASNILLD+DY AKLSDFGLA DGPE D TH++TRVMGT GYAAPEYIMTG
Sbjct  204  EKPVIYRDIKASNILLDADYNAKLSDFGLAIDGPEKDQTHITTRVMGTHGYAAPEYIMTG  263

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
             LT  SDVYSFGVVLLEL+TG+KS+DK RP REQ+LV+WARP LKD  KL RI+D RL+ 
Sbjct  264  RLTTMSDVYSFGVVLLELITGKKSVDKKRPTREQDLVEWARPLLKDSHKLERIIDSRLED  323

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GARK A L+Y+CLSQ   +RPTM  VVK LEPL    ++P+  F+YVAP+
Sbjct  324  QYSIEGARKLATLAYQCLSQHDKSRPTMRTVVKTLEPLMKLNDIPIGHFVYVAPS  378



>ref|XP_009337171.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=411

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 245/297 (82%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V KGFV DKLRPGLKAQPVA+K LD D    QGH+EWLTE++ LGQLRHP+
Sbjct  89   LLGEGGFGPVFKGFVGDKLRPGLKAQPVAVKLLDLDGL--QGHKEWLTEIIFLGQLRHPN  146

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEY+  GSLENQLFR  S  L W+ RMKIA+GAAKGLAFLH A
Sbjct  147  LVKLIGYCCEDEHRLLVYEYIAGGSLENQLFRSYSTPLSWSKRMKIAVGAAKGLAFLHEA  206

Query  362  E-KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
            + KP+IFRDFK SNILL+SD+ AKLSDFGLA+DGPEG+DTH++TR +GT+GYA PEYIMT
Sbjct  207  DHKPVIFRDFKTSNILLESDHTAKLSDFGLARDGPEGEDTHITTRRIGTRGYADPEYIMT  266

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            G LT  SDVYSFGVVLLELLTG++ ID +RP RE+NLV+WA+P+LKDPRKL RI+DP ++
Sbjct  267  GCLTTKSDVYSFGVVLLELLTGKRCIDNSRPKRERNLVEWAKPRLKDPRKLDRIIDPMME  326

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAPT  886
            G YS  GARKAA L++KCLS     RP MS+VV +LE L+D+ E  +V  F+YVAP 
Sbjct  327  GQYSTRGARKAAALAFKCLSHNPKQRPRMSDVVVILEGLQDFNEELVVRPFVYVAPN  383



>ref|XP_002519978.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF42302.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=534

 Score =   426 bits (1096),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 236/279 (85%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  90   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPWATRM IA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLPWATRMMIALGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  208  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  268  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKLLQIIDPRLEN  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  328  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_010922837.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Elaeis guineensis]
Length=405

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 235/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  78   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPNL  135

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAAKGLAFLH AE
Sbjct  136  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSWATRMSIALGAAKGLAFLHNAE  195

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  196  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGH  255

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVY FGVVLLELLTGR+S+DKTRP +E +LVDWARP+L D RK+ +I+DPRL+G 
Sbjct  256  LTARSDVYGFGVVLLELLTGRRSVDKTRPSKEHSLVDWARPKLNDKRKMLQIIDPRLEGQ  315

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  316  YSVRVAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  353



>ref|XP_011018376.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
Length=422

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 236/287 (82%), Gaps = 2/287 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKG+VDD LR GLKAQ VA+K LD +    QGHREWL EV+ LGQLRHP+
Sbjct  97   LLGEGGFGTVHKGYVDDNLRQGLKAQAVAVKLLDIEGL--QGHREWLAEVIFLGQLRHPN  154

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEE++RLLVYE+MPRGSLEN LF+RIS SLPW+TR+KIA+GAAKGLAFLHGA
Sbjct  155  LVKLIGYCCEEEERLLVYEFMPRGSLENHLFKRISVSLPWSTRLKIAIGAAKGLAFLHGA  214

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SN+LLDSD+  KLSDFGLAK GPEG DTHV+TRVMGT GYAAPEY+ TG
Sbjct  215  EKPVIYRDFKTSNVLLDSDFTVKLSDFGLAKMGPEGSDTHVTTRVMGTYGYAAPEYVSTG  274

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDV+SFGVVLLELLTGR++ DK+RP REQN++DWA+P L   R+L  I+DPRL G
Sbjct  275  HLTTKSDVFSFGVVLLELLTGRRATDKSRPKREQNIIDWAKPYLTSSRRLRCIIDPRLAG  334

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV  862
             YS  GA++ ALL+ +C+S     RP M  +V+ LE L+ YK++ + 
Sbjct  335  QYSVKGAKQMALLARQCVSLNPKDRPKMPSIVETLEALQHYKDMAVA  381



>ref|XP_010553184.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=410

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/288 (71%), Positives = 238/288 (83%), Gaps = 2/288 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++DD LR GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  68   ILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  125

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L W+ RM IA+GAAKGLA LH A
Sbjct  126  LVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSWSRRMMIALGAAKGLACLHNA  185

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  186  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  245

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGRKS+DKTRP REQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  246  HLTARSDVYSFGVVLLEMLTGRKSVDKTRPSREQNLVDWARPKLNDKRKLLQIIDPRLEN  305

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVT  865
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+   +V  V+
Sbjct  306  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQCTGDVGQVS  353



>ref|XP_011006228.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Populus 
euphratica]
Length=432

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  90   ILGEGGFGTVYKGYIDENVRVGLKSIPVAVKVLNREGL--QGHREWLTEVNFLGQLRHPN  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  208  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  268  HLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWARPKLNDKRKLLQIIDPRLEN  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  328  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_007032291.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY03217.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
Length=405

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  63   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  120

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  121  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLSWATRMMIALGAAKGLAFLHNA  180

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  181  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  240

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQNLV+WARP+L D RKL +I+DPRL+ 
Sbjct  241  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVEWARPKLNDKRKLLQIIDPRLEN  300

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  301  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  339



>ref|XP_002872982.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49241.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++DD LR GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  74   ILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  131

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L W+ RM IA+GAAKGLAFLH A
Sbjct  132  LVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSWSRRMMIALGAAKGLAFLHNA  191

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  192  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  251

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGRKS+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  252  HLTARSDVYSFGVVLLEMLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  311

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  312  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  350



>ref|XP_004492609.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cicer 
arietinum]
Length=439

 Score =   422 bits (1086),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 235/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  99   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  156

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  157  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIALGAAKGLAFLHNA  216

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  217  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  276

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  277  HLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWARPKLNDKRKLLQIIDPRLEN  336

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+ 
Sbjct  337  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  376



>ref|XP_010922836.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Elaeis guineensis]
Length=414

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 235/278 (85%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAAKGLAFLH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSWATRMSIALGAAKGLAFLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVY FGVVLLELLTGR+S+DKTRP +E +LVDWARP+L D RK+ +I+DPRL+G 
Sbjct  265  LTARSDVYGFGVVLLELLTGRRSVDKTRPSKEHSLVDWARPKLNDKRKMLQIIDPRLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSVRVAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_010424023.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Camelina 
sativa]
 ref|XP_010496821.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Camelina 
sativa]
Length=410

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++DD LR GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  74   ILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  131

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L W+ RM IA+GAAKGLAFLH A
Sbjct  132  LVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSWSRRMMIALGAAKGLAFLHNA  191

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  192  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  251

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGRKS+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  252  HLTARSDVYSFGVVLLEMLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  311

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  312  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  350



>ref|XP_003623694.1| Protein kinase 2B [Medicago truncatula]
 gb|AES79912.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=437

 Score =   422 bits (1085),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  96   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  153

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA+GAAKGLAFLH A
Sbjct  154  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLTWATRMMIALGAAKGLAFLHNA  213

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  214  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  273

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RKL +I+DPRL+ 
Sbjct  274  HLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWARPKLNDKRKLLQIIDPRLEN  333

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  334  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  372



>ref|NP_195722.2| serine/threonine-protein kinase [Arabidopsis thaliana]
 sp|Q8GXZ3.1|Y5102_ARATH RecName: Full=Serine/threonine-protein kinase At5g01020 [Arabidopsis 
thaliana]
 dbj|BAC42590.1| putative protein kinase [Arabidopsis thaliana]
 gb|AED90288.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=410

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++DD LR GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  74   ILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  131

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L W+ RM IA+GAAKGLAFLH A
Sbjct  132  LVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSWSRRMMIALGAAKGLAFLHNA  191

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  192  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  251

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGRKS+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  252  HLTARSDVYSFGVVLLEMLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  311

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  312  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  350



>gb|KDP39727.1| hypothetical protein JCGZ_02747 [Jatropha curcas]
Length=415

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 236/288 (82%), Gaps = 2/288 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKG+VDD LR GLKAQPVA+K LD +    QGHREWL EVV LGQLRHP+
Sbjct  97   LLGEGGFGTVHKGYVDDHLREGLKAQPVAVKLLDIEGL--QGHREWLAEVVFLGQLRHPN  154

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+++RLLVYE+MPRGSLEN LF+RIS SLPW TR+KIA+GAAKGLAFLH A
Sbjct  155  LVKLIGYCCEDEERLLVYEFMPRGSLENHLFKRISVSLPWGTRLKIAVGAAKGLAFLHDA  214

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SN+LLDSD+ AKLSDFGLAK GPEG DTHV+TRVMGT GYAAPEY+ TG
Sbjct  215  EKPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSDTHVTTRVMGTYGYAAPEYVSTG  274

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+++DK+RP  EQNL+DWA+P L   R+L  IMDPRL G
Sbjct  275  HLTTKSDVYSFGVVLLELLTGRRAMDKSRPKSEQNLIDWAKPYLTSSRRLRYIMDPRLAG  334

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVT  865
             YS  GA++ A L+ +C+S     RP M  +V+ LE L+ YK++ + +
Sbjct  335  QYSVKGAKQIAHLATQCISINPKDRPKMPAIVETLEALQQYKDMAVTS  382



>ref|XP_006662686.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
 ref|XP_006663762.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
Length=413

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/278 (73%), Positives = 233/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVRFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFRR +  LPWATRM IA+GAAKGLA LH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRRTATPLPWATRMSIALGAAKGLACLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +PII+RDFK SNILLDSDY AKLSDFGLAK GPEGD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPIIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP RE +LVDWA P+L D R+L +I+DP+L+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREHSLVDWALPKLNDKRRLLQIIDPKLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSVRAAHKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_002450171.1| hypothetical protein SORBIDRAFT_05g001450 [Sorghum bicolor]
 gb|EES09159.1| hypothetical protein SORBIDRAFT_05g001450 [Sorghum bicolor]
Length=410

 Score =   421 bits (1082),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/277 (72%), Positives = 232/277 (84%), Gaps = 2/277 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV CLGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNCLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPW TRM IA+GAAKGLA LH A+
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQ  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDQTHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP REQ+LVDWA P+L D R+L +I+DP+L+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPKLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPL  835
            YS   A KA  L++ CLSQ   ARP MS+VV+ LEPL
Sbjct  325  YSVRAAHKACSLAFYCLSQNPKARPLMSDVVETLEPL  361



>ref|XP_009383280.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   421 bits (1082),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/278 (72%), Positives = 234/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGAVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAAKGLAFLH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAAAPLSWATRMSIALGAAKGLAFLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGR+S+DK RP +EQ+LVDWARP+L D RKL +I+DPRL+  
Sbjct  265  LTARSDVYSFGVVLLELLTGRRSVDKARPSKEQSLVDWARPKLNDKRKLLQIIDPRLEDQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLS    ARP MS+VV+ LEPL+
Sbjct  325  YSVRAAQKACSLAYYCLSHNPKARPLMSDVVETLEPLQ  362



>ref|XP_008388407.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
 ref|XP_008388408.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
 ref|XP_008388409.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=416

 Score =   421 bits (1082),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 200/283 (71%), Positives = 234/283 (83%), Gaps = 2/283 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  85   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGY--QGHREWLTEVNFLGQLRHPN  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W TRM IA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWGTRMMIALGAAKGLAFLHNA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY  KLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  203  ERPVIYRDFKTSNILLDSDYATKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  263  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE  850
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+   E
Sbjct  323  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSCNE  365



>ref|XP_010429651.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=424

 Score =   421 bits (1083),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 235/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDK++PGL+AQPVA+K LD      QGHREWL E++ LGQL + H
Sbjct  93   MLGEGGFGPVYKGFIDDKVKPGLEAQPVAVKALDLH--GHQGHREWLAEILFLGQLSNKH  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+C EE+QR+LVYEYMPRGSLENQ+FRR S ++ W  RMKIA+GAAKGL FLH A
Sbjct  151  LVKLIGFCYEEEQRVLVYEYMPRGSLENQIFRRNSVAMAWGIRMKIALGAAKGLVFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDS+Y AKLSDFGLAKDGPEG+ THV+TRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKTSNILLDSNYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  +DVYSFGVVLLEL+TG+KS+D TR  REQ+LV+W RP L+D RKL +I+DPRL+ 
Sbjct  271  HLTTMNDVYSFGVVLLELITGKKSMDNTRARREQSLVEWMRPMLRDQRKLGQIIDPRLES  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y  + A+ AA L+YKCLSQ+   RPTM EVVKVLE +++
Sbjct  331  QYKTEAAQVAASLAYKCLSQQPKYRPTMCEVVKVLESIQE  370



>ref|XP_009381351.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   421 bits (1082),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/278 (72%), Positives = 234/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNRDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L WATRM IA+GAAKGLAFLH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSWATRMSIALGAAKGLAFLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGR+S+DKTRP +EQ+LVDWARP+L D RKL +I+D RL+  
Sbjct  265  LTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWARPKLNDKRKLLQIIDSRLEDQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A+KA  L+Y CLS    ARP MS+VV+ LEPL+
Sbjct  325  YSARAAQKACSLAYYCLSHNPKARPLMSDVVETLEPLQ  362



>gb|KFK24698.1| hypothetical protein AALP_AA8G013200 [Arabis alpina]
Length=401

 Score =   420 bits (1080),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++DD LR GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  71   ILGEGGFGTVYKGYIDDNLRLGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  128

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L W+ RM IA+GAAKGLAFLH A
Sbjct  129  LVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSWSRRMMIALGAAKGLAFLHNA  188

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  189  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  248

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGRKS+DKT+P +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  249  HLTARSDVYSFGVVLLEMLTGRKSVDKTKPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  308

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  309  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  347



>ref|XP_006429669.1| hypothetical protein CICLE_v10011776mg [Citrus clementina]
 ref|XP_006481270.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Citrus 
sinensis]
 gb|ESR42909.1| hypothetical protein CICLE_v10011776mg [Citrus clementina]
 gb|KDO64217.1| hypothetical protein CISIN_1g014079mg [Citrus sinensis]
Length=431

 Score =   421 bits (1083),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 200/279 (72%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  85   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L WATRM IA GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATRMMIAFGAAKGLAFLHNA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  203  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RK+ +I+DPRL+ 
Sbjct  263  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLEN  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  323  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  361



>gb|ACN35685.1| unknown [Zea mays]
 gb|AFW64655.1| putative protein kinase superfamily protein [Zea mays]
Length=426

 Score =   421 bits (1082),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 233/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV CLGQLRHP++
Sbjct  103  LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNCLGQLRHPNL  160

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPW TRM IA+GAAKGLA LH A+
Sbjct  161  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTATPLPWGTRMSIALGAAKGLACLHNAQ  220

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAKDGPEGD THVSTRVMGT GYAAPEY+MTGH
Sbjct  221  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKDGPEGDQTHVSTRVMGTYGYAAPEYVMTGH  280

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP REQ+LVDWA P+L D R+L +I+DPRL+G 
Sbjct  281  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREQSLVDWALPKLNDKRRLLQIIDPRLEGQ  340

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A K+  L++ CLSQ   ARP MS+VV+ L PL+
Sbjct  341  YSARAAHKSCSLAFYCLSQNPKARPLMSDVVETLAPLQ  378



>ref|XP_006649093.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
Length=446

 Score =   422 bits (1084),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 239/293 (82%), Gaps = 3/293 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KGFVD KLRPGL +Q VA+K LDTD    QGHREWL EVV LG L HPH
Sbjct  81   FIGEGGFGPVYKGFVDAKLRPGLHSQHVAVKYLDTD--GPQGHREWLAEVVYLGMLSHPH  138

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCC++D R+LVYEYM RGSLE+ LF+ + +SLPWATR+KIA+GAAKGLAFLH A
Sbjct  139  LVKLIGYCCQDDHRMLVYEYMARGSLEHHLFKNLLSSLPWATRLKIAVGAAKGLAFLHDA  198

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+I+RDFKASNILLDSDY AKLSDFGLAK+GP+GD THV+TRVMGT GYAAPEYI+TG
Sbjct  199  DTPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQGDATHVTTRVMGTHGYAAPEYILTG  258

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DK R  REQNLVDWARP L+ P +L+R+MDP L+G
Sbjct  259  HLTAKSDVYSFGVVLLELLTGRRSVDKRRRGREQNLVDWARPYLRRPERLHRVMDPSLEG  318

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEP-LKDYKEVPMVTFLYV  877
             YS+  A KAA+++Y CL     +RP M +VV  LEP L    +VP   F+Y 
Sbjct  319  GYSDKVANKAAMVAYHCLHSVPKSRPHMRDVVDALEPLLHTCGDVPAGPFVYT  371



>gb|EYU26700.1| hypothetical protein MIMGU_mgv1a006846mg [Erythranthe guttata]
Length=429

 Score =   421 bits (1082),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 236/279 (85%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  91   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  148

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ ++ L W+TRM IA+GAAKGLAFLH A
Sbjct  149  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATSPLSWSTRMMIALGAAKGLAFLHNA  208

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  209  ERPVIYRDFKTSNILLDSDYMAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  268

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RK+ +I+DPRL+ 
Sbjct  269  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLEN  328

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  329  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  367



>ref|XP_006398549.1| hypothetical protein EUTSA_v10013688mg [Eutrema salsugineum]
 gb|ESQ40002.1| hypothetical protein EUTSA_v10013688mg [Eutrema salsugineum]
Length=410

 Score =   420 bits (1080),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++DD LR GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  74   ILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  131

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L W+ RM IA+GAAKGLAFLH A
Sbjct  132  LVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSWSRRMMIALGAAKGLAFLHNA  191

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  192  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  251

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGRKS+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  252  HLTARSDVYSFGVVLLEMLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  311

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+K+  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  312  QYSVRAAQKSCSLAYYCLSQNPKARPLMSDVVETLEPLQ  350



>ref|XP_010244204.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=419

 Score =   421 bits (1081),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/295 (68%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKG++D+ LR GLKAQ VA+K LD++    QGHREWL EV+ LGQLRHPH
Sbjct  94   LLGEGGFGTVHKGYIDENLRQGLKAQAVAVKLLDSEGL--QGHREWLAEVIFLGQLRHPH  151

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V+LIGYCCE+++RLLVYE+MPRGSLEN LFRRIS SLPW TR+KIA+GAAKGLAFLHGA
Sbjct  152  LVRLIGYCCEDEERLLVYEFMPRGSLENHLFRRISVSLPWGTRLKIAIGAAKGLAFLHGA  211

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SN+LLDSD+ AKLSDFGLAK GPEG +THV+TRVMGT GYAAPEY+ TG
Sbjct  212  EKPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSNTHVTTRVMGTYGYAAPEYVTTG  271

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+S+DKTRP  EQNLVDWARP L   RKL  IMD RL G
Sbjct  272  HLTTKSDVYSFGVVLLELLTGRRSMDKTRPKSEQNLVDWARPYLTSSRKLRCIMDTRLAG  331

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS  GAR+ A L+ +C+S     RP M  +V+ LE L++ +++ +    + A T
Sbjct  332  QYSVKGAREIASLALQCVSPNPKDRPRMPAIVETLEKLQNLRDMAVTCGQWPAAT  386



>ref|XP_006279336.1| hypothetical protein CARUB_v10012732mg [Capsella rubella]
 gb|EOA12234.1| hypothetical protein CARUB_v10012732mg [Capsella rubella]
Length=410

 Score =   420 bits (1080),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++DD LR GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  74   ILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  131

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +A L W+ RM I++GAAKGLAFLH A
Sbjct  132  LVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSWSRRMMISLGAAKGLAFLHNA  191

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  192  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  251

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLE+LTGRKS+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  252  HLTARSDVYSFGVVLLEMLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  311

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  312  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  350



>ref|XP_002880775.1| root-specific kinase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57034.1| root-specific kinase 1 [Arabidopsis lyrata subsp. lyrata]
Length=423

 Score =   420 bits (1080),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 237/280 (85%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDK++PG++AQPVA+K LD      QGHREWL E++ LGQL + H
Sbjct  93   MLGEGGFGPVYKGFIDDKVKPGIEAQPVAVKALDLH--GHQGHREWLAEIIFLGQLSNKH  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+CCEE+QR+LVYEYMPRGSLENQLFRR S ++ W  RMKIA+GAAKGLAFLH A
Sbjct  151  LVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRNSLAMAWGIRMKIALGAAKGLAFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSDY AKLSDFGLAKDGPEG+ THV+TRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  +DVYSFGVVLLEL+TG++S+D TR  REQ+LV+WARP L+D RKL R++DPRL+ 
Sbjct  271  HLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQSLVEWARPMLRDQRKLERVIDPRLEN  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y  + A+ AA L+YKCLSQ    RPTM EVVKVLE +++
Sbjct  331  QYKIEAAQVAAALAYKCLSQHPKYRPTMCEVVKVLESIQE  370



>ref|XP_009337839.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
 ref|XP_009337840.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
 ref|XP_009337841.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=416

 Score =   420 bits (1079),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 200/283 (71%), Positives = 234/283 (83%), Gaps = 2/283 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  85   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGF--QGHREWLTEVNFLGQLRHPN  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W TRM IA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLLWGTRMMIALGAAKGLAFLHNA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY  KLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  203  ERPVIYRDFKTSNILLDSDYATKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  263  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLEN  322

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKE  850
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+   E
Sbjct  323  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSCNE  365



>ref|NP_001049156.1| Os03g0179400 [Oryza sativa Japonica Group]
 gb|ABF94292.1| serine/threonine-protein kinase NAK, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11070.1| Os03g0179400 [Oryza sativa Japonica Group]
 dbj|BAG97926.1| unnamed protein product [Oryza sativa Japonica Group]
Length=425

 Score =   420 bits (1080),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/295 (71%), Positives = 247/295 (84%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KG+VDDKL+PGL+AQPVA+K LD +    QGH EWLTEV+ LGQLRHPH
Sbjct  97   FIGEGGFGPVYKGYVDDKLKPGLRAQPVAVKLLDLEGT--QGHNEWLTEVIFLGQLRHPH  154

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ RLLVYE+M RGSLE  LF++ +ASLPW+TR+KIA+GAAKGLAFLH A
Sbjct  155  LVKLIGYCYEDEHRLLVYEFMTRGSLEKHLFKKYAASLPWSTRLKIAIGAAKGLAFLHEA  214

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSD++AKLSDFGLAKDGPE D+THVSTRVMGTQGYAAPEYIMTG
Sbjct  215  EKPVIYRDFKTSNILLDSDFKAKLSDFGLAKDGPEDDETHVSTRVMGTQGYAAPEYIMTG  274

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVY FGVVLLELL+GRKS+DK+RP REQNLV+WARP L D R+L R+MD  L G
Sbjct  275  HLTAKSDVYGFGVVLLELLSGRKSVDKSRPAREQNLVEWARPYLTDARRLGRVMDRNLAG  334

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAP  883
             Y    A+KAA L+++C+S    +RP MS VV+ LEPL    +  +V TF+YVAP
Sbjct  335  QYPAKAAQKAAALAHRCVSLNPKSRPHMSAVVEALEPLLALDDDCLVGTFVYVAP  389



>ref|XP_003579009.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brachypodium 
distachyon]
Length=411

 Score =   420 bits (1079),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 201/278 (72%), Positives = 231/278 (83%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++DD +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDDNVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN L R+ +  LPWATRM IA+GAAKGLA LH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLLRKTATPLPWATRMSIALGAAKGLACLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDQTHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP RE +LVDW RP+L D R+L +I+DP+L+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREHSLVDWVRPKLSDKRRLLQIIDPKLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSVRAAHKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>gb|KDP21817.1| hypothetical protein JCGZ_00604 [Jatropha curcas]
Length=433

 Score =   421 bits (1081),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  92   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  149

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W TRM IA+GAAKGLAFLH A
Sbjct  150  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWGTRMMIALGAAKGLAFLHNA  209

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  210  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  269

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RK+ +I+DPRL+ 
Sbjct  270  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQILDPRLES  329

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  330  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  368



>dbj|BAK05812.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   419 bits (1078),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 200/278 (72%), Positives = 233/278 (84%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVNFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPWATRM IA+GAAKGLA LH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAIPLPWATRMSIALGAAKGLACLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +P+I+RDFK SNILLDSDY AKLSDFGLAK GPEGD+THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+R  RE +LVDW RP+L D R+L++I+DP+L+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRKSIDKSRASREHSLVDWVRPKLSDKRRLHQIIDPKLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSVRAAHKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>gb|KGN58674.1| hypothetical protein Csa_3G727920 [Cucumis sativus]
Length=537

 Score =   424 bits (1090),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  203  ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  260

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  LPWA RM IA+GAAKGLAFLH A
Sbjct  261  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLPWARRMMIALGAAKGLAFLHNA  320

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  321  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  380

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKT+P +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  381  HLTARSDVYSFGVVLLELLTGRKSVDKTKPSKEQNLVDWARPKLNDKRKLLQIIDPRLES  440

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  441  QYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  479



>ref|XP_010417417.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=424

 Score =   420 bits (1079),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 235/280 (84%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDK++PGL+ QPVA+K LD      QGHREWL E++ LGQL + H
Sbjct  93   MLGEGGFGPVYKGFIDDKVKPGLEPQPVAVKALDLH--GHQGHREWLAEILFLGQLSNKH  150

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+C EE+QR+LVYEYMPRGSLENQLFRR S ++ W  RMKIA+GAAKGLAFLH A
Sbjct  151  LVKLIGFCYEEEQRVLVYEYMPRGSLENQLFRRNSVAMAWGIRMKIALGAAKGLAFLHEA  210

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDS+Y AKLSDFGLAKDGPEG+ THV+TRVMGTQGYAAPEYIMTG
Sbjct  211  EKPVIYRDFKTSNILLDSNYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTG  270

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  +DVYSFGVVLLEL+TG++S+D TR  REQ+LV+W RP L+D RKL +I+DPRL+ 
Sbjct  271  HLTTMNDVYSFGVVLLELITGKRSMDNTRARREQSLVEWMRPMLRDQRKLEQIIDPRLES  330

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y  + A+ AA L+YKCLSQ+   RPTM EVVKVLE +++
Sbjct  331  QYKTEAAQVAASLAYKCLSQQPKYRPTMCEVVKVLESIQE  370



>ref|XP_008393577.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=401

 Score =   419 bits (1077),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/297 (70%), Positives = 240/297 (81%), Gaps = 4/297 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             +GEGGFG V KGFV DK+RPGLKAQPVA+K LD D    QGH+EWL E+V LGQLRH +
Sbjct  89   LIGEGGFGPVFKGFVGDKVRPGLKAQPVAVKLLDLDGL--QGHKEWLAEIVFLGQLRHQN  146

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE++ RLLVYEYM  GSLENQLFR  S  L W+ RMKIA+GAAKGLAFLH A
Sbjct  147  LVKLIGYCCEDEHRLLVYEYMAGGSLENQLFRSYSTPLSWSKRMKIAVGAAKGLAFLHEA  206

Query  362  E-KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMT  538
            + KP+IFRDFK SNILLDSDY AKLSDFGLAKDGPEG+DTH++TR++GTQGYAAPEYIMT
Sbjct  207  DHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKDGPEGEDTHITTRIIGTQGYAAPEYIMT  266

Query  539  GHLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLD  718
            G LT  SDVYSFGVVLLELLTG++ ID T P REQ LV+WA+P+LKD RKL  I+DP ++
Sbjct  267  GCLTTKSDVYSFGVVLLELLTGKRCIDNTCPSREQKLVEWAKPRLKDTRKLDGIIDPMME  326

Query  719  GMYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMV-TFLYVAPT  886
            G YS  GARKAA L+Y CLS     RP MS+VV +LE L+D+ E  +V  F+YVAP 
Sbjct  327  GQYSIRGARKAAALAYSCLSHNPKQRPRMSDVVVILEGLQDFDEGLVVRPFVYVAPN  383



>ref|XP_011077494.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Sesamum 
indicum]
Length=432

 Score =   420 bits (1079),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 235/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  90   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  147

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ +  L W+TRM IA+GAAKGLAFLH A
Sbjct  148  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWSTRMMIALGAAKGLAFLHNA  207

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  208  ERPVIYRDFKTSNILLDSDYMAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  267

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RK+ +I+DPRL+ 
Sbjct  268  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLEN  327

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  328  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_003572269.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brachypodium 
distachyon]
Length=479

 Score =   422 bits (1084),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/294 (69%), Positives = 239/294 (81%), Gaps = 6/294 (2%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            +LG GGFG V+KG V D+LRPGL+AQPVA+K LD D C+ QGH+EWL EV  LGQLRH +
Sbjct  103  YLGCGGFGPVYKGRVSDELRPGLQAQPVAVKYLDLD-CSTQGHKEWLAEVFFLGQLRHKN  161

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ R+LVYEYM  GSLE  LF+ +  S+PW TRM+IA+GAAKGLAFLH A
Sbjct  162  LVKLIGYCYEDEHRMLVYEYMGNGSLEKHLFKSLDGSMPWITRMRIAVGAAKGLAFLHDA  221

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            + P+IFRDFKASNILLD DY +KLSDFGLAKDGP+GD THV+TR+MGT GYAAPEYIMTG
Sbjct  222  DTPVIFRDFKASNILLDEDYNSKLSDFGLAKDGPQGDATHVTTRIMGTHGYAAPEYIMTG  281

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELL+GR+SID+ R  REQ+LVD+ARP LK P KLYRIMDP L+G
Sbjct  282  HLTAKSDVYSFGVVLLELLSGRRSIDRARRSREQSLVDYARPYLKKPEKLYRIMDPALEG  341

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YS  GA +AA ++YKCLSQ S +RPTM EVVK LEP+ D     M  +L V P
Sbjct  342  QYSCKGAEQAAQVAYKCLSQNSKSRPTMREVVKSLEPILD-----MDDYLQVGP  390



>emb|CDP06356.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   420 bits (1080),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 236/279 (85%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  96   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  153

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ + +L W+TRM IA+GAAKGLAFLH A
Sbjct  154  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVTLSWSTRMMIALGAAKGLAFLHNA  213

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  214  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  273

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTG+KS+DKTRP +EQNLVDWARP+L D RK+ +I+DPRL+ 
Sbjct  274  HLTARSDVYSFGVVLLELLTGKKSVDKTRPSKEQNLVDWARPKLNDKRKMLQIIDPRLEN  333

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  334  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  372



>ref|XP_008802984.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Phoenix 
dactylifera]
Length=415

 Score =   419 bits (1076),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 236/286 (83%), Gaps = 2/286 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKG+VDD++RPGLKAQ VA+K LD +    QGHREWLTEV+ LGQ RHPH
Sbjct  94   LLGEGGFGTVHKGYVDDRMRPGLKAQAVAVKLLDME--GRQGHREWLTEVIFLGQFRHPH  151

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+++RLLVYE+MPRGSLEN LF+RISA+L W TR+KIA+GAAKGLAFLHG+
Sbjct  152  LVKLIGYCCEDEERLLVYEFMPRGSLENHLFKRISATLSWGTRLKIAIGAAKGLAFLHGS  211

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLDSD+ AKLSDFGLAK GPEG+DTHV+TRVMGT GYAAPEY+MTG
Sbjct  212  EKPVIYRDFKTSNILLDSDFTAKLSDFGLAKMGPEGEDTHVTTRVMGTHGYAAPEYVMTG  271

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYS+GVVLLELLTGR+++DK R   E+ LV+WA+P L   RKL  I+DP+  G
Sbjct  272  HLTTKSDVYSYGVVLLELLTGRRAMDKNRSKSEEKLVNWAKPYLTSSRKLRCIIDPKFGG  331

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPM  859
             YS  GAR+ A L+ +C+S   N RP MS  V++LE L+  K++ +
Sbjct  332  QYSIKGAREVASLALQCISPNPNDRPRMSAAVQILEGLRHLKDMAV  377



>ref|XP_010693043.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   420 bits (1079),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/279 (71%), Positives = 233/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  106  ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  163

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+    L W+TRM IA+GAAKGLAFLH A
Sbjct  164  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAVVPLSWSTRMMIALGAAKGLAFLHNA  223

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY  KLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  224  ERPVIYRDFKTSNILLDSDYTTKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  283

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP +EQNLVDWARP+L D RKL +I+DPRL+ 
Sbjct  284  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLES  343

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  344  QYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  382



>ref|XP_007135433.1| hypothetical protein PHAVU_010G129000g [Phaseolus vulgaris]
 gb|ESW07427.1| hypothetical protein PHAVU_010G129000g [Phaseolus vulgaris]
Length=464

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 239/295 (81%), Gaps = 2/295 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG+V+KGF+DD  + GLKAQ VA+K L+ D    QGHREWL EV+ LGQL+H H
Sbjct  87   ILGEGGFGKVYKGFIDDSFKRGLKAQVVAVKALNLD--GKQGHREWLAEVIFLGQLKHRH  144

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V LIGYCCE++ RLLVYEYM RG+LE +LF+   A+LPW TR+KIA+GAAKGL FLH  
Sbjct  145  LVNLIGYCCEDEYRLLVYEYMERGNLEEKLFKGYVAALPWLTRIKIAIGAAKGLMFLHEE  204

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFKASNILLD+DY AKLSDFGLA DGPE D TH++TRVMGT+GYAAPEYIMTG
Sbjct  205  EKPVIYRDFKASNILLDADYNAKLSDFGLAIDGPEKDQTHITTRVMGTKGYAAPEYIMTG  264

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTG+KS+DK RP REQ+LV+WARP L+D  KL RIMDPRL+ 
Sbjct  265  HLTTMSDVYSFGVVLLELLTGKKSVDKKRPSREQDLVEWARPLLRDSYKLERIMDPRLED  324

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAPT  886
             YS +GA++ A L+Y+CLS  +  RPTM  VV+ LE L   K++P+  F+YV P+
Sbjct  325  QYSPEGAKRFAALAYQCLSHHAKGRPTMRTVVRTLESLLKLKDIPVGPFVYVVPS  379



>ref|NP_001064525.1| Os10g0395000 [Oryza sativa Japonica Group]
 gb|AAM22740.1|AC092388_24 putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|AAM44878.1|AC122144_1 Putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|AAP53593.1| serine/threonine-protein kinase NAK, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26439.1| Os10g0395000 [Oryza sativa Japonica Group]
 gb|EAZ15967.1| hypothetical protein OsJ_31410 [Oryza sativa Japonica Group]
Length=389

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 197/294 (67%), Positives = 242/294 (82%), Gaps = 2/294 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
            F+GEGGFG V+KG+VD++L+PG++AQ VA+K LD +    QGH+EWL EV+ LGQLRH H
Sbjct  94   FVGEGGFGPVYKGYVDERLKPGVRAQAVAVKLLDLE--GSQGHKEWLAEVIFLGQLRHHH  151

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYC E++ RLLVYE+M RGSLE  LF++ SASLPW+TR+KIA+GAA+GLAFLH A
Sbjct  152  LVKLIGYCYEDEHRLLVYEFMARGSLEKHLFKKYSASLPWSTRLKIAIGAARGLAFLHEA  211

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
             KP+I+RDFK SNILL+SDY AKLSDFGLAKDGP+ D+THVSTRVMGTQGYAAPEYIMTG
Sbjct  212  AKPVIYRDFKTSNILLNSDYEAKLSDFGLAKDGPQEDETHVSTRVMGTQGYAAPEYIMTG  271

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYS+GVVLLELLTGRK++DK RPPREQNLV+WARP L D R+L R++D  L+G
Sbjct  272  HLTTKSDVYSYGVVLLELLTGRKAVDKKRPPREQNLVEWARPCLHDSRRLNRVIDKSLNG  331

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEVPMVTFLYVAP  883
             YS    +KAA ++Y+CLS    +RP MS VV+ LEPL    +  +  F+Y+AP
Sbjct  332  QYSTRAVQKAAAIAYQCLSVSPKSRPRMSAVVEALEPLLAMDDGIVEPFVYMAP  385



>gb|KDO46394.1| hypothetical protein CISIN_1g014736mg [Citrus sinensis]
Length=419

 Score =   418 bits (1075),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 233/284 (82%), Gaps = 2/284 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG VHKG++DD LR GLKAQ VA+K LD +    QGHREWL EV+ LGQLRHPH
Sbjct  98   LLGEGGFGTVHKGYIDDDLRQGLKAQAVAVKLLDIEGL--QGHREWLAEVIFLGQLRHPH  155

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +V+LIGYCCE+++RLLVYE+MPRGSLEN LF+RIS SLPW TR+KIA+GAAKGLAFLHGA
Sbjct  156  LVRLIGYCCEDEERLLVYEFMPRGSLENHLFKRISVSLPWGTRLKIAIGAAKGLAFLHGA  215

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E P+I+RDFK SNILLDSD+ AKLSDFGLAK GPEG +THV+TRVMGT GYAAPEYI TG
Sbjct  216  ENPVIYRDFKTSNILLDSDFTAKLSDFGLAKMGPEGSNTHVTTRVMGTYGYAAPEYISTG  275

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  SDVYSFGVVLLELLTGR+S+DK RP  EQNLVDWA+P L+  R+L  I+DPRL G
Sbjct  276  HLTTKSDVYSFGVVLLELLTGRRSMDKLRPKSEQNLVDWAKPYLRSSRRLRYIVDPRLAG  335

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKDYKEV  853
             YS  GA++ A+L+ +C+S     RP M+ VV  LE L + K++
Sbjct  336  QYSVKGAKEMAVLALQCISVNPKDRPKMAAVVATLESLLNLKDM  379



>ref|XP_009140739.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
Length=424

 Score =   419 bits (1076),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/280 (71%), Positives = 237/280 (85%), Gaps = 2/280 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KGF+DDK++PGL+AQPVA+K LD      QGHREWL E++ LGQL + H
Sbjct  94   MLGEGGFGPVYKGFIDDKVKPGLEAQPVAVKALDLH--GHQGHREWLAEIIFLGQLSNKH  151

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIG+CCEE+QR+LVYEYMPRGSLENQLFRR S ++ W  RMKIA+GAAKGLAFLH A
Sbjct  152  LVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRNSVAMAWGIRMKIALGAAKGLAFLHEA  211

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            EKP+I+RDFK SNILLD +Y AKLSDFGLAKDGPEG+ THV+TRVMGTQGYAAPEYIMTG
Sbjct  212  EKPVIYRDFKTSNILLDCNYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTG  271

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLT  +DVYSFGVVLLEL+TG++S+D TR  REQ+LV+WARP L+D RKL RI+DPRL+ 
Sbjct  272  HLTTMNDVYSFGVVLLELITGKRSVDTTRARREQSLVEWARPMLRDQRKLDRIIDPRLEC  331

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLKD  841
             Y  + A+ AA L++KCLSQ    RPTMS+VVKVLE +++
Sbjct  332  QYKTEAAQAAAALAFKCLSQNPKYRPTMSDVVKVLESIQE  371



>ref|NP_001065612.1| Os11g0121400 [Oryza sativa Japonica Group]
 gb|ABA91210.1| serine/threonine-protein kinase NAK, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27457.1| Os11g0121400 [Oryza sativa Japonica Group]
 dbj|BAG95471.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67564.1| hypothetical protein OsI_34907 [Oryza sativa Indica Group]
 gb|EEE51544.1| hypothetical protein OsJ_32754 [Oryza sativa Japonica Group]
Length=413

 Score =   418 bits (1074),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/278 (73%), Positives = 231/278 (83%), Gaps = 2/278 (1%)
 Frame = +2

Query  5    LGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPHV  184
            LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ D    QGHREWLTEV  LGQLRHP++
Sbjct  87   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDG--HQGHREWLTEVRFLGQLRHPNL  144

Query  185  VKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGAE  364
            VKLIGYCCE+D RLLVYE+M RGSLEN LFRR +  L WATRM IA+GAAKGLA LH AE
Sbjct  145  VKLIGYCCEDDHRLLVYEFMFRGSLENHLFRRTATPLSWATRMSIALGAAKGLACLHNAE  204

Query  365  KPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGH  544
            +PII+RDFK SNILLDSDY AKLSDFGLAK GPEGD THVSTRVMGT GYAAPEY+MTGH
Sbjct  205  RPIIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDQTHVSTRVMGTYGYAAPEYVMTGH  264

Query  545  LTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDGM  724
            LTA SDVYSFGVVLLELLTGRKSIDK+RP RE +LVDWA P+L D R+L +I+DP+L+G 
Sbjct  265  LTARSDVYSFGVVLLELLTGRKSIDKSRPSREHSLVDWALPKLNDKRRLLQIIDPKLEGQ  324

Query  725  YSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
            YS   A KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  YSVRAAHKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_004302496.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Fragaria 
vesca subsp. vesca]
Length=416

 Score =   418 bits (1074),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 201/279 (72%), Positives = 234/279 (84%), Gaps = 3/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+ +    QGHREWLTEV  LGQLRHP+
Sbjct  85   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL--QGHREWLTEVNFLGQLRHPN  142

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCEED RLLVYE+M RGSLEN LFR+ +  L W+ RM IA+GAAKGLAFLH A
Sbjct  143  LVKLIGYCCEEDHRLLVYEFMFRGSLENHLFRKATVPLSWSRRMLIALGAAKGLAFLHNA  202

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLDSDY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  203  ERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  262

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGR+S+DKTRP +EQNLVDWARP+L D RKL +I+DPRLD 
Sbjct  263  HLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWARPKLNDKRKLLQIIDPRLD-  321

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  322  QYSTRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  360



>gb|EPS64243.1| hypothetical protein M569_10538, partial [Genlisea aurea]
Length=401

 Score =   417 bits (1072),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 198/279 (71%), Positives = 234/279 (84%), Gaps = 2/279 (1%)
 Frame = +2

Query  2    FLGEGGFGQVHKGFVDDKLRPGLKAQPVAIKRLDTDKCTDQGHREWLTEVVCLGQLRHPH  181
             LGEGGFG V+KG++D+ +R GLK+ PVA+K L+  K   QGHREWLTEV  LGQLRHP+
Sbjct  87   ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLN--KEGHQGHREWLTEVNFLGQLRHPN  144

Query  182  VVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRRISASLPWATRMKIAMGAAKGLAFLHGA  361
            +VKLIGYCCE+D RLLVYE+M RGSLEN LFR+ ++ L W TRM IA+GAAKGLAFLH A
Sbjct  145  LVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTASPLSWKTRMMIALGAAKGLAFLHNA  204

Query  362  EKPIIFRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTG  541
            E+P+I+RDFK SNILLD+DY AKLSDFGLAK GP+GD+THVSTRVMGT GYAAPEY+MTG
Sbjct  205  ERPVIYRDFKTSNILLDTDYMAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAPEYVMTG  264

Query  542  HLTAASDVYSFGVVLLELLTGRKSIDKTRPPREQNLVDWARPQLKDPRKLYRIMDPRLDG  721
            HLTA SDVYSFGVVLLELLTGRKS+DKTRP +EQ+LVDWARP+L D RK+ +I+D RL+ 
Sbjct  265  HLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDTRLEN  324

Query  722  MYSEDGARKAALLSYKCLSQRSNARPTMSEVVKVLEPLK  838
             YS   A+KA  L+Y CLSQ   ARP MS+VV+ LEPL+
Sbjct  325  QYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3747766514492