BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34511_g1_i1 len=498 path=[476:0-497]

Length=498
                                                                      Score     E

emb|CBI20388.3|  unnamed protein product                              50.8    1e-04   
ref|XP_010644254.1|  PREDICTED: uncharacterized protein LOC100260642  50.8    1e-04   
emb|CAN75530.1|  hypothetical protein VITISV_001347                   50.4    2e-04   Vitis vinifera
emb|CDP08030.1|  unnamed protein product                              49.3    4e-04   



>emb|CBI20388.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 73/131 (56%), Gaps = 7/131 (5%)
 Frame = +1

Query  1    DIGVTYCllggailieaialihliFGHWTIFKIMNSGCYKNNKVVKNTILPLINCGMKLI  180
            DIGVTY LL GAI ++ IA++ LIF  WTI  + NS   +     +     L  C +   
Sbjct  279  DIGVTYALLIGAISLDVIAIVKLIFSDWTIVLLKNSTAKERIYYAREK---LFFCKLWET  335

Query  181  SQK---KSWSGKVIQYSLVKHSLTGQRWKWAEPKLELFSLKELIDSLLHTQTAEVGDRLK  351
            S+    + WS  + Q+ L+++ L  +R+KW +   ++  LK+L+D + + +T  V + LK
Sbjct  336  SKSFLDRRWSNSISQHGLIRYCLR-ERFKWFDKLADILGLKDLLDEIQYKKTVTVEENLK  394

Query  352  KLVVDNIKRKA  384
            + + + +K KA
Sbjct  395  EFIFEELKEKA  405



>ref|XP_010644254.1| PREDICTED: uncharacterized protein LOC100260642 [Vitis vinifera]
Length=721

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 78/143 (55%), Gaps = 7/143 (5%)
 Frame = +1

Query  1    DIGVTYCllggailieaialihliFGHWTIFKIMNSGCYKNNKVVKNTILPLINCGMKLI  180
            DIGVTY LL GAI ++ IA++ LIF  WTI  + NS   +     +     L  C +   
Sbjct  327  DIGVTYALLIGAISLDVIAIVKLIFSDWTIVLLKNSTAKERIYYAREK---LFFCKLWET  383

Query  181  SQK---KSWSGKVIQYSLVKHSLTGQRWKWAEPKLELFSLKELIDSLLHTQTAEVGDRLK  351
            S+    + WS  + Q+ L+++ L  +R+KW +   ++  LK+L+D + + +T  V + LK
Sbjct  384  SKSFLDRRWSNSISQHGLIRYCLR-ERFKWFDKLADILGLKDLLDEIQYKKTVTVEENLK  442

Query  352  KLVVDNIKRKAADDINNNNSQDV  420
            + + + +K KA     +  ++++
Sbjct  443  EFIFEELKEKAKSSEQSRIAKEI  465



>emb|CAN75530.1| hypothetical protein VITISV_001347 [Vitis vinifera]
Length=730

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 73/131 (56%), Gaps = 7/131 (5%)
 Frame = +1

Query  1    DIGVTYCllggailieaialihliFGHWTIFKIMNSGCYKNNKVVKNTILPLINCGMKLI  180
            DIGVTY LL GAI ++ IA++ LIF  WTI  + NS   +     +     L  C +   
Sbjct  327  DIGVTYALLIGAISLDVIAIVKLIFSDWTIVLLKNSTAKERIYYAREK---LFFCKLWET  383

Query  181  SQK---KSWSGKVIQYSLVKHSLTGQRWKWAEPKLELFSLKELIDSLLHTQTAEVGDRLK  351
            S+    + WS  + Q+ L+++ L  +R+KW +   ++  LK+L+D + + +T  V + LK
Sbjct  384  SKSFLDRRWSNSISQHGLIRYCLR-ERFKWFDKLADILGLKDLLDEIQYKKTVTVEENLK  442

Query  352  KLVVDNIKRKA  384
            + + + +K KA
Sbjct  443  EFIFEELKEKA  453



>emb|CDP08030.1| unnamed protein product [Coffea canephora]
Length=637

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 72/142 (51%), Gaps = 12/142 (8%)
 Frame = +1

Query  1    DIGVTYCllggailieaialihliFGHWTIFKIMNSGCYKNNKVVKNTILPLINCGMKLI  180
            D+ VTY LL GA+ ++ +ALI +IF  WT+  + N    +    V++T+           
Sbjct  289  DVAVTYILLYGAVGLDLVALIKVIFSDWTVVVLKNRRVKRIVSAVRDTL-----------  337

Query  181  SQKKSWSGKVIQYSLVKHSLTGQRWKWAEPKLELFSLKELIDSLLHTQTAEVGDRLKKLV  360
            S  + WS  + QY+L+   L  QRW+W +   E   LK ++D + + +   + D LK+ +
Sbjct  338  SSDRRWSNTISQYNLINFCL-NQRWRWLDIAAETIGLKAVLDEMKYKKDFFIQDNLKEFI  396

Query  361  VDNIKRKAADDINNNNSQDVMA  426
               +K KA     N  ++++ +
Sbjct  397  FQELKGKARKAETNKVAKEIYS  418



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506732777192