BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34383_g1_i1 len=172 path=[150:0-171]

Length=172
                                                                      Score     E

gb|KCW89016.1|  hypothetical protein EUGRSUZ_A01341                   62.0    2e-09   
ref|XP_010068602.1|  PREDICTED: probable LRR receptor-like serine...  62.0    3e-09   
ref|XP_010068537.1|  PREDICTED: probable LRR receptor-like serine...  62.0    3e-09   
gb|KCW89022.1|  hypothetical protein EUGRSUZ_A01348                   61.2    5e-09   
ref|XP_010068611.1|  PREDICTED: probable LRR receptor-like serine...  61.2    6e-09   
ref|XP_002522985.1|  receptor protein kinase, putative                60.1    1e-08   Ricinus communis
gb|KCW89027.1|  hypothetical protein EUGRSUZ_A01354                   59.3    2e-08   
gb|KCW89014.1|  hypothetical protein EUGRSUZ_A01339                   59.3    3e-08   
ref|XP_010068524.1|  PREDICTED: probable LRR receptor-like serine...  58.9    3e-08   
ref|XP_010313677.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  58.2    6e-08   
ref|XP_010068485.1|  PREDICTED: probable leucine-rich repeat rece...  57.4    8e-08   
ref|XP_009344388.1|  PREDICTED: LRR receptor-like serine/threonin...  57.8    9e-08   
gb|KCW89013.1|  hypothetical protein EUGRSUZ_A01336                   57.4    1e-07   
ref|XP_010068445.1|  PREDICTED: probable LRR receptor-like serine...  57.4    1e-07   
ref|XP_004292236.1|  PREDICTED: probable LRR receptor-like serine...  57.4    1e-07   
ref|XP_010262428.1|  PREDICTED: probable LRR receptor-like serine...  57.4    1e-07   
gb|KCW89019.1|  hypothetical protein EUGRSUZ_A01344                   57.0    2e-07   
ref|XP_006358417.1|  PREDICTED: probable LRR receptor-like serine...  57.0    2e-07   
ref|XP_010068565.1|  PREDICTED: probable LRR receptor-like serine...  57.0    2e-07   
ref|XP_008337999.1|  PREDICTED: probable LRR receptor-like serine...  56.2    3e-07   
ref|XP_006360466.1|  PREDICTED: receptor-like protein 12-like         55.5    3e-07   
gb|KHN40544.1|  Putative LRR receptor-like serine/threonine-prote...  55.8    3e-07   
gb|KHN40541.1|  Putative LRR receptor-like serine/threonine-prote...  55.8    4e-07   
ref|XP_006602872.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_006602866.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_009588086.1|  PREDICTED: probable LRR receptor-like serine...  55.8    4e-07   
ref|XP_006352023.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    4e-07   
ref|XP_007162586.1|  hypothetical protein PHAVU_001G163700g           55.8    4e-07   
ref|XP_003553507.1|  PREDICTED: probable leucine-rich repeat rece...  55.5    5e-07   
gb|KHN02477.1|  Putative LRR receptor-like serine/threonine-prote...  55.5    6e-07   
ref|XP_009781301.1|  PREDICTED: probable LRR receptor-like serine...  55.5    6e-07   
ref|XP_008439080.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  54.7    8e-07   
ref|XP_008372189.1|  PREDICTED: probable LRR receptor-like serine...  54.7    8e-07   
ref|XP_008235768.1|  PREDICTED: probable LRR receptor-like serine...  54.7    9e-07   
gb|EYU17940.1|  hypothetical protein MIMGU_mgv1a021580mg              54.7    9e-07   
ref|XP_011000225.1|  PREDICTED: probable leucine-rich repeat rece...  54.7    9e-07   
ref|XP_010068647.1|  PREDICTED: probable leucine-rich repeat rece...  54.7    1e-06   
gb|KHN10771.1|  Putative LRR receptor-like serine/threonine-prote...  54.7    1e-06   
ref|XP_004167791.1|  PREDICTED: probable LRR receptor-like serine...  54.3    1e-06   
ref|XP_006576954.1|  PREDICTED: probable leucine-rich repeat rece...  54.7    1e-06   
gb|KDO60383.1|  hypothetical protein CISIN_1g036117mg                 54.3    1e-06   
ref|XP_004148166.1|  PREDICTED: probable LRR receptor-like serine...  54.3    1e-06   
ref|XP_002308696.2|  hypothetical protein POPTR_0006s27780g           54.3    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011000226.1|  PREDICTED: probable LRR receptor-like serine...  54.3    1e-06   
ref|XP_006374674.1|  hypothetical protein POPTR_0015s151102g          53.9    1e-06   
gb|KDP39096.1|  hypothetical protein JCGZ_00853                       54.3    1e-06   
gb|KCW89026.1|  hypothetical protein EUGRSUZ_A01353                   54.3    1e-06   
gb|KCW89018.1|  hypothetical protein EUGRSUZ_A01343                   54.3    1e-06   
ref|XP_006443766.1|  hypothetical protein CICLE_v10024479mg           54.3    1e-06   
ref|XP_006443768.1|  hypothetical protein CICLE_v10024331mg           54.3    1e-06   
ref|XP_007199430.1|  hypothetical protein PRUPE_ppa026559mg           54.3    2e-06   
ref|XP_009363708.1|  PREDICTED: probable LRR receptor-like serine...  53.9    2e-06   
ref|XP_006480080.1|  PREDICTED: probable LRR receptor-like serine...  53.9    2e-06   
gb|KCW89004.1|  hypothetical protein EUGRSUZ_A01326                   53.9    2e-06   
gb|KCW89005.1|  hypothetical protein EUGRSUZ_A01326                   53.5    2e-06   
ref|XP_010048149.1|  PREDICTED: probable LRR receptor-like serine...  53.5    2e-06   
gb|KCW89025.1|  hypothetical protein EUGRSUZ_A01352                   53.1    3e-06   
ref|XP_010522578.1|  PREDICTED: probable LRR receptor-like serine...  53.1    3e-06   
ref|XP_002322384.2|  hypothetical protein POPTR_0015s15050g           53.1    4e-06   Populus trichocarpa [western balsam poplar]
gb|KDP22433.1|  hypothetical protein JCGZ_26264                       52.8    4e-06   
gb|KHN02478.1|  Leucine-rich repeat receptor-like serine/threonin...  52.4    4e-06   
ref|XP_004247501.1|  PREDICTED: probable LRR receptor-like serine...  52.8    4e-06   
gb|KCW89015.1|  hypothetical protein EUGRSUZ_A01340                   52.8    4e-06   
gb|KDP39098.1|  hypothetical protein JCGZ_00855                       52.8    4e-06   
ref|XP_008437705.1|  PREDICTED: probable leucine-rich repeat rece...  51.6    5e-06   
ref|XP_002510965.1|  receptor protein kinase, putative                52.4    5e-06   Ricinus communis
ref|XP_009372221.1|  PREDICTED: probable leucine-rich repeat rece...  52.4    5e-06   
ref|XP_003520610.2|  PREDICTED: probable leucine-rich repeat rece...  52.4    6e-06   
ref|XP_007200853.1|  hypothetical protein PRUPE_ppa026760mg           52.4    6e-06   
emb|CDP11094.1|  unnamed protein product                              52.0    7e-06   
ref|XP_004492918.1|  PREDICTED: probable LRR receptor-like serine...  52.4    7e-06   
gb|KGN50357.1|  hypothetical protein Csa_5G168940                     50.1    7e-06   
ref|XP_002526561.1|  receptor protein kinase, putative                52.4    7e-06   Ricinus communis
ref|XP_003553506.1|  PREDICTED: probable leucine-rich repeat rece...  52.0    7e-06   
gb|KEH23423.1|  LRR receptor-like kinase family protein               52.0    7e-06   
ref|XP_010652404.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
ref|XP_008235774.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
ref|XP_008352753.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
gb|KCW84032.1|  hypothetical protein EUGRSUZ_B00906                   51.6    1e-05   
ref|XP_010045705.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
emb|CDM85534.1|  unnamed protein product                              51.6    1e-05   
gb|KCW68454.1|  hypothetical protein EUGRSUZ_F02113                   51.6    1e-05   
ref|XP_007200326.1|  hypothetical protein PRUPE_ppa000538mg           51.6    1e-05   
ref|XP_007201213.1|  hypothetical protein PRUPE_ppa001142mg           51.6    1e-05   
ref|XP_006387107.1|  hypothetical protein POPTR_1834s00200g           50.4    1e-05   
ref|XP_010064688.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
ref|XP_002322381.2|  hypothetical protein POPTR_0015s15210g           51.6    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008235778.1|  PREDICTED: probable LRR receptor-like serine...  51.2    1e-05   
emb|CBI37170.3|  unnamed protein product                              51.6    1e-05   
ref|XP_002318299.1|  putative leucine-rich repeat transmembrane p...  51.2    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011029917.1|  PREDICTED: probable LRR receptor-like serine...  51.2    1e-05   
ref|XP_009769693.1|  PREDICTED: probable leucine-rich repeat rece...  50.1    1e-05   
ref|XP_009372104.1|  PREDICTED: probable leucine-rich repeat rece...  51.2    1e-05   
emb|CBI37168.3|  unnamed protein product                              51.2    1e-05   
ref|XP_004295703.1|  PREDICTED: probable leucine-rich repeat rece...  50.4    1e-05   
ref|XP_002270822.2|  PREDICTED: probable LRR receptor-like serine...  51.2    1e-05   Vitis vinifera
emb|CBI37167.3|  unnamed protein product                              51.2    1e-05   
ref|XP_007201600.1|  hypothetical protein PRUPE_ppa019271mg           51.2    2e-05   
ref|XP_007162587.1|  hypothetical protein PHAVU_001G163800g           51.2    2e-05   
ref|XP_009344386.1|  PREDICTED: leucine-rich repeat receptor-like...  49.3    2e-05   
gb|EYU17941.1|  hypothetical protein MIMGU_mgv1a000490mg              51.2    2e-05   
ref|XP_010068555.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
ref|XP_002325932.2|  hypothetical protein POPTR_0019s08830g           50.8    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002270968.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-05   Vitis vinifera
ref|XP_010684679.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-05   
ref|XP_003632391.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
ref|XP_006442134.1|  hypothetical protein CICLE_v10023899mg           50.8    2e-05   
ref|XP_010038984.1|  PREDICTED: uncharacterized protein LOC104427617  50.8    2e-05   
ref|XP_011000224.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
ref|XP_002326079.2|  hypothetical protein POPTR_0019s14780g           50.8    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002270684.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   Vitis vinifera
ref|XP_010039095.1|  PREDICTED: probable LRR receptor-like serine...  50.4    2e-05   
gb|KDO37259.1|  hypothetical protein CISIN_1g0413001mg                48.9    2e-05   
ref|XP_010064693.1|  PREDICTED: probable LRR receptor-like serine...  50.4    2e-05   
ref|XP_006492795.1|  PREDICTED: probable LRR receptor-like serine...  50.4    2e-05   
ref|XP_010920309.1|  PREDICTED: probable LRR receptor-like serine...  50.4    2e-05   
gb|KCW68461.1|  hypothetical protein EUGRSUZ_F02121                   50.4    2e-05   
gb|KCW89012.1|  hypothetical protein EUGRSUZ_A01334                   50.4    2e-05   
ref|XP_007010868.1|  Leucine-rich repeat receptor-like protein ki...  50.4    2e-05   
ref|XP_011029916.1|  PREDICTED: probable LRR receptor-like serine...  50.4    3e-05   
ref|XP_007010909.1|  Leucine-rich repeat receptor-like protein ki...  50.4    3e-05   
ref|XP_004143724.1|  PREDICTED: probable leucine-rich repeat rece...  50.1    3e-05   
emb|CDP20826.1|  unnamed protein product                              50.4    3e-05   
ref|XP_002318300.2|  hypothetical protein POPTR_0012s14920g           50.4    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009336100.1|  PREDICTED: probable leucine-rich repeat rece...  50.4    3e-05   
ref|XP_003589771.1|  LRR-kinase protein                               50.1    3e-05   
ref|XP_004158143.1|  PREDICTED: probable leucine-rich repeat rece...  50.1    3e-05   
ref|XP_003589756.1|  LRR receptor-like protein kinase                 50.1    3e-05   
ref|XP_010658080.1|  PREDICTED: probable leucine-rich repeat rece...  50.4    3e-05   
ref|XP_003624299.1|  Receptor protein kinase-like protein             50.1    3e-05   
ref|XP_010920315.1|  PREDICTED: probable leucine-rich repeat rece...  50.1    3e-05   
gb|AES80517.2|  LRR receptor-like kinase family protein               50.1    3e-05   
gb|KCW89020.1|  hypothetical protein EUGRSUZ_A01345                   50.1    3e-05   
ref|XP_002304404.2|  putative leucine-rich repeat transmembrane p...  50.1    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009599912.1|  PREDICTED: probable LRR receptor-like serine...  50.1    4e-05   
ref|XP_003624304.1|  Receptor protein kinase-like protein             50.1    4e-05   
ref|XP_008235775.1|  PREDICTED: probable LRR receptor-like serine...  50.1    4e-05   
ref|XP_009783221.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    4e-05   
ref|XP_011002880.1|  PREDICTED: probable LRR receptor-like serine...  49.7    4e-05   
ref|XP_008339061.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    4e-05   
ref|XP_011010837.1|  PREDICTED: probable leucine-rich repeat rece...  49.7    4e-05   
ref|XP_008801285.1|  PREDICTED: probable LRR receptor-like serine...  49.7    4e-05   
ref|XP_011002881.1|  PREDICTED: probable LRR receptor-like serine...  49.7    4e-05   
ref|XP_007200865.1|  hypothetical protein PRUPE_ppa1027153mg          49.7    4e-05   
ref|XP_006374672.1|  hypothetical protein POPTR_0015s15080g           49.7    4e-05   
ref|XP_006421644.1|  hypothetical protein CICLE_v10007190mg           49.7    4e-05   
ref|XP_010911527.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    4e-05   
gb|KDO63963.1|  hypothetical protein CISIN_1g035742mg                 48.1    4e-05   
ref|XP_010107175.1|  putative LRR receptor-like serine/threonine-...  49.7    5e-05   
ref|XP_003624307.1|  Receptor protein kinase-like protein             49.7    5e-05   
gb|AES80525.2|  LRR receptor-like kinase family protein               49.7    5e-05   
ref|XP_009344379.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_003533567.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_008372583.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_010068454.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_010265040.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
gb|KCW89007.1|  hypothetical protein EUGRSUZ_A01328                   49.7    5e-05   
ref|XP_006371548.1|  hypothetical protein POPTR_0019s13060g           49.3    5e-05   
ref|XP_007010865.1|  Leucine-rich repeat receptor-like protein ki...  49.7    6e-05   
ref|XP_008346235.1|  PREDICTED: probable LRR receptor-like serine...  49.3    6e-05   
ref|XP_006442137.1|  hypothetical protein CICLE_v10018798mg           49.3    6e-05   
ref|XP_008235769.1|  PREDICTED: LRR receptor-like serine/threonin...  48.9    6e-05   
dbj|BAC87845.1|  leucine-rich repeat receptor-like protein kinase 1   49.3    6e-05   Populus nigra [black poplar]
ref|XP_011029919.1|  PREDICTED: probable LRR receptor-like serine...  49.3    6e-05   
ref|XP_002444138.1|  hypothetical protein SORBIDRAFT_07g009480        49.3    6e-05   Sorghum bicolor [broomcorn]
gb|KHN40539.1|  Putative LRR receptor-like serine/threonine-prote...  49.3    6e-05   
ref|XP_011029918.1|  PREDICTED: probable LRR receptor-like serine...  49.3    6e-05   
ref|XP_010684703.1|  PREDICTED: probable LRR receptor-like serine...  49.3    6e-05   
ref|XP_006601776.1|  PREDICTED: uncharacterized protein LOC100527...  49.3    7e-05   
ref|XP_010045481.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
gb|KCW83108.1|  hypothetical protein EUGRSUZ_B00062                   49.3    7e-05   
ref|XP_009372082.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    7e-05   
gb|KCW89011.1|  hypothetical protein EUGRSUZ_A01333                   49.3    7e-05   
gb|KDO36738.1|  hypothetical protein CISIN_1g043685mg                 48.9    7e-05   
ref|XP_004492920.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_010068462.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_010690721.1|  PREDICTED: probable LRR receptor-like serine...  48.9    8e-05   
ref|XP_008802426.1|  PREDICTED: probable leucine-rich repeat rece...  48.9    8e-05   
ref|XP_007038365.1|  Leucine-rich repeat receptor-like protein ki...  48.9    8e-05   
ref|XP_007010902.1|  Kinase family protein with leucine-rich repe...  48.5    8e-05   
gb|KDP26487.1|  hypothetical protein JCGZ_17645                       48.9    8e-05   
ref|XP_007035303.1|  Leucine-rich repeat receptor-like protein ki...  48.9    8e-05   
ref|XP_006490133.1|  PREDICTED: probable LRR receptor-like serine...  48.9    9e-05   
ref|XP_006377101.1|  hypothetical protein POPTR_0012s14900g           48.9    9e-05   
ref|XP_002321306.1|  hypothetical protein POPTR_0014s18490g           48.9    9e-05   Populus trichocarpa [western balsam poplar]
gb|KHM99087.1|  Putative LRR receptor-like serine/threonine-prote...  48.9    9e-05   
ref|NP_001235554.1|  receptor protein kinase-like protein             48.9    9e-05   
ref|XP_006602873.1|  PREDICTED: probable LRR receptor-like serine...  48.9    1e-04   
ref|XP_006602874.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
gb|KHN40546.1|  Putative LRR receptor-like serine/threonine-prote...  48.5    1e-04   
ref|XP_002274434.2|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   Vitis vinifera
ref|XP_007141641.1|  hypothetical protein PHAVU_008G213200g           48.5    1e-04   
ref|XP_010068587.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    1e-04   
ref|XP_006428847.1|  hypothetical protein CICLE_v10013366mg           47.4    1e-04   
ref|XP_010267605.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_008775331.1|  PREDICTED: LRR receptor-like serine/threonin...  47.4    1e-04   
ref|XP_006387609.1|  hypothetical protein POPTR_0780s002001g          45.8    1e-04   
ref|XP_010045748.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_004492917.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_006371672.1|  hypothetical protein POPTR_0019s15000g           48.1    1e-04   
gb|KDO43356.1|  hypothetical protein CISIN_1g038615mg                 47.4    1e-04   
ref|XP_010262429.1|  PREDICTED: probable leucine-rich repeat rece...  48.1    1e-04   
ref|XP_006421643.1|  hypothetical protein CICLE_v10004274mg           48.1    2e-04   
ref|XP_008235772.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_010091788.1|  putative LRR receptor-like serine/threonine-...  48.1    2e-04   
ref|XP_003589757.1|  Leucine-rich repeat receptor-like protein ki...  48.1    2e-04   
ref|XP_008229456.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
emb|CDP11083.1|  unnamed protein product                              47.4    2e-04   
ref|XP_006374683.1|  hypothetical protein POPTR_0015s151802g          47.8    2e-04   
ref|XP_008235779.1|  PREDICTED: LRR receptor-like serine/threonin...  47.8    2e-04   
ref|XP_008801283.1|  PREDICTED: probable LRR receptor-like serine...  47.4    2e-04   
ref|XP_009591012.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_010270812.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
emb|CDP11415.1|  unnamed protein product                              47.8    2e-04   
ref|XP_010032795.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
gb|KEH22311.1|  LRR receptor-like kinase family protein               47.8    2e-04   
ref|XP_008235777.1|  PREDICTED: probable leucine-rich repeat rece...  47.8    2e-04   
ref|XP_007140376.1|  hypothetical protein PHAVU_008G106500g           47.8    2e-04   
ref|XP_008229458.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  47.8    2e-04   
ref|XP_007050194.1|  Leucine-rich repeat receptor-like protein ki...  47.8    2e-04   
gb|KHN11557.1|  Putative LRR receptor-like serine/threonine-prote...  47.8    2e-04   
ref|XP_003622584.1|  Receptor protein kinase-like protein             47.8    2e-04   
ref|XP_011044955.1|  PREDICTED: probable leucine-rich repeat rece...  47.8    2e-04   
gb|AES78785.2|  LRR receptor-like kinase family protein               47.8    2e-04   
gb|KHN44768.1|  Putative LRR receptor-like serine/threonine-prote...  47.8    2e-04   
ref|XP_010032794.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_008235612.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_003545194.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_010068548.1|  PREDICTED: probable LRR receptor-like serine...  47.4    2e-04   
ref|XP_003622567.1|  Receptor-like protein kinase                     47.8    2e-04   
ref|XP_010039044.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  47.4    3e-04   
ref|XP_010051016.1|  PREDICTED: probable leucine-rich repeat rece...  47.4    3e-04   
gb|KDO41560.1|  hypothetical protein CISIN_1g041065mg                 44.7    3e-04   
ref|XP_006374673.1|  hypothetical protein POPTR_0015s15100g           47.4    3e-04   
ref|XP_011044952.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    3e-04   
ref|XP_008801289.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  47.4    3e-04   
ref|XP_011005716.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    3e-04   
gb|KDO55288.1|  hypothetical protein CISIN_1g041920mg                 45.4    3e-04   
gb|KCW64085.1|  hypothetical protein EUGRSUZ_G017472                  47.0    3e-04   
ref|XP_003624327.1|  Receptor protein kinase-like protein             47.4    3e-04   
ref|XP_004492922.1|  PREDICTED: probable LRR receptor-like serine...  47.0    3e-04   
gb|KDP33358.1|  hypothetical protein JCGZ_12907                       47.0    3e-04   
gb|KDO39482.1|  hypothetical protein CISIN_1g041034mg                 47.0    4e-04   
ref|XP_010105916.1|  putative leucine-rich repeat receptor-like p...  45.1    4e-04   
gb|KDO55848.1|  hypothetical protein CISIN_1g0414382mg                45.8    4e-04   
ref|XP_008801288.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    4e-04   
ref|XP_007133482.1|  hypothetical protein PHAVU_011G182300g           47.0    4e-04   
ref|XP_009390803.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    4e-04   
gb|KDP34786.1|  hypothetical protein JCGZ_10566                       47.0    4e-04   
ref|XP_010050532.1|  PREDICTED: LRR receptor-like serine/threonin...  44.7    4e-04   
ref|XP_006662429.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    4e-04   
gb|KCW48400.1|  hypothetical protein EUGRSUZ_K02104                   46.2    4e-04   
ref|XP_007201579.1|  hypothetical protein PRUPE_ppa019080mg           47.0    4e-04   
gb|KCW68823.1|  hypothetical protein EUGRSUZ_F02424                   46.2    5e-04   
ref|XP_003589785.1|  Receptor-like protein kinase                     47.0    5e-04   
ref|XP_002325645.2|  leucine-rich repeat transmembrane protein ki...  46.6    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006442763.1|  hypothetical protein CICLE_v10018678mg           46.6    5e-04   
gb|KCW89017.1|  hypothetical protein EUGRSUZ_A01342                   46.6    5e-04   
gb|KDP32517.1|  hypothetical protein JCGZ_14720                       46.6    5e-04   
ref|XP_010040479.1|  PREDICTED: probable LRR receptor-like serine...  46.6    5e-04   
gb|EEC67142.1|  hypothetical protein OsI_33975                        46.6    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008235780.1|  PREDICTED: probable leucine-rich repeat rece...  46.6    5e-04   
ref|XP_006477963.1|  PREDICTED: probable LRR receptor-like serine...  46.6    5e-04   
ref|XP_011094724.1|  PREDICTED: probable LRR receptor-like serine...  46.6    5e-04   
gb|KCW48734.1|  hypothetical protein EUGRSUZ_K02366                   46.6    6e-04   
ref|NP_001064815.1|  Os10g0468800                                     46.2    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004492928.1|  PREDICTED: probable LRR receptor-like serine...  46.6    6e-04   
ref|XP_006445530.1|  hypothetical protein CICLE_v10004109mg           45.8    6e-04   
ref|XP_009372116.1|  PREDICTED: probable LRR receptor-like serine...  46.6    6e-04   
gb|KDO64895.1|  hypothetical protein CISIN_1g040280mg                 45.4    6e-04   
gb|KCW45180.1|  hypothetical protein EUGRSUZ_L01191                   46.2    6e-04   
ref|XP_010064759.1|  PREDICTED: probable LRR receptor-like serine...  46.2    6e-04   
emb|CDX68730.1|  BnaC01g07230D                                        46.6    7e-04   
gb|KHN44766.1|  Putative LRR receptor-like serine/threonine-prote...  46.2    7e-04   
ref|XP_006428855.1|  hypothetical protein CICLE_v10012486mg           45.4    7e-04   
ref|XP_011002327.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
ref|XP_010271357.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
gb|KDP32512.1|  hypothetical protein JCGZ_14715                       44.7    7e-04   
emb|CDM85558.1|  unnamed protein product                              46.2    7e-04   
ref|XP_008219676.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
gb|KCW68825.1|  hypothetical protein EUGRSUZ_F02426                   46.2    7e-04   
emb|CDP03782.1|  unnamed protein product                              46.2    7e-04   
emb|CDP21394.1|  unnamed protein product                              45.4    7e-04   
ref|XP_004506329.1|  PREDICTED: probable LRR receptor-like serine...  46.2    7e-04   
ref|XP_002303118.2|  hypothetical protein POPTR_0002s25980g           46.2    8e-04   
ref|XP_007010630.1|  Leucine-rich repeat receptor-like protein ki...  45.8    8e-04   
emb|CDP21854.1|  unnamed protein product                              45.8    8e-04   
ref|XP_007131369.1|  hypothetical protein PHAVU_011G007900g           46.2    8e-04   
ref|XP_008801286.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    8e-04   
emb|CDP10147.1|  unnamed protein product                              45.8    8e-04   
emb|CBI36567.3|  unnamed protein product                              45.8    8e-04   
ref|XP_008219738.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
ref|XP_007216492.1|  hypothetical protein PRUPE_ppa025153mg           46.2    8e-04   
ref|XP_010050531.1|  PREDICTED: probable LRR receptor-like serine...  45.4    8e-04   
ref|XP_004238491.2|  PREDICTED: probable LRR receptor-like serine...  45.8    8e-04   
ref|XP_010696483.1|  PREDICTED: probable leucine-rich repeat rece...  46.2    8e-04   
ref|XP_003624321.1|  Receptor protein kinase-like protein             45.8    9e-04   
ref|XP_010050652.1|  PREDICTED: probable LRR receptor-like serine...  45.8    9e-04   
ref|XP_006371671.1|  hypothetical protein POPTR_0019s14990g           45.8    9e-04   
gb|KCW80187.1|  hypothetical protein EUGRSUZ_C01534                   45.8    9e-04   
ref|XP_006388720.1|  hypothetical protein POPTR_0113s00240g           45.8    0.001   
ref|XP_010656659.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    0.001   
ref|XP_009369424.1|  PREDICTED: probable LRR receptor-like serine...  45.8    0.001   
ref|XP_006306399.1|  hypothetical protein CARUB_v10012308mg           45.8    0.001   
ref|XP_010933242.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    0.001   
gb|KDP32504.1|  hypothetical protein JCGZ_14707                       45.8    0.001   
ref|XP_009336151.1|  PREDICTED: probable LRR receptor-like serine...  45.8    0.001   
gb|EEC67140.1|  hypothetical protein OsI_33971                        45.8    0.001   
gb|KDO40388.1|  hypothetical protein CISIN_1g042123mg                 45.8    0.001   



>gb|KCW89016.1| hypothetical protein EUGRSUZ_A01341 [Eucalyptus grandis]
Length=996

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I L   SL GTL +LDF SFPNLTRF + NN+  G +P +I NLSQL F
Sbjct  73   NGGGLVTGIGLSGSSLKGTLDALDFTSFPNLTRFDVSNNNLKGPIPSSIGNLSQLRF  129



>ref|XP_010068602.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
 gb|KCW89021.1| hypothetical protein EUGRSUZ_A01347 [Eucalyptus grandis]
Length=996

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I L   SL+GTL +LDF SFPNLTRF + NN+  G +P +I NLSQL F
Sbjct  73   NGGGLVTGIGLSGSSLNGTLDALDFTSFPNLTRFDVSNNNLEGPIPSSIGNLSQLRF  129



>ref|XP_010068537.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=893

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I L   SL GTL +LDF SFPNLTRF + NN+  G +P +I NLSQL F
Sbjct  73   NGGGLVTGIGLSGSSLKGTLDALDFTSFPNLTRFDVSNNNLKGPIPSSIGNLSQLRF  129



>gb|KCW89022.1| hypothetical protein EUGRSUZ_A01348, partial [Eucalyptus grandis]
Length=1032

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I L   SL+GTL +LDF SFPNLTRF + NN+  G +P  I NLSQL F
Sbjct  40   NGGGLVTDINLSGSSLNGTLDALDFASFPNLTRFDVSNNNLEGPIPSLIGNLSQLGF  96



>ref|XP_010068611.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1083

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I L   SL+GTL +LDF SFPNLTRF + NN+  G +P  I NLSQL F
Sbjct  73   NGGGLVTDINLSGSSLNGTLDALDFASFPNLTRFDVSNNNLEGPIPSLIGNLSQLGF  129



>ref|XP_002522985.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF39415.1| receptor protein kinase, putative [Ricinus communis]
Length=1003

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            N  G+V  I L +  L+GTL+SL F SFPNL R +  NNSF GS+P  +ANLS+L
Sbjct  71   NEAGSVTNISLRDSGLTGTLQSLSFSSFPNLIRLNFSNNSFYGSIPPTVANLSKL  125



>gb|KCW89027.1| hypothetical protein EUGRSUZ_A01354, partial [Eucalyptus grandis]
Length=912

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G V  I L   SL+GTL +LDF  FPNLTRF + NN+  G +P +I NLSQL F
Sbjct  51   GLVTDISLSGSSLNGTLDALDFTLFPNLTRFDISNNNLGGPIPSSIGNLSQLRF  104



>gb|KCW89014.1| hypothetical protein EUGRSUZ_A01339 [Eucalyptus grandis]
Length=1193

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +V +I L   +L GTL +LDF SFPNLTRF + NN+  G +P +I+NLS+L F
Sbjct  73   SVSEISLSGSNLCGTLHALDFASFPNLTRFDVSNNNLEGPIPSSISNLSKLTF  125



>ref|XP_010068524.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1225

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +V +I L   +L GTL +LDF SFPNLTRF + NN+  G +P +I+NLS+L F
Sbjct  73   SVSEISLSGSNLCGTLHALDFASFPNLTRFDVSNNNLEGPIPSSISNLSKLTF  125



>ref|XP_010313677.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase At1g17230 [Solanum lycopersicum]
Length=871

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G + +I L +  LSGTL  LDF SFP+LT FSL+ N+F+GS+P  I N S L F
Sbjct  71   GTISEINLSDAGLSGTLHQLDFTSFPSLTSFSLNGNNFSGSIPSNIGNASMLTF  124



>ref|XP_010068485.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=594

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G++ +I L   SL+GTL +L+F  FPNLT F+++NN+  GS+P +I NLSQL F
Sbjct  73   NSDGSISEISLSGSSLNGTLDALNFALFPNLTCFNVNNNNLEGSIPSSIGNLSQLRF  129



>ref|XP_009344388.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=1074

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V KI L N  + GTL   DF SFPNLT F+L+ N F G +PYA+ NLS+L
Sbjct  71   TVSKIDLSNMQILGTLSLFDFSSFPNLTHFNLNGNYFEGPIPYAVGNLSRL  121



>gb|KCW89013.1| hypothetical protein EUGRSUZ_A01336, partial [Eucalyptus grandis]
Length=865

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G++ +I L   SL+GTL +L+F  FPNLT F+++NN+  GS+P +I NLSQL F
Sbjct  48   NSDGSISEISLSGSSLNGTLDALNFALFPNLTCFNVNNNNLEGSIPSSIGNLSQLRF  104



>ref|XP_010068445.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1228

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G+V +I L   SLSGTL +LDF SFPNLTRF++ +N     +P +I NL +L F
Sbjct  71   NSGGSVSEISLPGSSLSGTLDALDFASFPNLTRFNVSSNHLVAPIPPSIGNLPKLRF  127



>ref|XP_004292236.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Fragaria vesca subsp. vesca]
Length=1219

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
             V +I L NF+L+ TL  LDF  F NLTRF+L+ N+FTG +P AI NL++L 
Sbjct  76   TVSQIDLSNFNLTATLTGLDFTQFLNLTRFNLNGNNFTGPIPSAIGNLTKLT  127



>ref|XP_010262428.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nelumbo nucifera]
Length=1219

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G+V +I L + SL+GTL  L F S  NLTRF L+ NS  G++P  IANLS+L +
Sbjct  69   NKAGSVTEINLPSSSLNGTLDQLSFASLSNLTRFDLNGNSIDGTIPSGIANLSKLTY  125



>gb|KCW89019.1| hypothetical protein EUGRSUZ_A01344, partial [Eucalyptus grandis]
Length=963

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G++ +I L   SL+GTL +LDF  FPNLT F++ +N+  G +P +I NLSQL F
Sbjct  48   NSDGSILEISLSGSSLNGTLDALDFALFPNLTCFNVSDNNLEGPIPSSIGNLSQLRF  104



>ref|XP_006358417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Solanum tuberosum]
Length=1219

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G + +I L + +LSGTL  LDF SFP+L  F+L+ N+F+GS+P +I N S L F
Sbjct  68   NDGGTISEINLSDAALSGTLDHLDFTSFPSLVNFNLNGNNFSGSIPSSIGNASLLTF  124



>ref|XP_010068565.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1365

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G++ +I L   SL+GTL +LDF  FPNLT F++ +N+  G +P +I NLSQL F
Sbjct  425  NSDGSILEISLSGSSLNGTLDALDFALFPNLTCFNVSDNNLEGPIPSSIGNLSQLRF  481



>ref|XP_008337999.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=1179

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            + KI L N  + G+L   DF  FPNLT F+L+ NSF G +PYAI NLS+L+
Sbjct  76   ISKIDLSNMHIIGSLSLFDFPLFPNLTHFNLNGNSFGGRIPYAIGNLSRLI  126



>ref|XP_006360466.1| PREDICTED: receptor-like protein 12-like [Solanum tuberosum]
Length=522

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G + +I L N +LSG+L  LDF SFPNLT F L+ N+F+GS+P  I N S L
Sbjct  71   GTISEINLSNATLSGSLDHLDFTSFPNLTSFILNGNNFSGSIPSNIGNASSL  122



>gb|KHN40544.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1072

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  +V  I L N+ LSGTL +L+F SFPNL   +++NNSF G++P  I N+S+L
Sbjct  69   DNSNSVSTINLPNYGLSGTLHTLNFSSFPNLLSLNIYNNSFYGTIPPQIGNMSKL  123



>gb|KHN40541.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1042

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  +V  I L N+ LSGTL +L+F SFPNL   +++NNSF G++P  I N+S+L
Sbjct  69   DNSNSVSTINLPNYGLSGTLHTLNFSSFPNLLSLNIYNNSFYGTIPPQIGNMSKL  123



>ref|XP_006602872.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Glycine max]
Length=1070

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  +V  I L N+ LSGTL +L+F SFPNL   +++NNSF G++P  I N+S+L
Sbjct  69   DNSNSVSTINLPNYGLSGTLHTLNFSSFPNLLSLNIYNNSFYGTIPPQIGNMSKL  123



>ref|XP_006602866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Glycine max]
Length=1072

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  +V  I L N+ LSGTL +L+F SFPNL   +++NNSF G++P  I N+S+L
Sbjct  69   DNSNSVSTINLPNYGLSGTLHTLNFSSFPNLLSLNIYNNSFYGTIPPQIGNMSKL  123



>ref|XP_009588086.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nicotiana tomentosiformis]
Length=1220

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G + +I L + SLSG+L  LDF SFP++T F+L+ N+F+GS+P  I N S L F
Sbjct  68   NTGGTLSEINLSDGSLSGSLDELDFTSFPSITSFNLNGNNFSGSIPSNIGNASMLTF  124



>ref|XP_006352023.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=924

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G +  I L +  LSGTL  LDF SFP+LT FSL+ N+ +GS+P  I N S L F
Sbjct  71   GTISDINLSDAGLSGTLDQLDFTSFPSLTSFSLNGNNLSGSIPSNIGNASMLTF  124



>ref|XP_007162586.1| hypothetical protein PHAVU_001G163700g [Phaseolus vulgaris]
 gb|ESW34580.1| hypothetical protein PHAVU_001G163700g [Phaseolus vulgaris]
Length=1239

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I L   +L+GT+  LDF S PNLT+ +LH+N F GS+P AI NLS+L  
Sbjct  80   TVSEINLSGANLNGTITVLDFASLPNLTQINLHSNRFGGSIPSAIGNLSKLTL  132



>ref|XP_003553507.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Glycine max]
Length=1230

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V +I L + +++GTL  LDF S PNLT+ +L++N+F GS+P AI NLS+L
Sbjct  76   TVLEINLSDANITGTLTPLDFASLPNLTKLNLNHNNFEGSIPSAIGNLSKL  126



>gb|KHN02477.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1189

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V +I L + +++GTL  LDF S PNLT+ +L++N+F GS+P AI NLS+L
Sbjct  76   TVLEINLSDANITGTLTPLDFASLPNLTKLNLNHNNFEGSIPSAIGNLSKL  126



>ref|XP_009781301.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nicotiana sylvestris]
Length=1220

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G + +I L + +LSG+L  LDF SF NLTRF+L+ N+F GS+P  I N S L F
Sbjct  68   NTGGTLSEINLSDATLSGSLDQLDFTSFLNLTRFNLNGNNFRGSIPSNIGNASMLTF  124



>ref|XP_008439080.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Cucumis melo]
Length=957

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN  +V +IKLDN  L GTL  L+F SFPNL R  L  N+ +G +P +I  LS+L F
Sbjct  82   NNQSSVIEIKLDNTGLIGTLDHLNFSSFPNLLRLDLKINNLSGVIPPSIGVLSKLQF  138



>ref|XP_008372189.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=1027

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V KI L N  + GTL   DF  FPNLT F+L+ N+F G +P+AI NLS+L
Sbjct  71   TVSKIDLSNMQILGTLSLFDFPLFPNLTHFNLNGNNFVGRIPHAIGNLSRL  121



>ref|XP_008235768.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=1254

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V KI L N +++GTL   DF  FP+LT F+L +N+F+G +P AI NL+ L F
Sbjct  104  TVSKIDLSNMNITGTLTRFDFIRFPDLTHFNLFSNNFSGQIPSAIGNLTSLTF  156



>gb|EYU17940.1| hypothetical protein MIMGU_mgv1a021580mg, partial [Erythranthe 
guttata]
Length=928

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G+V +I L N +L+G +  LDF S  NLT  +L+ NSF G++P +I NL++LVF
Sbjct  77   NSGGSVSQINLPNSNLTGAISHLDFSSLANLTTLNLNGNSFNGTIPTSIGNLTKLVF  133



>ref|XP_011000225.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Populus euphratica]
Length=760

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L N SL GTL SL F SFPNL    LHNNS  GS+P  I NL +L
Sbjct  81   GSVANISLPNSSLRGTLNSLRFPSFPNLINLILHNNSLYGSIPSHIGNLIRL  132



>ref|XP_010068647.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=1156

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN  +V +I L    L+GTL +LDF S PNLT F++ +N+  G +P +I NLSQL F
Sbjct  71   NNGESVSEISLPGSRLNGTLDALDFASLPNLTCFNVSDNNLEGPIPSSIGNLSQLRF  127



>gb|KHN10771.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1237

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I L + +L+GTL +LDF S PNLT+ +L  N F GS+P AI NLS+L  
Sbjct  77   TVLEINLSDANLTGTLTALDFASLPNLTQLNLTANHFGGSIPSAIGNLSKLTL  129



>ref|XP_004167791.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like, partial [Cucumis sativus]
Length=756

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN  +V +IKLDN  L GTL  L+F S PNL R  L  N+ TG +P +I  LS+L F
Sbjct  81   NNQSSVIQIKLDNTGLIGTLDHLNFSSLPNLLRLDLKINNLTGVIPPSIGVLSKLQF  137



>ref|XP_006576954.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Glycine max]
Length=1230

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I L + +L+GTL +LDF S PNLT+ +L  N F GS+P AI NLS+L  
Sbjct  77   TVLEINLSDANLTGTLTALDFASLPNLTQLNLTANHFGGSIPSAIGNLSKLTL  129



>gb|KDO60383.1| hypothetical protein CISIN_1g036117mg, partial [Citrus sinensis]
Length=641

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N VG++ +I L N  L GTL   DF +FPNLT  +L+ N+  GS+P  I N ++L+ 
Sbjct  60   NEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLIL  116



>ref|XP_004148166.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Cucumis sativus]
 gb|KGN57256.1| hypothetical protein Csa_3G175080 [Cucumis sativus]
Length=956

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN  +V +IKLDN  L GTL  L+F S PNL R  L  N+ TG +P +I  LS+L F
Sbjct  81   NNQSSVIQIKLDNTGLIGTLDHLNFSSLPNLLRLDLKINNLTGVIPPSIGVLSKLQF  137



>ref|XP_002308696.2| hypothetical protein POPTR_0006s27780g [Populus trichocarpa]
 gb|EEE92219.2| hypothetical protein POPTR_0006s27780g [Populus trichocarpa]
Length=963

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G V  I L ++ L GTL SL F SFPNL +  L NNS  GSVP  I NLS L+ 
Sbjct  81   GIVTNISLSHYRLRGTLNSLRFSSFPNLIKLILRNNSLYGSVPSHIGNLSNLII  134



>ref|XP_011000226.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Populus euphratica]
Length=1054

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L N SL GTL SL F SFPNL    LHNNS  GS+P  I NL +L
Sbjct  81   GSVTNISLPNSSLRGTLNSLRFPSFPNLINLILHNNSLYGSIPSHIGNLIRL  132



>ref|XP_006374674.1| hypothetical protein POPTR_0015s151102g, partial [Populus trichocarpa]
 gb|ERP52471.1| hypothetical protein POPTR_0015s151102g, partial [Populus trichocarpa]
Length=447

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L N SL GTL SL F SFPNL    LHNNS  GS+P  I NL +L
Sbjct  81   GSVTNISLPNSSLRGTLNSLRFPSFPNLIYLILHNNSLYGSIPPHIGNLIRL  132



>gb|KDP39096.1| hypothetical protein JCGZ_00853 [Jatropha curcas]
Length=981

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +  G+V  I L +  L GTL+SL F SFPNL   ++ NNSF G+VP  I NLS+L
Sbjct  69   DEAGSVTNISLRDTGLKGTLQSLSFSSFPNLLHLNVSNNSFHGNVPSQIGNLSRL  123



>gb|KCW89026.1| hypothetical protein EUGRSUZ_A01353, partial [Eucalyptus grandis]
Length=902

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L +  L GTL +LDF  FPNLT F++ +N+  G +P +I NL QL F
Sbjct  48   NNGGSVSEISLPSSRLGGTLDALDFALFPNLTCFNVSDNNLEGPIPSSIGNLFQLRF  104



>gb|KCW89018.1| hypothetical protein EUGRSUZ_A01343, partial [Eucalyptus grandis]
Length=925

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G++ +I L + SL+GTL +LD  SFPNLT F++  N+ +  +P +I NLSQL F
Sbjct  28   NDGGSISEINLYSLSLNGTLNALDVASFPNLTCFNVSENNLSSPIPSSIGNLSQLRF  84



>ref|XP_006443766.1| hypothetical protein CICLE_v10024479mg, partial [Citrus clementina]
 gb|ESR57006.1| hypothetical protein CICLE_v10024479mg, partial [Citrus clementina]
Length=1270

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N VG++ +I L N  L GTL   DF +FPNLT  +L+ N+  GS+P  I N ++L+ 
Sbjct  60   NEVGSISEINLANSGLDGTLDGFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLIL  116



>ref|XP_006443768.1| hypothetical protein CICLE_v10024331mg [Citrus clementina]
 gb|ESR57008.1| hypothetical protein CICLE_v10024331mg [Citrus clementina]
Length=1167

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N VG++ +I L N  L GTL   DF +FPNLT  +L+ N+  GS+P  I N ++L+ 
Sbjct  63   NEVGSISEINLANSGLDGTLDRFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLIL  119



>ref|XP_007199430.1| hypothetical protein PRUPE_ppa026559mg [Prunus persica]
 gb|EMJ00629.1| hypothetical protein PRUPE_ppa026559mg [Prunus persica]
Length=1254

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V KI L N +++G L   DF  FPNLT F+L +N+F+G +P AI NL+ L F
Sbjct  104  TVSKIDLSNMNITGKLTRFDFIRFPNLTHFNLFSNNFSGQIPSAIGNLTSLTF  156



>ref|XP_009363708.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Pyrus x bretschneideri]
Length=884

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V KI L N  + GTL   DF SFPNLT F+L  N F G +PYAI +L +L
Sbjct  73   TVSKIDLSNMQIFGTLSLFDFSSFPNLTHFNLSGNYFDGPIPYAIGSLCRL  123



>ref|XP_006480080.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Citrus sinensis]
Length=1126

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N VG++ +I L N  L GTL   DF +FPNLT  +L+ N+  GS+P  I N ++L+ 
Sbjct  73   NEVGSISEINLANSGLDGTLDRFDFSAFPNLTALNLNMNNLVGSIPAGIGNATKLIL  129



>gb|KCW89004.1| hypothetical protein EUGRSUZ_A01326 [Eucalyptus grandis]
Length=1149

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +LDF SFPNLTRF++ +N+  G +P +I+NLS+L F
Sbjct  75   NNGGSVSEISLSGSSLSGTLDALDFASFPNLTRFNVSSNNLVGPIPSSISNLSKLGF  131



>gb|KCW89005.1| hypothetical protein EUGRSUZ_A01326 [Eucalyptus grandis]
Length=1027

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +LDF SFPNLTRF++ +N+  G +P +I+NLS+L F
Sbjct  75   NNGGSVSEISLSGSSLSGTLDALDFASFPNLTRFNVSSNNLVGPIPSSISNLSKLGF  131



>ref|XP_010048149.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1227

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +LDF SFPNLTRF++ +N+  G +P +I+NLS+L F
Sbjct  75   NNGGSVSEISLSGSSLSGTLDALDFASFPNLTRFNVSSNNLVGPIPSSISNLSKLGF  131



>gb|KCW89025.1| hypothetical protein EUGRSUZ_A01352, partial [Eucalyptus grandis]
Length=842

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +V +I L + SL+GTL  LD  SFPNLT F++ +N+ +G +P +I NLSQL F
Sbjct  1    SVSEIILSSLSLNGTLNVLDVASFPNLTCFNVTDNNLSGPIPSSIGNLSQLRF  53



>ref|XP_010522578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Tarenaya hassleriana]
Length=1217

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G+V +I L    ++GTL  LDF +FPNLT F L+NN   G VP +IANL++L +
Sbjct  71   GSVSEINLLVSDINGTLSRLDFSAFPNLTTFDLNNNLIGGQVPASIANLTKLTY  124



>ref|XP_002322384.2| hypothetical protein POPTR_0015s15050g [Populus trichocarpa]
 gb|EEF06511.2| hypothetical protein POPTR_0015s15050g [Populus trichocarpa]
Length=982

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L N SL GTL SL F SFPNLT   L NNS  GS+P  I NL +L
Sbjct  81   GSVTNISLPNSSLRGTLNSLRFPSFPNLTVLILRNNSLYGSIPSRIGNLIKL  132



>gb|KDP22433.1| hypothetical protein JCGZ_26264 [Jatropha curcas]
Length=1007

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G+V +I L    L+GTL+ LDF SFPNL R  L  N  TG +P  I  LS+L F
Sbjct  72   NKAGSVTEINLAYTGLTGTLQDLDFSSFPNLLRLDLKVNQLTGIIPLNIGILSKLQF  128



>gb|KHN02478.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Glycine soja]
Length=408

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            V +I L + +L+GTL +LDF S PNLT+ +L+ N F GS+P AI  LS+L  
Sbjct  77   VSQINLSDANLTGTLTALDFSSLPNLTQLNLNANHFGGSIPSAIDKLSKLTL  128



>ref|XP_004247501.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Solanum lycopersicum]
Length=1219

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G +  I L + +LSG+L  LDF SFP+L  F+L+ N+F+GS+P +I N S L F
Sbjct  71   GTISVINLSDAALSGSLDHLDFTSFPSLVNFNLNQNNFSGSIPSSIGNASLLTF  124



>gb|KCW89015.1| hypothetical protein EUGRSUZ_A01340 [Eucalyptus grandis]
Length=988

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            NN G+V +I L    L GTL +LDF  FPNLT F++ +N+  G +P +I NL QL
Sbjct  81   NNGGSVSEISLPGSRLGGTLDALDFALFPNLTCFNVSDNNLEGPIPSSIGNLFQL  135



>gb|KDP39098.1| hypothetical protein JCGZ_00855 [Jatropha curcas]
Length=979

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +  G+V  I L +  L GTL+SL F SFPNL   ++ NNSF G++P  I NLS++
Sbjct  73   DEAGSVTNISLRDTGLKGTLQSLSFSSFPNLLHLNVSNNSFHGNIPSQIGNLSRV  127



>ref|XP_008437705.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Cucumis melo]
Length=343

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            V +I L N  L+GT++SLDF SFPNL R  L  N+  GS+P +I  LS+L F
Sbjct  90   VIEINLANTGLNGTIESLDFSSFPNLLRLDLKLNNLNGSIPPSIGLLSKLQF  141



>ref|XP_002510965.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF51567.1| receptor protein kinase, putative [Ricinus communis]
Length=949

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            ++ G+V +I L    L+GTL +LDF SFPNL R  L  N  TG++P  I  LS+L F
Sbjct  76   DDAGSVTEINLAYTGLTGTLDNLDFSSFPNLLRLDLKVNQLTGTIPSNIGILSKLQF  132



>ref|XP_009372221.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Pyrus x bretschneideri]
Length=1207

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V KI L N  + GTL   DF  FPNLT F+L  N F G +P AI NLS+L 
Sbjct  70   VSKIDLSNMQMYGTLAHFDFSLFPNLTHFNLSGNYFRGPIPSAIGNLSRLT  120



>ref|XP_003520610.2| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Glycine max]
Length=1235

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I L + +L+GTL + DF S PNLT+ +L+ N+F GS+P AI  LS+L  
Sbjct  84   TVSQINLSDANLTGTLTTFDFASLPNLTQLNLNGNNFEGSIPSAIGKLSKLTL  136



>ref|XP_007200853.1| hypothetical protein PRUPE_ppa026760mg [Prunus persica]
 gb|EMJ02052.1| hypothetical protein PRUPE_ppa026760mg [Prunus persica]
Length=1141

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L NF++S TL   +F  F NLT+F+L+ N+FTG VP AI NLS+L 
Sbjct  83   VSQIDLSNFNISATLTHFNFTPFLNLTQFNLYGNNFTGPVPSAIGNLSKLT  133



>emb|CDP11094.1| unnamed protein product [Coffea canephora]
Length=744

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I + +  + GTL  L+F S P+LTRF L++N+F G++P  I NLS+L+ 
Sbjct  48   NKAGRVSVINITSSGIKGTLDHLNFSSLPHLTRFDLYDNAFYGTIPSNIGNLSRLLL  104



>ref|XP_004492918.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X2 [Cicer arietinum]
Length=1021

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -1

Query  148  IKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            I L+N+ + GTL SL F SFPNL   +++ N F G++P  I NLS L+F
Sbjct  81   INLENYGIKGTLHSLSFSSFPNLITINIYQNHFYGTIPPQIGNLSNLMF  129



>gb|KGN50357.1| hypothetical protein Csa_5G168940 [Cucumis sativus]
Length=206

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N    V +I L +  L+GT++SLDF SFPNL R  L  N+  GS+P +I  LS+L F
Sbjct  81   NESTHVIEINLAHTGLNGTIESLDFSSFPNLLRLDLKLNNLNGSIPPSIGLLSKLQF  137



>ref|XP_002526561.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF35839.1| receptor protein kinase, putative [Ricinus communis]
Length=1224

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +  G V +I L N +++GTL    F SF N+T F L NN+  G +P AI NLS+L +
Sbjct  69   DTTGTVSEIHLSNLNITGTLAQFSFSSFSNITSFDLQNNNIGGVIPSAIINLSKLTY  125



>ref|XP_003553506.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Glycine max]
Length=1234

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I L + +L+GTL +LDF S PNLT+ +L+ N F GS+P AI  LS+L  
Sbjct  76   TVSQINLSDANLTGTLTALDFSSLPNLTQLNLNANHFGGSIPSAIDKLSKLTL  128



>gb|KEH23423.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=946

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +  I L N  L GTL SL F SFPNL    + NNSF G++P  I NLS+L
Sbjct  69   ISTIGLANLGLKGTLHSLTFSSFPNLLMIDIRNNSFYGTIPAQIGNLSKL  118



>ref|XP_010652404.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Vitis vinifera]
Length=1164

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             G V +I L   +L GTL   DF SF NLTRF+L  N+  G +P  +ANLS+L F
Sbjct  75   TGTVSEINLSQANLKGTLAQFDFGSFTNLTRFNLSINNLNGLIPSTVANLSKLTF  129



>ref|XP_008235774.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=1136

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L NF +S TL   +F  F NLT+F+L+ N+FTG VP AI NLS+L 
Sbjct  81   VSQIDLSNFDISATLTHFNFSPFLNLTQFNLNGNNFTGPVPSAIGNLSKLT  131



>ref|XP_008352753.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=737

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V KI L N  ++GTL   DF  FPNLT F+L  N F G +P AI NLS L
Sbjct  352  TVSKIDLSNMQINGTLALFDFYLFPNLTHFNLSGNYFRGPIPSAIGNLSSL  402



>gb|KCW84032.1| hypothetical protein EUGRSUZ_B00906 [Eucalyptus grandis]
Length=935

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +++G+V  + L N ++ GTL  L+F   PNL  F+L NNSF G +P ++ANL++L +
Sbjct  62   DSLGSVASLNLSNSTIHGTLHYLNFSRLPNLIAFTLANNSFFGKIPLSMANLAKLTY  118



>ref|XP_010045705.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1048

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +++G+V  + L N ++ GTL  L+F   PNL  F+L NNSF G +P ++ANL++L +
Sbjct  85   DSLGSVASLNLSNSTIHGTLHYLNFSRLPNLIAFTLANNSFFGKIPLSMANLAKLTY  141



>emb|CDM85534.1| unnamed protein product [Triticum aestivum]
Length=750

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            ++ G + ++ L   SLSGTL  LDF +FP+L +  L  N   GS+P  I NL+ LV
Sbjct  69   DSAGHIRELDLSGVSLSGTLDKLDFSAFPHLKKLILSRNGLYGSIPEGIGNLTSLV  124



>gb|KCW68454.1| hypothetical protein EUGRSUZ_F02113, partial [Eucalyptus grandis]
Length=858

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N +G++  + L N ++ GTL+ L+F   PNL    L NNSF+G++P ++ANL++L 
Sbjct  28   NPLGSITSLNLSNSAIHGTLRHLNFSRLPNLVALKLANNSFSGNIPPSMANLAKLA  83



>ref|XP_007200326.1| hypothetical protein PRUPE_ppa000538mg [Prunus persica]
 gb|EMJ01525.1| hypothetical protein PRUPE_ppa000538mg [Prunus persica]
Length=1108

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L NF++S TL   +F  F NLT+F+L+ N+FTG VP A+ NLS+L 
Sbjct  83   VSQIDLSNFNISATLTHFNFTPFLNLTQFNLNGNNFTGPVPSAVGNLSKLT  133



>ref|XP_007201213.1| hypothetical protein PRUPE_ppa001142mg [Prunus persica]
 gb|EMJ02412.1| hypothetical protein PRUPE_ppa001142mg [Prunus persica]
Length=897

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +N   V +I L NF+++ TL   +F +F NLT+F L+NN F G +P AI NLS+L 
Sbjct  79   HNTKTVAQIDLSNFNITATLIQFNFTTFLNLTQFILYNNYFRGPIPSAIGNLSKLT  134



>ref|XP_006387107.1| hypothetical protein POPTR_1834s00200g, partial [Populus trichocarpa]
 gb|ERP46021.1| hypothetical protein POPTR_1834s00200g, partial [Populus trichocarpa]
Length=330

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N G+V  + L++F L GTL  L+F SFPNL    L +NS +G +P +I NL+ L
Sbjct  37   DNSGSVTNLTLESFGLRGTLYDLNFSSFPNLFCLDLADNSLSGPIPSSIGNLTSL  91



>ref|XP_010064688.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=947

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N +G++  + L N ++ GTL+ L+F   PNL    L NNSF+G++P ++ANL++L 
Sbjct  85   NPLGSITSLNLSNSAIHGTLRHLNFSRLPNLVALKLANNSFSGNIPPSMANLAKLA  140



>ref|XP_002322381.2| hypothetical protein POPTR_0015s15210g [Populus trichocarpa]
 gb|EEF06508.2| hypothetical protein POPTR_0015s15210g [Populus trichocarpa]
Length=1065

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G+V  I L + SL GTL  L F SFPNLT  +L NNS  G VP  I NLS L F
Sbjct  83   GSVINISLPDSSLRGTLNRLRFSSFPNLTVLNLPNNSLYGYVPSHIGNLSNLSF  136



>ref|XP_008235778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=962

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L NF +S TL   +F  F NLT+F+L+ N+FTG +P AI NLS+L 
Sbjct  81   VSQIDLSNFDISATLTHFNFSPFLNLTQFNLNGNNFTGPIPSAIGNLSKLT  131



>emb|CBI37170.3| unnamed protein product [Vitis vinifera]
Length=1597

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             G V +I L   +L GTL   DF SF NLTRF+L  N+  G +P  +ANLS+L F
Sbjct  855  TGTVSEINLSQANLKGTLAQFDFGSFTNLTRFNLSINNLNGLIPSTVANLSKLTF  909



>ref|XP_002318299.1| putative leucine-rich repeat transmembrane protein kinase [Populus 
trichocarpa]
 gb|EEE96519.1| putative leucine-rich repeat transmembrane protein kinase [Populus 
trichocarpa]
Length=993

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  169  NVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
              G +  + L N  L GT+ SL+F SFP+L + +L NNS  G++P  I+NLS+L  
Sbjct  82   QAGGIANLSLQNAGLRGTIHSLNFSSFPSLMKLNLSNNSLYGTIPSQISNLSRLTI  137



>ref|XP_011029917.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Populus euphratica]
Length=1038

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             G +  + L N  L GT+ SL+F SFP+L + +L NNS  G++P  I+NLS+L  
Sbjct  83   AGGIANLSLQNAGLRGTIHSLNFSSFPSLMKLNLSNNSLHGTIPSKISNLSRLTI  137



>ref|XP_009769693.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710, partial [Nicotiana sylvestris]
Length=281

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G + +I L +  LSG+L  LDF SFP+LT F+L++N+F+GS+   I N + L F
Sbjct  98   GTISEINLSSAGLSGSLYQLDFTSFPSLTSFNLNSNNFSGSILSTIGNATMLTF  151



>ref|XP_009372104.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Pyrus x bretschneideri]
Length=753

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V KI L N  ++GTL   DF  FPNLT  +L  N F G +P AI NLS+L 
Sbjct  77   VSKIDLSNMQITGTLALFDFSLFPNLTHLNLSGNYFRGPIPSAIGNLSKLT  127



>emb|CBI37168.3| unnamed protein product [Vitis vinifera]
Length=844

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNS-FTGSVPYAIANLSQLVF  2
            ++ G++  I L    L GTL   DF SFPNLT F+L  NS   GS+P  I NLS+L F
Sbjct  69   HSTGSISVINLSETQLEGTLAQFDFGSFPNLTGFNLSTNSKLNGSIPSTICNLSKLTF  126



>ref|XP_004295703.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Fragaria vesca subsp. vesca]
Length=342

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G+VY+I L N+ + GTL  L F SFPNL    L  N     +P  I++LS+L++
Sbjct  89   NTAGSVYRINLTNYGIQGTLHDLSFSSFPNLECLELGFNELHDVIPPQISSLSKLIY  145



>ref|XP_002270822.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Vitis vinifera]
Length=1219

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNS-FTGSVPYAIANLSQLVF  2
            ++ G++  I L    L GTL   DF SFPNLT F+L  NS   GS+P  I NLS+L F
Sbjct  69   HSTGSISVINLSETQLEGTLAQFDFGSFPNLTGFNLSTNSKLNGSIPSTICNLSKLTF  126



>emb|CBI37167.3| unnamed protein product [Vitis vinifera]
Length=804

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNS-FTGSVPYAIANLSQLVF  2
            +  G+V  I L    L GTL   DF SFPNLT F+L +NS   GS+P  I NLS+L F
Sbjct  67   DTTGSVTVINLSETELEGTLAQFDFGSFPNLTGFNLSSNSKLNGSIPSTIYNLSKLTF  124



>ref|XP_007201600.1| hypothetical protein PRUPE_ppa019271mg [Prunus persica]
 gb|EMJ02799.1| hypothetical protein PRUPE_ppa019271mg [Prunus persica]
Length=889

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  ++ +I L NF++S TL   +F  F NLT+F L  N+FTG VP AI  LS+L
Sbjct  72   HNTKSISQIDLSNFNISATLTHFNFTPFLNLTQFKLKGNNFTGPVPSAIGKLSKL  126



>ref|XP_007162587.1| hypothetical protein PHAVU_001G163800g [Phaseolus vulgaris]
 gb|ESW34581.1| hypothetical protein PHAVU_001G163800g [Phaseolus vulgaris]
Length=1192

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I L   +L+GTL +LDF S PNLT+ +L+ N+F GS+P  I  LS+L  
Sbjct  75   TVSEINLSGANLTGTLSALDFASLPNLTQLNLNANNFEGSIPSTIGKLSKLTL  127



>ref|XP_009344386.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3, partial [Pyrus x bretschneideri]
Length=214

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             + KI L N  + GTL   DF SFPNLT F+L+ N F G +P  I  +++L +
Sbjct  71   TISKIDLSNMQIDGTLSLFDFPSFPNLTHFNLNGNYFHGPIPSEIDQVTELQY  123



>gb|EYU17941.1| hypothetical protein MIMGU_mgv1a000490mg [Erythranthe guttata]
Length=1123

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G+V +I L + +L+GT+   DF S  NLT  +L+ N+F GS+P +I NL++LV
Sbjct  71   NSGGSVSQIDLSDSNLAGTISQFDFSSLINLTTLNLNGNAFNGSIPTSIGNLTKLV  126



>ref|XP_010068555.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=940

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            V +I L + SL+GTL +LD  SFPNLT F++  N+ +  +P +I NLSQL F
Sbjct  44   VEEINLYSLSLNGTLNALDVASFPNLTCFNVSENNLSSPIPSSIGNLSQLRF  95



>ref|XP_002325932.2| hypothetical protein POPTR_0019s08830g [Populus trichocarpa]
 gb|EEF00314.2| hypothetical protein POPTR_0019s08830g [Populus trichocarpa]
Length=1020

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +N G+V  + L +F L GTL  L+F SFPNL    L NNS +G++P+ I  L  L F
Sbjct  87   DNSGSVTNLTLQSFGLRGTLYDLNFSSFPNLLFLVLPNNSLSGTIPHEIGKLRNLSF  143



>ref|XP_002270968.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Vitis vinifera]
Length=1219

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNS-FTGSVPYAIANLSQLVF  2
            +  G+V  I L    L GTL   DF SFPNLT F+L +NS   GS+P  I NLS+L F
Sbjct  69   DTTGSVTVINLSETELEGTLAQFDFGSFPNLTGFNLSSNSKLNGSIPSTIYNLSKLTF  126



>ref|XP_010684679.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Beta vulgaris subsp. vulgaris]
Length=1164

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +N+ ++ +I L    L+GTL S +F +FPNL  F L  N+  G +P +I NLSQLV
Sbjct  77   DNLTSITRIVLSKRGLAGTLDSFNFTAFPNLKSFILGTNNLKGQIPLSIGNLSQLV  132



>ref|XP_003632391.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Vitis vinifera]
Length=1219

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNS-FTGSVPYAIANLSQLVF  2
            +  G+V  I L    L GTL   DF SFPNLT F+L +NS   GS+P  I NLS+L F
Sbjct  69   DTTGSVTVINLSETELEGTLAQFDFGSFPNLTGFNLSSNSKLNGSIPSTIYNLSKLTF  126



>ref|XP_006442134.1| hypothetical protein CICLE_v10023899mg, partial [Citrus clementina]
 gb|ESR55374.1| hypothetical protein CICLE_v10023899mg, partial [Citrus clementina]
Length=1073

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G V  I L N  LSGTL+ L F SFP L    L  N F G++P  I NL++L +
Sbjct  31   NDAGRVTNISLRNTGLSGTLRDLSFSSFPQLVHLDLSLNGFFGTIPSQIGNLTKLSY  87



>ref|XP_010038984.1| PREDICTED: uncharacterized protein LOC104427617 [Eucalyptus grandis]
Length=717

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            N+ GA+  + L    L GTL SL+F    ++  F L NNS  GS+P +I NLS+L
Sbjct  392  NDFGAITHLNLSYLGLRGTLNSLNFSCLTSVVSFELANNSIYGSIPSSIGNLSKL  446



>ref|XP_011000224.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Populus euphratica]
Length=982

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L N SL GTL SL   SFPNLT   L NNS  GS+P  I NL +L
Sbjct  80   GSVTNISLPNSSLRGTLNSLRLPSFPNLTVIILRNNSLYGSIPSRIGNLIKL  131



>ref|XP_002326079.2| hypothetical protein POPTR_0019s14780g [Populus trichocarpa]
 gb|EEF00461.2| hypothetical protein POPTR_0019s14780g [Populus trichocarpa]
Length=904

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +N G+V  + L +F L GTL   +F SFPNL    L  NS +G++P  I NLS+++
Sbjct  97   DNSGSVTNLTLQSFGLRGTLYDFNFSSFPNLLILDLRQNSLSGTIPSQIGNLSKII  152



>ref|XP_002270684.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Vitis vinifera]
Length=1132

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             G++ +I L +  L GT+   +  SFPNLT  +L+ N   GS+P A+ANLS+L F
Sbjct  68   AGSISEINLSDAKLRGTIVEFNCSSFPNLTSLNLNTNRLKGSIPTAVANLSKLTF  122



>ref|XP_010039095.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=605

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +N GA+  + L N  L GTL SLDF    NL  F L  NS  GS+P +I NLS+L F
Sbjct  43   DNSGALNSLNLSNLDLRGTLDSLDFSRLTNLVSFVLPYNSIYGSIPSSIGNLSKLNF  99



>gb|KDO37259.1| hypothetical protein CISIN_1g0413001mg, partial [Citrus sinensis]
Length=203

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G V  I L N  LSGTL+   F SFP L    L  N F G++P  I NL++L +
Sbjct  48   NDAGRVTNISLRNTGLSGTLRDFSFSSFPQLVHLDLSLNGFFGTIPSQIGNLTKLSY  104



>ref|XP_010064693.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=947

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +G++  + L N ++ GTL+ L+F   PNL    L NNSF+G++P ++ANL++L 
Sbjct  87   LGSITSLNLSNSAIRGTLRHLNFSRLPNLVALKLANNSFSGNIPPSMANLAKLA  140



>ref|XP_006492795.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Citrus sinensis]
Length=1111

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G V  I L N  LSGTL+ L F SFP L    L +N   G++P  I NLS+L +
Sbjct  79   NDAGRVTNISLRNTGLSGTLRDLSFSSFPQLVLLDLSHNGLFGTIPSQIGNLSKLSY  135



>ref|XP_010920309.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Elaeis guineensis]
Length=1215

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G+V ++ L N +L GTL  L+F S P+LT+  LH+N   G +P  I+ LS+L 
Sbjct  66   NSAGSVVQLSLPNANLDGTLDELNFASLPSLTKLDLHDNYLHGPIPSNISALSKLT  121



>gb|KCW68461.1| hypothetical protein EUGRSUZ_F02121, partial [Eucalyptus grandis]
Length=861

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +G++  + L N ++ GTL+ L+F   PNL    L NNSF+G++P ++ANL++L 
Sbjct  26   LGSITSLNLSNSAIRGTLRHLNFSRLPNLVALKLANNSFSGNIPPSMANLAKLA  79



>gb|KCW89012.1| hypothetical protein EUGRSUZ_A01334, partial [Eucalyptus grandis]
Length=807

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN  +V +I L    L+GTL +LDF  FPNLT F++ +N+  G +P +I NL QL F
Sbjct  19   NNGESVSEISLPGSRLNGTLDALDFALFPNLTCFNVSHNNLEGPIPSSIGNLFQLRF  75



>ref|XP_007010868.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
 gb|EOY19678.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
Length=1083

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFS--LSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            + VG++  + L N+   L GTL SL+F SFP L    L NNS  G +P  I NLS+L+F
Sbjct  102  DEVGSITNLTLPNYEEGLIGTLHSLNFFSFPKLMSLELRNNSLYGPIPSHIGNLSKLIF  160



>ref|XP_011029916.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Populus euphratica]
Length=1049

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +  G + K+ L + SL GTL  L F SF NL   +L NNS  G++P  I+NLS+L+
Sbjct  89   DKTGNITKLSLQDCSLRGTLHGLQFSSFLNLIELNLRNNSLYGTIPSHISNLSKLI  144



>ref|XP_007010909.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
 gb|EOY19719.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
Length=1170

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G++  + L N  L GTL+SL+F S PNL    L NNS  G +P  I NLS+L F
Sbjct  73   GSITNLSLPNSGLRGTLRSLNFFSLPNLMGLGLRNNSLYGGLPSQIGNLSKLSF  126



>ref|XP_004143724.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
Length=630

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            V +I L +  L+GT++SLDF SFPNL R  L  N+  GS+P +I  LS+L F
Sbjct  86   VIEINLAHTGLNGTIESLDFSSFPNLLRLDLKLNNLNGSIPPSIGLLSKLQF  137



>emb|CDP20826.1| unnamed protein product [Coffea canephora]
Length=959

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I + +  + GTL  L+F S P+LTRF L++N+  G +P  I NLS+L++
Sbjct  48   NRAGRVSVINITSSGIRGTLDHLNFSSLPHLTRFDLYDNALHGIIPSNIGNLSRLIY  104



>ref|XP_002318300.2| hypothetical protein POPTR_0012s14920g [Populus trichocarpa]
 gb|EEE96520.2| hypothetical protein POPTR_0012s14920g [Populus trichocarpa]
Length=1051

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +  G + K+ L + SL GTL  L F SF NL   +L NNS  G++P  I+NLS+L+
Sbjct  91   DKTGNITKLSLQDCSLRGTLHGLQFSSFLNLIELNLRNNSLYGTIPSHISNLSKLI  146



>ref|XP_009336100.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Pyrus x bretschneideri]
Length=912

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  169  NVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            N   V +I+L NF + GTL   +F  F NLT F L+ N F G +P AI NL++L
Sbjct  73   NTKTVSEIRLSNFQIRGTLTHFNFNPFLNLTHFYLNQNRFIGPIPSAIGNLTRL  126



>ref|XP_003589771.1| LRR-kinase protein [Medicago truncatula]
 gb|AES60022.1| LRR receptor-like kinase family protein, putative [Medicago truncatula]
Length=515

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            NN  ++ KI L +F L GTL+SL+F S P + +  L NN F G +PY I  +S L
Sbjct  69   NNSKSINKIDLTSFELKGTLQSLNFSSLPKIQKLVLRNNFFYGVIPYHIGVMSNL  123



>ref|XP_004158143.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cucumis sativus]
Length=630

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            V +I L +  L+GT++SLDF SFPNL R  L  N+  GS+P +I  LS+L F
Sbjct  86   VIEINLAHTGLNGTIESLDFSSFPNLLRLDLKLNNLNGSIPPSIGLLSKLQF  137



>ref|XP_003589756.1| LRR receptor-like protein kinase [Medicago truncatula]
Length=671

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            NN  ++ KI L +F L GTL+SL+F S P + +  L NN F G +PY I  +S L
Sbjct  69   NNSKSINKIDLTSFELKGTLQSLNFSSLPKIQKLVLRNNFFYGVIPYHIGVMSNL  123



>ref|XP_010658080.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
 ref|XP_010658082.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=1192

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            G+V  + L +  L GTL +L+F S PNL   +LHNNS  G++P  I+NLS+L+
Sbjct  97   GSVSNLDLHSCGLRGTLYNLNFSSLPNLFSLNLHNNSLYGTIPINISNLSKLI  149



>ref|XP_003624299.1| Receptor protein kinase-like protein [Medicago truncatula]
Length=1067

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +  I L N  L GTL SL F SFPNL    + NNSF G++P  I NLS +
Sbjct  69   ISTIGLANLGLKGTLHSLTFSSFPNLLMIDIRNNSFYGTIPAQIGNLSNI  118



>ref|XP_010920315.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Elaeis guineensis]
Length=808

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+VG++ ++ L N +L+GTL  LDF S P+LT+ +L++N   G +P  ++ LS+L 
Sbjct  66   NSVGSIVQLSLPNANLNGTLDELDFASLPSLTKLNLNSNLLCGPIPSNVSALSKLT  121



>gb|AES80517.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1066

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +  I L N  L GTL SL F SFPNL    + NNSF G++P  I NLS +
Sbjct  68   ISTIGLANLGLKGTLHSLTFSSFPNLLMIDIRNNSFYGTIPAQIGNLSNI  117



>gb|KCW89020.1| hypothetical protein EUGRSUZ_A01345, partial [Eucalyptus grandis]
Length=1112

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +LDF SFPNLT F + NN+  G +P  I+NLS+L F
Sbjct  32   NNGGSVSEISLSGSSLSGTLHALDFASFPNLTCFDVSNNNLEGLIPSLISNLSKLRF  88



>ref|XP_002304404.2| putative leucine-rich repeat transmembrane protein kinase [Populus 
trichocarpa]
 gb|EEE79383.2| putative leucine-rich repeat transmembrane protein kinase [Populus 
trichocarpa]
Length=945

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            ++ G V +I L N  L+GTL+ LDF S  NL R  L  N  TG++P +I  L +L +
Sbjct  75   DDAGNVTQINLPNVGLTGTLQYLDFSSLTNLLRLDLRENQLTGTIPSSIGTLYKLQY  131



>ref|XP_009599912.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nicotiana tomentosiformis]
Length=1024

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            ++VG V ++ + N+S+ GTL  LDF SF  L R  L NNS  G++P  I NLS+L +
Sbjct  78   DSVGRVTEMNMPNYSIKGTLHYLDFSSFSYLIRLDLPNNSLYGTLPTNIFNLSRLSY  134



>ref|XP_003624304.1| Receptor protein kinase-like protein [Medicago truncatula]
 gb|AES80522.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1061

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +  I L N  L GTL SL F SFPNL   +++NN F G++P  I NLS++
Sbjct  68   ISTIDLANLGLKGTLHSLTFSSFPNLITLNIYNNHFYGTIPPQIGNLSRI  117



>ref|XP_008235775.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=1027

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L NF++S TL   +   F NLT+F+L+ N+FTG VP AI NLS+L 
Sbjct  81   VSQIDLSNFNISATLTHFNVTPFLNLTQFNLYGNNFTGPVPSAIGNLSKLT  131



>ref|XP_009783221.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710, partial [Nicotiana sylvestris]
Length=612

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G + +I L +  LSG+L  LDF SFP+LT F+L++N+F+GS+   I N + L F
Sbjct  69   GTISEINLSSAGLSGSLYQLDFTSFPSLTSFNLNSNNFSGSILSTIGNATMLTF  122



>ref|XP_011002880.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X1 [Populus euphratica]
Length=992

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G+V  I L NF L GTL   +F SF NL+   L +NS  G++P  I+NLS+L  
Sbjct  126  NDGGSVSTINLTNFQLKGTLDDFNFSSFHNLSCLDLQHNSLKGNIPPHISNLSKLTI  182



>ref|XP_008339061.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=1010

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
             V +I+L +  ++GTL   DF  FPNLT F+L  N F G +P AI NLS L 
Sbjct  71   TVSEIQLSHMEINGTLALFDFSLFPNLTHFNLSGNYFRGPIPSAIGNLSSLA  122



>ref|XP_011010837.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Populus euphratica]
Length=949

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +N G V +I L N  L+GTL+  DF S  NL R  L  N  TG++P +I  L +L +
Sbjct  75   DNAGNVTQINLPNVGLTGTLQYFDFSSLTNLLRLDLRENQLTGTIPSSIGTLYKLQY  131



>ref|XP_008801285.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Phoenix dactylifera]
Length=629

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G++ ++ L N +L GTL  LDF S P+LT+  L+ N   GS+P  I+ LS L 
Sbjct  66   NSAGSIVQLSLPNANLDGTLDELDFASLPSLTKLDLNTNLLNGSIPSNISALSNLT  121



>ref|XP_011002881.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X2 [Populus euphratica]
Length=936

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G+V  I L NF L GTL   +F SF NL+   L +NS  G++P  I+NLS+L  
Sbjct  70   NDGGSVSTINLTNFQLKGTLDDFNFSSFHNLSCLDLQHNSLKGNIPPHISNLSKLTI  126



>ref|XP_007200865.1| hypothetical protein PRUPE_ppa1027153mg [Prunus persica]
 gb|EMJ02064.1| hypothetical protein PRUPE_ppa1027153mg [Prunus persica]
Length=741

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N   + ++ L NF+++ TL    F  F NLT+F+L+ N+FTG +P A+ NLS+L
Sbjct  72   HNTKTISQVDLSNFNITATLTHFHFTPFLNLTQFNLNGNNFTGPIPSAVGNLSKL  126



>ref|XP_006374672.1| hypothetical protein POPTR_0015s15080g [Populus trichocarpa]
 gb|ERP52469.1| hypothetical protein POPTR_0015s15080g [Populus trichocarpa]
Length=796

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L N SL GTL SL F SFPNL   +L  NS  G VP  I NLS L
Sbjct  81   GSVINISLPNSSLRGTLNSLRFSSFPNLIELTLSYNSLYGYVPSHIGNLSNL  132



>ref|XP_006421644.1| hypothetical protein CICLE_v10007190mg, partial [Citrus clementina]
 gb|ESR34884.1| hypothetical protein CICLE_v10007190mg, partial [Citrus clementina]
Length=846

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +V +I L N  L+GTL  LDF SFPNL RF +  N   G++P  I  LS+L F
Sbjct  1    SVTEINLANTGLAGTLHDLDFSSFPNLLRFDVKRNYLFGTIPTNIGLLSKLQF  53



>ref|XP_010911527.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710, partial [Elaeis guineensis]
Length=533

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            + ++ L    L GTL +LDF + P+LT  SL  N  TG++P AIANLS LV
Sbjct  82   ITELSLPRAGLVGTLDALDFSALPSLTVVSLRRNFLTGAIPAAIANLSGLV  132



>gb|KDO63963.1| hypothetical protein CISIN_1g035742mg, partial [Citrus sinensis]
Length=214

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            ++ G V  I L N  LSGTL    F SFP L    L  N F G++P  I NLS+L +
Sbjct  44   SDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSY  100



>ref|XP_010107175.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC13940.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=892

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V +I L    L GTL++LDF SFP+L    L+ N  TG++P +I  LS L +
Sbjct  75   NKAGTVTEINLAYAGLRGTLENLDFSSFPSLVILDLNENQLTGTIPISIGMLSNLEY  131



>ref|XP_003624307.1| Receptor protein kinase-like protein [Medicago truncatula]
Length=1140

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  ++  I L+NF L GTL SL F SF NL   +++NN F G++P  I N+S++
Sbjct  59   DNSKSISTINLENFGLKGTLHSLTFSSFSNLQTLNIYNNYFYGTIPPQIGNISKI  113



>gb|AES80525.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1052

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  ++  I L+NF L GTL SL F SF NL   +++NN F G++P  I N+S++
Sbjct  59   DNSKSISTINLENFGLKGTLHSLTFSSFSNLQTLNIYNNYFYGTIPPQIGNISKI  113



>ref|XP_009344379.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Pyrus x bretschneideri]
Length=787

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V KI L N  + GTL   DF SFPNLT F+L+ N F G +P  I  +++L +
Sbjct  73   TVSKIDLSNMQIDGTLSLFDFPSFPNLTHFNLNGNYFHGPIPSEIDQVTELQY  125



>ref|XP_003533567.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Glycine max]
Length=1009

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  +V  I L  + L GTL +L+F SFPNL   +++NNSF G++P  I N+S++
Sbjct  86   DNSKSVSGINLAYYGLKGTLHTLNFSSFPNLLSLNIYNNSFYGTIPPQIGNMSKV  140



>ref|XP_008372583.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=890

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            V +I+L    ++GTL   DF  FPNLT F+L  N F G +P AI NLS L
Sbjct  156  VSEIQLSRMEINGTLALFDFSLFPNLTHFNLSGNYFRGPIPSAIGNLSSL  205



>ref|XP_010068454.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1230

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +LDF SFPNLT F++ +N+  G +P +I NLS+L F
Sbjct  73   NNGGSVTEISLSGSSLSGTLDALDFASFPNLTCFNVSHNNLKGLIPSSIGNLSKLSF  129



>ref|XP_010265040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nelumbo nucifera]
Length=1225

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN  +V  I L   +L+GTL +  F S PNLT   L  N+F G++P AIANLS L +
Sbjct  70   NNARSVSYITLYRLNLNGTLHNFSFSSLPNLTVLDLSENNFYGTIPSAIANLSMLTY  126



>gb|KCW89007.1| hypothetical protein EUGRSUZ_A01328, partial [Eucalyptus grandis]
Length=1176

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +LDF SFPNLT F++ +N+  G +P +I NLS+L F
Sbjct  40   NNGGSVTEISLSGSSLSGTLDALDFASFPNLTCFNVSHNNLKGLIPSSIGNLSKLSF  96



>ref|XP_006371548.1| hypothetical protein POPTR_0019s13060g [Populus trichocarpa]
 gb|ERP49345.1| hypothetical protein POPTR_0019s13060g [Populus trichocarpa]
Length=897

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G+V  I L NF L GTL    F SF NL+   L +NS  G++P  I+NLS+L  
Sbjct  120  NDGGSVSTINLTNFQLKGTLDDFSFSSFHNLSCLDLQHNSLKGNIPPHISNLSKLTI  176



>ref|XP_007010865.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
 gb|EOY19675.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
Length=1102

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFS--LSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +  G++  + L N+   L GTL SL+F SFP L    L NNS  G +P  I NLS+L+F
Sbjct  72   DKAGSITNLSLPNYEEGLRGTLHSLNFFSFPKLMNLQLRNNSLYGPIPSHIGNLSKLIF  130



>ref|XP_008346235.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Malus domestica]
Length=722

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V +I+L    ++GTL   DF  FPNLT F+L  N F G +P AI NLS L
Sbjct  155  TVSEIQLSRMEINGTLALFDFSLFPNLTHFNLSGNYFRGPIPSAIGNLSSL  205



>ref|XP_006442137.1| hypothetical protein CICLE_v10018798mg [Citrus clementina]
 gb|ESR55377.1| hypothetical protein CICLE_v10018798mg [Citrus clementina]
Length=886

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            ++ G V  I L N  LSGTL+ L F SFP L    L +N   G++P  I NLS+L +
Sbjct  79   DDAGRVTNISLRNTGLSGTLRDLSFSSFPQLVLLDLSHNGLFGTIPSQIGNLSKLSY  135



>ref|XP_008235769.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Prunus mume]
Length=488

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L NF+++ TL   +F  F NLT+F+L+ N FTG VP AI  LS+L 
Sbjct  82   VSQIDLSNFNIAATLAHFNFTPFVNLTQFNLNGNKFTGPVPSAIGKLSKLT  132



>dbj|BAC87845.1| leucine-rich repeat receptor-like protein kinase 1 [Populus nigra]
Length=856

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N G+V    L +F L GTL S +F SFPNL   +L NNS  G++P  I+NL+++
Sbjct  90   DNSGSVANFSLPHFGLRGTLHSFNFSSFPNLLTPNLRNNSLYGTIPSHISNLTKI  144



>ref|XP_011029919.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X2 [Populus euphratica]
Length=891

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G+V  + L   SLSGT+ +L F SFPNL +  L  NS  G++P  I+NLS+L  
Sbjct  70   GSVTNLSLPGSSLSGTIHNLRFSSFPNLIKLDLSKNSLYGTIPSHISNLSKLTI  123



>ref|XP_002444138.1| hypothetical protein SORBIDRAFT_07g009480 [Sorghum bicolor]
 gb|EES13633.1| hypothetical protein SORBIDRAFT_07g009480 [Sorghum bicolor]
Length=744

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G V ++ L    L GTL +LD  +FP LT+  LHNN+ +GS+P  I++L+ L
Sbjct  76   GRVTELSLPGTGLHGTLSALDLAAFPALTKLDLHNNNISGSIPANISSLTYL  127



>gb|KHN40539.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1052

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V  I L  + L GTL +L+F SFPNL   +++NNSF+G++P  I N+S++
Sbjct  63   SVSNIDLPFYGLKGTLHTLNFSSFPNLLGLNIYNNSFSGTIPPQIGNISKV  113



>ref|XP_011029918.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X1 [Populus euphratica]
Length=1001

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G+V  + L   SLSGT+ +L F SFPNL +  L  NS  G++P  I+NLS+L  
Sbjct  70   GSVTNLSLPGSSLSGTIHNLRFSSFPNLIKLDLSKNSLYGTIPSHISNLSKLTI  123



>ref|XP_010684703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Beta vulgaris subsp. vulgaris]
Length=1213

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +++ ++ +I L    L+GTL S +F +FPNLT F L +N+  G +P +I+NLS LV
Sbjct  76   DDLNSITRIVLSKKGLTGTLTSFNFSAFPNLTSFILDSNNLKGQIPPSISNLSNLV  131



>ref|XP_006601776.1| PREDICTED: uncharacterized protein LOC100527193 isoform X1 [Glycine 
max]
Length=1062

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V  I L  + L GTL +L+F SFPNL   +++NNSF+G++P  I N+S++
Sbjct  73   SVSNIDLPFYGLKGTLHTLNFSSFPNLLGLNIYNNSFSGTIPPQIGNISKV  123



>ref|XP_010045481.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=946

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +G++  + L N ++ GTL+ L+F   PNL    L NNSF+G++P ++ NL++L 
Sbjct  87   LGSITSLNLSNSAIRGTLRHLNFSQLPNLVALKLANNSFSGNIPPSMVNLAKLA  140



>gb|KCW83108.1| hypothetical protein EUGRSUZ_B00062, partial [Eucalyptus grandis]
Length=918

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +G++  + L N ++ GTL+ L+F   PNL    L NNSF+G++P ++ NL++L 
Sbjct  87   LGSITSLNLSNSAIRGTLRHLNFSQLPNLVALKLANNSFSGNIPPSMVNLAKLA  140



>ref|XP_009372082.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Pyrus x bretschneideri]
Length=984

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I+L    ++GTL   DF  FPNLT F+L  N F G +P AI NLS L  
Sbjct  77   TVSEIQLSGMEINGTLALFDFSLFPNLTHFNLSGNYFRGPIPSAIGNLSGLTI  129



>gb|KCW89011.1| hypothetical protein EUGRSUZ_A01333 [Eucalyptus grandis]
Length=1191

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +L+F SFPNL RF + NN+  G +P  I+NLS+L F
Sbjct  70   NNGGSVSEISLSGSSLSGTLHALNFASFPNLIRFDVSNNNLEGLIPSLISNLSKLRF  126



>gb|KDO36738.1| hypothetical protein CISIN_1g043685mg, partial [Citrus sinensis]
Length=620

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G V  I L N  LSGTL+ L F SFP L    L  N   G++P  I NLS+L +
Sbjct  30   NDAGRVINISLRNTGLSGTLRDLSFSSFPQLEYLDLSLNGLFGTIPSQIGNLSKLSY  86



>ref|XP_004492920.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Cicer arietinum]
Length=1069

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLS  14
            +V  I L+N+ + GTL SL F SFPNL   +++ N F G++P  I N+S
Sbjct  77   SVSGISLENYGIKGTLHSLSFSSFPNLITINIYQNQFYGTIPPQIGNMS  125



>ref|XP_010068462.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=1163

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G+V +I L   SLSGTL +L+F SFPNL RF + NN+  G +P  I+NLS+L F
Sbjct  53   NNGGSVSEISLSGSSLSGTLHALNFASFPNLIRFDVSNNNLEGLIPSLISNLSKLRF  109



>ref|XP_010690721.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Beta vulgaris subsp. vulgaris]
Length=975

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V ++ L N  L+GTL + +F S PNL+   LH+N+  G++P +I NL++L
Sbjct  84   GSVTRLNLTNVGLTGTLYAFNFSSLPNLSYLDLHDNNLFGNIPSSITNLTKL  135



>ref|XP_008802426.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Phoenix dactylifera]
Length=865

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G++ ++ L N +L GTL  LDF S P+LT+  L+ N   GS+P  I+ LS L 
Sbjct  92   NSAGSIVQLSLPNANLDGTLDELDFASLPSLTKLDLNTNLLNGSIPSNISVLSNLT  147



>ref|XP_007038365.1| Leucine-rich repeat receptor-like protein kinase family protein 
[Theobroma cacao]
 gb|EOY22866.1| Leucine-rich repeat receptor-like protein kinase family protein 
[Theobroma cacao]
Length=943

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            NN G V  I L    L GT+++LDF SFPNL R  L  N  +G +P  I  LS+L F
Sbjct  73   NNAGNVIAINLAYTGLKGTVENLDFFSFPNLLRLDLKVNQLSGKIPSNIGLLSKLQF  129



>ref|XP_007010902.1| Kinase family protein with leucine-rich repeat domain [Theobroma 
cacao]
 gb|EOY19712.1| Kinase family protein with leucine-rich repeat domain [Theobroma 
cacao]
Length=440

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -1

Query  172  NNVGAVYKIKLDNF--SLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +  G++  + L N+   L GTL SL+F SFP L    L NNS  G +P  I NLS+L+F
Sbjct  58   DEAGSMTNLSLPNYVEGLRGTLHSLNFFSFPKLMNLELRNNSLYGPIPSHIGNLSKLIF  116



>gb|KDP26487.1| hypothetical protein JCGZ_17645 [Jatropha curcas]
Length=1149

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +  G + KI L N +++GTL   +F SF N+  F + NN+  G +P AI +LS+L +
Sbjct  69   DTTGTISKINLSNLNITGTLIQFNFSSFANIASFDIQNNNIAGLIPSAIGSLSKLTY  125



>ref|XP_007035303.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
 gb|EOY06229.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
Length=908

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G++  I L +  L GTL++ +F SFPNL    L NNS  G++P  I+NLS+L +
Sbjct  84   GSIIHINLTSSQLKGTLQNFNFISFPNLLSLDLSNNSLYGTIPAHISNLSELSY  137



>ref|XP_006490133.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Citrus sinensis]
Length=948

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 39/79 (49%), Gaps = 24/79 (30%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRF------------------------SL  65
            N+ G+V +I L N  L+GTL  LDF SFPNL RF                         L
Sbjct  74   NDAGSVTEINLANTGLAGTLHDLDFSSFPNLLRFDVKINYLFDTIPTNIGLLPKLQFLDL  133

Query  64   HNNSFTGSVPYAIANLSQL  8
              NSF G++P + ANL+Q+
Sbjct  134  STNSFNGTLPISFANLTQV  152



>ref|XP_006377101.1| hypothetical protein POPTR_0012s14900g [Populus trichocarpa]
 gb|ERP54898.1| hypothetical protein POPTR_0012s14900g [Populus trichocarpa]
Length=977

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G+V  + L   SLSGT+ SL F  FPNL +  L  NS  G++P  I+NLS+L  
Sbjct  42   GSVTNLSLPGSSLSGTIHSLRFSYFPNLVKLDLSENSLYGTIPSHISNLSKLTI  95



>ref|XP_002321306.1| hypothetical protein POPTR_0014s18490g [Populus trichocarpa]
 gb|EEE99621.1| hypothetical protein POPTR_0014s18490g [Populus trichocarpa]
Length=1199

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             V +I L +  ++GTL   +F  F +LTRF + NN+ +G++P AI  LS+L++
Sbjct  75   TVSQINLPSLEINGTLAHFNFTPFTDLTRFDIQNNTVSGAIPSAIGGLSKLIY  127



>gb|KHM99087.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=983

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V  I + N  L GTL +L+F SFP L    + +NSF+G++P  IANLS +
Sbjct  45   SVTAINVTNLGLQGTLHTLNFSSFPKLLTLDISHNSFSGTIPQQIANLSSV  95



>ref|NP_001235554.1| receptor protein kinase-like protein [Glycine max]
 gb|ACM89602.1| receptor protein kinase-like protein [Glycine max]
Length=983

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V  I + N  L GTL +L+F SFP L    + +NSF+G++P  IANLS +
Sbjct  45   SVTAINVTNLGLQGTLHTLNFSSFPKLLTLDISHNSFSGTIPQQIANLSSV  95



>ref|XP_006602873.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X1 [Glycine max]
Length=1082

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V +I L ++ L GTL++ +F +FPNL   ++ NNSF G++P  I N+S++
Sbjct  88   SVSRITLADYELKGTLQTFNFSAFPNLLSLNIFNNSFYGTIPPQIGNMSKV  138



>ref|XP_006602874.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X2 [Glycine max]
Length=968

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V +I L ++ L GTL++ +F +FPNL   ++ NNSF G++P  I N+S++
Sbjct  88   SVSRITLADYELKGTLQTFNFSAFPNLLSLNIFNNSFYGTIPPQIGNMSKV  138



>gb|KHN40546.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1053

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V +I L ++ L GTL++ +F +FPNL   ++ NNSF G++P  I N+S++
Sbjct  59   SVSRITLADYELKGTLQTFNFSAFPNLLSLNIFNNSFYGTIPPQIGNMSKV  109



>ref|XP_002274434.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Vitis vinifera]
Length=972

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            G+V  + L  F L GTL++L F S  NL  F+L+NNSF G++P  ++ LS+L 
Sbjct  78   GSVTHLNLSGFGLRGTLQNLSFSSISNLLSFNLYNNSFYGTIPTHVSKLSKLT  130



>ref|XP_007141641.1| hypothetical protein PHAVU_008G213200g [Phaseolus vulgaris]
 gb|ESW13635.1| hypothetical protein PHAVU_008G213200g [Phaseolus vulgaris]
Length=1023

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            V  I + N  L GTL +L+F SFPNL    + NNSF+ ++P+ I NLS++
Sbjct  80   VTTINVANHGLKGTLHTLNFSSFPNLLTLDVSNNSFSDTIPHQIGNLSKV  129



>ref|XP_010068587.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=253

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N + +V  + L + +L GTL  LDF S PNL    L NNS  G +P ++ NLS+L +
Sbjct  86   NPLRSVISLNLSSSALHGTLHDLDFSSLPNLVTLKLANNSLFGIIPSSLGNLSKLAY  142



>ref|XP_006428847.1| hypothetical protein CICLE_v10013366mg [Citrus clementina]
 gb|ESR42087.1| hypothetical protein CICLE_v10013366mg [Citrus clementina]
Length=288

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G++  I+L   S+ G L SL+F  FPNL   +L NN+ +GS+P  I +LS L +
Sbjct  76   GSITHIELVECSIKGELGSLNFSCFPNLQYLNLWNNNLSGSIPPQIGSLSNLKY  129



>ref|XP_010267605.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nelumbo nucifera]
Length=982

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V +I L   +L G L + DF SFPNL R  L +N  +G++P  I  L++L +
Sbjct  76   NKAGNVTEINLFKAALQGKLDNFDFSSFPNLLRLDLSDNQLSGTIPTHIGKLTRLTY  132



>ref|XP_008775331.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Phoenix dactylifera]
Length=254

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+  +V  I L N+ ++  L +L+F S PNLT   L NN   GS+P +I +LS+LV
Sbjct  48   NHAKSVIGISLSNYYINSILGNLNFSSLPNLTHLDLRNNILNGSIPASIGSLSKLV  103



>ref|XP_006387609.1| hypothetical protein POPTR_0780s002001g, partial [Populus trichocarpa]
 gb|ERP46523.1| hypothetical protein POPTR_0780s002001g, partial [Populus trichocarpa]
Length=157

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            V  + L++F L GTL  L+F SFPNL    L +NS +G +P +I NL+ L
Sbjct  1    VTNLTLESFGLRGTLYDLNFSSFPNLFCLDLADNSLSGPIPSSIGNLTSL  50



>ref|XP_010045748.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
 gb|KCW84071.1| hypothetical protein EUGRSUZ_B00951 [Eucalyptus grandis]
Length=1091

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +++G+V  + L N  + GTL  L+F   PNL   +L NNSF G +P ++ANL++L +
Sbjct  85   DSLGSVASLNLSNSIIHGTLHYLNFSQLPNLIALTLTNNSFFGKIPLSMANLAKLTY  141



>ref|XP_004492917.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X1 [Cicer arietinum]
Length=1069

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  148  IKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            I L+N+ + GTL SL F SFPNL   +++ N F G++P  I N+S++
Sbjct  81   INLENYGIKGTLHSLSFSSFPNLITINIYQNHFYGTIPPQIGNMSRV  127



>ref|XP_006371672.1| hypothetical protein POPTR_0019s15000g [Populus trichocarpa]
 gb|ERP49469.1| hypothetical protein POPTR_0019s15000g [Populus trichocarpa]
Length=968

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  +   NF L GTL   +F SFPNL+   L NNS  G++P  I NLS++
Sbjct  102  GSVANLTFPNFGLRGTLYDFNFSSFPNLSILDLSNNSIHGTIPSHIGNLSKI  153



>gb|KDO43356.1| hypothetical protein CISIN_1g038615mg [Citrus sinensis]
Length=274

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G++  I+L   S+ G L SL+F  FPNL   +L NN+ +GS+P  I +LS L +
Sbjct  76   GSITHIELVECSIKGELGSLNFSCFPNLQYLNLWNNNLSGSIPPQIGSLSNLKY  129



>ref|XP_010262429.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nelumbo nucifera]
Length=593

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N  G+V ++ L N  L GTL  L F   PNLT F +  N   G++P AI+NLS+L+
Sbjct  81   NTGGSVAQMNLSNSRLHGTLNELSFALLPNLTHFDVTINILHGAIPSAISNLSKLI  136



>ref|XP_006421643.1| hypothetical protein CICLE_v10004274mg [Citrus clementina]
 gb|ESR34883.1| hypothetical protein CICLE_v10004274mg [Citrus clementina]
Length=892

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 39/79 (49%), Gaps = 24/79 (30%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLH-----------------------  62
            N+ G+V +I L N  L+GTL  LDF SFPNL RF +                        
Sbjct  74   NDAGSVTEINLANTGLAGTLHDLDFSSFPNLLRFDVKINYLFDTIPTNIGLLSKLLFLDL  133

Query  61   -NNSFTGSVPYAIANLSQL  8
              NSF G++P + ANL+Q+
Sbjct  134  STNSFNGTLPLSFANLTQV  152



>ref|XP_008235772.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=850

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             N   V +I L NF+++ TL   +F  F NLT+F+L  N FTG VP AI  LS+L
Sbjct  76   QNSEQVSQIDLSNFNIAATLTHFNFTPFLNLTQFNLSGNYFTGHVPSAIGKLSKL  130



>ref|XP_010091788.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB45996.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=1057

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G V +I L    L+GTL   +F  F N+T F+L+ N+  G++P AI NLS+L  
Sbjct  70   NSTGEVSEINLSGSELTGTLDQFNFTPFVNITVFNLNKNNLVGTIPPAIGNLSRLTL  126



>ref|XP_003589757.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 ref|XP_003589772.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES60008.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1137

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPY  32
            ++YK+ L N  L GTL++L+F S P +    L NNSF G +PY
Sbjct  79   SIYKVNLTNIGLKGTLQTLNFSSLPKIQELVLRNNSFYGVIPY  121



>ref|XP_008229456.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=443

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N   ++  I L +  L GTL +  F SFP+L   +L+ NSF GS+P ++ NLS+L++
Sbjct  81   NEFRSITNISLSSIGLRGTLYAFGFSSFPSLLSLNLYQNSFYGSIPSSLGNLSKLIY  137



>emb|CDP11083.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G V  I + +  + GTL  L+F S  +LTRF L  N+  G++P  I NLS+L++
Sbjct  83   NKAGRVSVINITSSGIKGTLDHLNFSSLAHLTRFDLDRNALHGTIPANIGNLSRLIY  139



>ref|XP_006374683.1| hypothetical protein POPTR_0015s151802g, partial [Populus trichocarpa]
 gb|ERP52480.1| hypothetical protein POPTR_0015s151802g, partial [Populus trichocarpa]
Length=524

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
             V  I L N SL GTL SL F SFPNL   +L  NS  G VP  I NLS L
Sbjct  74   CVTNISLSNSSLRGTLNSLRFSSFPNLIELTLSYNSLYGYVPSHIGNLSNL  124



>ref|XP_008235779.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Prunus mume]
Length=833

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
             N   V +I L NF+++ TL   +F  F NLT+F+L  N FTG VP AI  LS+L 
Sbjct  76   QNSEQVSQIDLSNFNIAATLTHFNFTPFLNLTQFNLSGNYFTGHVPSAIGKLSKLT  131



>ref|XP_008801283.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Phoenix dactylifera]
Length=484

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G++ ++ L N +L+GTL   DF S P+LT+  L+ N   GS+P  I+ LS L 
Sbjct  66   NSAGSIVQLSLPNANLNGTLDEFDFASLPSLTKLDLNTNLLNGSIPSNISALSNLT  121



>ref|XP_009591012.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nicotiana tomentosiformis]
Length=904

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G V ++ + N+ + GTL  L+F SFP+L      NNS  G++P  I NLS+L F
Sbjct  95   GRVTQMDIANYGIRGTLHHLNFSSFPHLQLIDFSNNSLHGTLPQNICNLSRLSF  148



>ref|XP_010270812.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Nelumbo nucifera]
Length=967

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G+V ++ L    LSG L +LDF   PNL R +L  N   GS+P  I+ LS+L 
Sbjct  77   NSDGSVTQLNLPEAGLSGKLDNLDFSMLPNLGRLNLSGNKLEGSIPQHISTLSKLT  132



>emb|CDP11415.1| unnamed protein product [Coffea canephora]
Length=836

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N  G +  I +    + GTL  L+F S P LTR  L+ N+F G++P  I NLS+L++
Sbjct  60   NKAGRISIINITRSGIKGTLDHLNFSSLPYLTRVDLYYNAFYGTIPSHIGNLSRLIY  116



>ref|XP_010032795.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X2 [Eucalyptus grandis]
 gb|KCW52281.1| hypothetical protein EUGRSUZ_J01701 [Eucalyptus grandis]
Length=1058

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            GA+  + L +  L GTL  LDF    ++  F L NNS  GS+P +I NLS+L F
Sbjct  91   GAITHLNLSSLGLRGTLDGLDFSCLTSVVSFELGNNSIYGSIPSSIGNLSKLNF  144



>gb|KEH22311.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1278

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V K+ L N  L GTL+SL+F S PN+   ++ +NS  GS+P  I  LS+L
Sbjct  84   SVSKVNLTNMGLKGTLESLNFSSLPNIQTLNISHNSLNGSIPSHIGMLSKL  134



>ref|XP_008235777.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Prunus mume]
Length=949

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L N  +S TL   +F  F NLT+F+L+ N+F G +P AI NLS+L 
Sbjct  81   VSQIDLSNLDISATLTDFNFTPFLNLTQFNLNGNNFEGPIPSAIGNLSKLT  131



>ref|XP_007140376.1| hypothetical protein PHAVU_008G106500g [Phaseolus vulgaris]
 gb|ESW12370.1| hypothetical protein PHAVU_008G106500g [Phaseolus vulgaris]
Length=1032

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L N  LSGTL++L+F S PN+    +  NS +GS+P  I  LS+L
Sbjct  80   GSVSNINLTNIGLSGTLQTLNFSSLPNILTLDMSLNSLSGSIPPQIGVLSKL  131



>ref|XP_008229458.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=1003

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N   ++  I L +  L GTL +  F SFP+L   +L+ NSF GS+P ++ NLS+L++
Sbjct  81   NEFRSITNISLSSIGLRGTLYAFGFSSFPSLLSLNLYQNSFYGSIPSSLGNLSKLIY  137



>ref|XP_007050194.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007050195.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94351.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94352.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative isoform 1 [Theobroma cacao]
Length=1221

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +  G V +I L N ++SG++  L+F  F NLTR  L N+   G +P AI  LS+L+
Sbjct  69   DGTGTVSEINLSNANMSGSIAQLNFTPFANLTRLDLINSGMEGPIPSAIGTLSKLL  124



>gb|KHN11557.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1009

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N  +V  I L  + L GT  +L+F SFPNL   +++NNSF G++P  I N+S++
Sbjct  86   DNSKSVSGINLAYYGLKGTFHTLNFSSFPNLLSLNIYNNSFYGTIPPQIGNMSKV  140



>ref|XP_003622584.1| Receptor protein kinase-like protein [Medicago truncatula]
 gb|AES78802.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1083

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V K+ L N  L GTL+SL+F S PN+   ++ +NS  GS+P  I  LS+L
Sbjct  75   SVSKVNLTNMGLKGTLESLNFSSLPNIQTLNISHNSLNGSIPSHIGMLSKL  125



>ref|XP_011044955.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Populus euphratica]
Length=1307

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N G+V    L +F L G L S +F SFPNL    L NNS  G++P  I+NL+++
Sbjct  40   DNSGSVANFSLPHFGLRGKLHSFNFSSFPNLVTLILWNNSLYGTIPSHISNLTKI  94



>gb|AES78785.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1180

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V K+ L N  L GTL+SL+F S PN+   ++ +NS  GS+P  I  LS+L
Sbjct  84   SVSKVNLTNMGLKGTLESLNFSSLPNIQTLNISHNSLNGSIPSHIGMLSKL  134



>gb|KHN44768.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=976

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V  I + N  L GTL SL F SFP L    + NNSF G +P  I+NLS++
Sbjct  83   SVTAINVANLGLKGTLHSLKFSSFPKLLTLDISNNSFNGIIPQQISNLSRV  133



>ref|XP_010032794.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X1 [Eucalyptus grandis]
Length=1069

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            GA+  + L +  L GTL  LDF    ++  F L NNS  GS+P +I NLS+L F
Sbjct  91   GAITHLNLSSLGLRGTLDGLDFSCLTSVVSFELGNNSIYGSIPSSIGNLSKLNF  144



>ref|XP_008235612.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Prunus mume]
Length=1224

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            V +I L NF++  TL   +F  F NLT+F+L+ N+FTG VP AI  LS+L 
Sbjct  81   VSQIDLSNFNIYATLTHFNFTPFLNLTQFNLNGNNFTGPVPSAIGKLSKLT  131



>ref|XP_003545194.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X1 [Glycine max]
Length=977

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V  I + N  L GTL SL F SFP L    + NNSF G +P  I+NLS++
Sbjct  84   SVTAINVANLGLKGTLHSLKFSSFPKLLTLDISNNSFNGIIPQQISNLSRV  134



>ref|XP_010068548.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Eucalyptus grandis]
Length=481

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G+V +I L + SLSG L +LDF SFPNLT F++ NN+  G +  +I NLS+L F
Sbjct  26   GSVSEINLSSSSLSGRLHALDFASFPNLTCFNVSNNNLKGPIQSSIGNLSELRF  79



>ref|XP_003622567.1| Receptor-like protein kinase [Medicago truncatula]
Length=1772

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +V K+ L N  L GTL+SL+F S PN+   ++ +NS  GS+P  I  LS+L
Sbjct  650  SVSKVNLTNMGLKGTLESLNFSSLPNIQTLNISHNSLNGSIPSHIGMLSKL  700



>ref|XP_010039044.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At1g35710 [Eucalyptus grandis]
Length=1275

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            AV  + L +  L GTL SLDF    ++  F L NNS  GS+P +I NLS+L
Sbjct  93   AVAHLXLSDLGLKGTLDSLDFSRLTSMVSFKLDNNSIYGSIPTSIGNLSKL  143



>ref|XP_010051016.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=1154

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            N+ GA+  + L + +L+GTL  L+F    ++  F L NNS  GS+P  I NLS+L
Sbjct  89   NDYGAITHLNLSHLNLTGTLDGLNFSCLTSVVSFELANNSIYGSIPSGIGNLSKL  143



>gb|KDO41560.1| hypothetical protein CISIN_1g041065mg, partial [Citrus sinensis]
Length=148

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G V  I L N  ++GTL    F SFP+L    L  N F G++P  I+NLS L +
Sbjct  49   NDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRY  105



>ref|XP_006374673.1| hypothetical protein POPTR_0015s15100g [Populus trichocarpa]
 gb|ERP52470.1| hypothetical protein POPTR_0015s15100g [Populus trichocarpa]
Length=989

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  157  VYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            V  I L N SL G L +L F SFPNL    L NNS  GSVP  I NLS L
Sbjct  14   VTNISLPNSSLRGRLNTLRFSSFPNLIVLILRNNSLYGSVPSHIGNLSNL  63



>ref|XP_011044952.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710, partial [Populus euphratica]
Length=653

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            +N G+V    L NF L GTL S +F  FPNL   +L NNS  G++P  I  L+ L F
Sbjct  88   DNSGSVADFSLPNFGLRGTLHSFNFSFFPNLLTINLGNNSLYGTIPLEIGLLTSLNF  144



>ref|XP_008801289.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At1g35710 [Phoenix dactylifera]
Length=949

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G++ ++ L N  L+GTL   DF S P+LT+  L+ N   GS+P  I+ LS L 
Sbjct  66   NSAGSIVQLSLPNAKLNGTLDEFDFASLPSLTKLDLNTNLLNGSIPSNISALSNLT  121



>ref|XP_011005716.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710, partial [Populus euphratica]
Length=661

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            +N G V    L +F L GT+ S  F SFPNL    L NNS  G++P  I+NL+++ 
Sbjct  87   DNSGRVADFSLPHFGLRGTIHSFSFSSFPNLLTLILWNNSLYGTIPSHISNLTKIT  142



>gb|KDO55288.1| hypothetical protein CISIN_1g041920mg, partial [Citrus sinensis]
Length=193

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G++  I L   ++ G L  L+F  FPNL    L NNS +GS+P  I +LS L +
Sbjct  76   GSIILIDLQESNIKGELGRLNFSCFPNLQYLDLWNNSLSGSIPSQIGSLSNLKY  129



>gb|KCW64085.1| hypothetical protein EUGRSUZ_G017472, partial [Eucalyptus grandis]
Length=929

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N + +V  + L + +L GTL  LDF S PNL    L NNS  G +P ++ NLS+L +
Sbjct  65   NPLRSVISLNLSSSALHGTLHDLDFSSLPNLVTLKLANNSLFGIIPSSLGNLSKLAY  121



>ref|XP_003624327.1| Receptor protein kinase-like protein [Medicago truncatula]
 gb|AES80545.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1060

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            ++  I L++  L GTL SL F SF NLT  ++++N+F G++P  I NLS++
Sbjct  69   SITTINLESLGLKGTLHSLTFSSFTNLTTLNIYDNNFYGTIPPQIGNLSKI  119



>ref|XP_004492922.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Cicer arietinum]
Length=1093

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  160  AVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            ++  I L N+ + G L+SL F SFPNL   +++ N F G++P  I NLS++
Sbjct  93   SISSINLANYGIKGKLQSLTFSSFPNLITINIYQNHFYGTIPPQIGNLSKI  143



>gb|KDP33358.1| hypothetical protein JCGZ_12907 [Jatropha curcas]
Length=1021

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G++ +I + + +L GTL +L+F  F +L    LHNNS  G++P  I+NLS+L
Sbjct  82   GSISRIDVSSSNLRGTLYNLEFSCFSSLLELDLHNNSLYGTIPSQISNLSKL  133



>gb|KDO39482.1| hypothetical protein CISIN_1g041034mg, partial [Citrus sinensis]
Length=701

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            G++  I+L   S+ G L SL+F  FPNL   +L NN+ +GS+P  I +LS L +
Sbjct  37   GSITHIELVECSIKGELGSLNFSCFPNLQYLNLWNNNLSGSIPPQIGSLSNLKY  90



>ref|XP_010105916.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
 gb|EXC06735.1| putative leucine-rich repeat receptor-like protein kinase [Morus 
notabilis]
Length=188

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G+V KI L +  L GTL    F SFP L    L  NS  G++P  I +LS+L++
Sbjct  13   NHFGSVTKINLTSSGLKGTLHEFKFSSFPYLAYLDLSMNSLFGTIPPKIGHLSKLMY  69



>gb|KDO55848.1| hypothetical protein CISIN_1g0414382mg, partial [Citrus sinensis]
Length=249

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
            N+ G V+ I L + SL+GTL    F SFP+L    L+NN     +P  I+NLS+L +
Sbjct  81   NHAGRVFGINLTSISLNGTLLEFSFSSFPHLAYLDLYNNELFDIIPPQISNLSKLEY  137



>ref|XP_008801288.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Phoenix dactylifera]
Length=803

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLV  5
            N+ G++ ++ L N +L+GTL   DF S P+LT+  L+ N   GS+P  I+ LS L 
Sbjct  66   NSAGSIVQLSLPNANLNGTLDEFDFASLPSLTKLDLNANLLNGSIPSNISALSNLA  121



>ref|XP_007133482.1| hypothetical protein PHAVU_011G182300g [Phaseolus vulgaris]
 gb|ESW05476.1| hypothetical protein PHAVU_011G182300g [Phaseolus vulgaris]
Length=1057

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  163  GAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            G+V  I L +  LSGTL++L+F + PN+    + +NS +GS+P  I  LS+L
Sbjct  81   GSVSNINLTDIGLSGTLQTLNFSTLPNILTLDMSHNSLSGSIPPQIGVLSKL  132



>ref|XP_009390803.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=973

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -1

Query  166  VGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQLVF  2
             G++ +++L +  L+GTL  L F + PNLT   L+ NS  G VP AI+  S+L+F
Sbjct  65   AGSLVQLRLPSSGLNGTLLDLVFSALPNLTHLDLYGNSLHGRVPPAISAASKLIF  119



>gb|KDP34786.1| hypothetical protein JCGZ_10566 [Jatropha curcas]
Length=911

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 29/55 (53%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            N  G+V  I + N  L GTL  L   SFP L    LHNNS  GS+P  +  ++ L
Sbjct  77   NKAGSVVNISIANSGLKGTLYGLSLLSFPKLIHLDLHNNSVYGSIPPEVGKMTSL  131



>ref|XP_010050532.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
Length=176

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = -1

Query  172  NNVGAVYKIKLDNFSLSGTLKSLDFRSFPNLTRFSLHNNSFTGSVPYAIANLSQL  8
            +N GAV  + L    L GTL SLDF    ++    L NNS  G++P ++ N+S+L
Sbjct  93   DNYGAVTHLNLSYLGLRGTLDSLDFSRLTSVVSLELGNNSIYGAIPSSVGNISKL  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513120851568