BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34372_g1_i1 len=1520 path=[1498:0-1519]

Length=1520
                                                                      Score     E

emb|CDP04352.1|  unnamed protein product                                523   4e-175   
ref|XP_011077010.1|  PREDICTED: U-box domain-containing protein 5...    523   2e-174   
ref|XP_010545486.1|  PREDICTED: U-box domain-containing protein 3...    448   3e-145   
ref|XP_009145663.1|  PREDICTED: U-box domain-containing protein 35      445   5e-144   
emb|CDY29801.1|  BnaC05g31890D                                          444   7e-144   
emb|CDY25396.1|  BnaA05g18880D                                          442   1e-142   
ref|XP_006406411.1|  hypothetical protein EUTSA_v10020098mg             441   2e-142   
ref|XP_006297019.1|  hypothetical protein CARUB_v10013010mg             440   5e-142   
gb|KFK39345.1|  hypothetical protein AALP_AA3G232100                    438   5e-141   
ref|XP_002883235.1|  kinase family protein                              437   6e-141   
ref|NP_188655.2|  Protein kinase protein with adenine nucleotide ...    436   7e-141   Arabidopsis thaliana [mouse-ear cress]
gb|EYU39810.1|  hypothetical protein MIMGU_mgv1a024838mg                434   1e-140   
dbj|BAB01879.1|  Ser/Thr protein kinaseroteinase)                       435   6e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508613.1|  PREDICTED: U-box domain-containing protein 3...    431   2e-138   
ref|XP_010508621.1|  PREDICTED: U-box domain-containing protein 3...    431   2e-138   
ref|XP_010696198.1|  PREDICTED: U-box domain-containing protein 35      432   4e-138   
ref|XP_010487989.1|  PREDICTED: U-box domain-containing protein 3...    425   2e-136   
ref|XP_010927278.1|  PREDICTED: U-box domain-containing protein 5...    421   4e-135   
ref|XP_008798198.1|  PREDICTED: U-box domain-containing protein 52      412   1e-131   
gb|KHN30795.1|  U-box domain-containing protein 35                      402   5e-128   
ref|XP_010468319.1|  PREDICTED: U-box domain-containing protein 3...    405   1e-124   
ref|XP_009418576.1|  PREDICTED: U-box domain-containing protein 3...    388   1e-122   
ref|XP_006453185.1|  hypothetical protein CICLE_v10010281mg             385   2e-121   
ref|XP_009400106.1|  PREDICTED: U-box domain-containing protein 5...    394   2e-119   
ref|XP_007137133.1|  hypothetical protein PHAVU_009G102500g             380   4e-119   
ref|XP_010669507.1|  PREDICTED: U-box domain-containing protein 52      379   9e-119   
gb|KDO62030.1|  hypothetical protein CISIN_1g035604mg                   378   2e-118   
ref|XP_007137134.1|  hypothetical protein PHAVU_009G102500g             377   5e-118   
gb|EPS61860.1|  hypothetical protein M569_12933                         367   2e-116   
ref|XP_006474648.1|  PREDICTED: U-box domain-containing protein 3...    374   2e-113   
ref|XP_002520858.1|  ATP binding protein, putative                      363   1e-112   Ricinus communis
gb|KHN32924.1|  U-box domain-containing protein 34                      360   4e-112   
ref|XP_006572917.1|  PREDICTED: U-box domain-containing protein 5...    353   8e-109   
gb|AET05083.2|  adenine nucleotide alpha hydrolase-like domain ki...    349   2e-107   
ref|XP_003630605.1|  U-box domain-containing protein                    349   4e-107   
ref|XP_009354312.1|  PREDICTED: U-box domain-containing protein 3...    345   4e-106   
emb|CDY60522.1|  BnaAnng16890D                                          344   1e-105   
ref|XP_006412615.1|  hypothetical protein EUTSA_v10026931mg             351   5e-105   
ref|XP_003630607.1|  U-box domain-containing protein                    339   3e-103   
ref|NP_001046304.1|  Os02g0218400                                       329   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|NP_198388.1|  protein kinase protein with adenine nucleotide ...    328   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004951440.1|  PREDICTED: U-box domain-containing protein 5...    327   2e-99    
ref|XP_008786959.1|  PREDICTED: U-box domain-containing protein 3...    326   5e-99    
emb|CDX93094.1|  BnaA03g38160D                                          324   6e-99    
ref|XP_009136185.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    320   6e-97    
emb|CDY48312.1|  BnaC05g13660D                                          320   7e-97    
emb|CDY26235.1|  BnaA06g11820D                                          321   1e-96    
ref|XP_006306901.1|  hypothetical protein CARUB_v10008461mg             318   3e-96    
emb|CDX96762.1|  BnaA08g23050D                                          315   6e-95    
emb|CDY50937.1|  BnaC03g74370D                                          310   2e-93    
gb|AAF79480.1|AC022492_24  F1L3.25                                      311   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110401.1|  PREDICTED: U-box domain-containing protein 3...    306   5e-92    
ref|XP_006340592.1|  PREDICTED: U-box domain-containing protein 5...    306   5e-91    
ref|XP_009793818.1|  PREDICTED: U-box domain-containing protein 5...    300   1e-88    
ref|XP_009793816.1|  PREDICTED: U-box domain-containing protein 5...    300   1e-88    
ref|XP_009793817.1|  PREDICTED: U-box domain-containing protein 5...    300   2e-88    
ref|XP_009793815.1|  PREDICTED: U-box domain-containing protein 5...    300   2e-88    
ref|XP_009610864.1|  PREDICTED: U-box domain-containing protein 5...    299   4e-88    
ref|XP_009610856.1|  PREDICTED: U-box domain-containing protein 5...    299   4e-88    
ref|XP_009610849.1|  PREDICTED: U-box domain-containing protein 5...    299   5e-88    
ref|XP_007152997.1|  hypothetical protein PHAVU_004G177800g             296   3e-87    
ref|XP_010319966.1|  PREDICTED: U-box domain-containing protein 5...    296   4e-87    
dbj|BAB11488.1|  receptor-like protein kinase                           290   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019963.1|  PREDICTED: U-box domain-containing protein 3...    289   2e-85    
gb|EYU39578.1|  hypothetical protein MIMGU_mgv1a004000mg                279   5e-83    
ref|XP_006390621.1|  hypothetical protein EUTSA_v10019640mg             280   2e-82    
ref|XP_002518240.1|  ATP binding protein, putative                      283   3e-82    Ricinus communis
gb|EYU25756.1|  hypothetical protein MIMGU_mgv1a001768mg                281   8e-82    
emb|CAN69465.1|  hypothetical protein VITISV_023046                     281   9e-82    Vitis vinifera
gb|EPS65707.1|  hypothetical protein M569_09070                         280   1e-81    
ref|XP_010252203.1|  PREDICTED: U-box domain-containing protein 3...    280   3e-81    
ref|XP_010252202.1|  PREDICTED: U-box domain-containing protein 3...    280   3e-81    
ref|XP_010648456.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    280   3e-81    
ref|XP_008361051.1|  PREDICTED: U-box domain-containing protein 3...    279   8e-81    
ref|XP_008219968.1|  PREDICTED: U-box domain-containing protein 52      278   1e-80    
ref|XP_009385916.1|  PREDICTED: U-box domain-containing protein 5...    277   2e-80    
ref|XP_011094049.1|  PREDICTED: U-box domain-containing protein 3...    278   2e-80    
gb|KDP33410.1|  hypothetical protein JCGZ_06981                         278   2e-80    
ref|XP_010913853.1|  PREDICTED: U-box domain-containing protein 3...    277   3e-80    
emb|CBI24063.3|  unnamed protein product                                273   4e-80    
ref|XP_008781718.1|  PREDICTED: U-box domain-containing protein 3...    276   5e-80    
ref|XP_008466286.1|  PREDICTED: U-box domain-containing protein 5...    275   5e-80    
ref|XP_011006665.1|  PREDICTED: U-box domain-containing protein 3...    275   6e-80    
ref|XP_011006664.1|  PREDICTED: U-box domain-containing protein 3...    275   6e-80    
ref|XP_010429418.1|  PREDICTED: U-box domain-containing protein 3...    265   7e-80    
ref|XP_011006666.1|  PREDICTED: U-box domain-containing protein 3...    275   8e-80    
ref|XP_004305796.1|  PREDICTED: U-box domain-containing protein 3...    276   8e-80    
ref|XP_007225224.1|  hypothetical protein PRUPE_ppa001920mg             275   9e-80    
ref|XP_006450025.1|  hypothetical protein CICLE_v10013950mg             275   1e-79    
ref|XP_008781717.1|  PREDICTED: U-box domain-containing protein 3...    275   1e-79    
ref|XP_009396581.1|  PREDICTED: U-box domain-containing protein 3...    275   1e-79    
ref|XP_006371832.1|  hypothetical protein POPTR_0018s04050g             274   2e-79    
ref|XP_008466285.1|  PREDICTED: U-box domain-containing protein 5...    275   2e-79    
ref|XP_009779108.1|  PREDICTED: U-box domain-containing protein 3...    275   2e-79    
ref|XP_011002967.1|  PREDICTED: U-box domain-containing protein 3...    274   3e-79    
ref|XP_003603561.1|  U-box domain-containing protein                    276   3e-79    
gb|AES73812.2|  adenine nucleotide alpha hydrolase-like domain ki...    275   3e-79    
gb|KDO48984.1|  hypothetical protein CISIN_1g040785mg                   275   3e-79    
ref|XP_010263442.1|  PREDICTED: U-box domain-containing protein 3...    275   4e-79    
ref|NP_178015.2|  adenine nucleotide alpha hydrolases-domain cont...    272   4e-79    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42581.1|  unknown protein                                        272   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006483740.1|  PREDICTED: U-box domain-containing protein 5...    275   5e-79    
ref|XP_006303100.1|  hypothetical protein CARUB_v100212851mg            271   6e-79    
ref|XP_006582487.1|  PREDICTED: U-box domain-containing protein 5...    274   6e-79    
ref|XP_010527112.1|  PREDICTED: U-box domain-containing protein 5...    274   6e-79    
emb|CDY40035.1|  BnaC05g12800D                                          273   6e-79    
emb|CDP12490.1|  unnamed protein product                                274   6e-79    
ref|XP_009149113.1|  PREDICTED: U-box domain-containing protein 3...    273   7e-79    
ref|XP_010656706.1|  PREDICTED: U-box domain-containing protein 5...    275   7e-79    
ref|XP_006296408.1|  hypothetical protein CARUB_v10025585mg             274   7e-79    
gb|KHN18232.1|  U-box domain-containing protein 52                      274   7e-79    
ref|XP_008782816.1|  PREDICTED: U-box domain-containing protein 3...    273   7e-79    
ref|XP_010656705.1|  PREDICTED: U-box domain-containing protein 5...    274   7e-79    
ref|XP_010656707.1|  PREDICTED: U-box domain-containing protein 5...    274   8e-79    
ref|XP_009618440.1|  PREDICTED: U-box domain-containing protein 35      274   8e-79    
ref|XP_006416783.1|  hypothetical protein EUTSA_v10009494mg             272   1e-78    
ref|XP_010419304.1|  PREDICTED: U-box domain-containing protein 5...    267   1e-78    
ref|XP_007217395.1|  hypothetical protein PRUPE_ppa025268mg             273   1e-78    
gb|EYU22082.1|  hypothetical protein MIMGU_mgv1a001807mg                273   1e-78    
ref|XP_009616384.1|  PREDICTED: U-box domain-containing protein 5...    273   1e-78    
gb|EPS69919.1|  hypothetical protein M569_04840                         271   1e-78    
ref|XP_009118123.1|  PREDICTED: U-box domain-containing protein 5...    272   1e-78    
ref|XP_004501223.1|  PREDICTED: U-box domain-containing protein 3...    273   2e-78    
ref|XP_009801055.1|  PREDICTED: U-box domain-containing protein 5...    273   2e-78    
emb|CDY50990.1|  BnaA09g56190D                                          272   2e-78    
ref|NP_001185432.1|  adenine nucleotide alpha hydrolases-domain c...    272   2e-78    
ref|XP_006404968.1|  hypothetical protein EUTSA_v10000051mg             273   2e-78    
ref|XP_010106940.1|  U-box domain-containing protein 35                 272   2e-78    
ref|XP_011082098.1|  PREDICTED: U-box domain-containing protein 3...    269   2e-78    
ref|XP_009616383.1|  PREDICTED: U-box domain-containing protein 5...    273   2e-78    
gb|AAC17071.1|  Similar to protein serine/threonine kinase NPK15 ...    272   2e-78    Arabidopsis thaliana [mouse-ear cress]
gb|KCW80744.1|  hypothetical protein EUGRSUZ_C02137                     271   2e-78    
ref|XP_007014562.1|  Kinase protein with adenine nucleotide alpha...    267   3e-78    
emb|CDY70022.1|  BnaCnng66370D                                          262   3e-78    
ref|XP_002890187.1|  kinase family protein                              271   3e-78    
ref|XP_009801054.1|  PREDICTED: U-box domain-containing protein 5...    272   3e-78    
ref|XP_009106610.1|  PREDICTED: U-box domain-containing protein 35      271   3e-78    
gb|KFK42273.1|  hypothetical protein AALP_AA2G234500                    271   3e-78    
ref|XP_009398619.1|  PREDICTED: U-box domain-containing protein 5...    271   3e-78    
ref|XP_006468244.1|  PREDICTED: U-box domain-containing protein 3...    271   4e-78    
ref|XP_006389938.1|  hypothetical protein EUTSA_v10018168mg             271   4e-78    
emb|CDX81778.1|  BnaC08g38230D                                          271   4e-78    
ref|XP_009398618.1|  PREDICTED: U-box domain-containing protein 5...    271   4e-78    
ref|XP_006382208.1|  hypothetical protein POPTR_0006s29380g             271   4e-78    
gb|AFX60112.1|  phytophthora resistance protein RpsWD15-2               267   4e-78    
ref|XP_010928974.1|  PREDICTED: U-box domain-containing protein 3...    271   4e-78    
ref|XP_010429760.1|  PREDICTED: U-box domain-containing protein 5...    271   4e-78    
gb|KGN60182.1|  hypothetical protein Csa_3G882930                       271   5e-78    
ref|XP_009417309.1|  PREDICTED: U-box domain-containing protein 5...    270   5e-78    
ref|XP_010459224.1|  PREDICTED: U-box domain-containing protein 3...    271   5e-78    
ref|XP_006579059.1|  PREDICTED: U-box domain-containing protein 5...    271   5e-78    
ref|XP_002880578.1|  kinase                                             271   6e-78    
ref|XP_010476794.1|  PREDICTED: U-box domain-containing protein 3...    271   6e-78    
ref|XP_010417508.1|  PREDICTED: U-box domain-containing protein 5...    270   6e-78    
ref|XP_010498006.1|  PREDICTED: U-box domain-containing protein 3...    271   6e-78    
ref|XP_002309024.1|  kinase family protein                              269   7e-78    Populus trichocarpa [western balsam poplar]
ref|XP_010112125.1|  U-box domain-containing protein 35                 271   7e-78    
ref|NP_173120.1|  protein kinase protein with adenine nucleotide ...    270   7e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304388.1|  hypothetical protein CARUB_v10010903mg             270   7e-78    
ref|XP_009590276.1|  PREDICTED: U-box domain-containing protein 5...    269   7e-78    
gb|KFK32639.1|  hypothetical protein AALP_AA6G269400                    271   9e-78    
ref|XP_002889221.1|  predicted protein                                  270   9e-78    
ref|XP_010417189.1|  PREDICTED: U-box domain-containing protein 5...    271   9e-78    
ref|XP_010537753.1|  PREDICTED: U-box domain-containing protein 3...    270   1e-77    
ref|XP_008228017.1|  PREDICTED: U-box domain-containing protein 3...    271   1e-77    
ref|NP_180014.2|  adenine nucleotide alpha hydrolase domain-conta...    270   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010050906.1|  PREDICTED: U-box domain-containing protein 52      271   1e-77    
ref|XP_007011461.1|  Kinase protein with adenine nucleotide alpha...    270   1e-77    
ref|XP_011082097.1|  PREDICTED: U-box domain-containing protein 3...    269   1e-77    
gb|AAG09082.1|AC026237_3  Similar to protein kinases                    270   1e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAD18110.1|  putative protein kinase                                 270   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AID16034.1|  putative universal stress protein                       269   2e-77    
ref|XP_010542113.1|  PREDICTED: U-box domain-containing protein 52      271   2e-77    
ref|XP_007161331.1|  hypothetical protein PHAVU_001G060600g             270   2e-77    
ref|XP_010472730.1|  PREDICTED: U-box domain-containing protein 5...    269   2e-77    
ref|XP_009762627.1|  PREDICTED: U-box domain-containing protein 3...    261   2e-77    
ref|XP_010548526.1|  PREDICTED: U-box domain-containing protein 3...    269   3e-77    
ref|XP_010325202.1|  PREDICTED: U-box domain-containing protein 5...    267   3e-77    
ref|XP_010548525.1|  PREDICTED: U-box domain-containing protein 3...    269   3e-77    
ref|XP_008357473.1|  PREDICTED: U-box domain-containing protein 3...    269   3e-77    
ref|XP_010548527.1|  PREDICTED: U-box domain-containing protein 3...    269   3e-77    
ref|XP_011082095.1|  PREDICTED: U-box domain-containing protein 3...    269   3e-77    
ref|XP_009590275.1|  PREDICTED: U-box domain-containing protein 5...    269   3e-77    
ref|XP_008378145.1|  PREDICTED: U-box domain-containing protein 35      269   3e-77    
ref|XP_009590270.1|  PREDICTED: U-box domain-containing protein 5...    269   3e-77    
gb|KHN16699.1|  U-box domain-containing protein 35                      269   4e-77    
ref|XP_006450083.1|  hypothetical protein CICLE_v10010213mg             273   4e-77    
ref|XP_006584790.1|  PREDICTED: U-box domain-containing protein 3...    269   4e-77    
ref|XP_009353332.1|  PREDICTED: U-box domain-containing protein 3...    268   5e-77    
ref|XP_010261770.1|  PREDICTED: U-box domain-containing protein 3...    269   6e-77    
gb|KHM99859.1|  U-box domain-containing protein 35                      268   7e-77    
ref|XP_009334996.1|  PREDICTED: U-box domain-containing protein 52      268   7e-77    
ref|XP_006601602.1|  PREDICTED: U-box domain-containing protein 5...    268   7e-77    
ref|XP_010472443.1|  PREDICTED: U-box domain-containing protein 5...    268   8e-77    
ref|XP_009396685.1|  PREDICTED: U-box domain-containing protein 5...    268   8e-77    
ref|XP_003588643.1|  Protein kinase catalytic domain-containing p...    261   9e-77    
ref|XP_006843202.1|  hypothetical protein AMTR_s00146p00101680          267   9e-77    
ref|XP_006580498.1|  PREDICTED: U-box domain-containing protein 3...    268   9e-77    
ref|XP_007014561.1|  Kinase protein with adenine nucleotide alpha...    268   9e-77    
ref|XP_008358252.1|  PREDICTED: U-box domain-containing protein 3...    265   1e-76    
gb|KHN24375.1|  U-box domain-containing protein 35                      268   1e-76    
ref|XP_004245436.1|  PREDICTED: U-box domain-containing protein 5...    267   1e-76    
ref|XP_006850971.1|  hypothetical protein AMTR_s00025p00206220          268   1e-76    
ref|XP_006360651.1|  PREDICTED: U-box domain-containing protein 3...    268   1e-76    
ref|XP_009353318.1|  PREDICTED: U-box domain-containing protein 3...    267   2e-76    
ref|XP_009128323.1|  PREDICTED: U-box domain-containing protein 5...    267   2e-76    
ref|XP_006580497.1|  PREDICTED: U-box domain-containing protein 3...    267   3e-76    
ref|XP_004172287.1|  PREDICTED: U-box domain-containing protein 5...    266   3e-76    
ref|XP_008448004.1|  PREDICTED: U-box domain-containing protein 3...    266   3e-76    
ref|XP_009128322.1|  PREDICTED: U-box domain-containing protein 5...    266   3e-76    
emb|CDX96806.1|  BnaA08g23490D                                          266   4e-76    
ref|XP_009110442.1|  PREDICTED: U-box domain-containing protein 3...    266   4e-76    
gb|KGN43210.1|  hypothetical protein Csa_7G009060                       266   4e-76    
ref|XP_006355246.1|  PREDICTED: U-box domain-containing protein 3...    266   4e-76    
emb|CDY55241.1|  BnaC02g44910D                                          265   5e-76    
ref|XP_002310353.2|  hypothetical protein POPTR_0007s15230g             265   5e-76    Populus trichocarpa [western balsam poplar]
ref|XP_002533177.1|  kinase, putative                                   261   5e-76    Ricinus communis
ref|XP_010247378.1|  PREDICTED: U-box domain-containing protein 3...    261   6e-76    
ref|XP_009417522.1|  PREDICTED: U-box domain-containing protein 52      263   7e-76    
ref|XP_009140543.1|  PREDICTED: U-box domain-containing protein 52      265   7e-76    
ref|XP_008381640.1|  PREDICTED: U-box domain-containing protein 5...    266   1e-75    
emb|CDX87421.1|  BnaA07g34520D                                          270   1e-75    
gb|EPS61916.1|  hypothetical protein M569_12876                         265   1e-75    
ref|XP_010321639.1|  PREDICTED: U-box domain-containing protein 3...    266   1e-75    
emb|CDX88492.1|  BnaC06g39360D                                          270   1e-75    
ref|XP_009117133.1|  PREDICTED: U-box domain-containing protein 5...    265   1e-75    
emb|CDY34775.1|  BnaA09g41420D                                          265   1e-75    
ref|XP_002870429.1|  kinase family protein                              264   2e-75    
ref|XP_010925037.1|  PREDICTED: U-box domain-containing protein 52      264   2e-75    
ref|XP_009380166.1|  PREDICTED: U-box domain-containing protein 5...    263   2e-75    
emb|CBI18425.3|  unnamed protein product                                263   2e-75    
ref|XP_010655258.1|  PREDICTED: U-box domain-containing protein 3...    264   3e-75    
emb|CDY20308.1|  BnaC04g36480D                                          264   3e-75    
ref|XP_011031475.1|  PREDICTED: U-box domain-containing protein 35      264   3e-75    
ref|XP_004144908.1|  PREDICTED: U-box domain-containing protein 3...    265   4e-75    
emb|CDY46145.1|  BnaA04g14330D                                          263   4e-75    
gb|KEH27279.1|  adenine nucleotide alpha hydrolase-like domain ki...    264   4e-75    
ref|XP_002513301.1|  ATP binding protein, putative                      263   5e-75    Ricinus communis
ref|XP_008380441.1|  PREDICTED: U-box domain-containing protein 3...    263   5e-75    
ref|XP_007216419.1|  hypothetical protein PRUPE_ppa022892mg             263   6e-75    
ref|XP_008445579.1|  PREDICTED: U-box domain-containing protein 51      264   6e-75    
ref|XP_006374811.1|  hypothetical protein POPTR_0014s01190g             261   6e-75    
ref|XP_004305624.1|  PREDICTED: U-box domain-containing protein 5...    262   7e-75    
gb|KGN62856.1|  hypothetical protein Csa_2G377920                       263   7e-75    
ref|XP_010262238.1|  PREDICTED: U-box domain-containing protein 52      260   1e-74    
gb|KCW70920.1|  hypothetical protein EUGRSUZ_F04036                     260   1e-74    
gb|KDP25035.1|  hypothetical protein JCGZ_22570                         265   1e-74    
ref|XP_010065061.1|  PREDICTED: U-box domain-containing protein 5...    261   2e-74    
ref|XP_006286064.1|  hypothetical protein CARUB_v10007597mg             260   2e-74    
gb|AES58877.2|  adenine nucleotide alpha hydrolase-like domain ki...    261   2e-74    
ref|XP_008374014.1|  PREDICTED: U-box domain-containing protein 3...    261   2e-74    
ref|XP_003588626.1|  U-box domain-containing protein                    261   2e-74    
gb|ACN25241.1|  unknown                                                 251   3e-74    Zea mays [maize]
ref|NP_001048340.1|  Os02g0787200                                       261   3e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007023631.1|  Kinase protein with adenine nucleotide alpha...    261   3e-74    
ref|XP_010545488.1|  PREDICTED: U-box domain-containing protein 3...    261   3e-74    
ref|XP_007023630.1|  Kinase protein with adenine nucleotide alpha...    261   3e-74    
tpg|DAA58697.1|  TPA: putative protein kinase superfamily protein       253   3e-74    
gb|EEC74143.1|  hypothetical protein OsI_09217                          261   3e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_006403083.1|  hypothetical protein EUTSA_v10003492mg             260   3e-74    
emb|CDP18079.1|  unnamed protein product                                261   4e-74    
gb|KHN31852.1|  U-box domain-containing protein 35                      260   4e-74    
ref|XP_010112459.1|  U-box domain-containing protein 35                 261   5e-74    
ref|XP_010669606.1|  PREDICTED: U-box domain-containing protein 3...    261   6e-74    
ref|XP_010669604.1|  PREDICTED: U-box domain-containing protein 3...    261   6e-74    
ref|XP_002867309.1|  kinase family protein                              260   6e-74    
ref|XP_002533173.1|  kinase, putative                                   259   6e-74    Ricinus communis
ref|XP_006595204.1|  PREDICTED: U-box domain-containing protein 3...    260   6e-74    
ref|XP_011081656.1|  PREDICTED: U-box domain-containing protein 51      258   6e-74    
gb|AFW64200.1|  putative protein kinase superfamily protein             255   1e-73    
ref|XP_008228827.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    259   1e-73    
ref|XP_004305494.1|  PREDICTED: U-box domain-containing protein 5...    258   1e-73    
ref|XP_009379211.1|  PREDICTED: U-box domain-containing protein 52      260   1e-73    
ref|XP_008372808.1|  PREDICTED: U-box domain-containing protein 5...    259   1e-73    
ref|XP_004513116.1|  PREDICTED: U-box domain-containing protein 5...    260   1e-73    
ref|XP_004513115.1|  PREDICTED: U-box domain-containing protein 5...    260   1e-73    
ref|XP_006843910.1|  hypothetical protein AMTR_s00007p00268730          259   1e-73    
ref|XP_009375498.1|  PREDICTED: U-box domain-containing protein 5...    259   1e-73    
ref|XP_003564167.1|  PREDICTED: U-box domain-containing protein 5...    259   1e-73    
ref|XP_006597079.1|  PREDICTED: U-box domain-containing protein 3...    259   1e-73    
gb|KDP34071.1|  hypothetical protein JCGZ_07642                         257   2e-73    
ref|XP_010655259.1|  PREDICTED: U-box domain-containing protein 3...    258   3e-73    
ref|XP_008808214.1|  PREDICTED: U-box domain-containing protein 52      258   3e-73    
emb|CDX83940.1|  BnaC08g17050D                                          264   3e-73    
ref|XP_008228731.1|  PREDICTED: U-box domain-containing protein 3...    258   3e-73    
ref|XP_010447602.1|  PREDICTED: U-box domain-containing protein 3...    258   4e-73    
ref|XP_010447603.1|  PREDICTED: U-box domain-containing protein 3...    258   4e-73    
dbj|BAK03771.1|  predicted protein                                      257   4e-73    
ref|XP_006374752.1|  kinase family protein                              257   5e-73    
ref|XP_010234042.1|  PREDICTED: U-box domain-containing protein 3...    256   5e-73    
gb|KHN40317.1|  U-box domain-containing protein 34                      258   5e-73    
ref|XP_003571113.1|  PREDICTED: U-box domain-containing protein 3...    257   5e-73    
emb|CCM07282.1|  putative Serine threonine kinase 1-l                   257   5e-73    
ref|XP_009388676.1|  PREDICTED: U-box domain-containing protein 5...    257   5e-73    
ref|XP_010438067.1|  PREDICTED: U-box domain-containing protein 3...    257   6e-73    
ref|XP_010438068.1|  PREDICTED: U-box domain-containing protein 3...    257   7e-73    
ref|XP_010432888.1|  PREDICTED: U-box domain-containing protein 3...    257   7e-73    
ref|XP_010432890.1|  PREDICTED: U-box domain-containing protein 3...    257   7e-73    
ref|XP_010438066.1|  PREDICTED: U-box domain-containing protein 3...    257   7e-73    
ref|XP_002453538.1|  hypothetical protein SORBIDRAFT_04g007620          256   9e-73    
ref|XP_006399719.1|  hypothetical protein EUTSA_v10012830mg             255   9e-73    
gb|KDO73524.1|  hypothetical protein CISIN_1g008365mg                   252   9e-73    
gb|EMS62362.1|  U-box domain-containing protein 52                      255   1e-72    
ref|XP_008368671.1|  PREDICTED: U-box domain-containing protein 3...    256   1e-72    
ref|XP_008679842.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    256   1e-72    
ref|XP_007160217.1|  hypothetical protein PHAVU_002G302700g             256   1e-72    
ref|XP_007150846.1|  hypothetical protein PHAVU_005G185700g             257   1e-72    
ref|XP_007150845.1|  hypothetical protein PHAVU_005G185700g             257   1e-72    
ref|XP_009412924.1|  PREDICTED: U-box domain-containing protein 3...    256   1e-72    
ref|XP_008347301.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    245   2e-72    
ref|XP_003572885.1|  PREDICTED: U-box domain-containing protein 3...    256   2e-72    
gb|KCW79251.1|  hypothetical protein EUGRSUZ_C00670                     253   2e-72    
gb|KHN45477.1|  U-box domain-containing protein 34                      249   2e-72    
ref|XP_004964592.1|  PREDICTED: U-box domain-containing protein 3...    256   2e-72    
gb|KDP21660.1|  hypothetical protein JCGZ_03331                         256   2e-72    
gb|EAY99981.1|  hypothetical protein OsI_21985                          255   2e-72    
gb|AFW64201.1|  putative protein kinase superfamily protein             255   3e-72    
ref|XP_010094961.1|  U-box domain-containing protein 35                 254   4e-72    
gb|EAY74665.1|  hypothetical protein OsI_02560                          253   4e-72    
gb|KEH39701.1|  adenine nucleotide alpha hydrolase-like domain ki...    253   5e-72    
gb|KHN22379.1|  U-box domain-containing protein 35                      256   5e-72    
ref|XP_009121892.1|  PREDICTED: U-box domain-containing protein 5...    252   5e-72    
ref|XP_006647075.1|  PREDICTED: U-box domain-containing protein 5...    254   6e-72    
ref|XP_004305476.1|  PREDICTED: U-box domain-containing protein 3...    254   6e-72    
dbj|BAK07305.1|  predicted protein                                      250   7e-72    
ref|XP_007214779.1|  hypothetical protein PRUPE_ppa023720mg             253   8e-72    
ref|XP_007216833.1|  hypothetical protein PRUPE_ppa022664mg             254   8e-72    
emb|CBI20673.3|  unnamed protein product                                252   8e-72    
ref|XP_010419785.1|  PREDICTED: U-box domain-containing protein 5...    252   9e-72    
gb|ACR38284.1|  unknown                                                 248   9e-72    
ref|XP_010453264.1|  PREDICTED: U-box domain-containing protein 5...    252   9e-72    
ref|XP_006285266.1|  hypothetical protein CARUB_v10006638mg             257   1e-71    
ref|XP_010648364.1|  PREDICTED: U-box domain-containing protein 5...    252   1e-71    
ref|XP_006289405.1|  hypothetical protein CARUB_v10002905mg             253   1e-71    
ref|XP_010491957.1|  PREDICTED: U-box domain-containing protein 5...    251   1e-71    
ref|XP_009121891.1|  PREDICTED: U-box domain-containing protein 5...    252   1e-71    
emb|CDX97160.1|  BnaC09g44650D                                          252   1e-71    
gb|ACN33899.1|  unknown                                                 252   1e-71    
ref|XP_006342501.1|  PREDICTED: U-box domain-containing protein 3...    251   2e-71    
ref|NP_001136486.1|  uncharacterized protein LOC100216601               251   2e-71    
ref|NP_001140500.1|  uncharacterized LOC100272561                       253   2e-71    
ref|XP_008672352.1|  PREDICTED: uncharacterized LOC100272561 isof...    253   2e-71    
ref|XP_007226770.1|  hypothetical protein PRUPE_ppa018572mg             253   2e-71    
ref|XP_011070514.1|  PREDICTED: U-box domain-containing protein 5...    252   2e-71    
ref|XP_006342500.1|  PREDICTED: U-box domain-containing protein 3...    251   2e-71    
ref|XP_010937301.1|  PREDICTED: U-box domain-containing protein 3...    243   2e-71    
ref|XP_006342499.1|  PREDICTED: U-box domain-containing protein 3...    251   2e-71    
emb|CDY13420.1|  BnaA03g51380D                                          253   2e-71    
ref|XP_008391475.1|  PREDICTED: U-box domain-containing protein 3...    253   2e-71    
ref|XP_010419784.1|  PREDICTED: U-box domain-containing protein 5...    252   2e-71    
ref|XP_009137999.1|  PREDICTED: U-box domain-containing protein 35      253   2e-71    
ref|XP_010453263.1|  PREDICTED: U-box domain-containing protein 5...    251   3e-71    
gb|KEH39700.1|  adenine nucleotide alpha hydrolase-like domain ki...    253   3e-71    
ref|XP_010491956.1|  PREDICTED: U-box domain-containing protein 5...    251   3e-71    
ref|XP_002324143.2|  kinase family protein                              251   3e-71    
ref|XP_010648363.1|  PREDICTED: U-box domain-containing protein 5...    252   3e-71    
ref|XP_006466153.1|  PREDICTED: U-box domain-containing protein 5...    252   3e-71    
ref|XP_010314823.1|  PREDICTED: U-box domain-containing protein 3...    250   3e-71    
ref|XP_004954165.1|  PREDICTED: U-box domain-containing protein 3...    253   3e-71    
ref|XP_008228685.1|  PREDICTED: U-box domain-containing protein 5...    253   4e-71    
ref|XP_008220512.1|  PREDICTED: U-box domain-containing protein 3...    252   4e-71    
ref|XP_006453060.1|  hypothetical protein CICLE_v10010543mg             251   4e-71    
ref|XP_008220511.1|  PREDICTED: U-box domain-containing protein 5...    252   4e-71    
gb|KGN61212.1|  hypothetical protein Csa_2G070290                       248   4e-71    
ref|XP_002437997.1|  hypothetical protein SORBIDRAFT_10g006130          253   5e-71    
ref|XP_008654459.1|  PREDICTED: uncharacterized protein LOC100216...    252   5e-71    
ref|XP_008654458.1|  PREDICTED: uncharacterized protein LOC100216...    252   5e-71    
ref|XP_008654457.1|  PREDICTED: uncharacterized protein LOC100216...    252   5e-71    
dbj|BAK06108.1|  predicted protein                                      253   5e-71    
ref|XP_010050404.1|  PREDICTED: U-box domain-containing protein 5...    253   6e-71    
ref|XP_008654456.1|  PREDICTED: uncharacterized protein LOC100216...    252   6e-71    
ref|XP_007226500.1|  hypothetical protein PRUPE_ppa026359mg             251   6e-71    
ref|XP_004253092.1|  PREDICTED: U-box domain-containing protein 3...    250   7e-71    
ref|XP_002873544.1|  kinase                                             250   8e-71    
ref|XP_010655256.1|  PREDICTED: U-box domain-containing protein 3...    252   8e-71    
ref|XP_006474435.1|  PREDICTED: U-box domain-containing protein 5...    251   8e-71    
emb|CDY67812.1|  BnaAnng25230D                                          248   9e-71    
ref|XP_010915203.1|  PREDICTED: U-box domain-containing protein 5...    251   9e-71    
ref|XP_006474436.1|  PREDICTED: U-box domain-containing protein 5...    251   1e-70    
ref|XP_006474434.1|  PREDICTED: U-box domain-containing protein 5...    251   1e-70    
dbj|BAK03904.1|  predicted protein                                      251   1e-70    
gb|EEE65245.1|  hypothetical protein OsJ_20418                          251   1e-70    
ref|XP_008354863.1|  PREDICTED: U-box domain-containing protein 3...    251   1e-70    
ref|XP_009341594.1|  PREDICTED: U-box domain-containing protein 5...    250   1e-70    
emb|CAB87673.1|  putative receptor-like kinase                          249   2e-70    
ref|NP_196761.2|  Protein kinase protein with adenine nucleotide ...    249   2e-70    
emb|CDY64004.1|  BnaCnng42950D                                          250   2e-70    
ref|XP_004969416.1|  PREDICTED: U-box domain-containing protein 3...    250   2e-70    
gb|EYU29341.1|  hypothetical protein MIMGU_mgv1a002420mg                249   2e-70    
ref|XP_002452944.1|  hypothetical protein SORBIDRAFT_04g035360          251   2e-70    
ref|XP_009124445.1|  PREDICTED: U-box domain-containing protein 3...    250   2e-70    
ref|XP_002455839.1|  hypothetical protein SORBIDRAFT_03g026030          250   2e-70    
ref|XP_006289371.1|  hypothetical protein CARUB_v10002865mg             248   2e-70    
ref|XP_010046884.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    250   3e-70    
ref|XP_009362073.1|  PREDICTED: U-box domain-containing protein 35      249   3e-70    
ref|XP_008223966.1|  PREDICTED: U-box domain-containing protein 35      253   3e-70    
gb|EYU46472.1|  hypothetical protein MIMGU_mgv1a002470mg                248   3e-70    
gb|EAZ12456.1|  hypothetical protein OsJ_02353                          249   3e-70    
ref|NP_194851.2|  Protein kinase protein with adenine nucleotide ...    249   3e-70    
ref|XP_011009941.1|  PREDICTED: U-box domain-containing protein 3...    249   4e-70    
ref|XP_004488971.1|  PREDICTED: U-box domain-containing protein 3...    249   5e-70    
gb|KDO65137.1|  hypothetical protein CISIN_1g005343mg                   248   5e-70    
gb|AAV64214.1|  stk                                                     249   5e-70    
ref|XP_007024548.1|  Kinase protein with adenine nucleotide alpha...    249   6e-70    
ref|XP_008658989.1|  PREDICTED: serine threonine kinase1 isoform X1     249   6e-70    
gb|KFK25460.1|  hypothetical protein AALP_AA8G117900                    246   6e-70    
ref|NP_001183778.1|  serine threonine kinase1                           249   6e-70    
gb|AAK73111.2|AF391808_21  serine threonine kinase 1                    249   7e-70    
ref|NP_001043411.1|  Os01g0581400                                       249   7e-70    
gb|EMS65140.1|  U-box domain-containing protein 34                      249   7e-70    
gb|AAC13610.1|  similar to eukaryotic protein kinase domains (Pfa...    241   8e-70    
ref|XP_004152889.1|  PREDICTED: U-box domain-containing protein 3...    250   8e-70    
gb|KFK41698.1|  hypothetical protein AALP_AA2G161400                    234   9e-70    
ref|XP_010273873.1|  PREDICTED: U-box domain-containing protein 3...    247   9e-70    
ref|XP_009591661.1|  PREDICTED: U-box domain-containing protein 3...    246   9e-70    
ref|XP_010273872.1|  PREDICTED: U-box domain-containing protein 5...    247   9e-70    
ref|XP_009591660.1|  PREDICTED: U-box domain-containing protein 3...    246   9e-70    
ref|XP_004163060.1|  PREDICTED: U-box domain-containing protein 3...    250   1e-69    
ref|XP_008460102.1|  PREDICTED: U-box domain-containing protein 3...    249   1e-69    
emb|CDP08293.1|  unnamed protein product                                247   1e-69    
gb|KFK25461.1|  hypothetical protein AALP_AA8G117900                    247   1e-69    
ref|XP_009780371.1|  PREDICTED: U-box domain-containing protein 3...    246   1e-69    
ref|XP_010322089.1|  PREDICTED: U-box domain-containing protein 5...    246   2e-69    
ref|XP_010655257.1|  PREDICTED: U-box domain-containing protein 3...    248   2e-69    
ref|XP_009108027.1|  PREDICTED: U-box domain-containing protein 35      247   2e-69    
ref|XP_007024547.1|  Kinase protein with adenine nucleotide alpha...    249   2e-69    
ref|XP_009591658.1|  PREDICTED: U-box domain-containing protein 3...    246   2e-69    
ref|XP_009591659.1|  PREDICTED: U-box domain-containing protein 3...    246   2e-69    
gb|AFO66517.1|  putative kinase                                         252   2e-69    
ref|XP_009601901.1|  PREDICTED: U-box domain-containing protein 3...    245   2e-69    
ref|XP_009372417.1|  PREDICTED: U-box domain-containing protein 5...    247   2e-69    
ref|XP_009798004.1|  PREDICTED: U-box domain-containing protein 3...    245   3e-69    
ref|XP_003569258.2|  PREDICTED: U-box domain-containing protein 3...    247   4e-69    
emb|CDY24991.1|  BnaC02g40170D                                          246   4e-69    
ref|XP_009130043.1|  PREDICTED: U-box domain-containing protein 51      246   4e-69    
ref|XP_008231955.1|  PREDICTED: U-box domain-containing protein 5...    247   4e-69    
emb|CDY05538.1|  BnaA02g31530D                                          246   4e-69    
gb|AAD40140.1|AF149413_21  contains similarity to protein kinase ...    245   5e-69    
ref|XP_010064877.1|  PREDICTED: U-box domain-containing protein 5...    246   5e-69    
emb|CDY59782.1|  BnaCnng35580D                                          246   5e-69    
ref|XP_009601900.1|  PREDICTED: U-box domain-containing protein 3...    245   5e-69    
gb|ACE75946.1|  calcium-dependent protein kinase                        245   6e-69    
ref|XP_009798003.1|  PREDICTED: U-box domain-containing protein 3...    245   6e-69    
ref|XP_007012336.1|  Kinase protein with adenine nucleotide alpha...    246   6e-69    
gb|KCW69804.1|  hypothetical protein EUGRSUZ_F03165                     246   7e-69    
emb|CDX91180.1|  BnaC02g04170D                                          248   8e-69    
ref|XP_006350355.1|  PREDICTED: U-box domain-containing protein 3...    244   8e-69    
ref|NP_197987.1|  protein kinase                                        245   8e-69    
ref|XP_009340706.1|  PREDICTED: U-box domain-containing protein 5...    246   8e-69    
ref|XP_006396094.1|  hypothetical protein EUTSA_v10003057mg             245   9e-69    
ref|XP_008228381.1|  PREDICTED: U-box domain-containing protein 35      246   9e-69    
ref|XP_008462338.1|  PREDICTED: U-box domain-containing protein 3...    245   9e-69    
ref|XP_004305731.1|  PREDICTED: U-box domain-containing protein 5...    245   9e-69    
ref|XP_007216961.1|  hypothetical protein PRUPE_ppa015558mg             246   1e-68    
emb|CDY33692.1|  BnaC04g29590D                                          245   1e-68    
emb|CDM83211.1|  unnamed protein product                                245   1e-68    
emb|CBI35918.3|  unnamed protein product                                244   2e-68    
ref|XP_010450373.1|  PREDICTED: U-box domain-containing protein 3...    244   2e-68    
ref|XP_010669367.1|  PREDICTED: U-box domain-containing protein 5...    244   2e-68    
ref|XP_008445511.1|  PREDICTED: U-box domain-containing protein 5...    244   2e-68    
ref|XP_010654499.1|  PREDICTED: U-box domain-containing protein 5...    243   2e-68    
ref|XP_004501456.1|  PREDICTED: U-box domain-containing protein 3...    243   2e-68    
emb|CDX83902.1|  BnaC08g17430D                                          244   2e-68    
ref|XP_009125843.1|  PREDICTED: U-box domain-containing protein 51      248   2e-68    
ref|XP_010654498.1|  PREDICTED: U-box domain-containing protein 5...    244   2e-68    
ref|XP_008462336.1|  PREDICTED: U-box domain-containing protein 3...    245   2e-68    
ref|XP_004501455.1|  PREDICTED: U-box domain-containing protein 3...    243   3e-68    
gb|AID16038.1|  putative universal stress protein                       243   4e-68    
ref|XP_006416691.1|  hypothetical protein EUTSA_v10006957mg             243   4e-68    
gb|KHN29704.1|  U-box domain-containing protein 35                      237   4e-68    
ref|XP_008445509.1|  PREDICTED: U-box domain-containing protein 5...    243   5e-68    
ref|XP_004501454.1|  PREDICTED: U-box domain-containing protein 3...    243   5e-68    
ref|XP_010087704.1|  U-box domain-containing protein 51                 242   6e-68    
ref|XP_004167209.1|  PREDICTED: U-box domain-containing protein 5...    243   6e-68    
ref|XP_004144270.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    243   6e-68    
gb|KGN47604.1|  hypothetical protein Csa_6G363600                       243   8e-68    
gb|EMT25251.1|  Lycopene epsilon cyclase, chloroplastic                 247   8e-68    
ref|XP_004141807.1|  PREDICTED: U-box domain-containing protein 5...    242   1e-67    
ref|XP_010440711.1|  PREDICTED: U-box domain-containing protein 3...    242   1e-67    
ref|XP_010462754.1|  PREDICTED: U-box domain-containing protein 3...    239   1e-67    
ref|XP_009624934.1|  PREDICTED: U-box domain-containing protein 5...    243   2e-67    
ref|XP_007136849.1|  hypothetical protein PHAVU_009G0793001g            238   2e-67    
ref|XP_004305504.1|  PREDICTED: U-box domain-containing protein 3...    242   2e-67    
gb|KHN20156.1|  U-box domain-containing protein 52                      235   2e-67    
gb|KGN45512.1|  hypothetical protein Csa_7G450690                       243   2e-67    
ref|XP_006601678.1|  PREDICTED: U-box domain-containing protein 5...    236   2e-67    
ref|XP_009775324.1|  PREDICTED: U-box domain-containing protein 3...    235   2e-67    
ref|XP_007136848.1|  hypothetical protein PHAVU_009G0793001g            238   2e-67    
ref|XP_002308542.2|  hypothetical protein POPTR_0006s24180g             241   3e-67    
ref|NP_178719.2|  adenine nucleotide alpha hydrolases-domain cont...    240   3e-67    
ref|XP_011019410.1|  PREDICTED: U-box domain-containing protein 35      240   5e-67    
ref|XP_010940191.1|  PREDICTED: U-box domain-containing protein 3...    240   6e-67    
ref|XP_004305505.1|  PREDICTED: U-box domain-containing protein 3...    243   9e-67    
gb|KFK43937.1|  hypothetical protein AALP_AA1G193700                    239   1e-66    
ref|XP_002892956.1|  kinase                                             239   1e-66    
ref|XP_010498122.1|  PREDICTED: U-box domain-containing protein 3...    239   2e-66    
ref|XP_010498119.1|  PREDICTED: U-box domain-containing protein 3...    239   2e-66    
ref|XP_010498120.1|  PREDICTED: U-box domain-containing protein 3...    239   2e-66    
ref|XP_010498121.1|  PREDICTED: U-box domain-containing protein 3...    239   2e-66    
ref|XP_010476911.1|  PREDICTED: U-box domain-containing protein 35      238   3e-66    



>emb|CDP04352.1| unnamed protein product [Coffea canephora]
Length=720

 Score =   523 bits (1346),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 302/533 (57%), Positives = 379/533 (71%), Gaps = 35/533 (7%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------QHKQQLEAQNKDLFVTFH  155
             +SQYA++WT +NLL KGQ+V+L+HV  ++ ++             QQ+E   KDLF+TFH
Sbjct  30    SSQYALRWTVDNLLVKGQTVILIHVLPRSSSTAAAGNTCALNDANQQVEKTAKDLFLTFH  89

Query  156   CFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSK  335
             C+CTRK+I C D+ + G DIAKA+T+YV+  AIE+LVLGSSRH F++RLK  D+PT   K
Sbjct  90    CYCTRKDIQCFDVTLQGNDIAKAITEYVAQGAIESLVLGSSRHGFIRRLKTIDVPTAALK  149

Query  336   AAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEI---QEQAQ------NNPDIRT  488
              APDFCTV+VISK+KIS VRNA+R APF SP++ Q+ +I   Q+Q Q       +PD+R 
Sbjct  150   GAPDFCTVYVISKTKISQVRNASRLAPFTSPIYNQINQINQVQDQFQVSRSTCTSPDLRP  209

Query  489   KNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
             K  P  +   D    R F   E   + R    R   RG   +     +  E +SD+SF+S
Sbjct  210   KQIP--VMRGDVTPRRPFIPREDHELIRSPFARG--RGFTGKTF--GDLSESESDISFIS  263

Query  669   SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
             S  RPS DRMS+ L E ++SGRT R+S+SSD SFGS R G K +DL+SF +FSSSS+E D
Sbjct  264   S-ERPSVDRMSA-LYEGMDSGRTSRISTSSDSSFGSERFGSKASDLSSFYEFSSSSIETD  321

Query  846   EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW----rveeerrineeevnek  1013
             +AE EMRRLKLELQ+TMD+YSTACKEALTAKQK +EL RW        +     EE ++ 
Sbjct  322   DAEAEMRRLKLELQRTMDMYSTACKEALTAKQKAAELHRWRIEEEKRLKEARLAEEADKN  381

Query  1014  skssvtsetkktgggenMPVPV----RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKC  1181
                S +   + +   +    P+    RYRRYTI+EIE AT++FSES KIGEGGYGPVFKC
Sbjct  382   KSESASETDQASQTSQAQSPPIYCGFRYRRYTIEEIEAATDNFSESHKIGEGGYGPVFKC  441

Query  1182  ILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGS  1361
              LDHTAVAVK+LRPDA QGR QFQQEVE+LSCMRHPNMV+LLGACPEYGCLVYE M +GS
Sbjct  442   YLDHTAVAVKILRPDATQGRSQFQQEVEVLSCMRHPNMVLLLGACPEYGCLVYECMPNGS  501

Query  1362  VDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             ++DRL  RGN P L+WQ+RFRIAAE+ TGLLFLH+ KP+P+VHRDLKP NILL
Sbjct  502   LEDRLYRRGNTPALTWQLRFRIAAEIATGLLFLHRTKPEPLVHRDLKPANILL  554



>ref|XP_011077010.1| PREDICTED: U-box domain-containing protein 52-like [Sesamum indicum]
Length=783

 Score =   523 bits (1347),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 301/564 (53%), Positives = 381/564 (68%), Gaps = 68/564 (12%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV----------DNQTQTSLQH-----KQQLEAQNKDL  140
             SQYAIKW  ENLL++GQ+V+L+HV          +N     +       KQ LE   KDL
Sbjct  32    SQYAIKWAIENLLTRGQTVILIHVVLRSSMAALCENYAGNGVSGDPCTTKQILEKHTKDL  91

Query  141   FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
             F+TFHCFCTRK+IHC D++++ TDIAKA+T+YV+ AAIENLVLG+SRH F++RLK+ D+P
Sbjct  92    FLTFHCFCTRKDIHCFDVVLEDTDIAKAITEYVAHAAIENLVLGASRHGFIRRLKMVDVP  151

Query  321   TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN---NPDIRTK  491
                SK +PDFCTV+VISK+KISSVRNA+R APF SPL  Q+Q++QEQ  N   +PD R K
Sbjct  152   NSVSKGSPDFCTVYVISKTKISSVRNASRLAPFTSPLLTQIQQMQEQTNNTTSSPDARPK  211

Query  492   NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             N PS +R+ D    +   +++S+S+  P      +R       + A+  E DSD+SFVSS
Sbjct  212   NLPS-IRATDRTPRKG--VDDSDSLKSP-----FSRAQRFHANMFADLSESDSDISFVSS  263

Query  672   GSRPSGDR-----MSSFLSETVESGRTPRLssssdgsfgsgR-LGKGNDLNSFTDFSSSS  833
             G RPS DR     MS  L + ++ GRT RLS+SS+ SFGS R   + ++L S+TDFSSSS
Sbjct  264   G-RPSVDRAITDPMSGMLYDGIDPGRTSRLSTSSESSFGSMRSTARFSELGSYTDFSSSS  322

Query  834   LENDEAEVEMRRLKLELQKTMDLYSTA---------------------------CKEALT  932
              END+ E EMRRLKLELQKTM++YSTA                           C+ A  
Sbjct  323   TENDDVEAEMRRLKLELQKTMEMYSTACKEALTAKQKAVELHRWRVDEEQRLEECRLAEE  382

Query  933   AKQKTSELQRWrveeerrineeevnekskssvtsetkktgggenMP--------VPVRYR  1088
             A ++T+E ++ + +      +         S      +    + +         +P RYR
Sbjct  383   AARRTAEKEKAKYKAAMENAQAAQRVAELESRKRVDAEKKAIQEVDDKDEAVGVMPFRYR  442

Query  1089  RYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEI  1268
             RYTIDEIEEATE F+ SRKIGEGGYGPVFKC LDHT VA+KVLRPDAAQGR QFQQEVE+
Sbjct  443   RYTIDEIEEATEFFAVSRKIGEGGYGPVFKCYLDHTRVAIKVLRPDAAQGRAQFQQEVEV  502

Query  1269  LSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTG  1448
             L CMRHPN+V+LLGACPEYGCLVYEYMA+GS++DRL+ +GN   LSWQ+RFRIAAE+ TG
Sbjct  503   LCCMRHPNIVLLLGACPEYGCLVYEYMANGSLEDRLVRQGNTRSLSWQLRFRIAAEIATG  562

Query  1449  LLFLHQNKPDPIVHRDLKPGNILL  1520
             L FLHQ KP+P+VHRDLKPGNILL
Sbjct  563   LHFLHQTKPEPLVHRDLKPGNILL  586



>ref|XP_010545486.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Tarenaya 
hassleriana]
Length=788

 Score =   448 bits (1153),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 267/572 (47%), Positives = 354/572 (62%), Gaps = 72/572 (13%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ---HKQQLEAQNKDLFVTFHCFCTRKN  176
             SQ+A+KWT +NL+SKGQ+++L+HV  ++  S +    KQ++E Q KDLF+TF C+CTRK 
Sbjct  28    SQHALKWTADNLVSKGQTIILIHVVLKSSVSGESNTEKQRIEKQTKDLFMTFRCYCTRKE  87

Query  177   IHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAPDFC  353
             IHCLD+ ++  ++ KALT+Y S A IE LVLG +SRH F+++ K++D P+  SK APDFC
Sbjct  88    IHCLDVTLEDDNVVKALTEYTSFAVIETLVLGATSRHGFMRKFKMSDTPSSVSKGAPDFC  147

Query  354   TVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHM  533
             TV+VISK K+SS+R+A+R AP+ASP+   + E++ Q+  +   + KN+ S     D   M
Sbjct  148   TVYVISKGKVSSLRHASRLAPYASPI---MTEVENQSAISSYEKFKNSMSF--KADRALM  202

Query  534   RSFKLEESESVSRPSIERAA-------------------TRGIPPRRMLGAETVEGDSDL  656
             +       E  ++    R +                   + G P      + +  G +D+
Sbjct  203   KPSPTSSVEDYAKSPFARRSNFVNSFYDFSDSEADISFVSSGRPSMSSRPSTSTTGRTDM  262

Query  657   SFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFT-DFS---  824
             SF+SSG   +    SSF+ E  ESG TPRLS++S  S GS RLG   + N    DFS   
Sbjct  263   SFMSSGRPSTSTTGSSFICEFPESGLTPRLSTNSGQSIGSLRLGIRFNNNGLPHDFSFVS  322

Query  825   ------SSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTA--------KQKTSELQR  962
                   S S   +E EVEMRRLK EL+ T+D+Y TAC+EAL A        +QKT E  +
Sbjct  323   QDSARTSCSQSLEEVEVEMRRLKQELKHTIDMYGTACREALAAKQEAKQLQRQKTEEEGK  382

Query  963   WrveeerrineeevnekskssvtsetkktgggenMPVP----------------------  1076
             ++ E+      + + EK +++  +          + +                       
Sbjct  383   FQDEQISEKATKSLMEKERANKVAAEATQTANRIVELETQRRTIEHSNSLEDSMMVMSSF  442

Query  1077  ----VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGRE  1244
                  RYRRYTI EIE AT+ F +S KIGEGGYGPVFK  +DHTAVAVKVLRPDAAQGR 
Sbjct  443   SSTDARYRRYTIGEIEVATDSFEKSNKIGEGGYGPVFKGFIDHTAVAVKVLRPDAAQGRS  502

Query  1245  QFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFR  1424
             QFQ+EVE+LSC+RHPNMV+L+GACPEYG LVYEYMA GS+ DRL    N P LSWQ+RFR
Sbjct  503   QFQREVEVLSCIRHPNMVLLIGACPEYGVLVYEYMAKGSLADRLYRHSNTPALSWQLRFR  562

Query  1425  IAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             IAAE+ TGLLFLHQ KP+PIVHRDLKPGNILL
Sbjct  563   IAAEVATGLLFLHQTKPEPIVHRDLKPGNILL  594



>ref|XP_009145663.1| PREDICTED: U-box domain-containing protein 35 [Brassica rapa]
 ref|XP_009145664.1| PREDICTED: U-box domain-containing protein 35 [Brassica rapa]
 ref|XP_009145665.1| PREDICTED: U-box domain-containing protein 35 [Brassica rapa]
Length=788

 Score =   445 bits (1144),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 269/569 (47%), Positives = 355/569 (62%), Gaps = 70/569 (12%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQT-SLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ+A+KW  + L+SKG +++L+HV +++ + S++   +   Q ++LFVTFHC+C+RK I 
Sbjct  30    SQHALKWAADRLVSKGDTIILLHVIHRSSSDSVEVTAEKHKQAENLFVTFHCYCSRKEIQ  89

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             CLD+ ++   I K+L +YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCTV
Sbjct  90    CLDVTLEDDSIVKSLAEYVSSGVIENLVLGAPSRHGFMRKFKMSDTPSNVAKAAPDFCTV  149

Query  360   FviskskissvRNATRPAPFASPLHPQLQEIQ-----EQAQNNPDIRTKN-APSSLRSFD  521
             +VISK KISSVR+A R AP+ SPL  Q++        E+ +N    R +  A SS+ S  
Sbjct  150   YVISKGKISSVRHARRDAPYQSPLIAQIENHSALTNYEKFRNTMSFRDRTPARSSVSSSI  209

Query  522   EKHMRS------------FKLEESE------SVSRPSIERAATRGIPPRRMLGAETVEGD  647
             E + +S            + L +S+      S  RPSI  +  R I         T  G 
Sbjct  210   EDYGKSPLARTSNNANSFYDLTDSDNDISFVSSGRPSITSSGRRSITSSERPSTST-NGR  268

Query  648   SDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDF  821
             SD+SFVSSG RPS     S  F+ E  +SG TPR+S+ S  S GS RLG    +N   DF
Sbjct  269   SDISFVSSG-RPSTSTTGSPSFIYEFPDSGLTPRMSTGSGQSVGSMRLG----INIQHDF  323

Query  822   S-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR-  962
             S           S S +N ++ E EMRRLKLEL+ T+DLY +AC+EAL AKQ+  ELQR 
Sbjct  324   SFVSQDSGRSSCSCSPQNLEDVEAEMRRLKLELKHTIDLYGSACREALAAKQEAKELQRQ  383

Query  963   ------WrveeerrineeevnekskssvtsetkktgggenMP-----------------V  1073
                   W  E +      ++  + + +  +    +     +                   
Sbjct  384   KMEEEGWGQEGQLSEKSTKLIAEKERANKAAMDASETANKIADLETQRRAIESGDAFSDS  443

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
              +RYRRY I EIEEAT  F ++ KIGEGGYGPVFK  LDHT VA+KVLRPDAAQGR QFQ
Sbjct  444   NLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVFKGHLDHTPVAIKVLRPDAAQGRSQFQ  503

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             +EVE+LSC+RHP+MV+L+GACPEYG LVYEYM  GS+ DRL   GN PPLSW++RFRIAA
Sbjct  504   REVEVLSCIRHPHMVLLIGACPEYGVLVYEYMGKGSLADRLYRNGNTPPLSWELRFRIAA  563

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  564   EVATGLLFLHQTKPEPIVHRDLKPGNILI  592



>emb|CDY29801.1| BnaC05g31890D [Brassica napus]
Length=788

 Score =   444 bits (1143),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 269/570 (47%), Positives = 354/570 (62%), Gaps = 71/570 (12%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQT-SLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ+A+KW  + L+SKG +++L+HV +++ + S++   +   Q  +LFVTFHC+C+RK I 
Sbjct  30    SQHALKWAADRLVSKGDTIILLHVIHRSSSDSVEVTAEKHKQTDNLFVTFHCYCSRKEIQ  89

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             CLD+ ++   I K+L +YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCTV
Sbjct  90    CLDVTLEDDSIVKSLAEYVSSGVIENLVLGAPSRHGFMRKFKMSDTPSNVAKAAPDFCTV  149

Query  360   FviskskissvRNATRPAPFASPLHPQLQEIQ-----EQAQNNPDIRTKN-APSSLRSFD  521
             ++ISK KISSVR+A R AP+ SPL  Q++        E+ +N    R +  A SS+ S  
Sbjct  150   YIISKGKISSVRHARRDAPYQSPLIAQIENHSALTNYEKFRNTMSFRDRTPARSSVSSSV  209

Query  522   EKHMRS------------FKLEESE-------SVSRPSIERAATRGIPPRRMLGAETVEG  644
             E   +S            + L +S+       S  RPSI  +  R I         T  G
Sbjct  210   EDFGKSPLARTSNNANSFYDLSDSDNNDISFVSSGRPSITSSGRRSITSSERPSTST-NG  268

Query  645   DSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTD  818
              SD+SFVSSG RPS     S  F+ E  +SG TPR+S+ S  S GS RLG    +N   D
Sbjct  269   RSDISFVSSG-RPSTSTTGSPSFIYEFPDSGLTPRMSTGSGQSVGSMRLG----INIQHD  323

Query  819   FS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             FS           S S +N ++ E EMRRLKLEL+ T+DLY +AC+EAL AKQ+  ELQR
Sbjct  324   FSFVSQDSGRSSCSCSPQNLEDVEAEMRRLKLELKHTIDLYGSACREALAAKQEAKELQR  383

Query  963   -------WrveeerrineeevnekskssvtsetkktgggenMP-----------------  1070
                    W  E +      ++  + + +  +    +     +                  
Sbjct  384   QKMEEEGWGQEGQLSEKSTKLIAEKERANKAAMDASETANKIADLETQRRAIESGDAFSD  443

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
               +RYRRY I EIEEAT  F ++ KIGEGGYGPVFK  LDHT VA+KVLRPDAAQGR QF
Sbjct  444   SNLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVFKGHLDHTPVAIKVLRPDAAQGRSQF  503

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIA  1430
             Q+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL   GN PPLSW++RFRIA
Sbjct  504   QREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLADRLYRNGNTPPLSWELRFRIA  563

Query  1431  AEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  564   AEVATGLLFLHQTKPEPIVHRDLKPGNILI  593



>emb|CDY25396.1| BnaA05g18880D [Brassica napus]
Length=798

 Score =   442 bits (1136),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 268/569 (47%), Positives = 354/569 (62%), Gaps = 70/569 (12%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQT-SLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ+A+KW  + L+SKG +++L+HV +++ + S++   +   Q ++LFVTFHC+C+RK I 
Sbjct  30    SQHALKWAADRLVSKGDTIILLHVIHRSSSDSVEVTAEKHKQAENLFVTFHCYCSRKEIQ  89

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             CLD+ ++   I K+L +YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCTV
Sbjct  90    CLDVTLEDDSIVKSLAEYVSSGVIENLVLGAPSRHGFMRKFKMSDTPSNVAKAAPDFCTV  149

Query  360   FviskskissvRNATRPAPFASPLHPQLQEIQ-----EQAQNNPDIRTKN-APSSLRSFD  521
             +VISK KISSVR+A R AP+ SPL  Q++        E+ +N    R +  A SS+ S  
Sbjct  150   YVISKGKISSVRHARRDAPYQSPLIAQIENHSALTNYEKFRNTMSFRDRTPARSSVSSSI  209

Query  522   EKHMRS------------FKLEESE------SVSRPSIERAATRGIPPRRMLGAETVEGD  647
             E   +S            + L +S+      S  RPSI  +  R I         T  G 
Sbjct  210   EDFGKSPLARTSNNANSFYDLSDSDNDISFVSSGRPSITSSGRRSITSSERPSTST-NGR  268

Query  648   SDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDF  821
             SD+SFVSSG RPS     S  F+ E  +SG TPR+S+ S  S GS RLG    +N   DF
Sbjct  269   SDISFVSSG-RPSTSTTGSPSFIYEFPDSGLTPRMSTGSGQSVGSMRLG----INIQHDF  323

Query  822   S-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR-  962
             S           S S +N ++ E EMRRLKLEL+ T+DLY +AC+EAL AKQ+  ELQR 
Sbjct  324   SFISQDSGRSSCSCSPQNLEDVEAEMRRLKLELKHTIDLYGSACREALAAKQEAKELQRQ  383

Query  963   ------WrveeerrineeevnekskssvtsetkktgggenMP-----------------V  1073
                   W  E +      ++  + + +  +    +     +                   
Sbjct  384   KMEEEGWGQEGQLSEKSTKLIAEKERANKAAMDASETANKIADLETQRRAIESGDAFSDS  443

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
              +RYRRY I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQ
Sbjct  444   NLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVYKGHLDHTPVAIKVLRPDAAQGRSQFQ  503

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             +EVE+LSC+RHP+MV+L+GACPEYG LVYEYM  GS+ DRL   GN PPLSW++RFRIAA
Sbjct  504   REVEVLSCIRHPHMVLLIGACPEYGVLVYEYMGKGSLADRLYRNGNTPPLSWELRFRIAA  563

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  564   EVATGLLFLHQTKPEPIVHRDLKPGNILI  592



>ref|XP_006406411.1| hypothetical protein EUTSA_v10020098mg [Eutrema salsugineum]
 gb|ESQ47864.1| hypothetical protein EUTSA_v10020098mg [Eutrema salsugineum]
Length=797

 Score =   441 bits (1134),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 269/575 (47%), Positives = 360/575 (63%), Gaps = 71/575 (12%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQT-SLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ+A+KW  ++L+SKGQ+++L+HV  ++ + S++   +   Q ++LFVTFHC+C+RK I 
Sbjct  28    SQHALKWAADHLVSKGQTIILLHVLLRSSSDSVEVNAEKHKQAENLFVTFHCYCSRKEIQ  87

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             CLD+ ++  +I K+L +YVS+  IENLVLG+ SRH F+++ K++D P+  +KAAPDFCTV
Sbjct  88    CLDVTLEDDNIVKSLAEYVSNGVIENLVLGAPSRHGFMRKFKMSDTPSNVAKAAPDFCTV  147

Query  360   FviskskissvRNATRPAPFASPLHPQLQEIQ-----EQAQNNPDIRTKN-APSSLRSFD  521
             +VISK KISSVR+ATR AP+ SPL  Q++        E+ +N    R +  A  S+ S  
Sbjct  148   YVISKGKISSVRHATRTAPYRSPLMGQIENHSAISNYEKFRNTMSFRDRTPARPSVSSSI  207

Query  522   EKHMRS------------FKLEESES------VSRPSIERAA-----TRGIPPRRMLGAE  632
             E + +S            F L +SE+        RPS   +      + G P      + 
Sbjct  208   EDYGKSPMARKSNYANSFFDLSDSENDISFVYSGRPSTTSSGRPSTTSSGRPSTTSRPSL  267

Query  633   TVEGDSDLSFVSSGSRPSG--DRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDL  803
             +  G SD+SFVSSG RPS   +   SF+ +  +SG TPR+S+ S  S GS RLG + ND 
Sbjct  268   STNGRSDISFVSSG-RPSTSTNGSPSFIYDFPDSGLTPRMSTGSGQSVGSMRLGIRFNDT  326

Query  804   NSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
             N   DFS           S S +N +E E EMRRLK EL+ T+D+Y +AC+EAL AKQ+ 
Sbjct  327   NIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHTIDMYGSACREALAAKQEA  386

Query  948   SELQR-------WrveeerrineeevnekskssvtsetkktgggenMP------------  1070
              ELQR       W  E +      +   + + +  +  + +     +             
Sbjct  387   KELQRQKMEEEGWVHEGQLSEKSTKSIVEKERANKAAMEASETASKIAELENQRRAMEAG  446

Query  1071  -----VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQ  1235
                    +RYRRY I EIEEAT  F ++ KIGEGGYGPVFK  LDHT VAVKVLR DAAQ
Sbjct  447   GSFSDSSLRYRRYVISEIEEATNSFDKANKIGEGGYGPVFKGQLDHTPVAVKVLRQDAAQ  506

Query  1236  GREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQV  1415
             GR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL   G  PPLSW++
Sbjct  507   GRSQFQREVEVLSCIRHPHMVLLIGACPEYGMLVYEYMAKGSLADRLYRNGKTPPLSWEL  566

Query  1416  RFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  567   RFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  601



>ref|XP_006297019.1| hypothetical protein CARUB_v10013010mg [Capsella rubella]
 gb|EOA29917.1| hypothetical protein CARUB_v10013010mg [Capsella rubella]
Length=793

 Score =   440 bits (1131),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 271/575 (47%), Positives = 356/575 (62%), Gaps = 74/575 (13%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHC  185
             SQ+A+KW  +NL+SKGQ+++L+HV  ++ +      +   Q + LFVTFHC+C+RK I C
Sbjct  28    SQHALKWAADNLVSKGQTIILLHVILRSSSDSGDNTEKHKQAESLFVTFHCYCSRKEIQC  87

Query  186   LDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
             LD+ ++  +I K+L +YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCTV+
Sbjct  88    LDVTLEDDNIVKSLAEYVSSGVIENLVLGAPSRHGFMRKFKISDTPSNVTKAAPDFCTVY  147

Query  363   viskskissvRNATRPAPFASPLHPQLQ---EI--QEQAQNNPDIRTKN-APSSLRSFDE  524
             VISK KISSVR ATR AP+ SPL  Q++   EI   E+ +N    R +  A SS  S  E
Sbjct  148   VISKGKISSVRYATRAAPYRSPLIGQIENHSEICNYEKFRNTMSFRDRTPARSSTASSIE  207

Query  525   KHMRS------------FKLEESES------VSRPSIERA-----ATRGIPPRRMLG-AE  632
              + +S            + L +SE+        RPS   +     A+ G P     G   
Sbjct  208   DYGKSPLARTPNYANSFYDLSDSENDISFVCSGRPSTTSSGRRSTASSGRPSTTGSGRPS  267

Query  633   TVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLG-KGNDL  803
             T  G SD+SFVSSG RPS     S  F  +  +SG TPR+S+SS  S    RLG + ND 
Sbjct  268   TSTGRSDISFVSSG-RPSTSTTGSPSFFYDFPDSGLTPRMSTSSGHSM---RLGIRFNDT  323

Query  804   NSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
             N   DFS           S S +N +E E EMRRLK EL++T+D+Y +AC+EAL AKQ+ 
Sbjct  324   NIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKQTIDMYGSACREALAAKQEA  383

Query  948   SELQR-------WrveeerrineeevnekskssvtsetkktgggenMP------------  1070
              ELQR       W  E +      +   + + +  +  + +     +             
Sbjct  384   KELQRQKMEEEGWVQEGQLSEKSTKSIVEKERANKAAMEASETASKIADLETQRRAIEAA  443

Query  1071  -----VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQ  1235
                    +RYRRY I +IEEAT  F E+ KIGEGGYGPV+K  LDHT VA+KVLRPDAAQ
Sbjct  444   GSLSDSNLRYRRYVISKIEEATNSFDEANKIGEGGYGPVYKGYLDHTPVAIKVLRPDAAQ  503

Query  1236  GREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQV  1415
             GR QFQ+EVE+LSC+RHP+MV+L+GACPE+G LVYEYMA GS+ DRL    N PPLSW++
Sbjct  504   GRSQFQREVEVLSCIRHPHMVLLIGACPEFGVLVYEYMAKGSLADRLYKYENTPPLSWEL  563

Query  1416  RFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  564   RFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  598



>gb|KFK39345.1| hypothetical protein AALP_AA3G232100 [Arabis alpina]
Length=811

 Score =   438 bits (1126),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 262/588 (45%), Positives = 360/588 (61%), Gaps = 84/588 (14%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQT-SLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ+A+KW  ++L++KGQ+++L+HV  +T + S +   +   Q KDLFVTFHC+C+RK I 
Sbjct  29    SQHALKWAADHLVTKGQTIILLHVLLRTSSDSAEANAEKHKQAKDLFVTFHCYCSRKEIQ  88

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             CLD+ ++  +I K++T+YV++  IENLVLG+ SRH F+++ K++D P+  +KAAPDFCTV
Sbjct  89    CLDVTLEDDNIVKSITEYVTNGVIENLVLGAPSRHGFMRKFKMSDTPSHVAKAAPDFCTV  148

Query  360   FviskskissvRNATRPAPFASPLHPQLQEIQ-----EQAQNNPDIRTKN-APSSLRSFD  521
             +VI K K+SSVRNA+R AP+ SPL  Q++        E+ +N    R +    +S+ S  
Sbjct  149   YVIGKGKVSSVRNASRAAPYRSPLMGQIENHSAISNYEKFRNTMSFRDRGPGRTSVSSSI  208

Query  522   EKHMRS------------FKLEESE--------------SVSRPSIERAATR--------  599
             E + +S            F L +SE              S  RPS   +           
Sbjct  209   EDYGKSPLARTSNYGNSFFDLSDSEIDITIPCSGRPSTTSSGRPSTTSSGRPSRSSTTSS  268

Query  600   GIPPRRMLG--AETVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgs  767
             G P     G  + +  G SD+SFVSSG RPS     S  ++ E+ ESG TPR+S+SS  S
Sbjct  269   GRPGTTRSGRPSTSTNGRSDMSFVSSG-RPSTSSTGSPKYIYESPESGHTPRMSTSSGQS  327

Query  768   fgsgRLG-KGNDLNSFTDFSSSSLEN------------DEAEVEMRRLKLELQKTMDLYS  908
              GS RLG + ND N   ++S +S ++            +E E EMR+LK EL+ TM++Y 
Sbjct  328   VGSMRLGIRFNDTNIQHEYSFTSQDSGRSSCSCSPQNLEEVEAEMRKLKQELKHTMEMYG  387

Query  909   TACKEALTAKQKTSE-----------------LQRWrveeerrineeevnekskssvtse  1037
             +AC+EAL AKQ+  E                 L++       +    +    +  + +  
Sbjct  388   SACREALAAKQEAKELQRQKMEEEGSVHEGKLLEKSTKSIVEKERANKAVMDASQTASKL  447

Query  1038  tkktgggenMPV-------PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHT  1196
              +     + + V        +RYRRY I EIEEAT  F E+ KIGEGGYGPV+K  LDHT
Sbjct  448   AELKTHKKAIEVVASLSDSSLRYRRYVIGEIEEATNSFDEANKIGEGGYGPVYKGHLDHT  507

Query  1197  AVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRL  1376
              VA+KVLRPDAAQGR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL
Sbjct  508   PVAIKVLRPDAAQGRSQFQREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLADRL  567

Query  1377  MNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
                G+ PPLSW++RFRI+AE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  568   YRHGSSPPLSWELRFRISAEVATGLLFLHQTKPEPIVHRDLKPGNILI  615



>ref|XP_002883235.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59494.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   437 bits (1123),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 273/575 (47%), Positives = 355/575 (62%), Gaps = 89/575 (15%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV------DNQTQTSLQHKQQLEAQNKDLFVTFHCFCT  167
             SQ+A+KW  ++L+SKGQ+++L+HV      D+   T+ +HKQ   A+N  LFVTFHC+C+
Sbjct  28    SQHALKWAADHLVSKGQTIILLHVILRSPSDSGEITAEKHKQ---AEN--LFVTFHCYCS  82

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAP  344
             RK I CLD+ ++  +I K+L +YVS   IENLVLG+ SRH F+++ K++D P+  +KAAP
Sbjct  83    RKEIQCLDVTLEDDNIVKSLAEYVSSGVIENLVLGAPSRHGFMRKFKISDTPSNVAKAAP  142

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQ---EI--QEQAQNNPDIRTKN-APSS  506
             DFCTV+VISK KISSVR A+R AP+ SPL  Q++   EI   E+ +N    R +  A SS
Sbjct  143   DFCTVYVISKGKISSVRYASRAAPYRSPLMGQIENHSEIINYEKFKNTMSFRDRAPARSS  202

Query  507   LRSFDEKHMRS------------FKLEESES------VSRPSIERAATRGIPPRRMLGAE  632
               S  E + +S            F+LE+SE+        RPS     + G P        
Sbjct  203   TASSIEDYGKSPMARTSNYANSFFELEDSENDISFVCSGRPS---TTSSGRP-------S  252

Query  633   TVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLG-KGNDL  803
             T  G SD+SFVSSG RPS     S  F+ +  +SG TPR    S  S  S RLG + ND 
Sbjct  253   TSTGRSDISFVSSG-RPSTSTTGSPSFIYDFPDSGLTPR---KSTSSGHSMRLGIRFNDT  308

Query  804   NSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
             N   DFS           S S +N +E E EMRRLK EL+  +D+Y +AC+EAL AKQ+ 
Sbjct  309   NIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHAIDMYGSACREALAAKQEA  368

Query  948   SELQR-------WrveeerrineeevnekskssvtsetkktgggenMP------------  1070
              ELQR       W  E +      +   + + +  +  + +     +             
Sbjct  369   KELQRQKIEEEGWVQEGQLSEKSTKSIVEKERAHKAAMEASETAGKIADLETQRRAIEAA  428

Query  1071  -----VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQ  1235
                    +RYRRY I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+KVLR DA Q
Sbjct  429   GSFSDSSLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVYKGYLDHTPVAIKVLRADAVQ  488

Query  1236  GREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQV  1415
             GR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL   GN PPLSW++
Sbjct  489   GRSQFQREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLADRLYKYGNTPPLSWEL  548

Query  1416  RFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  549   RFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  583



>ref|NP_188655.2| Protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
 dbj|BAC43233.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAO64892.1| At3g20200 [Arabidopsis thaliana]
 gb|AEE76346.1| Protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
Length=780

 Score =   436 bits (1122),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 271/575 (47%), Positives = 354/575 (62%), Gaps = 89/575 (15%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV------DNQTQTSLQHKQQLEAQNKDLFVTFHCFCT  167
             SQ+A+KW  ++L+SKGQ+++L+HV      D+   T+ +HKQ   A+N  LFVTFHC+C+
Sbjct  28    SQHALKWAADHLVSKGQTIILLHVILRSSSDSGEITAEKHKQ---AEN--LFVTFHCYCS  82

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAP  344
             RK I CLD+ ++  +I K+L +YVS   IENL+LG+ SRH F+++ K++D P+  +KAAP
Sbjct  83    RKEIQCLDVTLEDDNIVKSLAEYVSSGVIENLILGAPSRHGFMRKFKISDTPSNVAKAAP  142

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQ---EI--QEQAQNNPDIRTKNAP-SS  506
             DFCTV+VISK KISSVR+A+R AP+ SPL  Q++   EI   E+ +N    R +  P SS
Sbjct  143   DFCTVYVISKGKISSVRHASRAAPYRSPLMGQIENHSEIINYEKFRNTMSFRDRAPPRSS  202

Query  507   LRSFDEKHMRS------------FKLEESES------VSRPSIERAATRGIPPRRMLGAE  632
               S  E + +S            F LE+SE+        RPS    A+ G P        
Sbjct  203   TASSIEDYGKSPMARTSNYANSFFDLEDSENDISFVCSGRPS---TASSGRP-------S  252

Query  633   TVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLG-KGNDL  803
             T  G SD+SFVSSG RPS     S  F+ +  +SG TPR    S  S  S RLG + ND 
Sbjct  253   TSTGRSDISFVSSG-RPSTSTTGSPSFIYDFPDSGLTPR---ESTSSGHSMRLGIRFNDT  308

Query  804   NSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
             N   DFS           S S +N +E E EMRRLK EL+  +D+Y +AC+EAL AKQ+ 
Sbjct  309   NIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHAIDMYGSACREALAAKQEA  368

Query  948   SELQR-------WrveeerrineeevnekskssvtsetkktgggenMP------------  1070
              ELQR       W  E +      +   + + +  +    +     +             
Sbjct  369   KELQRQKIEEEGWVQEGQLSEKSTKSIVEKERAHKAAKDASETAGKIAELETQRRAIEAA  428

Query  1071  -----VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQ  1235
                    +RYRRY I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+K L+ DA Q
Sbjct  429   GSFSDSSLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVYKGYLDHTPVAIKALKADAVQ  488

Query  1236  GREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQV  1415
             GR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL   GN PPLSW++
Sbjct  489   GRSQFQREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLADRLYKYGNTPPLSWEL  548

Query  1416  RFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  549   RFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  583



>gb|EYU39810.1| hypothetical protein MIMGU_mgv1a024838mg [Erythranthe guttata]
Length=737

 Score =   434 bits (1117),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 257/559 (46%), Positives = 347/559 (62%), Gaps = 95/559 (17%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS-------LQ--------HKQQLEAQNKDL  140
             SQ A+KW TENLL++GQ+V+L+HV  ++  +       LQ        HKQ  E Q K+L
Sbjct  33    SQAALKWATENLLTRGQTVILIHVVQRSSLASFGYNFALQDLNGATCGHKQVHEKQTKEL  92

Query  141   FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
              +TFHCFC+RK+I+C D++++ TD+AKA+T+YV+ AAIENLVLG+SRH F++RLK  DIP
Sbjct  93    LLTFHCFCSRKDINCFDVVLEDTDVAKAITEYVAHAAIENLVLGASRHGFIRRLKTVDIP  152

Query  321   TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAP  500
                SK APDFCTV+VISK+KISSV+NA+R A F SPL  Q+ ++ EQ      I  K + 
Sbjct  153   MSVSKTAPDFCTVYVISKTKISSVKNASRLAQFVSPLKAQIHQM-EQGNGAEKILLKES-  210

Query  501   SSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSR  680
                            +++ + V  P    +   G P       +  E D+D+SF+SS  R
Sbjct  211   ---------------VDDIDIVKSPFSRGSRYNGKPY-----GDFSEPDTDISFISS-DR  249

Query  681   PSGDRM----SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEND-  845
             PS D++    S     ++ SG                   +G++ NSFTDFSSSSLE+D 
Sbjct  250   PSVDKLMSTSSDSSYGSIRSG------------------ARGSEQNSFTDFSSSSLESDD  291

Query  846   -EAE-----------------------------VEMRRLKLELQKTMDLYSTACKEA-LT  932
              EAE                             VE+ R +++ ++ ++    + + A LT
Sbjct  292   VEAEMRRLKLELQRTMEMYSTACKAALTAQQKAVELHRWRMDEERRLEEARLSEESAKLT  351

Query  933   AKQKTSELQRWrveeerrineeevnekskssvtsetkktgggenMPVP---VRYRRYTID  1103
             A+Q+ ++ +      E      E+  + ++S   +  +    ++  +    +RYRRY I+
Sbjct  352   AEQEKAKCRAAMENAEAAQRIAEIESQKRASAEMKALQESDEKDKAMSMSQLRYRRYCIE  411

Query  1104  EIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMR  1283
             EIEEATE+F+E+RK+GEGGYGPV+KC LDHT VAVKVLRPDAAQGR QF +EVE+LSCMR
Sbjct  412   EIEEATEYFAEARKVGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFHKEVEVLSCMR  471

Query  1284  HPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLH  1463
             HPNMV+LLGACPEYGCLVYEYMA GS++DRL  RGN   LSW +RFRIAAE+ TGL FLH
Sbjct  472   HPNMVLLLGACPEYGCLVYEYMAKGSLEDRLFRRGNTGALSWPLRFRIAAEIATGLHFLH  531

Query  1464  QNKPDPIVHRDLKPGNILL  1520
             Q KP+P+VHRDLKPGNILL
Sbjct  532   QTKPEPLVHRDLKPGNILL  550



>dbj|BAB01879.1| Ser/Thr protein kinaseroteinase) [Arabidopsis thaliana]
Length=822

 Score =   435 bits (1119),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 269/575 (47%), Positives = 353/575 (61%), Gaps = 89/575 (15%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV------DNQTQTSLQHKQQLEAQNKDLFVTFHCFCT  167
             SQ+A+KW  ++L+SKGQ+++L+HV      D+   T+ +HKQ      ++LFVTFHC+C+
Sbjct  28    SQHALKWAADHLVSKGQTIILLHVILRSSSDSGEITAEKHKQA-----ENLFVTFHCYCS  82

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAP  344
             RK I CLD+ ++  +I K+L +YVS   IENL+LG+ SRH F+++ K++D P+  +KAAP
Sbjct  83    RKEIQCLDVTLEDDNIVKSLAEYVSSGVIENLILGAPSRHGFMRKFKISDTPSNVAKAAP  142

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQ---EI--QEQAQNNPDIRTKNAP-SS  506
             DFCTV+VISK KISSVR+A+R AP+ SPL  Q++   EI   E+ +N    R +  P SS
Sbjct  143   DFCTVYVISKGKISSVRHASRAAPYRSPLMGQIENHSEIINYEKFRNTMSFRDRAPPRSS  202

Query  507   LRSFDEKHMRS------------FKLEESES------VSRPSIERAATRGIPPRRMLGAE  632
               S  E + +S            F LE+SE+        RPS    A+ G P        
Sbjct  203   TASSIEDYGKSPMARTSNYANSFFDLEDSENDISFVCSGRPS---TASSGRP-------S  252

Query  633   TVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLG-KGNDL  803
             T  G SD+SFVSSG RPS     S  F+ +  +SG TPR    S  S  S RLG + ND 
Sbjct  253   TSTGRSDISFVSSG-RPSTSTTGSPSFIYDFPDSGLTPR---ESTSSGHSMRLGIRFNDT  308

Query  804   NSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
             N   DFS           S S +N +E E EMRRLK EL+  +D+Y +AC+EAL AKQ+ 
Sbjct  309   NIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHAIDMYGSACREALAAKQEA  368

Query  948   SELQR-------WrveeerrineeevnekskssvtsetkktgggenMP------------  1070
              ELQR       W  E +      +   + + +  +    +     +             
Sbjct  369   KELQRQKIEEEGWVQEGQLSEKSTKSIVEKERAHKAAKDASETAGKIAELETQRRAIEAA  428

Query  1071  -----VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQ  1235
                    +RYRRY I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+K L+ DA Q
Sbjct  429   GSFSDSSLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVYKGYLDHTPVAIKALKADAVQ  488

Query  1236  GREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQV  1415
             GR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL   GN PPLSW++
Sbjct  489   GRSQFQREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLADRLYKYGNTPPLSWEL  548

Query  1416  RFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  549   RFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  583



>ref|XP_010508613.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Camelina sativa]
Length=804

 Score =   431 bits (1107),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 265/577 (46%), Positives = 346/577 (60%), Gaps = 76/577 (13%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEA--QNKDLFVTFHCFCTRKNI  179
             SQ+A+KW  ++L+SKGQ+++L+HV  ++ +S   +   E   Q + LFVTFHC+C+RK I
Sbjct  29    SQHALKWAADHLVSKGQTIILLHVILRSSSSDSGEVSAEKHMQAESLFVTFHCYCSRKEI  88

Query  180   HCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCT  356
              CLD+ ++  +I K+LT+YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCT
Sbjct  89    QCLDVTLEDDNIVKSLTEYVSSGVIENLVLGAPSRHGFMRKFKISDTPSNVAKAAPDFCT  148

Query  357   VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQ-----------------------  467
             V+VISK KISSVR A+R AP+ SPL  Q++   E                          
Sbjct  149   VYVISKGKISSVRYASRDAPYRSPLMGQIENHSEICNYEKFRNTMSFKDRTPARSSTASS  208

Query  468   -----NNPDIRTKNAPSSLRSF-DEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLG-  626
                   +P  RT N P+S     D ++  SF      S +        + G P     G 
Sbjct  209   IEDYGKSPMARTSNYPNSFYDLIDSENDISFVFSGRPSTASSGRRSTTSSGRPSTTSSGR  268

Query  627   AETVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLG-KGN  797
               T  G SD+SFVSSG RPS     S  F+ +  +SG TPR+S+ S  S    RLG + N
Sbjct  269   PSTSTGRSDISFVSSG-RPSLSTTGSPSFIYDFPDSGLTPRMSTGSGHSM---RLGIRFN  324

Query  798   DLNSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
             D N   DFS           S S +N +E E EMRRLK EL+ T+D+Y +AC+EAL AKQ
Sbjct  325   DTNIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHTIDMYGSACREALAAKQ  384

Query  942   KTSELQR-------WrveeerrineeevnekskssvtsetkktgggenMP----------  1070
             +  ELQR       W  E +      +   + + +  +    +     +           
Sbjct  385   EAKELQRQKLEDEGWVQEGQISEKSIKSIVEKERANKAAMDASETASKIADLETQRRAIE  444

Query  1071  -------VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDA  1229
                      +RYRRY I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+KVLRPDA
Sbjct  445   AAGSFSDSNLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVYKGYLDHTPVAIKVLRPDA  504

Query  1230  AQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSW  1409
             AQGR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL    N PPLSW
Sbjct  505   AQGRSQFQREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLSDRLYKYENTPPLSW  564

Query  1410  QVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             ++RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  565   ELRFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  601



>ref|XP_010508621.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Camelina sativa]
Length=797

 Score =   431 bits (1107),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 265/577 (46%), Positives = 346/577 (60%), Gaps = 76/577 (13%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEA--QNKDLFVTFHCFCTRKNI  179
             SQ+A+KW  ++L+SKGQ+++L+HV  ++ +S   +   E   Q + LFVTFHC+C+RK I
Sbjct  29    SQHALKWAADHLVSKGQTIILLHVILRSSSSDSGEVSAEKHMQAESLFVTFHCYCSRKEI  88

Query  180   HCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCT  356
              CLD+ ++  +I K+LT+YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCT
Sbjct  89    QCLDVTLEDDNIVKSLTEYVSSGVIENLVLGAPSRHGFMRKFKISDTPSNVAKAAPDFCT  148

Query  357   VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQ-----------------------  467
             V+VISK KISSVR A+R AP+ SPL  Q++   E                          
Sbjct  149   VYVISKGKISSVRYASRDAPYRSPLMGQIENHSEICNYEKFRNTMSFKDRTPARSSTASS  208

Query  468   -----NNPDIRTKNAPSSLRSF-DEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLG-  626
                   +P  RT N P+S     D ++  SF      S +        + G P     G 
Sbjct  209   IEDYGKSPMARTSNYPNSFYDLIDSENDISFVFSGRPSTASSGRRSTTSSGRPSTTSSGR  268

Query  627   AETVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRLG-KGN  797
               T  G SD+SFVSSG RPS     S  F+ +  +SG TPR+S+ S  S    RLG + N
Sbjct  269   PSTSTGRSDISFVSSG-RPSLSTTGSPSFIYDFPDSGLTPRMSTGSGHSM---RLGIRFN  324

Query  798   DLNSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
             D N   DFS           S S +N +E E EMRRLK EL+ T+D+Y +AC+EAL AKQ
Sbjct  325   DTNIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHTIDMYGSACREALAAKQ  384

Query  942   KTSELQR-------WrveeerrineeevnekskssvtsetkktgggenMP----------  1070
             +  ELQR       W  E +      +   + + +  +    +     +           
Sbjct  385   EAKELQRQKLEDEGWVQEGQISEKSIKSIVEKERANKAAMDASETASKIADLETQRRAIE  444

Query  1071  -------VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDA  1229
                      +RYRRY I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+KVLRPDA
Sbjct  445   AAGSFSDSNLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVYKGYLDHTPVAIKVLRPDA  504

Query  1230  AQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSW  1409
             AQGR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL    N PPLSW
Sbjct  505   AQGRSQFQREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLSDRLYKYENTPPLSW  564

Query  1410  QVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             ++RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  565   ELRFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  601



>ref|XP_010696198.1| PREDICTED: U-box domain-containing protein 35 [Beta vulgaris 
subsp. vulgaris]
Length=885

 Score =   432 bits (1112),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 274/640 (43%), Positives = 364/640 (57%), Gaps = 146/640 (23%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQT--------------SLQHKQQLEAQNKDLF  143
             SQYAI+W  ++LLS+G+++VL+HV + +                S  + QQ++ Q K+LF
Sbjct  28    SQYAIRWAIDHLLSRGRAIVLIHVTSGSSFAAASSAIVSASGPGSSPNYQQVDKQTKELF  87

Query  144   VTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPT  323
             +TF CFCTRK+I C+D+ +   D+ +AL +Y + AAIENLVLG+S+  F+++ K  D+PT
Sbjct  88    LTFRCFCTRKDIRCIDVTLKDNDVGRALIEYANYAAIENLVLGASKGGFMRKFKQADVPT  147

Query  324   LTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPS  503
             + S+ APDFC +FVISK+K+S+VRNA+RP P  SPL   L+ +         ++ K++PS
Sbjct  148   IVSRGAPDFCNIFVISKTKMSNVRNASRPVPHTSPLQNYLESV---------VKDKSSPS  198

Query  504   SLRSFDEKHMRSFK---------------------LEESESVSRPSI--------ERAAT  596
             +  S   K   S K                     L+ +++  RPS         +R   
Sbjct  199   TPVSTPPKRSLSIKGFFHFLCTTILLALVLLQMMNLDSAQAGERPSYSGCTPPRDDRELV  258

Query  597   RGI--------------------PP-------------RRMLGAETVEGDSDLSFVSSGS  677
             R I                    PP              R++ ++  E D+D+SFVSS  
Sbjct  259   RYILHTIPLEGQAHSMIIILSIIPPGYNYERSLPDRIHERLMMSDFPESDTDISFVSS-D  317

Query  678   RPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND---  845
             R S DR+S    + ++S RTPR+S+SSD SFGS R G + ND++   DFS  S E+    
Sbjct  318   RTSVDRLSVHY-DYMDSARTPRMSTSSDHSFGSVRFGQRMNDMSPRPDFSFMSQESGMTS  376

Query  846   ------------------------------EAEVEMRRLKLELQKTMDLYSTACKEALTA  935
                                           E E EMRRLKLEL++TM++YS ACKEA+ A
Sbjct  377   SSSLPSVSTLKLNEDINGQYLQLNAVNHEEETETEMRRLKLELKQTMEMYSEACKEAVVA  436

Query  936   KQK----------TSELQRW---------------rveeerrineeevnekskssvtset  1040
             K++            EL RW                V       ++      +      +
Sbjct  437   KERERQQNVKQTQAMELHRWRLEEDKKLEETGTPEEVAMVLAERKKAERAAEQQEERKLS  496

Query  1041  kktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLR  1220
                    +    V YR+YTI+EIE AT+ FSES K+GEGGYGPVFKC LDHT VAVKVLR
Sbjct  497   TGNTDYRSTNGSVSYRKYTIEEIETATDSFSESLKVGEGGYGPVFKCYLDHTRVAVKVLR  556

Query  1221  PDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPP  1400
             PDAAQGR QFQQEVE+LSC+RHPNMV+LLGACPEYGC+VYEYMA+GS+DDRL  RGN P 
Sbjct  557   PDAAQGRTQFQQEVEVLSCIRHPNMVLLLGACPEYGCIVYEYMANGSLDDRLFRRGNTPA  616

Query  1401  LSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             LSWQVRFRIAA++ TGL FLHQ KP+P+VHRDLKPGNILL
Sbjct  617   LSWQVRFRIAADIATGLNFLHQTKPEPLVHRDLKPGNILL  656



>ref|XP_010487989.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=798

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 268/582 (46%), Positives = 353/582 (61%), Gaps = 85/582 (15%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV-------DNQTQTSLQHKQQLEAQNKDLFVTFHCFC  164
             SQ+A+KW  ++L+SKGQ+++L+HV        +  + S +  +Q E+    LFVTFHC+C
Sbjct  29    SQHALKWAADHLVSKGQTIILLHVILRSSSSSDSGEISAEKHKQAES----LFVTFHCYC  84

Query  165   TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
             +RK I CLD+ ++  +I K+LT+YVS   IENLVLG+ SRH F+++ K++D P+  +KAA
Sbjct  85    SRKEIQCLDVTLEDDNIVKSLTEYVSSGIIENLVLGAPSRHGFMRKFKISDTPSNVAKAA  144

Query  342   PDFCTVFviskskissvRNATRPAPFASPLHPQLQ---EI--QEQAQNNPDIRTKN----  494
             PDFCTV+VISK KISSVR A+R AP+ SPL  Q++   EI   E+ +N    R +     
Sbjct  145   PDFCTVYVISKGKISSVRYASRDAPYRSPLMGQIENHSEICNYEKFRNTMSFRDRTPARS  204

Query  495   -APSSLRSFDEKHMRS--------FKLEESES------VSRPSI-----ERAATRGIPPR  614
                SS+  + +  M          + L +SE+        RPS          + G P  
Sbjct  205   WTASSIEDYGKSPMSRTSNYANAFYDLSDSENDISFVCSGRPSTASSGRRSTTSSGRPST  264

Query  615   RMLG-AETVEGDSDLSFVSSGSRPSGDRMSS--FLSETVESGRTPRLssssdgsfgsgRL  785
                G   T  G SD+SFVSSG RPS     S  F+ +  +SG TPR+S+ S  S    RL
Sbjct  265   TSSGRPSTSTGRSDISFVSSG-RPSLSTTGSPSFIYDFPDSGLTPRMSTGSGHSM---RL  320

Query  786   G-KGNDLNSFTDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEA  926
             G + ND N   DFS           S S +N +E E EMRRLK EL+ T+D+Y +AC+EA
Sbjct  321   GIRFNDTNIQHDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHTIDMYGSACREA  380

Query  927   LTAKQKTSELQR-------WrveeerrineeevnekskssvtsetkktgggenMP-----  1070
             L AKQ+  ELQR       W  E +      +   + + +  +    +     +      
Sbjct  381   LAAKQEAKELQRQKLEDEGWVQEGQISEKSIKSIVEKERANKAAMDASETASKIADLETQ  440

Query  1071  ------------VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKV  1214
                           +RYRRY I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+KV
Sbjct  441   RRAIEAAGSFSDSNLRYRRYVIGEIEEATNSFDKANKIGEGGYGPVYKGYLDHTPVAIKV  500

Query  1215  LRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNK  1394
             LRPDAAQGR QFQ+EVE+LSC+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL    N 
Sbjct  501   LRPDAAQGRSQFQREVEVLSCIRHPHMVLLIGACPEYGVLVYEYMAKGSLSDRLYKYENT  560

Query  1395  PPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             PPLSW++RFRIAAE+ TGLLFLHQ KP+PIVHRDLKPGNIL+
Sbjct  561   PPLSWELRFRIAAEVATGLLFLHQTKPEPIVHRDLKPGNILI  602



>ref|XP_010927278.1| PREDICTED: U-box domain-containing protein 52-like [Elaeis guineensis]
Length=764

 Score =   421 bits (1082),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 252/573 (44%), Positives = 334/573 (58%), Gaps = 93/573 (16%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQH------KQQLEAQNKDLFVTFHCFC  164
             +SQ A+KW  +NL++ G++++LVHV+ ++ ++  H      K+  + Q K+LF+ F CFC
Sbjct  26    SSQNALKWAVDNLVASGETLILVHVNTKSPSAGNHDDGACFKEPTDPQMKELFLPFRCFC  85

Query  165   TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAP  344
             TRK+I C D++++  D+AKA+ ++VS+A+IE LV+G        R + TD P+  S+ AP
Sbjct  86    TRKDIRCRDVVLEEQDVAKAIVEFVSNASIEKLVVGYPTRGGFMRFRSTDTPSNISRGAP  145

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD-IRTKNAPSSLRSFD  521
             DFCTV+VISK K+ S+RNA RPAP  SPLH     IQ QA   PD   T++     R   
Sbjct  146   DFCTVYVISKGKVLSMRNAIRPAPGISPLH---APIQSQASVKPDPAVTQHGSLGPRVLS  202

Query  522   EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM-  698
             E  + S  L   +S+  P       RG   +    A+    DSD+SFVSSG RPS DRM 
Sbjct  203   EASLDSRSLHHDDSIKSPFAR--GMRGTTAKSY--ADFSFTDSDISFVSSG-RPSVDRMY  257

Query  699   -------SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSF------TDFSSSSLE  839
                    S  L  + E   TP           +     GND +S       T +SS ++E
Sbjct  258   PPRLSTGSESLDRSFEMVTTP--------MKSADSFSTGNDFSSISQASTGTSWSSHTME  309

Query  840   NDEAEVEMRRLKLEL------------------QKTMDLY--------------------  905
             + EAE  M+RL+LEL                  QK M+L+                    
Sbjct  310   DVEAE--MKRLRLELKQTMEMYNTACREAITAKQKAMELHRWKTEEEQRLVEAKMAEESA  367

Query  906   -------STACKEALTAKQKTSELQRWrveeerrineeevnekskssvtsetkktgggen  1064
                       C+ AL A Q +  +     ++      + + E  +    ++         
Sbjct  368   LALVEREKANCRAALEAAQASQRIAELEAQKRAHAEMKALKEAEERKRAADI--------  419

Query  1065  MPVPV-RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGR  1241
             +P PV RYRRY I++IE ATE+F+E RKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR
Sbjct  420   IPRPVVRYRRYAIEDIEAATEYFAEHRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGR  479

Query  1242  EQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRF  1421
              QFQQEVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DDRL  RGN P + WQ RF
Sbjct  480   SQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPVIPWQHRF  539

Query  1422  RIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RIAAE+ +GLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  540   RIAAEIASGLLFLHQTKPEPLVHRDLKPGNILL  572



>ref|XP_008798198.1| PREDICTED: U-box domain-containing protein 52 [Phoenix dactylifera]
Length=788

 Score =   412 bits (1060),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 254/573 (44%), Positives = 337/573 (59%), Gaps = 93/573 (16%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQH------KQQLEAQNKDLFVTFHCFCT  167
             SQ A+KW  +NL++ G++++LVHV+ ++  +  H      K+  + Q K+LF+ F CFCT
Sbjct  27    SQNALKWAVDNLVTSGETLILVHVNTKSPPAGNHEDGACFKEPTDPQMKELFLPFRCFCT  86

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAP  344
             RK+I   D+L++  D+AKA+ ++VS AAIE LV+G  S+  F++R K  D PT  SK AP
Sbjct  87    RKDIRSKDVLLEEHDVAKAIVEFVSHAAIEKLVVGYPSKGGFMRRFKSADTPTNISKGAP  146

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPS-SLRSFD  521
             DFCTV+VISK K+ S+RNA R AP  SPLH Q   IQ  A    D  T+   S   R+  
Sbjct  147   DFCTVYVISKGKVLSMRNAVRAAPAISPLHAQ---IQSPASLKSDTVTQQHCSLGPRALS  203

Query  522   EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEG----DSDLSFVSSGSRPSG  689
             +  + S  L + +S+  P       RG+   R + A++       DSD+SFVSSG RPS 
Sbjct  204   DAALVSRSLHQDDSIKSP-----FARGM---RGMTAKSYTDLSFPDSDISFVSSG-RPSV  254

Query  690   DRM-SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSF------TDFSSSSLENDE  848
             DRM    LS   E+         +     +     GND +S       T +SS ++E+ E
Sbjct  255   DRMYPPRLSSGSEALDHRSFEMVTTPMKSADSFSTGNDFSSISQGSTGTSWSSQTMEDVE  314

Query  849   AEVEMRRLKLEL------------------QKTMDLY-----------------------  905
             AE  M+RL+LEL                  QK M+L+                       
Sbjct  315   AE--MKRLRLELKQTMDMYNTACREAITAKQKAMELHRWKTEEEQRLAEAKMAEESAMAL  372

Query  906   -------STACKEALTAKQKTSELQRWrveeerrineeevnekskssvtsetkktgggen  1064
                    S A  EA  A Q+ +EL+            ++       ++    ++    ++
Sbjct  373   VERERANSRAALEAARASQRIAELE-----------AQKRIHAEMKALKEAEERKRAADS  421

Query  1065  MP-VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGR  1241
             +P   VRYRRY I++IE ATE+F+E RK+GEGGYGPV+KC LDHT VA+KVLRPDAAQGR
Sbjct  422   IPHAVVRYRRYMIEDIEAATEYFAEHRKVGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGR  481

Query  1242  EQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRF  1421
              QFQQEVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DDRL  RGN P + WQ RF
Sbjct  482   SQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPIIPWQHRF  541

Query  1422  RIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RIAAE+  GLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  542   RIAAEIARGLLFLHQTKPEPLVHRDLKPGNILL  574



>gb|KHN30795.1| U-box domain-containing protein 35 [Glycine soja]
Length=748

 Score =   402 bits (1033),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 263/553 (48%), Positives = 344/553 (62%), Gaps = 66/553 (12%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQL----------------------  119
             SQ A+KW  ++LL+KG +VVL++V ++  +       +                      
Sbjct  28    SQNALKWAIDHLLTKGSNVVLLYVKHKPSSLSASASLMTPRVVANGIGHPEPSALVCHDP  87

Query  120   EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKR  299
             + + K++F  +  FC RK+IHC D++++  DI+KAL +Y S  AIE+LV+GSS      R
Sbjct  88    DDKTKEIFRPYRVFCARKDIHCKDVVLEDVDISKALIEYASQYAIEHLVIGSSNKGGFLR  147

Query  300   LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN--  473
              KV DIP   SK APDFCTV+V++K KI S+R+A+R AP  SPL  QL     ++ ++  
Sbjct  148   FKVADIPGTVSKGAPDFCTVYVVAKGKIQSMRSASRAAPAFSPLQNQLSHASARSDHSEP  207

Query  474   --PDIRTKNAPSSLRSFDEKHMRSFKL-EESESVSRPSIERAATRGIPPRRMLGAETVEG  644
               P +     P   RSF+    RS     +S   +  S     TR     +  G  +V  
Sbjct  208   RGPLVNGAKGPER-RSFEAPPRRSQDAPRKSNDGTTDSFRSPFTRRGMYDKSYGEISVP-  265

Query  645   DSDLSFVSSGSRPSGDRMSSFLSETV-----ESG-RTPRLssssdg-----sfgsgRLGK  791
             DSD+SFVSS  RPS D +   L         E+G   PRLS SSD      SF S   G+
Sbjct  266   DSDISFVSS-RRPSTDPLFPSLYNNNNNNHSETGISNPRLSYSSDTDGNNYSFESMHFGR  324

Query  792   GN-DLNSFT--------DFSSSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
              + D++S            SSS+L   D+ E EMRRLKLEL++T++LY+ A KEALTA+Q
Sbjct  325   RSMDISSDFSSFSQESEGLSSSALRGVDDVEAEMRRLKLELKQTIELYNNAYKEALTAQQ  384

Query  942   KTSELQRWrveeerrineeevnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEAT  1121
             K  ELQRW++EEERR+ E ++ E++    +S                  +YTI+EIE AT
Sbjct  385   KAVELQRWKLEEERRLEEAKLAEEAALIESSHG---------------EKYTIEEIEAAT  429

Query  1122  EHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVM  1301
               F+ES+KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+EVE+LSC+RHPNMV+
Sbjct  430   NFFTESQKIGEGGYGPVYKCHLDHTPVAVKVLRPDAAQGRSQFQREVEVLSCIRHPNMVL  489

Query  1302  LLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDP  1481
             LLGACPEYGCLVYEYM++GS+DDRL  RGN  P+ WQ+RFRIAAE+GTGLLFLHQ KP+P
Sbjct  490   LLGACPEYGCLVYEYMSNGSLDDRLFCRGNTHPIPWQLRFRIAAEIGTGLLFLHQTKPEP  549

Query  1482  IVHRDLKPGNILL  1520
             +VHRDLKP NILL
Sbjct  550   LVHRDLKPANILL  562



>ref|XP_010468319.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=1204

 Score =   405 bits (1040),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 263/562 (47%), Positives = 338/562 (60%), Gaps = 81/562 (14%)
 Frame = +3

Query  36    NLLSKGQSVVLVHV--DNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHCLDILIDGT  209
             N   K   +  VHV   + +  S++   +   Q + LFVTFHC+C+RK I CLD+ ++  
Sbjct  454   NSFDKANKIGEVHVILRSSSSDSVEISAEKHKQAESLFVTFHCYCSRKEIQCLDVTLEDD  513

Query  210   DIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCTVFviskskis  386
             +I K+LT+YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCTV+VISK KIS
Sbjct  514   NIVKSLTEYVSSGIIENLVLGAPSRHGFMRKFKISDTPSNVAKAAPDFCTVYVISKGKIS  573

Query  387   svRNATRPAPFASPLHPQLQ---EI--QEQAQNNPDIRTKN-APSSLRSFDEKHMRS---  539
             SVR A+R AP+ SPL  Q++   EI   E+ +N    R +  A SS  S  E + +S   
Sbjct  574   SVRYASRDAPYRSPLMGQIENHSEICNYEKFRNTMSFRDRTPARSSTASSFEDYGKSPKA  633

Query  540   ---------FKLEESE------SVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSG  674
                      + L +SE      S  RPS    A+ G P        T  G SD+SFVSSG
Sbjct  634   RTSNYPNSFYDLSDSENDISFVSSGRPS---TASSGRP-------STSTGRSDISFVSSG  683

Query  675   SRPSGDRMSS--FLSETVES-GRTPRLssssdgsfgsgRLG-KGNDLNSFTDFS------  824
              RPS     S  F+ +  +S G TPR+S+ S  S    RLG + ND N   DFS      
Sbjct  684   -RPSLSTTGSPSFIYDFPDSSGLTPRMSTGSGHSM---RLGIRFNDTNIQHDFSFVSQDS  739

Query  825   -----SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR-------W  965
                  S S +N +E E EMRRLK EL+ T+D+Y +AC+EAL AKQ+  ELQR       W
Sbjct  740   GRSSCSCSPQNLEEVEAEMRRLKQELKHTIDMYGSACREALAAKQEAKELQRQKMEDEGW  799

Query  966   rveeerrineeevnekskssvtsetkktgggenMP-----------------VPVRYRRY  1094
               E +      +   + + +  +    +     +                    +RYRRY
Sbjct  800   VQERQISEKSTKSILEKERANKAAMDASETASKIADLETQRRAIEAAGSFSDSNLRYRRY  859

Query  1095  TIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILS  1274
              I EIEEAT  F ++ KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQ+EVE+LS
Sbjct  860   VIGEIEEATNSFDKANKIGEGGYGPVYKGYLDHTPVAIKVLRPDAAQGRSQFQREVEVLS  919

Query  1275  CMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLL  1454
             C+RHP+MV+L+GACPEYG LVYEYMA GS+ DRL    N PPLSW+ RFRIAAE+ TGLL
Sbjct  920   CIRHPHMVLLIGACPEYGVLVYEYMAKGSLADRLYRYENTPPLSWEHRFRIAAEVATGLL  979

Query  1455  FLHQNKPDPIVHRDLKPGNILL  1520
             FLHQ KP+PIVHRDLKPGNIL+
Sbjct  980   FLHQTKPEPIVHRDLKPGNILI  1001


 Score =   216 bits (551),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 178/450 (40%), Positives = 247/450 (55%), Gaps = 81/450 (18%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV--DNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNI  179
             SQ+A+KW  ++L+SKGQ+++L+HV   + +  S++   +   Q + LFVTFHC+C+RK I
Sbjct  29    SQHALKWAADHLVSKGQTIILLHVILRSSSSDSVEISAEKHKQAESLFVTFHCYCSRKEI  88

Query  180   HCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCT  356
              CLD+ ++  +I K+LT+YVS   IENLVLG+ SRH F+++ K++D P+  +KAAPDFCT
Sbjct  89    QCLDVTLEDDNIVKSLTEYVSSGIIENLVLGAPSRHGFMRKFKISDTPSNVAKAAPDFCT  148

Query  357   VFviskskissvRNATRPAPFASPLHPQLQ---EI--QEQAQNNPDIRTKN-APSSLRSF  518
             V+VISK KISSVR A+R AP+ SPL  Q++   EI   E+ +N    R +  A SS  S 
Sbjct  149   VYVISKGKISSVRYASRDAPYRSPLMGQIENHSEICNYEKFRNTMSFRDRTPARSSTASS  208

Query  519   DEKHMRS------------FKLEESE------SVSRPSIERAATRGIPPRRMLGAETVEG  644
              E + +S            + L +SE      S  RPS    A+ G P        T  G
Sbjct  209   FEDYGKSPKARTSNYPNSFYDLSDSENDISFVSSGRPS---TASSGRP-------STSTG  258

Query  645   DSDLSFVSSGSRPSGDRMS--SFLSETVE-SGRTPRLssssdgsfgsgRLG-KGNDLNSF  812
              SD+SFVSSG RPS       SF+ +  + SG TPR+   S GS  S RLG + ND N  
Sbjct  259   RSDISFVSSG-RPSLSTTGSPSFIYDFPDSSGLTPRM---STGSGHSMRLGIRFNDTNIQ  314

Query  813   TDFS-----------SSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL  956
              DFS           S S +N +E E EMRRLK EL+ T+D+Y +AC+EAL AKQ+  EL
Sbjct  315   HDFSFVSQDSGRSSCSCSPQNLEEVEAEMRRLKQELKHTIDMYGSACREALAAKQEAKEL  374

Query  957   QR-------WrveeerrineeevnekskssvtsetkktgggenMP---------------  1070
             QR       W  E +      +   + + +  +    +     +                
Sbjct  375   QRQKMEDEGWVQERQISEKSTKSILEKERANKAAMDASETASKIADLETQRRAIEAAGSF  434

Query  1071  --VPVRYRRYTIDEIEEATEHFSESRKIGE  1154
                 +RYRRY I EIEEAT  F ++ KIGE
Sbjct  435   SDSNLRYRRYVIGEIEEATNSFDKANKIGE  464



>ref|XP_009418576.1| PREDICTED: U-box domain-containing protein 35-like [Musa acuminata 
subsp. malaccensis]
Length=737

 Score =   388 bits (996),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 239/547 (44%), Positives = 327/547 (60%), Gaps = 81/547 (15%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             +S  A +W  +N+++KGQ++ L+HV+         K       +D+FV F CFCTRK+++
Sbjct  37    SSHAAFRWALDNVVTKGQTLTLIHVNT--------KSGYGDDARDVFVPFRCFCTRKDVY  88

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGSS--RHSFLKRLKVTDIPTLTSKAAPDFCT  356
               D++++ TD+AKA+  +V+DAAIE LV+GSS  R  F++  + +DI T   K  PDFCT
Sbjct  89    NKDVILEDTDVAKAIIGFVADAAIEKLVVGSSSSRGGFVRSFRNSDISTNIYKGVPDFCT  148

Query  357   VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
             V++I K K+SSV+NA RPAP  S L  Q+Q +   +   PD           S D  H  
Sbjct  149   VYLIHKGKVSSVKNAVRPAPAFSLLQKQIQGL---SSVRPD-----------SLDHSHKN  194

Query  537   SFK----LEESESVSRP--------SIERAATRG--IPPRRMLGAETVEGDSDLSFVSSG  674
               K    L  SE+   P        SI+   TRG  +  ++  G   ++GD  L+     
Sbjct  195   DMKDRNFLMPSEAAFAPRNLQREDESIKSPFTRGTCVSTKKSNGEMMIDGDKSLA----N  250

Query  675   SRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAE  854
             +R    R+S+ +S+T +                      GN++ S +  S SS   ++ E
Sbjct  251   ARSYPPRLSN-ISDTYDCN-------------SESSCSSGNEVASLSSESLSSQPKEDVE  296

Query  855   VEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL-------------------------Q  959
              ++ RL+LEL++TMD+YSTA +EALTAKQK  EL                         Q
Sbjct  297   AKLNRLRLELKQTMDMYSTARREALTAKQKAMELQRWKMEDEPRLEEAQLVKEAANVFAQ  356

Query  960   RWrveeerrineeevnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSES  1139
             R   E  R+I   +  +  +  V +ET+K          + YR+YTI+EIE AT+H+++ 
Sbjct  357   RETAEASRKIAVSKSQKNIRGEVIAETEKNDFEALSHTSLSYRKYTIEEIEVATDHYAQD  416

Query  1140  RKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACP  1319
             RKIGEGGYGPV++  LDHT VA+KVLRPDAAQGR QFQ+EVEIL C+RHPNMV+LLGACP
Sbjct  417   RKIGEGGYGPVYRGYLDHTPVAIKVLRPDAAQGRTQFQREVEILCCIRHPNMVLLLGACP  476

Query  1320  EYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDL  1499
             E+GCLVYEYMA+GS++D L  RGN PP+ WQ RFRIAAE+GTGLLFLHQ KP+P+VHRDL
Sbjct  477   EHGCLVYEYMANGSLEDCLFRRGNTPPIPWQHRFRIAAEIGTGLLFLHQTKPEPLVHRDL  536

Query  1500  KPGNILL  1520
             KP NILL
Sbjct  537   KPANILL  543



>ref|XP_006453185.1| hypothetical protein CICLE_v10010281mg, partial [Citrus clementina]
 gb|ESR66425.1| hypothetical protein CICLE_v10010281mg, partial [Citrus clementina]
Length=725

 Score =   385 bits (988),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 249/559 (45%), Positives = 328/559 (59%), Gaps = 76/559 (14%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQT------------------QTSLQHKQQLEAQN  131
             SQYA++W  ++LLS+GQ++ L+HV  +                   + +  +KQQ++ Q 
Sbjct  23    SQYALRWAVDHLLSRGQNLTLLHVKQRVSSVPNPSGNSVAISKVNNEVARIYKQQVDNQA  82

Query  132   KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
             K+LFV F CFCTRK I C +I+++ TDIAKAL DYVS   IE LVLG+ SR  F+KR K 
Sbjct  83    KELFVPFRCFCTRKEIKCKEIVLEDTDIAKALIDYVSSHTIETLVLGAASRTGFVKRFKT  142

Query  309   TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPF-ASP---LHPQLQEIQEQAQNNP  476
              DIP+  SK APD+C V+VI K KISSVR+AT   P  ASP   L  Q ++    + ++P
Sbjct  143   ADIPSNVSKGAPDYCNVYVIGKGKISSVRSATASVPVRASPGSQLQSQSRQPSHSSDSSP  202

Query  477   DIRTKNA-PSSLRSFDEKHMRSFKLEESESVSRPSIERAATR---GIPPRRMLGAETVEG  644
              +R K + P    S  E  + SF      S  RPS +R       G+ P    G++    
Sbjct  203   FLRGKGSIPKYEPSLPESDI-SFV-----SSGRPSTDRMIYDMDFGMTPWLSTGSDYESS  256

Query  645   DSDLSFVS--SGSRPSGDRMSS---FLSETVESGRTPRLssssdgsfgsg-----RLGKG  794
                 SFVS  SGSR S DR SS   F S + ESGRT   S S             RL   
Sbjct  257   ----SFVSLQSGSR-SIDRNSSPDEFSSYSQESGRTSSSSQSQSVEEVEVEMRRLRLELR  311

Query  795   NDLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMD--------------LYSTACK---E  923
               ++ ++     +L   +   E+ R KLE ++ ++                   CK   E
Sbjct  312   QTMDMYSAACKEALAAKQKARELHRWKLEEKQKLEDARMAEEAALALAEKERAKCKRAIE  371

Query  924   ALTAKQKTSELQRWrveeerrineeevnekskssvtsetkktgggenMPVPVRYRRYTID  1103
             A  A Q+ +EL+            ++       ++    ++     ++ V +RYR+Y+I+
Sbjct  372   AAEAAQRIAELE-----------AQKCKNVEFKALREAKERKAALNSLTVDLRYRKYSIE  420

Query  1104  EIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMR  1283
             EIEEATE+FS SRKIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQEVE+L  +R
Sbjct  421   EIEEATENFSNSRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQEVEVLCNIR  480

Query  1284  HPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLH  1463
             HPNMV+LLGACPE+GCL+YEYMA+GS++DRL  RG  P L WQ+RFRIAAE+ T LLFLH
Sbjct  481   HPNMVLLLGACPEFGCLIYEYMANGSLEDRLFRRGGSPVLPWQIRFRIAAEIATALLFLH  540

Query  1464  QNKPDPIVHRDLKPGNILL  1520
             Q KP+P+VHRDLKPGNILL
Sbjct  541   QTKPEPLVHRDLKPGNILL  559



>ref|XP_009400106.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=1428

 Score =   394 bits (1012),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 231/545 (42%), Positives = 327/545 (60%), Gaps = 45/545 (8%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ------HKQQLEAQNKDLFVTFHCFCT  167
             SQ A+KW  +NLL++GQ++ L+HV   +Q S         K+  + Q+K+LF+ F CFCT
Sbjct  694   SQNALKWAVDNLLARGQTLTLIHVKLTSQPSANLDDDGGFKEPTDHQSKELFLPFRCFCT  753

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAP  344
             RK++ C D+L++  D AKA+ ++VS AAIE LV+G SS+  F++R K  D+    +K  P
Sbjct  754   RKDVRCKDVLLEDVDAAKAIIEFVSHAAIEKLVVGASSKGGFVRRFKNHDVSASVTKGVP  813

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSL-----  509
             DFCTV+VI K K+S++RNA RPAP  SPL  Q+Q       +    R    P+ +     
Sbjct  814   DFCTVYVIGKGKVSAMRNAVRPAPAVSPLRAQIQSEASLKSDALPPRFLLGPNGIGFVGV  873

Query  510   -------RSFDEKHMRS-----FKLEESE----SVSRPSIERAATRGIPPRRMLGAETVE  641
                    RS   + MR+       L +++    S  RPSI++A     PPR   G++ ++
Sbjct  874   HRVSLSNRSPYARGMRASTIADLSLSDTDISFVSSGRPSIDQA----FPPRLSNGSDGLD  929

Query  642   GDSDLSFV----SSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNS  809
                +++      S+ S  +G+  SSF   +  +  + +     +      RL   + ++ 
Sbjct  930   RSFEMALTPNNRSADSYSTGNEFSSFSQGSTGTSWSSQTMEDVEDEMKKLRLELKHTMDM  989

Query  810   FTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrveeerri  989
             + +    +L   +  +E++R K++ QK +   +   +EA  A  +  + +R    +  R 
Sbjct  990   YNNACKEALSAKQKAMELQRWKVDEQKRL-YEAQMAEEAAVASVEKEKARRRVAMDTARA  1048

Query  990   neeevnekskssvtsetkktgggenMPVP--------VRYRRYTIDEIEEATEHFSESRK  1145
                    +S+  V +E            P        VRYR+YTI++IE ATE+F+E RK
Sbjct  1049  ENRIAELESQKRVDAEMMAIKDAHENNRPLDSAPRADVRYRKYTIEDIEIATEYFAEHRK  1108

Query  1146  IGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEY  1325
             IGEGGYGPV+KC LDHTAVAVKVLRPDAAQGR QFQQEVE+LSC+RHPNMV+LLGACPEY
Sbjct  1109  IGEGGYGPVYKCHLDHTAVAVKVLRPDAAQGRSQFQQEVEVLSCIRHPNMVLLLGACPEY  1168

Query  1326  GCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKP  1505
             GC+VYEYMA+GS+DDRL  RGN P + WQ RFRIA E+ TGLLFLH+ KP+P+VHRDLKP
Sbjct  1169  GCIVYEYMANGSLDDRLFRRGNSPVIPWQHRFRIACEIATGLLFLHRMKPEPLVHRDLKP  1228

Query  1506  GNILL  1520
             GNILL
Sbjct  1229  GNILL  1233



>ref|XP_007137133.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
 gb|ESW09127.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
Length=776

 Score =   380 bits (975),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 256/586 (44%), Positives = 337/586 (58%), Gaps = 102/586 (17%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV-----------------------DNQTQTSLQHKQQ  116
             SQ A+KW  +NLL +  +V+L+HV                       D+ +    +H   
Sbjct  28    SQTALKWAVDNLLMRSATVILIHVKLLAPTLSPSPSLFVPRISAFLGDDSSVVGKEH---  84

Query  117   LEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFL  293
              E QNK+LF+ +  FCTRK+IHC D+ ++ +D++KA+T+Y S   IE+LVLGSS + S L
Sbjct  85    -ECQNKNLFLPYRVFCTRKDIHCKDVQLEDSDVSKAITEYASQTGIEHLVLGSSAKTSLL  143

Query  294   KRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN  473
             KR KV+DIP   SK APDFCTV+VI+K KI ++R+ATR  P    + P L        N 
Sbjct  144   KRFKVSDIPGEISKGAPDFCTVYVIAKGKIQTMRSATRQPP---TIFPNLVYQGSVRSNI  200

Query  474   PDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
              D    + P+      E+   SF   +S S    S     TR     R  G +T   D D
Sbjct  201   SDPNMHSDPN----IKEEQSHSF---DSASQYDESFRSPFTRKHYNGRHYG-DTPNSDMD  252

Query  654   LSFVSSGSRPSGDRMSSFLSETVESG-RTPRLssssdgsfg----sgRLG-KGNDLNSFT  815
             +SFVS+G R S DR+   L+  +++G   PRLS SSD        S   G K  +LNS  
Sbjct  253   ISFVSTG-RKSTDRLIPSLN--LDTGISNPRLSYSSDTDANLSFESIHYGRKSPELNSPN  309

Query  816   DFSSSSLEND------------EAE-----------------------------VEMRRL  872
             +F+S S E+D            EAE                             VE+++ 
Sbjct  310   EFTSFSFESDNQSFTSQATDDMEAEMRRLKLELKQTMEMYNTACKEALTAHQKAVELQQW  369

Query  873   KLELQKTMDLYSTACKEALTAKQK----------TSELQRWrveeerrineeevneksks  1022
             K+E +  M+    A K+A+   +K          T+E Q+         +++ +  + K+
Sbjct  370   KIEEEMRMEEAKLAGKKAMAMAEKEKAKSKAAIETAEAQK---RIAELESQKRLVAEMKA  426

Query  1023  svtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAV  1202
                SE K+      + V +RYR+YTI+EIEEAT  FSES KIGEGGYGPVFKC LDHT V
Sbjct  427   IRESEEKRKVLDALVNVDIRYRKYTIEEIEEATNFFSESLKIGEGGYGPVFKCHLDHTPV  486

Query  1203  AVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMN  1382
             AVKVLRPDA QGR QFQ+EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+D+ L  
Sbjct  487   AVKVLRPDAQQGRSQFQREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDNCLFR  546

Query  1383  RGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GN PPL WQ+RF+IAAE+GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  547   KGNTPPLPWQLRFKIAAEIGTGLLFLHQTKPEPLVHRDLKPANILL  592



>ref|XP_010669507.1| PREDICTED: U-box domain-containing protein 52 [Beta vulgaris 
subsp. vulgaris]
Length=784

 Score =   379 bits (973),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 235/564 (42%), Positives = 328/564 (58%), Gaps = 59/564 (10%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS-----LQHKQQLEAQNKDLFVTFHCFCTR  170
             SQ+A+KW  +NLL +GQ+VVLVHV  +         + + +Q + Q KDLF+ F CFCTR
Sbjct  28    SQHALKWAIDNLLQRGQTVVLVHVKVKPSYGSNPHVVINGRQWDQQTKDLFLPFRCFCTR  87

Query  171   KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPD  347
             K+I C DI+++ +++ KALT++V+ +A+E L++G+ S+ +   R   TDIP+  SK  P+
Sbjct  88    KDIQCRDIVLEDSEVQKALTEFVTQSAVEVLIIGAASKGNLFTRFGKTDIPSAVSKGVPE  147

Query  348   FCTVFvisks-kissvRNATRPAPFASPLHPQ-LQEIQEQAQNNPDIRT---KNAPSS--  506
             FCTV++ISK  KI++ R+A RPAP  S L  Q +Q+    + + P  R    K  PS   
Sbjct  148   FCTVYIISKGGKIANTRSACRPAPLNSQLRSQIMQQPTTTSLSPPHSRIGSEKTTPSGSP  207

Query  507   -------------LRSFDEKHMRSFK--LEESE----SVSRPSIERA----ATRGIPPRR  617
                           R     HMRS+   L +++    S  RPS++R     A+  +P  R
Sbjct  208   FSGSDDLDFKSPFTRGGRHPHMRSYGDILGDTDISFVSSGRPSVDRMPLPLASDAVPEER  267

Query  618   MLGAE--TVEGDSDLSFVSSGSRPSGDRMS-----------SFLSETVESGRTPRLssss  758
                    +   D+D  + +S  R S D              SF   T  +    +  S  
Sbjct  268   RSTNNRLSTSSDNDFLYDTSHRRSSVDTPLSSPPPPSSSNISFDDMTNVNWSNTQSQSMD  327

Query  759   dgsfgsgRLGK--GNDLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMD---LYSTACKE  923
             D      RL       +N +++    +L   +  +E++R K+E ++ +D    YS     
Sbjct  328   DVEAHMKRLQMELKQTMNMYSNACKEALTAKQKALELQRWKVEEERKVDDNVRYSEEPTR  387

Query  924   ALTAKQKTSELQRWrveeer-----rineeevnekskssvtsetkktgggenMPVPVRYR  1088
             +   K+K   +      ++       +  ++       ++    +     +++   VRYR
Sbjct  388   SFMEKEKAKSMAAMEASDQAHRRLAELEAQKRVSVEMKALKEAEENNKDMDSISSAVRYR  447

Query  1089  RYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEI  1268
             RYTI+EIE ATE F+E+RKIGEGGYGPVF+C LDHT VAVKVLRPDAAQGR QFQQEVE+
Sbjct  448   RYTIEEIENATEFFAEARKIGEGGYGPVFRCQLDHTLVAVKVLRPDAAQGRSQFQQEVEV  507

Query  1269  LSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTG  1448
             LSC+RHPNMV+LLGACPEYGCLVYEYM +GS++DRL  RG  PPLSWQ RFRIAAE+ TG
Sbjct  508   LSCIRHPNMVLLLGACPEYGCLVYEYMHNGSLEDRLFCRGGSPPLSWQHRFRIAAEIATG  567

Query  1449  LLFLHQNKPDPIVHRDLKPGNILL  1520
             LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  568   LLFLHQTKPEPLVHRDLKPGNILL  591



>gb|KDO62030.1| hypothetical protein CISIN_1g035604mg [Citrus sinensis]
Length=768

 Score =   378 bits (970),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 251/589 (43%), Positives = 327/589 (56%), Gaps = 100/589 (17%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQT------------------QTSLQHKQQLEAQN  131
             SQYA++W  ++LLS+GQ++ L+HV  +                   + +  +KQQ++ Q 
Sbjct  23    SQYALRWAVDHLLSRGQNLTLLHVKQRVSSVPNPSGNSVAISKVNNEVARIYKQQVDNQA  82

Query  132   KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
             K+LFV F CFCTRK I C +I+++ TDIAKAL DYVS   IE LVLG+ SR  F+KR K 
Sbjct  83    KELFVPFRCFCTRKEIKCKEIVLEDTDIAKALIDYVSSHTIETLVLGAASRTGFVKRFKT  142

Query  309   TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI--  482
              DIP+  SK APD+C V+VI K KISSVR+AT   P  +    QLQ    Q  ++ D   
Sbjct  143   ADIPSNVSKGAPDYCNVYVIGKGKISSVRSATASVPVRASPGSQLQSQSRQPSHSSDSYE  202

Query  483   -----------------RTKNAPSSLRSFDEKHMRSF------------KLEESE----S  563
                              RT    SSL + D      F             L ES+    S
Sbjct  203   SAMTNSQSSRVAISAAERTPPTTSSLINDDVPIKSPFLRGKGSIPKYEPSLPESDISFVS  262

Query  564   VSRPSIERAATR---GIPPRRMLGAETVEGDSDLSFVS--SGSRPSGDRMSS---FLSET  719
               RPS +R       G+ P    G++        SFVS  SGSR S DR SS   F S +
Sbjct  263   SGRPSTDRMIYDMDFGMTPWLSTGSDYESS----SFVSLQSGSR-SIDRNSSPDEFSSYS  317

Query  720   VESGRTPRLssssdgsfgsg-----RLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLEL  884
              ESGRT   S S             RL     ++ ++     +L   +   E+ R KLE 
Sbjct  318   QESGRTSSSSQSQSVEEVEVEMRRLRLELRQTMDMYSAACKEALAAKQKARELHRWKLEE  377

Query  885   QKTMD--------------LYSTACK---EALTAKQKTSELQRWrveeerrineeevnek  1013
             ++ ++                   CK   EA  A Q+ +EL+            ++    
Sbjct  378   KQKLEDARMAEEAALALAEKERAKCKRAIEAAEAAQRIAELE-----------AQKCKNV  426

Query  1014  skssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDH  1193
                ++    ++     ++ V +RYR+Y+I+EIEEATE+FS SRKIGEGGYGPV+K  LDH
Sbjct  427   EFKALREAKERKAALNSLTVDLRYRKYSIEEIEEATENFSNSRKIGEGGYGPVYKSYLDH  486

Query  1194  TAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDR  1373
             T VA+KVLRPDAAQGR QFQQEVE+L  +RHPNMV+LLGACPE+GCL+YEYMA+GS++DR
Sbjct  487   TPVAIKVLRPDAAQGRSQFQQEVEVLCNIRHPNMVLLLGACPEFGCLIYEYMANGSLEDR  546

Query  1374  LMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             L  RG  P L WQ+RFRIAAE+ T LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  547   LFRRGGSPVLPWQIRFRIAAEIATALLFLHQTKPEPLVHRDLKPGNILL  595



>ref|XP_007137134.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
 gb|ESW09128.1| hypothetical protein PHAVU_009G102500g [Phaseolus vulgaris]
Length=775

 Score =   377 bits (968),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 253/585 (43%), Positives = 335/585 (57%), Gaps = 101/585 (17%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHV-----------------------DNQTQTSLQHKQQ  116
             SQ A+KW  +NLL +  +V+L+HV                       D+ +    +H   
Sbjct  28    SQTALKWAVDNLLMRSATVILIHVKLLAPTLSPSPSLFVPRISAFLGDDSSVVGKEH---  84

Query  117   LEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLK  296
              E QNK+LF+ +  FCTRK+IHC D+ ++ +D++KA+T+Y S   IE+LVLGSS  + L 
Sbjct  85    -ECQNKNLFLPYRVFCTRKDIHCKDVQLEDSDVSKAITEYASQTGIEHLVLGSSAKTSLL  143

Query  297   RLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNP  476
             + KV+DIP   SK APDFCTV+VI+K KI ++R+ATR  P    + P L        N  
Sbjct  144   KFKVSDIPGEISKGAPDFCTVYVIAKGKIQTMRSATRQPP---TIFPNLVYQGSVRSNIS  200

Query  477   DIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDL  656
             D    + P+      E+   SF   +S S    S     TR     R  G +T   D D+
Sbjct  201   DPNMHSDPN----IKEEQSHSF---DSASQYDESFRSPFTRKHYNGRHYG-DTPNSDMDI  252

Query  657   SFVSSGSRPSGDRMSSFLSETVESG-RTPRLssssdgsfg----sgRLG-KGNDLNSFTD  818
             SFVS+G R S DR+   L+  +++G   PRLS SSD        S   G K  +LNS  +
Sbjct  253   SFVSTG-RKSTDRLIPSLN--LDTGISNPRLSYSSDTDANLSFESIHYGRKSPELNSPNE  309

Query  819   FSSSSLEND------------EAE-----------------------------VEMRRLK  875
             F+S S E+D            EAE                             VE+++ K
Sbjct  310   FTSFSFESDNQSFTSQATDDMEAEMRRLKLELKQTMEMYNTACKEALTAHQKAVELQQWK  369

Query  876   LELQKTMDLYSTACKEALTAKQK----------TSELQRWrveeerrineeevnekskss  1025
             +E +  M+    A K+A+   +K          T+E Q+         +++ +  + K+ 
Sbjct  370   IEEEMRMEEAKLAGKKAMAMAEKEKAKSKAAIETAEAQK---RIAELESQKRLVAEMKAI  426

Query  1026  vtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVA  1205
               SE K+      + V +RYR+YTI+EIEEAT  FSES KIGEGGYGPVFKC LDHT VA
Sbjct  427   RESEEKRKVLDALVNVDIRYRKYTIEEIEEATNFFSESLKIGEGGYGPVFKCHLDHTPVA  486

Query  1206  VKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNR  1385
             VKVLRPDA QGR QFQ+EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+D+ L  +
Sbjct  487   VKVLRPDAQQGRSQFQREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDNCLFRK  546

Query  1386  GNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GN PPL WQ+RF+IAAE+GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  547   GNTPPLPWQLRFKIAAEIGTGLLFLHQTKPEPLVHRDLKPANILL  591



>gb|EPS61860.1| hypothetical protein M569_12933, partial [Genlisea aurea]
Length=585

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 236/439 (54%), Positives = 296/439 (67%), Gaps = 42/439 (10%)
 Frame = +3

Query  294   KRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQE----Q  461
             +R K+ DIP   SK+APDFCTV VISK+KI+SVRNA R APF SPL  Q+Q+  +    +
Sbjct  1     RRFKMIDIPASVSKSAPDFCTVHVISKTKIASVRNAFRQAPFTSPLLAQIQKNVDHRASE  60

Query  462   AQNNPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVE  641
             A   P + T   P     F         +++++ V  P    +  RG    +M G +  E
Sbjct  61    AAAPPQVTTARGPEKASPFRAA------VDDTDLVRSPF---SKARGYH-SKMFG-DPSE  109

Query  642   GDSDLSFVSSGSRPSGDRMS-----SFLSETVESGRTPRLssssdgsfgsgRLG--KGND  800
              DSD+SF+SS  RPS DR+S       L +++++ R  RLS+SSD S+GS R G  K ++
Sbjct  110   FDSDISFISS-DRPSTDRLSIDRIPGMLPDSIDARRNSRLSTSSDSSYGSIRSGTTKASE  168

Query  801   LNSFTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL--------  956
             ++SFT+FSSSS+E+D+ E EMRRLKLELQKTM++YSTACKEALTAKQK SEL        
Sbjct  169   MSSFTNFSSSSMESDDVETEMRRLKLELQKTMEMYSTACKEALTAKQKASELIMYNFYYY  228

Query  957   -----------QRWrveeerrineeevnekskssvtsetkktgggenMPVPVRYRRYTID  1103
                        +R   E     +   +  + +S   S    +     +   ++YRRY+I+
Sbjct  229   AFELHKWRVDEERRMEETRLTEDSARLTTEQESGKRSSFTDSKDKGYIMSSLQYRRYSIE  288

Query  1104  EIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMR  1283
             EIEEATE FSESRK+GEGGYGPVFKC LDHT VAVKVLRPDAAQGR QFQQEVE+LSC+R
Sbjct  289   EIEEATESFSESRKVGEGGYGPVFKCYLDHTPVAVKVLRPDAAQGRSQFQQEVEVLSCLR  348

Query  1284  HPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLH  1463
             HPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN   LSW +RFRIAAE+ TGL FLH
Sbjct  349   HPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTRALSWPLRFRIAAEISTGLHFLH  408

Query  1464  QNKPDPIVHRDLKPGNILL  1520
             Q KP+P+VHRD KP NILL
Sbjct  409   QKKPEPLVHRDFKPANILL  427



>ref|XP_006474648.1| PREDICTED: U-box domain-containing protein 35-like [Citrus sinensis]
Length=1173

 Score =   374 bits (959),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 246/583 (42%), Positives = 324/583 (56%), Gaps = 94/583 (16%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQT------------------QTSLQHKQQLEAQN  131
             SQYA++W  ++LLS+GQ++ L+HV  +                   + +  +KQQ++ Q 
Sbjct  434   SQYALRWAVDHLLSRGQNLTLLHVKQRVSSVPNPSGNSVAISKVNNEVARIYKQQVDNQA  493

Query  132   KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVT  311
             K+LFV F CFCTRK I C +I+++ TDIAKAL DYVS   IE LVLG++  +   + K  
Sbjct  494   KELFVPFRCFCTRKEIKCKEIVLEDTDIAKALIDYVSSHTIETLVLGAASRTGFVKFKTA  553

Query  312   DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI---  482
             DIP+  SK APD+C V+VI K KISSVR+AT   P  +    QLQ    Q  ++ D    
Sbjct  554   DIPSNVSKGAPDYCNVYVIGKGKISSVRSATASVPVRASPGSQLQSQSRQPSHSSDSYES  613

Query  483   -----------RTKNAPSSLRSFDEKHMRSF------------KLEESE----SVSRPSI  581
                        RT    SSL + D      F             L ES+    S  RPS 
Sbjct  614   AMTNSQSSRAERTPPTTSSLINDDVPIKSPFLRGKGSIPKYEPSLPESDISFVSSGRPST  673

Query  582   ERAATR---GIPPRRMLGAETVEGDSDLSFVS--SGSRPSGDRMSS---FLSETVESGRT  737
             +R       G+ P    G++        SFVS  SGSR S DR SS   F S + ESGRT
Sbjct  674   DRMIYDMDFGMTPWLSTGSDYESS----SFVSLQSGSR-SIDRNSSPDEFSSYSQESGRT  728

Query  738   PRLssssdgsfgsg-----RLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMD-  899
                S S             RL     ++ ++     +L   +   E+ R KLE ++ ++ 
Sbjct  729   SSSSQSQSVEEVEVEMRRLRLELRQTMDMYSAACKEALAAKQKARELHRWKLEEKQKLED  788

Query  900   -------------LYSTACK---EALTAKQKTSELQRWrveeerrineeevnekskssvt  1031
                               CK   EA  A Q+ +EL+            ++       ++ 
Sbjct  789   ARMAEEAALALAEKERAKCKRAIEAAEAAQRIAELE-----------AQKCKNVEFKALR  837

Query  1032  setkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVK  1211
                ++     ++ V +RYR+Y+I+EIEEATE+FS SRKIGEGGYGPV+K  LDHT VA+K
Sbjct  838   EAKERKAALNSLTVDLRYRKYSIEEIEEATENFSNSRKIGEGGYGPVYKSYLDHTPVAIK  897

Query  1212  VLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGN  1391
             VLRPDAAQGR QFQQEVE+L  +RHPNMV+LLGACPE+GCL+YEYMA+GS++DRL  RG 
Sbjct  898   VLRPDAAQGRSQFQQEVEVLCNIRHPNMVLLLGACPEFGCLIYEYMANGSLEDRLFRRGG  957

Query  1392  KPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              P L WQ+RFRIAAE+ T LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  958   SPVLPWQIRFRIAAEIATALLFLHQTKPEPLVHRDLKPGNILL  1000


 Score =   143 bits (360),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 176/337 (52%), Gaps = 66/337 (20%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQH---------KQQLEAQNKDLFVTFHC  158
            SQ+A+KW  +N+LS+ Q++ LVHV  ++ ++ Q+         +QQ +    ++F+ F C
Sbjct  30   SQHALKWAADNILSRHQTIKLVHVIQKSHSNSQYSGISEELIEQQQHDIHAMEVFLPFRC  89

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRL-KVTDIPTLTSK  335
            +CTR++I C  ++++  D+A+AL +YVS   +E ++LG+   + L RL K +D P    K
Sbjct  90   YCTRRHIQCELVVLERQDVARALIEYVSQYGVETMLLGAPTKNGLSRLFKASDTPGTVLK  149

Query  336  AAPDFCTVFviskskissvRNATRPAPFA--SPLHPQLQEIQEQAQNNPDIRTKNAPSSL  509
             APDFC V+++SK K  ++R+ATRP P     PL P+ + + E A N           ++
Sbjct  150  WAPDFCNVYIVSKGKCHALRSATRPVPPVPTEPLTPRTRLLAEAAAN-----------AI  198

Query  510  RSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSG  689
            R++DE     F   E E                               L+  +SG   + 
Sbjct  199  RNYDE-----FSTAEME-------------------------------LTLSNSGRLSTD  222

Query  690  DRMSSF-----LSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAE  854
                SF     L+   +S  +PR S  S        L   ++ +S T  SS ++E+ E +
Sbjct  223  SNFFSFYESLGLNMEGKSFDSPRASRGSINLTSLPELPSISNDSSGTSSSSQNMEDMEDD  282

Query  855  VEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            V  +RLK+EL++TMD+Y+ ACKEAL AKQK  EL++W
Sbjct  283  V--KRLKMELKQTMDMYNAACKEALAAKQKAVELEKW  317



>ref|XP_002520858.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41567.1| ATP binding protein, putative [Ricinus communis]
Length=780

 Score =   363 bits (932),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 238/572 (42%), Positives = 327/572 (57%), Gaps = 82/572 (14%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVD----------NQTQTSLQHKQQLEAQNKDLFVTFH  155
             SQYA+KW  +N L++GQSV L+H+              + +  + + LE++ +DLF+ F 
Sbjct  30    SQYALKWAVDNFLNRGQSVTLLHIALKASPPHSQYGNEEITRTYSKNLESEVRDLFLPFR  89

Query  156   CFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKR-LKVTDIPTLT  329
             CFCTRK+I C +I+I+  DI KA+ +YVS   IENL+LG+ +R   + R  K TD+P+  
Sbjct  90    CFCTRKDIKCHEIVIEDVDIPKAILEYVSTHLIENLILGTPTRGGIIARKFKSTDVPSTV  149

Query  330   SKAAPDFCTVFviskskissvRNATR--PAPFASPLHPQLQEIQEQAQNNPDIRTKNAPS  503
             SK+AP+FC V++I+K+K+SS R+AT   PA  + P             ++P I  ++ PS
Sbjct  150   SKSAPEFCNVYIINKAKVSSQRSATAQIPARHSPP------------NSSPQIMLQHRPS  197

Query  504   SLRSFDEKH-MRSFKLEESESVSRPSIERAA-TRGIPPRRMLGA-ETVEGDSDLSFVSSG  674
             +L   D  H  R  ++    +    + +R+  TRG   R  L   E    + D+SFVSSG
Sbjct  198   NLAPADTPHGNRHTRISTGRTNLITNWDRSPFTRG---RSSLNKYEPYTPEMDISFVSSG  254

Query  675   SRPSGDRMSSFLSETVESG----RTPRLssssdgsfgsgRLGKGNDLNSF----------  812
                S DR+ S  ++  + G    RT                G   DL S           
Sbjct  255   RSNSTDRIFSPFNDNSDPGTPPRRTSSTEYDYRSFGSVHSAGTSTDLGSHYSGSSQESGQ  314

Query  813   TDFSSSSLENDEAEV-----------------------------EMRRLKLELQKTMDLY  905
             T + S+++++ E+E+                             E +R KLE Q   D  
Sbjct  315   TTWYSNNMDDVESEMRRLRLELKQTMDMYSSACKEALSAKQKTREYQRWKLEEQHRFDEA  374

Query  906   STACKEALTAKQK-------TSELQRWrveeerrineeevnekskssvtsetkktgggen  1064
               A + AL   +K         E  +   +      ++ ++ ++KSS+ SE  K G    
Sbjct  375   RIAEEAALALIEKEKAKCKAAIEAAQAAQKLAELEAQKRMSLETKSSMESEETKKGKESR  434

Query  1065  MPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGRE  1244
             +P  +RYRRYTI+EIE AT  FS+  KIGEGGYGPV+KC LDHT VAVKVLR DAAQG  
Sbjct  435   VPSDIRYRRYTIEEIEAATNDFSDQLKIGEGGYGPVYKCYLDHTEVAVKVLRADAAQGMS  494

Query  1245  QFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFR  1424
             QF QEVE+LSC+RHPNMV+LLGACPE+GCLVYE+M++GS+DDRL  RGN  PL WQ+RFR
Sbjct  495   QFHQEVEVLSCIRHPNMVLLLGACPEHGCLVYEHMSNGSLDDRLFRRGNTLPLPWQMRFR  554

Query  1425  IAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             IAAE+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  555   IAAEIATGLLFLHQTKPEPLVHRDLKPGNILL  586



>gb|KHN32924.1| U-box domain-containing protein 34 [Glycine soja]
Length=731

 Score =   360 bits (924),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 321/531 (60%), Gaps = 51/531 (10%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQL-----EAQNKDLFVTFHCFCT  167
             TSQ+A KW  +NLL K Q ++L+HV  Q  +S+     L     + ++K+LF +F  FC 
Sbjct  25    TSQHAAKWAVDNLLPKDQCLLLIHV-RQRPSSVPLSDHLSEAVGDNESKELFESFRVFCN  83

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAP  344
             RK+I C ++L++ TDI+KAL D +S   IE LVLG+ SR   ++R + TD+P+  SK AP
Sbjct  84    RKSIQCKEVLLEDTDISKALIDTISTNTIELLVLGAPSRGGLVRRFRTTDVPSTVSKGAP  143

Query  345   DFCTVFviskskissvRNATRPAPFASPL------------HPQLQEIQEQAQNNPDIRT  488
              FCTV++ISK KISSVR+AT P     PL             P+     +  +N P   T
Sbjct  144   QFCTVYIISKGKISSVRSATAPLAPNMPLPLPPPLPPHPMRSPERFSDSQPPRNYPPRPT  203

Query  489   KNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
                P++  S    H     ++E + +S     RA     P +          DSD+SFVS
Sbjct  204   SERPTAFGSHGAHHP---MMDEDDIIS--PFTRAGKTYEPSKFQ--------DSDISFVS  250

Query  669   SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDE  848
             SG RPS +RM   L E  +S     L   ++          G ++  ++     ++    
Sbjct  251   SG-RPSVERMFPTLYEDQDSASGIALDEEAEA---------GTEM--YSSVCKEAMTAKH  298

Query  849   AEVEMRRLKLELQKTMD--LYSTACKEALTAKQKTS----ELQRWrveeerrineeevne  1010
               +E++R K+E QK ++    S++  EA+T+    +    E ++ R E  ++I   E  +
Sbjct  299   KAMELQRWKVEEQKKLEDSSMSSSPGEAVTSSSSMALMEMEQEKIREEALQKIAALEAQK  358

Query  1011  kskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILD  1190
             +    +  +  +     +     RYRRYTI+EIEEAT  FSES KIGEGGYGPV++C LD
Sbjct  359   RMSLQMERKKPEEKTVSSFGHTARYRRYTIEEIEEATNMFSESLKIGEGGYGPVYRCELD  418

Query  1191  HTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDD  1370
              T VA+KVL+PDAAQGREQFQQEVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD
Sbjct  419   CTQVAIKVLKPDAAQGREQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDD  478

Query  1371  RLMNRG-NKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              L  RG ++PPL WQ+RF+IAAE+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  479   CLFPRGKSRPPLPWQLRFQIAAEIATGLLFLHQTKPEPLVHRDLKPGNILL  529



>ref|XP_006572917.1| PREDICTED: U-box domain-containing protein 52-like [Glycine max]
Length=798

 Score =   353 bits (907),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 243/583 (42%), Positives = 330/583 (57%), Gaps = 92/583 (16%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQL-----EAQNKDLFVTFHCFCT  167
             TSQ+A KW  +NLL K Q ++L+HV  Q  +S+     L     + ++K+LF +F  FC 
Sbjct  25    TSQHAAKWAVDNLLPKDQCLLLIHV-RQRPSSVPSSDHLSEAVGDNESKELFESFRVFCN  83

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAP  344
             RK+I C ++L++ TDI+KAL D +S   IE LVLG+ SR   ++R + TD+P+  SK AP
Sbjct  84    RKSIQCKEVLLEDTDISKALIDTISTNTIELLVLGAPSRGGLVRRFRTTDVPSTVSKGAP  143

Query  345   DFCTVFviskskissvRNATRP-AP-----------FASPLH---------------PQL  443
              FCTV++ISK KISSVR+AT P AP             +P +               P+ 
Sbjct  144   QFCTVYIISKGKISSVRSATAPLAPNKAAIAAAAAAATTPRNQLQPQQQPHPQIMRSPER  203

Query  444   QEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRML  623
                 +  +N P   T   P++  S    H     ++E + +S     RA     P +   
Sbjct  204   FSDSQPPRNYPPRPTSERPTAFGSHGAHHP---MMDEDDIIS--PFTRAGKTYEPSKFQ-  257

Query  624   GAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVES------GRTPRLssssdgsfgsgRL  785
                    DSD+SFVSSG RPS +RM   L E  +S      GR       +  +      
Sbjct  258   -------DSDISFVSSG-RPSVERMFPTLYEDQDSASGIALGRFSDYDGRNSFASSYSSQ  309

Query  786   GKGNDLNSFTDFSSSSLENDEAE-------------------------------VEMRRL  872
              +G D +SF+  S  S   D+ E                               +E++R 
Sbjct  310   SQGIDDHSFSSQSRLSDCTDDVEFEMRRLKLELKQTMEMYSSVCKEAMTAKQKAMELQRW  369

Query  873   KLELQKTMD--LYSTACKEALTAKQKTS----ELQRWrveeerrineeevnekskssvts  1034
             K+E QK ++    S++  EA+T+    +    E ++ R E  ++I   E  ++    +  
Sbjct  370   KVEEQKKLEDSSMSSSPGEAVTSSSSMALMEMEQEKIREEALQKIAALEAQKRMSLQMER  429

Query  1035  etkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKV  1214
             +  +     +     RYRRYTI+EIEEAT  FSES KIGEGGYGPV++C LD T VA+KV
Sbjct  430   KKPEEKTLSSFGHTARYRRYTIEEIEEATNMFSESLKIGEGGYGPVYRCELDCTQVAIKV  489

Query  1215  LRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRG-N  1391
             L+PDAAQGREQFQQEVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  RG +
Sbjct  490   LKPDAAQGREQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFPRGKS  549

Query  1392  KPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +PPL WQ+RF+IAAE+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  550   RPPLPWQLRFQIAAEIATGLLFLHQTKPEPLVHRDLKPGNILL  592



>gb|AET05083.2| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=774

 Score =   349 bits (896),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 233/568 (41%), Positives = 323/568 (57%), Gaps = 81/568 (14%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHVDNQTQ----TSLQHKQQLEAQNKDLFVTFHCFCTR  170
             TSQYA KW  +NLL K Q ++LVHV  +      TS  + +Q++ ++K+LF +F  FC R
Sbjct  25    TSQYAAKWAVDNLLPKDQHLLLVHVRQKASSIPTTSRAYMRQMDNESKELFSSFRVFCNR  84

Query  171   KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPD  347
             KNI C ++L++  D++KA+ + + + +IE LVLG+ SR   ++R + +D+P+L SK AP+
Sbjct  85    KNILCKEVLLEDMDVSKAIIEGIREYSIELLVLGAPSRSGLVRRFRTSDVPSLVSKGAPE  144

Query  348   FCTVFviskskissvRNATRPAPF-ASPLH-----------PQLQEIQEQAQNNPDIR--  485
             FCTV++ISK KI SV+ AT P    A P +           P   ++Q+Q +N+P +R  
Sbjct  145   FCTVYIISKGKIQSVKTATSPLTLKAMPRNALQPPQQPQQSPNRIDVQQQKRNHP-LRCI  203

Query  486   ---TKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERA---------ATRGIPPRRMLGA  629
                T+ A  +  S++     S     S    RPSI+R          +  GI PR     
Sbjct  204   SPFTRGARPTHISYESSISDSDISFVSSG--RPSIDRMFHSLYEEMDSGNGITPR-----  256

Query  630   ETVEGDSDLSFVSSGSRPSGDRM-----SSFLSETVESGRTPRLssssdgsfgsg-----  779
               + G SD    S GS  SG +       SF S+          S S   +         
Sbjct  257   --ISGSSDYDLRSFGSLYSGVKSIDHNDYSFTSQGSGRSGMSMSSQSRISNSDKVEAEMR  314

Query  780   --RLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMD--------------LYST  911
               RL     +  ++     +L   +  +E++R KL+ ++ M+                  
Sbjct  315   RLRLELKQTMEMYSTACKEALTAKQKALELQRWKLDEERKMEDTRFCEETSLAVAEKERA  374

Query  912   ACK---EALTAKQKTSELQRWrveeerrineeevnekskssvtsetkktgggenMPVPVR  1082
              CK   EA  A +K +EL+           +    E   +S + + K+T G   +  P R
Sbjct  375   KCKVAMEAAEASRKIAELE---------AQKRMKVEIKSNSDSDQRKRTFGDSVLNSPAR  425

Query  1083  YRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEV  1262
             YRRYTI+EIEEAT +FS S KIGEGGYGPV++  LDHTAVA+KVL+PDAAQGR QFQQEV
Sbjct  426   YRRYTIEEIEEATNYFSNSLKIGEGGYGPVYRAELDHTAVAIKVLKPDAAQGRSQFQQEV  485

Query  1263  EILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNK--PPLSWQVRFRIAAE  1436
             E+LS +RHP+MV+LLGACPE+GCLVYE+M +GS+DD L  R N   P L WQ+RFRIAAE
Sbjct  486   EVLSSIRHPHMVLLLGACPEFGCLVYEHMTNGSLDDCLFRRNNSKLPVLPWQLRFRIAAE  545

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  546   IATGLLFLHQTKPEPLVHRDLKPGNILL  573



>ref|XP_003630605.1| U-box domain-containing protein [Medicago truncatula]
 gb|AET05081.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=801

 Score =   349 bits (895),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 236/593 (40%), Positives = 324/593 (55%), Gaps = 103/593 (17%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHV-----------------DNQTQTSLQHKQQLEAQN  131
             TSQYA KW  +NLL K Q ++LVHV                 D        + +Q++ ++
Sbjct  25    TSQYAAKWAVDNLLPKDQHLLLVHVRQKASSIPTTTGSHVSVDANDDVGRAYMRQMDNES  84

Query  132   KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
             K+LF +F  FC RKNI C ++L++  D++KA+ + + + +IE LVLG+ SR   ++R + 
Sbjct  85    KELFSSFRVFCNRKNILCKEVLLEDMDVSKAIIEGIREYSIELLVLGAPSRSGLVRRFRT  144

Query  309   TDIPTLTSKAAPDFCTVFviskskissvRNATRP-APFASPLHPQLQ--------EIQEQ  461
             +D+P+L SK AP+FCTV++ISK KI SV+ AT P  P A P +  LQ         +Q+ 
Sbjct  145   SDVPSLVSKGAPEFCTVYIISKGKIQSVKTATSPLTPKAMPRNNALQPQQSPDRINVQQL  204

Query  462   AQNNPDIRTKNAPSSL--RSFDEKHM------------RSFKLEESE------SVSRPSI  581
              +N+P   +   P+ L  R  DE  +            RS++   S+      S  RPSI
Sbjct  205   MRNHPLRPSNEKPTYLAHRPGDEGEIISPFTKGARPTHRSYESSISDSDISFVSSGRPSI  264

Query  582   ERA---------ATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM-----SSFLSET  719
             +R          +  GI PR       + G SD    S GS  SG +       SF S+ 
Sbjct  265   DRMFPSLYEEMDSGNGITPR-------ISGSSDYDLRSFGSLYSGVKSIDHNDYSFTSQD  317

Query  720   VESGRTPR-------LssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKL  878
                             S   +      RL     +  ++     +L   E  +E++R KL
Sbjct  318   SGRSGMSMSSQSRISYSDEVEAEMRRLRLELKQTMEMYSTACKEALTAKEKALELQRWKL  377

Query  879   ELQKTMD-----------------LYSTACKEALTAKQKTSELQRWrveeerrineeevn  1007
             + Q+ ++                   S A  EA  A +K +EL+           +    
Sbjct  378   DEQRKLEDTRFSEETSLEVAEKERAKSKAAMEAAEASRKIAELE---------AQKRVSV  428

Query  1008  ekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCIL  1187
             E   +S + + K+T G   +  P RYRRYTI+EIEEAT +FS S KIGEGGYGPV++  L
Sbjct  429   EMKSNSDSDQRKRTFGDSVLNSPARYRRYTIEEIEEATNYFSNSLKIGEGGYGPVYRAEL  488

Query  1188  DHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVD  1367
             DHTAVA+KVL+PDAAQGR QFQQEVE+LS +RHP+MV+LLGACPE+GCLVYE+M +GS+D
Sbjct  489   DHTAVAIKVLKPDAAQGRSQFQQEVEVLSSIRHPHMVLLLGACPEFGCLVYEHMTNGSLD  548

Query  1368  DRLMNRGNK--PPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             D L  R N   P L WQ+RFRIAAE+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  549   DCLFRRNNSKLPVLPWQLRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILL  601



>ref|XP_009354312.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=752

 Score =   345 bits (885),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 225/553 (41%), Positives = 320/553 (58%), Gaps = 69/553 (12%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHC  185
             S++AIKW  ++LL++GQ + L+HV NQT +  Q       Q + LF++F   C++KNI C
Sbjct  26    SEHAIKWAVDHLLTRGQPLTLLHV-NQTGSDPQ-------QTQGLFLSFRSLCSKKNIKC  77

Query  186   LDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVFv  365
              +++I  TDI  A+ DYV+   +E LVLG+   S L R K+TD+P+  SK APDFC+V+V
Sbjct  78    NEVVIKDTDIPNAIIDYVTANTVEILVLGAPSKSGLFRFKLTDVPSTVSKGAPDFCSVYV  137

Query  366   iskskissvRNAT--------------RPAPFASPLHPQLQEIQE-QAQNNPD--IRTKN  494
             I K K+S +R AT              +P+P +      L  +Q   A+N PD  I+ K+
Sbjct  138   IGKGKVSYMRCATSAPQKSAQRNQVQRQPSPNSEARSSALNRMQNYSARNQPDGDIQIKS  197

Query  495   APSSLR-SFDEKHMRSFKLEES-ESVSRPSIERAATR-------GIPPRRMLGAETVEGD  647
               +  R S D+ +  S + + S  S  RPSI+R + R       G+  R  +G++     
Sbjct  198   PFARGRPSMDKSYELSPETDISFVSSGRPSIDRMSPRCDFGVESGMNSRLSIGSDGDNRS  257

Query  648   SDLS-----FVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSF  812
             S  S     F+  GS      MSS  ++  +S  + +     +      +L     +  +
Sbjct  258   STSSYSRHKFLDMGSLQY--EMSSCSTDGGKSWSSSQNMDDVEAEMRRLKLELKQTMEMY  315

Query  813   TDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALT-----------------AKQ  941
             +     +L   + E E+ R KLE ++ +++   A + AL                  A Q
Sbjct  316   STACKEALTAKDKEKEINRWKLEDEQRLEVARHAEEAALALVEREKAKCKAAIEAAKAAQ  375

Query  942   KTSELQRWrveeerrineeevnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEAT  1121
             + +EL+  + +       +E  EK+K+                   RYR+YTI+EIE AT
Sbjct  376   RIAELEAQKRKVAEMKAHKESEEKNKALQARSYDP-----------RYRKYTIEEIESAT  424

Query  1122  EHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVM  1301
               FS++RKIGEGGYGPV++  LDHT VA+KVLRPDAAQG+ QF+QEVE+LS +RHPNMV+
Sbjct  425   NDFSQARKIGEGGYGPVYRGELDHTRVAIKVLRPDAAQGQSQFKQEVEVLSSIRHPNMVL  484

Query  1302  LLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDP  1481
             LLGACPEYGCLVYEYM++GS++DRL  RGN P + WQ+RFRIAAE+GTGLLF HQ KP+P
Sbjct  485   LLGACPEYGCLVYEYMSNGSLEDRLFCRGNTPVIPWQIRFRIAAEIGTGLLFFHQAKPEP  544

Query  1482  IVHRDLKPGNILL  1520
             +VHRDLKPGNILL
Sbjct  545   LVHRDLKPGNILL  557



>emb|CDY60522.1| BnaAnng16890D [Brassica napus]
Length=737

 Score =   344 bits (882),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 233/557 (42%), Positives = 304/557 (55%), Gaps = 91/557 (16%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKD----LFVTFHCFCTRK  173
             SQ A+KWT +NL+SKGQ++ L+HV  +   SL +      ++ D    LF+ F C+C RK
Sbjct  22    SQNALKWTVDNLVSKGQTLTLLHVKLKQFPSLPYSGSYPNRSGDDGTELFLPFRCYCARK  81

Query  174   NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFC  353
             ++ C D++++    AK + DYV   AIE LVLG+S+ + L R K  D+     K AP FC
Sbjct  82    DVLCQDVIVEDISAAKGILDYVQKNAIETLVLGASKMNLL-RFKAADVSNTVMKRAPSFC  140

Query  354   TVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHM  533
             TV+ ISK KISS+++AT   P ++             ++N ++  +          +  M
Sbjct  141   TVYSISKGKISSMKSATSSLPNST------------MRSNMNVERR----------QHTM  178

Query  534   RSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLS  713
                  E    +  P + R       P           DSD+SFVSSG RPS D M     
Sbjct  179   HRIHDEIQIEIKSPFMRRGYEGRYQPSMT--------DSDISFVSSG-RPSVDLMFPSFD  229

Query  714   ETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSL-------------------  836
             + +E    PRLS +SD              +S +D  S  L                   
Sbjct  230   DHIE---VPRLSVNSDYEENRISFAT----SSSSDKQSIDLGSSYTAFSSSSGRPSCSLS  282

Query  837   ENDEAEVEMRRLKLELQKTMDLYST------ACKEALTAKQK------------------  944
               DE E EMR+LK+EL+ TMD+Y++      + K+A T   K                  
Sbjct  283   TQDEIEAEMRKLKMELKHTMDMYNSACKEAISAKKAATELHKWKADKERKLEEVRLSKEE  342

Query  945   -----TSELQRWrveeerrineeevnekskssvtsetkktgggenMPVPVRYRRYTIDEI  1109
                   SE ++ RV  E  +    + E          ++          +RYR+Y I+EI
Sbjct  343   AMAMAESEKEKSRVAIETAVAAHRIAELEAQKTKHIIEENNKSVVKTTDLRYRKYIIEEI  402

Query  1110  EEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHP  1289
             EEATE FS SRKIGEGGYGPV+K  LD T VA+KVLRPDAAQGR QFQQEVE+L+ MRHP
Sbjct  403   EEATEDFSPSRKIGEGGYGPVYKGTLDFTQVAIKVLRPDAAQGRSQFQQEVEVLTSMRHP  462

Query  1290  NMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQN  1469
             NMV+LLGACPEYGCLVYEYMA+GS+DD L  RGN P LSWQ+RFRIAAE+ TGL FLHQ 
Sbjct  463   NMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGNSPALSWQLRFRIAAEIATGLHFLHQM  522

Query  1470  KPDPIVHRDLKPGNILL  1520
             KP+P+VHRDLKPGNILL
Sbjct  523   KPEPLVHRDLKPGNILL  539



>ref|XP_006412615.1| hypothetical protein EUTSA_v10026931mg, partial [Eutrema salsugineum]
 gb|ESQ54068.1| hypothetical protein EUTSA_v10026931mg, partial [Eutrema salsugineum]
Length=1155

 Score =   351 bits (900),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 221/587 (38%), Positives = 325/587 (55%), Gaps = 93/587 (16%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHV--------------DNQTQTSLQHKQ------QLE  122
             +SQ A+KW  +N+L +G +V+LVHV               N ++TS  +        + E
Sbjct  416   SSQNALKWAVDNMLQRGSTVLLVHVKTRASSLSTNPSINSNPSKTSQINSDSSLVCGEPE  475

Query  123   AQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKR  299
                K L++ F C C+RK+I C D+L++ +D+AKAL +Y +   IE LV+GSS +  FL+ 
Sbjct  476   GSIKQLYLPFRCLCSRKDIQCKDVLLEDSDVAKALVEYANQVIIEVLVIGSSSKGGFLRF  535

Query  300   LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPL-----------HPQL-  443
              K TDIP + +K APDFC+V+V++K K+S+ R A+R AP  SPL           HP L 
Sbjct  536   NKPTDIPGIVTKTAPDFCSVYVVTKGKLSTKRIASRTAPSVSPLRIQLQQNSLKPHPPLP  595

Query  444   --------QEIQEQAQNNPDIRTKN-------APSSLRSFDEKHMRSFKLEESE----SV  566
                     Q  + Q + + D ++ +       +P + R  + +      L +++    S 
Sbjct  596   STNTRAERQSFESQHRRSLDDQSDSFRYTSLLSPFTRRGLNGRSYGDLSLPDADISFISS  655

Query  567   SRPSIERAATRGI---------PPRRMLGAETVEGDSDLSFVSSGSR------PSGDRMS  701
              RPS ER ++  +         PP R+     ++  S    +++G R      P+     
Sbjct  656   GRPSTERNSSTSLYDNYDPNRTPPPRLSNFSDIDSGS-FESMTNGRRSMDISSPTAFSTG  714

Query  702   SFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLE  881
             SF ++   S  +       +      +L     +  ++     +L   +   E++R K+E
Sbjct  715   SFETDRFSSA-SQVADIDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRWKME  773

Query  882   LQK--------------TMDLYSTACKEALTAKQKTSELQRWrveeerrineeevneksk  1019
              ++               ++      K A+ A Q+ +E++          + + ++ + K
Sbjct  774   EERKLEEAKNAEEAALAIVEKEKAKSKAAIEAAQRIAEIE----------SRKRISAEMK  823

Query  1020  ssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTA  1199
             + + SE K           VRYR+Y+I+EIE+AT++F E  KIGEGGYGPV+KC LDHT 
Sbjct  824   ALMESEEKTKAVNALAHADVRYRKYSIEEIEDATDYFDEKYKIGEGGYGPVYKCYLDHTP  883

Query  1200  VAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLM  1379
             VAVK LRPDA QGR QFQ+EVE+LSCMRHPNMV+LLGACPE GCLVYE+MA+GS++DRL 
Sbjct  884   VAVKALRPDATQGRSQFQKEVEVLSCMRHPNMVLLLGACPECGCLVYEFMANGSLEDRLF  943

Query  1380  NRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              +GN PPLSWQ RFRIAAE+GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  944   RQGNTPPLSWQTRFRIAAEIGTVLLFLHQTKPEPLVHRDLKPANILL  990



>ref|XP_003630607.1| U-box domain-containing protein [Medicago truncatula]
Length=802

 Score =   339 bits (870),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 235/596 (39%), Positives = 322/596 (54%), Gaps = 109/596 (18%)
 Frame = +3

Query  3     TSQYAIKWTTENLLSKGQSVVLVHV-----------------DNQTQTSLQHKQQLEAQN  131
             TSQYA KW  +NLL K Q ++LVHV                 D        + +Q++ ++
Sbjct  25    TSQYAAKWAVDNLLPKDQHLLLVHVRQKASSIPTTTGSHVSVDANNDVGRAYMRQMDNES  84

Query  132   KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVT  311
             K+LF +F  FC RKNI C ++L++  D++KA+ + + + +IE LVLG+   S L  ++ +
Sbjct  85    KELFSSFRVFCNRKNILCKEVLLEDMDVSKAIIEGIREYSIELLVLGAPSRSGL--VRTS  142

Query  312   DIPTLTSKAAPDFCTVFviskskissvRNATRPAPF-ASPLH-----------PQLQEIQ  455
             D+P+L SK AP+FCTV++ISK KI SV+ AT P    A P +           P   ++Q
Sbjct  143   DVPSLVSKGAPEFCTVYIISKGKIQSVKTATSPLTLKAMPRNALQPPQQPQQSPNRIDVQ  202

Query  456   EQAQNNPDIRTKNAPSSL---RSFDEKHMRS----------FKLEESE--------SVSR  572
             +Q +N+P +R+ N   +    RS D+  M S             E S         S  R
Sbjct  203   QQKRNHP-LRSSNEKQTYHARRSVDKDEMISPFTRGARPTHISYESSISDSDISFVSSGR  261

Query  573   PSIERA---------ATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM-----SSFL  710
             PSI+R          +  GI PR       + G SD    S GS  SG +       SF 
Sbjct  262   PSIDRMFHSLYEEMDSGNGITPR-------ISGSSDYDLRSFGSLYSGVKSIDHNDYSFT  314

Query  711   SETVESGRTPRLssssdgsfgsg-------RLGKGNDLNSFTDFSSSSLENDEAEVEMRR  869
             S+          S S   +           RL     +  ++     +L   +  +E++R
Sbjct  315   SQGSGRSGMSMSSQSRISNSDKVEAEMRRLRLELKQTMEMYSTACKEALTAKQKALELQR  374

Query  870   LKLELQKTMD--------------LYSTACK---EALTAKQKTSELQRWrveeerrinee  998
              KL+ ++ M+                   CK   EA  A +K +EL+           + 
Sbjct  375   WKLDEERKMEDTRFCEETSLAVAEKERAKCKVAMEAAEASRKIAELE---------AQKR  425

Query  999   evnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFK  1178
                E   +S + + K+T G   +  P RYRRYTI+EIEEAT +FS S KIGEGGYGPV++
Sbjct  426   MKVEIKSNSDSDQRKRTFGDSVLNSPARYRRYTIEEIEEATNYFSNSLKIGEGGYGPVYR  485

Query  1179  CILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHG  1358
               LDHTAVA+KVL+PDAAQGR QFQQEVE+LS +RHP+MV+LLGACPE+GCLVYE+M +G
Sbjct  486   AELDHTAVAIKVLKPDAAQGRSQFQQEVEVLSSIRHPHMVLLLGACPEFGCLVYEHMTNG  545

Query  1359  SVDDRLMNRGNK--PPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             S+DD L  R N   P L WQ+RFRIAAE+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  546   SLDDCLFRRNNSKLPVLPWQLRFRIAAEIATGLLFLHQTKPEPLVHRDLKPGNILL  601



>ref|NP_001046304.1| Os02g0218400 [Oryza sativa Japonica Group]
 dbj|BAD17180.1| putative serine threonine kinase [Oryza sativa Japonica Group]
 dbj|BAF08218.1| Os02g0218400 [Oryza sativa Japonica Group]
 gb|EAY85030.1| hypothetical protein OsI_06387 [Oryza sativa Indica Group]
 gb|EAZ22252.1| hypothetical protein OsJ_05907 [Oryza sativa Japonica Group]
Length=730

 Score =   329 bits (844),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 195/530 (37%), Positives = 289/530 (55%), Gaps = 31/530 (6%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHC  185
             SQ A+KW  + LL++G  + LVHV  Q       +   +A+ + +F+++  +C RK +  
Sbjct  35    SQQAVKWAVDRLLARGSVLQLVHVKPQQNA----EAGADAEMQQMFISYRGYCARKGMQL  90

Query  186   LDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
              ++++DG+DI+KA+ +Y +  AI ++V+G+S R++F+++ +  D+PT   K  PD+CTV 
Sbjct  91    KEVILDGSDISKAIVEYATSNAITDIVVGASTRNTFIRKFRNPDVPTCLMKMVPDYCTVH  150

Query  363   viskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR------------TKNAPS-  503
             VI K K   V+ A  PAPF +    Q  +   ++   P  R              N PS 
Sbjct  151   VIHKGKAIQVKAAKAPAPFTTLPPKQYSQSSIESDGYPRSRGDWKKISNQSSPKANRPSV  210

Query  504   -SLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSR  680
               L  F +   R   L  + S      +       PPR  +   +   D D  F  S   
Sbjct  211   DRLSGFAKAPTRERPLSGARSAPPKDFDDYIDFIAPPRPSVTRSSFSDDVD--FPLSLEL  268

Query  681   PS---GDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEA  851
             PS   GD +   LS ++            +      RL     +  +      +++  + 
Sbjct  269   PSMDFGDSLELSLSASMSIESLSSAGKDVETEMRRLRLELKQTMEMYNSACKEAIDAKQK  328

Query  852   EVEMRRLKLELQKTMDLYSTACKEALT------AKQKTSELQRWrveeerrineeevnek  1013
               +M ++K+E  K       A +EAL       AK + +       +    +  ++    
Sbjct  329   AAQMHQMKMEESKKYQELRNAEEEALALVQMEKAKCRAALEAAEAAQRIAELEAQKRLRA  388

Query  1014  skssvtsetkktgggenMP-VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILD  1190
                +     ++    E M    +RYRRY+ID+IE AT  F ++ KIGEGGYGPV+K ++D
Sbjct  389   EWKAKREAEERKRATEAMNNTDLRYRRYSIDDIEAATHKFDKALKIGEGGYGPVYKAVMD  448

Query  1191  HTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDD  1370
             HT VA+K+LRPDA+QGR+QFQQE+E+LSCMRHPNMV+LLGACPEYGCLVYEYM +GS++D
Sbjct  449   HTNVAIKILRPDASQGRKQFQQEIEVLSCMRHPNMVLLLGACPEYGCLVYEYMDYGSLED  508

Query  1371  RLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             RL  RG   P+ W +RFRIAA++ TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  509   RLCRRGKTLPIPWNIRFRIAADIATGLLFLHQAKPEPLVHRDLKPANILL  558



>ref|NP_198388.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
 gb|AED93961.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
Length=731

 Score =   328 bits (842),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 221/537 (41%), Positives = 310/537 (58%), Gaps = 46/537 (9%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKD----LFVTFHCFCTRK  173
             SQ A+KW   NLLS+GQ++ L+HV  +  +SL +     ++  D    LF+ F C+C RK
Sbjct  22    SQNALKWAVSNLLSRGQTLTLLHVKLKQPSSLPYSGSNFSKPGDDPSELFLPFRCYCARK  81

Query  174   NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFC  353
             +I+C D++++    AK + DYV   AIE L+LGSS+ + L R K  D+ +   K AP FC
Sbjct  82    DINCQDVVVEDVSAAKGIVDYVQQNAIETLILGSSKMTLL-RFKAADVSSTVMKKAPSFC  140

Query  354   TVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHM  533
             TV+VISK KIS +R+AT   P ++   P ++       +N ++  +   +  R+ DE   
Sbjct  141   TVYVISKGKISFLRSATSSPPHSN--MPSMRHHSHAQTSNMNVERRQQ-TMQRTHDE---  194

Query  534   RSFKLE---ESESVSRPSIERA----ATRGIP---------------PRRMLGAETVEGD  647
                K+E     E V +PSI  +     + G P               PR  + +E   G+
Sbjct  195   --IKIEIKRGYEGVYQPSITDSDISFVSSGRPSVDQMFPSLYDDVDVPRLSVTSEY--GE  250

Query  648   SDLSFVSSGSRPSGDRMSSFL---SETVESGRTP-RLssssdgsfgsgRLGK--GNDLNS  809
             + LSF ++ S+ S D  S +    S + ESGR    L    +      RL     + +  
Sbjct  251   NRLSFATTYSKQSIDLGSPYAPNSSTSFESGRQSFSLQGQDELETEMRRLKMELKHTMEM  310

Query  810   FTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrveeerri  989
             +      ++   +A  E+ + K E +  ++    + + A+   ++  E  R  +E     
Sbjct  311   YNSACKEAISAKKAANELLKWKAEKEHKLEEVRLSKEAAMAMAEREKEKSRAAMEAAVAA  370

Query  990   neeevnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGP  1169
              +    E  K        +     +    +RYR+YTI+EIEEATE FS SRK+GEGGYGP
Sbjct  371   QKLSDLEAEKRKHIETVDEKKRAVS---SLRYRKYTIEEIEEATEDFSPSRKVGEGGYGP  427

Query  1170  VFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYM  1349
             V+K  LD+T VA+KVLRPDAAQGR QFQ+EVE+L+CMRHPNMV+LLGACPEYGCLVYEYM
Sbjct  428   VYKGTLDYTKVAIKVLRPDAAQGRSQFQREVEVLTCMRHPNMVLLLGACPEYGCLVYEYM  487

Query  1350  AHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             A+GS+DD L  RGN P LSWQ+RFRIA+E+ TGL FLHQ KP+P+VHRDLKPGNILL
Sbjct  488   ANGSLDDCLFRRGNSPILSWQLRFRIASEIATGLHFLHQMKPEPLVHRDLKPGNILL  544



>ref|XP_004951440.1| PREDICTED: U-box domain-containing protein 52-like [Setaria italica]
Length=721

 Score =   327 bits (838),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 196/538 (36%), Positives = 293/538 (54%), Gaps = 50/538 (9%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHC  185
             SQ A KW  + LLS+G ++ LVHV  +       K + +A+   LF+++  +C RK +H 
Sbjct  35    SQQAAKWAVDKLLSRGSTLQLVHVRAEAG-----KDEGDAEITHLFISYRGYCARKGMHL  89

Query  186   LDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
              ++++DG DI+K + DY +  AI ++V+G+S +++F++R +  D+PT   K APD+CTV 
Sbjct  90    KEVILDGNDISKEIIDYATSNAITDIVVGASTKNTFIRRFRNPDVPTCLMKMAPDYCTVH  149

Query  363   viskskissvRNATRPA-----PFASPLHPQLQ---------EIQEQAQNNPDIRTKNAP  500
             VI K+K   V+ A  PA     P      P ++         + ++ +  +  +  +N+ 
Sbjct  150   VIHKAKAIQVKAAKAPAPFSTLPPKQYSQPNIESDVSRASRGDWRKTSHTSSPVANRNSV  209

Query  501   SSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSR  680
               L ++ +   R   L  + +  +   +       PPR  +   +   D DL    S   
Sbjct  210   DRLSAYAKAPSRDRPLSGARTAPQKDFDDYIDFIAPPRPSVTRSSFSDDIDLPM--SMEL  267

Query  681   PSGDRMSSF-LSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEV  857
             PS D   S  LS  +            +      RL     +  +      +++  +   
Sbjct  268   PSIDFADSMELSSAMSMESLSYAGKDVETEMRRLRLELKQTMEMYNSACKEAIDAKQKAA  327

Query  858   EMRRLKLELQKTMDLYSTACKEALT-----------------AKQKTSELQRWrveeerr  986
             +M ++K+E  K       A +EAL                  A QK +EL+  +      
Sbjct  328   QMHQMKVEESKKFQELRNAEEEALALVQMEKAKCRAALEAAEAAQKIAELEAQKRLRAEW  387

Query  987   ineeevnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYG  1166
               + E  ++ K++                 +RYRRY+ID+IE AT  F ++ KIGEGGYG
Sbjct  388   KAKREAEDRKKATDALNRND----------LRYRRYSIDDIEAATHKFDKALKIGEGGYG  437

Query  1167  PVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEY  1346
             PV+K +LDHT VA+K+LRPDA+QGR+QFQQE+E+LSCMRHPNMV+LLGACPEYGCLVYEY
Sbjct  438   PVYKAVLDHTNVAIKILRPDASQGRKQFQQEIEVLSCMRHPNMVLLLGACPEYGCLVYEY  497

Query  1347  MAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             M +GS++DRL  RG   P+ W +RFRIAA++ TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  498   MDYGSLEDRLCRRGKTLPIPWSIRFRIAADIATGLLFLHQAKPEPLVHRDLKPANILL  555



>ref|XP_008786959.1| PREDICTED: U-box domain-containing protein 35-like [Phoenix dactylifera]
Length=727

 Score =   326 bits (835),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 215/567 (38%), Positives = 313/567 (55%), Gaps = 83/567 (15%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQT---QTSLQHK---------------QQLEAQN  131
             SQ+A+KW  +++L++GQ   L+HV  +    QT +  +               ++++ Q 
Sbjct  20    SQHALKWAADHVLTRGQIFYLLHVRRKIPSIQTPIGQQLSISEVNDGVASSCLERMDFQT  79

Query  132   KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
             K+L + F CFC R  +   ++++D TD+ KA+ D+++D  I+ L+ G SSR++ ++  K 
Sbjct  80    KELLLPFQCFCNRSGLQFKEVILDDTDVPKAIVDFIADRIIDKLIFGASSRNALIRSFKP  139

Query  309   TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN---NPD  479
              D+PT  SK AP+FC+++VISK K+SS R ATRP         +    + Q Q+    PD
Sbjct  140   ADVPTTVSKTAPEFCSIYVISKGKLSSTRPATRPITQRPACEFETDSARNQFQSIKSEPD  199

Query  480   IRTK-NAPSSL---------------RSFD---------EKHMRS---FKLEESESV---  566
              R    AP+                 RSF+         + H R    F  + + S    
Sbjct  200   SRYHTGAPARFHPAAIGYGGENGSFERSFEARISKKISRDSHARGCLDFSYQSAASCPSP  259

Query  567   SRPSIERAATRGIPPRRMLGAE----TVEGDSDLSFVS-----SGSRPSGDRMSSFLSET  719
             SR SI+++ T  +PP+  L  E         S+ SF S       S  S    S++ S  
Sbjct  260   SRTSIDQSNTY-VPPQFCLTGEPQSFMSNASSEYSFHSFHDEQQKSLVSNKNTSAYCSSG  318

Query  720   VESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMD  899
               S R  R S                     +  S  S+E+ +A+  MRRLK E ++  D
Sbjct  319   SGSSRYERSSWILKEES--------------SSLSDHSVEDIKAK--MRRLKFEPRQMKD  362

Query  900   LYSTACKEALTAKQKTSELQRWrveeerrineeevnekskssvtsetkktgggenMPVPV  1079
             +    CKEA   K   +     R+EE R   +   +   K   +    +    +     +
Sbjct  363   MSEDTCKEANYGKADGA----LRMEETRLAGDMRPHMAEKEQNSKALLQRNFSDCFHSNI  418

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRYT++EI++AT++F ++ KIGEGGYGPV+KC LDHT VA+K+LR D  QG +QF QE
Sbjct  419   RYRRYTVEEIQKATDNFLDALKIGEGGYGPVYKCNLDHTVVAIKILRSDPTQGMKQFHQE  478

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             +E+LSC+RHPNMV+L+GACPEYGCLVYE+MA+GS++DRL  +    PLSWQ+RF+IAAE+
Sbjct  479   IEVLSCIRHPNMVLLMGACPEYGCLVYEHMANGSLEDRLFCQNGTRPLSWQLRFKIAAEI  538

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  539   ATGLLFLHQTKPEPLVHRDLKPGNILL  565



>emb|CDX93094.1| BnaA03g38160D [Brassica napus]
Length=678

 Score =   324 bits (831),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 220/551 (40%), Positives = 304/551 (55%), Gaps = 85/551 (15%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVD-NQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ A+KW  +NL++ G+S+ LVHV   Q      +  +  +  K+LF+ F CFC RK+I 
Sbjct  21    SQAALKWAVDNLVTSGESLTLVHVKLKQALVINANPSKSSSDVKELFLPFRCFCNRKDIR  80

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
             C D +++  D AK + DYV + AI+ LVLG+S+ + LKR K  D+ +   K A +FCTV+
Sbjct  81    CEDAVLEDVDAAKGIIDYVKENAIDILVLGASKMTLLKRFKAADVTSTVMKGAANFCTVY  140

Query  363   viskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRSF  542
              IS SKISSVR+AT   P    + PQ   I  +  NN                       
Sbjct  141   AISGSKISSVRSATSSPPPLCAIRPQ---ITARPSNN-----------------------  174

Query  543   KLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM--SSFLS-  713
              + +SE+     I+  + RG         +    DSD+SFVSS  RPS D M  +S LS 
Sbjct  175   SMGQSETQDEIVIKYKSQRGFD-------QASRTDSDISFVSS-DRPSVDLMFPTSRLSI  226

Query  714   -ETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEN---------DEAEVEM  863
                 E  R    +SS      S  LG     +S++ FS  S  +         D+ + EM
Sbjct  227   YSEFEDNRCSFATSSCSSEKQSVDLG-----SSYSAFSPGSQGSGRLSTWSLQDDVQAEM  281

Query  864   RRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrveeerrineeevnekskssvtsetk  1043
             RRLK+EL+ TM++YSTACKEA+TAK  + EL +WRVE+E ++ E    +++  ++    K
Sbjct  282   RRLKMELRYTMEMYSTACKEAITAKNMSKELHKWRVEKEHKLEEARQAKEAAMAMAENEK  341

Query  1044  ktgggenMPVPVRYRRYTID-----EIEEATEHFSESRKIGEGGY---------------  1163
                      +    R   I+     +IE A+   +E +   +  Y               
Sbjct  342   AKTRAAMEAIATANRIAEIEAQKRKQIETASLREAEDKNTSDRRYREYTIEEIEEATENF  401

Query  1164  -----------GPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLG  1310
                        GPV+K  LD+T VA+KVLRPDA QGR QFQQEVE+L+ +RHPN+V+LLG
Sbjct  402   SINNKIGEGGYGPVYKGTLDYTKVAIKVLRPDARQGRSQFQQEVEVLTSIRHPNLVLLLG  461

Query  1311  ACPEYGCLVYEYMAHGSVDDRLMNRGNK-PPLSWQVRFRIAAEMGTGLLFLHQNKPDPIV  1487
             AC EYGCLVYE++ +GSV+D L+ RGN  P L+WQ+RFRIAAE+ T L FLHQ KP+P+V
Sbjct  462   ACTEYGCLVYEHLENGSVEDLLLKRGNNSPSLTWQLRFRIAAEIATSLNFLHQMKPEPVV  521

Query  1488  HRDLKPGNILL  1520
             HRDLKP N+LL
Sbjct  522   HRDLKPANVLL  532



>ref|XP_009136185.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
35 [Brassica rapa]
Length=716

 Score =   320 bits (820),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 221/553 (40%), Positives = 309/553 (56%), Gaps = 89/553 (16%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQN-KDLFVTFHCFCTRKNIH  182
             SQ A+KW  +NL++ G+S+ LVHV  +    +       + + K+LF+ F CFC RK+I 
Sbjct  21    SQAALKWAVDNLVTSGESLTLVHVKLKQALVINANPNKSSNDVKELFLPFRCFCNRKDIR  80

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
             C D +++  D AK + DYV + AI+ LVLG+S+ + LKR K  D+ ++  K A +FCTV+
Sbjct  81    CEDAVLEDVDAAKGIIDYVKENAIDILVLGASKMTLLKRFKAADVTSMVMKGAANFCTVY  140

Query  363   viskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRSF  542
              IS SKISSVR+AT     +SP  P L  I+ Q    P   + N+     + DE  ++S 
Sbjct  141   AISGSKISSVRSAT-----SSP--PPLCAIRPQITARP---SNNSMGQGETQDEIVIKSQ  190

Query  543   KLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM--SSFLS-  713
             +  +  SV+                         DSD+SFVSS  RPS D M  +S LS 
Sbjct  191   RGFDQASVT-------------------------DSDMSFVSS-DRPSVDLMFPTSRLSI  224

Query  714   -ETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEN-----------DEAEV  857
                 E  R    +SS      S  LG     +S++ FS  S  +           D+ + 
Sbjct  225   YSEFEDNRCSFATSSCSSEKQSVDLG-----SSYSAFSPGSQGSGRLSTWSLQVKDDVQA  279

Query  858   EMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrveeerrineeevnekskssvtse  1037
             EMRRLK+EL+ TM++YSTACKEA+TAK  + EL +WRVE+E ++ E    +++  ++   
Sbjct  280   EMRRLKMELRYTMEMYSTACKEAITAKNMSKELHKWRVEKEHKLEEARQAKEAAMAMAEN  339

Query  1038  tkktgggenMPVPVRYRRYTID-----EIEEATEHFSESRKIGEGGY-------------  1163
              K         +    R   I+     +IE A+   +E +   +  Y             
Sbjct  340   EKAKTRAAMEAIATANRIAEIEAQKRKQIETASLREAEDKNTSDRRYREYTIEEIEEATE  399

Query  1164  -------------GPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVML  1304
                          GPV+K  LD+T VA+KVLRPDA QGR QFQQEVE+L+ +RHPN+V+L
Sbjct  400   NFSINNKIGEGGYGPVYKGTLDYTKVAIKVLRPDARQGRSQFQQEVEVLTSIRHPNLVLL  459

Query  1305  LGACPEYGCLVYEYMAHGSVDDRLMNRGNK-PPLSWQVRFRIAAEMGTGLLFLHQNKPDP  1481
             LGAC EYGCLVYE++ +GSV+D L+ RGN  P L+WQ+RFRIAAE+ T L FLHQ KP+P
Sbjct  460   LGACTEYGCLVYEHLENGSVEDLLLKRGNNSPSLTWQLRFRIAAEIATSLNFLHQMKPEP  519

Query  1482  IVHRDLKPGNILL  1520
             +VHRDLKP N+LL
Sbjct  520   VVHRDLKPANVLL  532



>emb|CDY48312.1| BnaC05g13660D [Brassica napus]
Length=732

 Score =   320 bits (821),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 205/535 (38%), Positives = 298/535 (56%), Gaps = 61/535 (11%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKD----LFVTFHCFCTRK  173
             SQ+A+KW  EN++    + +L+HV  QT+  +  ++  EA N++     F+ F  FC RK
Sbjct  25    SQHALKWAVENIVVNSPNCILLHV--QTKLRIGAEENTEADNEEEAHQFFLPFRGFCARK  82

Query  174   NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDF  350
              I   ++L+   DIA A+ DY+++ +I N+VLG++ R+SFLK+ K  D+P    K  PD 
Sbjct  83    GIMAKEVLLHDIDIASAIVDYINNNSIANIVLGATARNSFLKKFKTVDVPGTLLKTTPDT  142

Query  351   CTVFviskskissvRNATRP-APFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEK  527
             C VFV+SK K+ + ++A+RP  P  SP  P+       A ++P       P+S  +F + 
Sbjct  143   CAVFVVSKGKLLTSKSASRPQTPQHSPQPPKPHP--HSAISDP------GPASSITFSDS  194

Query  528   HMRSFKLEESESVSRPSIERAATRGIPPR--RMLGAETVEGDSDLSFVSSGSRPSGDRMS  701
                S  L    S        +  R  P R    L      G+S+ SF S   R +    S
Sbjct  195   GRSSPALNGGFSPPTAHFTPSIIRSSPSRFSNELSPSGHSGESNASFYSILGRSTYGGSS  254

Query  702   SFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLE  881
                +   E                   L  G +   F+  S  + +N   E E+RRL+LE
Sbjct  255   HSSTSMSE-------------------LADGEE--RFSGSSYITEQNHNLEAEVRRLRLE  293

Query  882   LQK----------------TMDLYSTACKEALTAK---QKTSELQRWrveeerrineeev  1004
             LQ+                +    S   +EA  A+   +  SE+ + + + + +  E   
Sbjct  294   LQQYNVSMGRESAPHLQGPSAAAESVKLEEAKVARDMLRAMSEMDKHKTQSQIQATEMAR  353

Query  1005  nekskssvt---setkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVF  1175
                          E +     ++M   V YRRY+I ++E AT+ FS+++KIGEGGYGPV+
Sbjct  354   RLAEMEKQKRRLVEMQARFKEQDMASNVSYRRYSIRDVEGATDGFSDAQKIGEGGYGPVY  413

Query  1176  KCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAH  1355
             K +L++T+VA+K+L+ D +QG +QFQQEVE+LSCMRHPNMV+LLGACPEYGCLVYEYM +
Sbjct  414   KAVLENTSVAIKILKSDVSQGLKQFQQEVEVLSCMRHPNMVILLGACPEYGCLVYEYMEN  473

Query  1356  GSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             G+++DRL  + N PPLSW+ RFRIAAE+ TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  474   GTLEDRLFCKDNTPPLSWRERFRIAAEIATGLLFLHQAKPEPLVHRDLKPANILL  528



>emb|CDY26235.1| BnaA06g11820D [Brassica napus]
Length=768

 Score =   321 bits (822),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 209/533 (39%), Positives = 299/533 (56%), Gaps = 57/533 (11%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKD----LFVTFHCFCTRK  173
             SQ+A+KW  EN++    + +L+HV  QT+  +  ++  EA N++     F+ F  FC RK
Sbjct  25    SQHALKWAVENIVVNSPNCILLHV--QTKLRIGAEENTEADNEEEAHQFFLPFRGFCARK  82

Query  174   NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDF  350
              I   ++L+   DIA A+ DY+++ +I N+VLG++ R+SFLK+ K  D+P    K  PD 
Sbjct  83    GIMAKEVLLHDIDIASAIVDYINNNSIANIVLGATARNSFLKKFKTVDVPGTLLKTTPDT  142

Query  351   CTVFviskskissvRNATRP-APFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEK  527
             C VFV+SK K+ + ++A+RP  P  SP  P+       A ++P       P+S  +F + 
Sbjct  143   CAVFVVSKGKLLTSKSASRPQTPQHSPQPPKPHP--HSAISDP------GPASSITFSDS  194

Query  528   HMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSF  707
                S  L    S        +  R  P R                 S+G  PSG    S 
Sbjct  195   GRSSPALNGGFSPPTAHFTPSLIRSSPSR----------------FSNGLSPSGHSGESN  238

Query  708   LSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQ  887
             +S     GR+     SS  S     L  G +   F+  S  + +N   E E+RRL+LELQ
Sbjct  239   VSFYSILGRS-TYGGSSHSSTSMSELADGEE--RFSGGSYITEQNHNLEAEVRRLRLELQ  295

Query  888   K----------------TMDLYSTACKEALTAK---QKTSELQRWrveeerrineeevne  1010
             +                +    S   +EA  A+   +  SE+ + + + E    E     
Sbjct  296   QYNVSMGRESAPHLQGPSAAAESIKLEEAKVARDMLRAMSEMDKHKTQSEIHATELAHRL  355

Query  1011  kskssvt---setkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKC  1181
                        E +     ++M   V YRRY+I ++E AT+ FS+++KIGEGGYGPV+K 
Sbjct  356   AEMDKQKRRLVEMQARFTEQDMASNVSYRRYSIRDVEGATDGFSDAQKIGEGGYGPVYKA  415

Query  1182  ILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGS  1361
             +L++T+VA+K+L+ D +QG +QFQQEVE+LSCMRHPNMV+LLGACPEYGCLVYEYM +G+
Sbjct  416   VLENTSVAIKILKSDVSQGLKQFQQEVEVLSCMRHPNMVILLGACPEYGCLVYEYMENGT  475

Query  1362  VDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             ++DRL  + N PPLSW+ RFRIAAE+ TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  476   LEDRLFCKDNTPPLSWRQRFRIAAEIATGLLFLHQAKPEPLVHRDLKPANILL  528



>ref|XP_006306901.1| hypothetical protein CARUB_v10008461mg [Capsella rubella]
 gb|EOA39799.1| hypothetical protein CARUB_v10008461mg [Capsella rubella]
Length=704

 Score =   318 bits (815),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 199/532 (37%), Positives = 294/532 (55%), Gaps = 53/532 (10%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKD----LFVTFHCFCTRK  173
             SQ+A+KW  +N+++   + +L+HV  + +  +    +    N+D     F+ F  FC RK
Sbjct  25    SQHALKWAVDNIIANSPNCILLHVQTKLRIGVGENTEAPHDNQDEAHQFFLPFRGFCARK  84

Query  174   NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDF  350
              I   ++L+   DI+ A+ DYV++ +I N+VLG++ R+SFLK+ K  D+PT   K APD 
Sbjct  85    GIIATEVLLHDIDISSAIVDYVTNNSIANIVLGATARNSFLKKFKGVDVPTALLKTAPDT  144

Query  351   CTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKH  530
             C VF++SK K+ + R+A+RP    +P H      Q    ++P   +  +  S RS     
Sbjct  145   CAVFIVSKGKLITSRSASRPHTPQAPQHSPPTSKQPAMMSDPGRTSFTSSDSGRS-----  199

Query  531   MRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFL  710
                           P+I  + +  IP  +          S LS +S+   PSG    S  
Sbjct  200   -------------SPTINGSFSPPIPHYK-----PDFNRSPLSELSNEFSPSGHSSESNA  241

Query  711   SETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQK  890
             S     GR+     SS  S     +  G +     + +    +N EAEV  RRL+LEL++
Sbjct  242   SFYSILGRS-TYGGSSHSSASMSEMTDGEESVYGVNITDHQSQNLEAEV--RRLRLELKQ  298

Query  891   ---------------------TMDLY-STACKEALTAKQKTSELQRWrveeerrineeev  1004
                                  T  L  S A +E L A  +  + +     +   + +   
Sbjct  299   FNASMCRESAPHLHGPRATVETQKLEESKAAREMLRALSEMDKQKTQSAIQAAEMAQRLA  358

Query  1005  nekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCI  1184
               +++     E +     + M   + YRRY I ++E AT+ FS++ KIGEGGYGPV+K +
Sbjct  359   EMETQKRRLVEMQAKFKEQKMASSISYRRYNIKDVETATDGFSDTLKIGEGGYGPVYKAV  418

Query  1185  LDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSV  1364
             L++T+VA+K+L+ D +QG +QF QE+E+LSCMRHPNMV+LLGACPEYGCLVYEYM +G++
Sbjct  419   LENTSVAIKILKSDVSQGLKQFNQEIEVLSCMRHPNMVILLGACPEYGCLVYEYMENGTL  478

Query  1365  DDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +DRL  + N PPLSW+ RFRIAAE+ TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  479   EDRLFCKDNTPPLSWRARFRIAAEIATGLLFLHQAKPEPLVHRDLKPANILL  530



>emb|CDX96762.1| BnaA08g23050D [Brassica napus]
Length=706

 Score =   315 bits (806),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 201/531 (38%), Positives = 293/531 (55%), Gaps = 58/531 (11%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQ------TSLQHKQQLEAQNKDLFVTFHCFCT  167
             SQ+A+KW  ++++    + +L+HV  + +      T   H  Q EA     F+ F  FC 
Sbjct  25    SQHALKWALDHIVGDSPNCILLHVQTKLRIGEGENTEAPHDNQEEAHK--FFLPFRGFCA  82

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAP  344
             +K I   ++L+   DIA A+ DY++  +I N+V+G+S R++FLK+ K  D+PT   K  P
Sbjct  83    KKGIRATELLLHDIDIANAIVDYINKNSISNIVIGASARNTFLKKFKSVDVPTTLLKTTP  142

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDE  524
             D C+V+++SK K+ + R A+RP        PQ      + Q+   I +   P+S  S + 
Sbjct  143   DTCSVYIVSKDKLLTSRQASRPQT------PQHNPQPSKQQSLLSILSDPGPTSFTSTES  196

Query  525   KHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSS  704
                                 R+++   P R       +    +LS   S +R S +  SS
Sbjct  197   G-------------------RSSSALPPTRHYKPCLNMSSPGELSNELSSNRHSVESNSS  237

Query  705   FLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLEL  884
             F S     GR+     SS  S     +  G D    +  + +  EN   E+E+RRL+LEL
Sbjct  238   FYSIL---GRS-TYGGSSHSSTSLYDITDG-DEEGLSGGNITEQENQNLELEVRRLRLEL  292

Query  885   Q---KTMDL----------YSTACKEALTAKQKTSELQRWrveeerrineeevnekskss  1025
             Q    TM             S   +E   A++   EL     ++ +            + 
Sbjct  293   QHFNATMGRDTAPHHQAAHESEKLEETKVAREMLRELSEMDKQKTQSAIHANEAAHRLAE  352

Query  1026  vtset------kktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCIL  1187
             +  +       +     +NM   V YRRY+I ++E+AT+ FS++ KIGEGGYGPVFK +L
Sbjct  353   IEKQKRRLVEMQAKFNEQNMSNTVSYRRYSIKDVEDATDGFSDALKIGEGGYGPVFKAVL  412

Query  1188  DHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVD  1367
             ++T+VA+K+L+ D +QG +QFQQEVE+LSCMRHPNMV+LLGACPEYGCLVYEYM +G+++
Sbjct  413   ENTSVAIKILKSDVSQGLKQFQQEVEVLSCMRHPNMVILLGACPEYGCLVYEYMENGTLE  472

Query  1368  DRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             DRL  + N PPLSW+ RFRIAAE+ TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  473   DRLFCKDNTPPLSWRARFRIAAEIATGLLFLHQAKPEPLVHRDLKPANILL  523



>emb|CDY50937.1| BnaC03g74370D [Brassica napus]
Length=685

 Score =   310 bits (794),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 210/557 (38%), Positives = 296/557 (53%), Gaps = 94/557 (17%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVD-NQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ A+KW  +NL++ G+S+ LVHV   Q      +  +     K+LF+ F CFC RK+I 
Sbjct  21    SQAALKWAVDNLVTSGESLTLVHVKLKQALVINANPNKYSDDVKELFLPFRCFCNRKDIR  80

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
             C D +++  D AK +  YV + AI+ LVLG+S+ + LKR K  D+ +   K A +FCTV+
Sbjct  81    CEDAVLEDVDAAKGIIGYVKENAIDILVLGASKMTLLKRFKAADVTSTVMKGAANFCTVY  140

Query  363   viskskissvRNATRPAPFASPLHPQLQEI-------QEQAQNNPDIRTKNAPSSLRSFD  521
              IS SKISSVR+AT   P    + PQ+          Q + Q+  +I+ K    S R FD
Sbjct  141   AISGSKISSVRSATSSPPPLCAIRPQITARPSNNSMGQRETQDEIEIKYK----SQRGFD  196

Query  522   EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSR------P  683
             +  +                                     DSD+SFVSS  R      P
Sbjct  197   QASV------------------------------------TDSDISFVSSDRRSVDIMFP  220

Query  684   SGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEN-----DE  848
             +  R++ +     E  R+   +SS      S  LG      S +   S  L       D+
Sbjct  221   TPSRLAIY--SEFEDNRSSFATSSCSSEKQSVDLGSSYSAFSPSSQESGRLSTWWSLQDD  278

Query  849   AEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrveeerrineeevnekskssv  1028
              + EM+RLK+EL+ TM++YSTACKEA+TAK  + EL +WRVE+E ++ E    +++  ++
Sbjct  279   VQAEMKRLKMELRYTMEMYSTACKEAITAKNMSKELHKWRVEKEHKLEEARQAKEAAMAM  338

Query  1029  tsetkktgggenMPVPVRYRRYTID-----EIEEATEHFSESRKIGEGGY----------  1163
                 K         +    R   I+     +IE A+   +E +   +  Y          
Sbjct  339   AENEKAKTRAAMEAIATANRIAEIEAKKRKQIETASLRKAEDKNTSDRRYREYTIEEIEE  398

Query  1164  ----------------GPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNM  1295
                             GPV++  LD+T VA+KVLRPDA QGR QFQQEVE+L+ +RHPN+
Sbjct  399   ATENFSINNKIGEGGYGPVYEGTLDYTKVAIKVLRPDARQGRSQFQQEVEVLTSIRHPNL  458

Query  1296  VMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPP--LSWQVRFRIAAEMGTGLLFLHQN  1469
             V+LLGAC EYGCLVYE++ +GSV+D L+ RGN  P  L+WQ+RFRIAAE+ T L FLH  
Sbjct  459   VLLLGACAEYGCLVYEHLENGSVEDLLLKRGNNSPVLLTWQLRFRIAAEIATSLNFLHHM  518

Query  1470  KPDPIVHRDLKPGNILL  1520
             KP+P+VHRDLKP N+LL
Sbjct  519   KPEPVVHRDLKPANVLL  535



>gb|AAF79480.1|AC022492_24 F1L3.25 [Arabidopsis thaliana]
Length=845

 Score =   311 bits (798),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 195/543 (36%), Positives = 291/543 (54%), Gaps = 51/543 (9%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQ------TSLQHKQQLEAQNKDLFVTFHCFCT  167
             SQ+A+KW  EN++    + +L+HV  + +      T   H  Q EA     F+ F  FC 
Sbjct  25    SQHALKWAVENIIIDSPNCILLHVQTKLRFGAGENTEAPHDNQEEAHQ--FFLPFRGFCA  82

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAP  344
             RK I   ++L+   DI+ A+ DY+++ +I N+V+G+S R+SFLK+ K  D+PT   K  P
Sbjct  83    RKGIIATEVLLHDIDISSAIVDYITNNSISNIVIGASARNSFLKKFKSVDVPTTLLKTTP  142

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQ------LQEIQEQAQNNPDIRTKNAPSS  506
             D C VF++SK K+ + R+A+RP     P  PQ        +       +P + +   P+S
Sbjct  143   DTCAVFIVSKGKLLTSRSASRPQTPQGPHTPQGPQTPQAPQHPPHPSKHPSMMSDPGPTS  202

Query  507   LRSFDEKHMR---SFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGS  677
               S +        + +L       +PS+ R++   +         + E ++    +   S
Sbjct  203   STSSESGRSSPALNGELSPPTPHYKPSLYRSSMSELS-NEFPSDHSAESNASFYSILGRS  261

Query  678   RPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEV  857
                G   SS +S          +  +      +  L   +D   F  F     +N   E 
Sbjct  262   TYGGSSHSSMVS----------IPITFQIDILTTYLPGMHDSEMFVFFVHDYDQNQNLEA  311

Query  858   EMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrveeerrineeevnekskssvtse  1037
             E+RRL+ ELQ+     S      L   + T+E +R    +  R     ++E  K    + 
Sbjct  312   EVRRLRFELQQFNASMSRESAPHLLGPRATAETERLEEAKAAREMLRALSEMDKQKTQTA  371

Query  1038  tkktggg----------------------enMPVPVRYRRYTIDEIEEATEHFSESRKIG  1151
              + T                         +NM   + YRRY+I ++E AT+ FS++ KIG
Sbjct  372   IQATEVAQRLAEIETQKRRLVEMQARFKEQNMADSISYRRYSIRDVEGATDGFSDALKIG  431

Query  1152  EGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGC  1331
             EGGYGPV+K +L++T+VA+K+L+ D +QG +QF QE+E+LSCMRHPNMV+LLGACPEYGC
Sbjct  432   EGGYGPVYKAVLENTSVAIKLLKSDVSQGLKQFNQEIEVLSCMRHPNMVILLGACPEYGC  491

Query  1332  LVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGN  1511
             LVYEYM +G+++DRL  + N PPLSW+ RFRIAAE+ TGLLFLHQ KP+P+VHRDLKP N
Sbjct  492   LVYEYMENGTLEDRLFCKDNTPPLSWRARFRIAAEIATGLLFLHQAKPEPLVHRDLKPAN  551

Query  1512  ILL  1520
             IL+
Sbjct  552   ILI  554



>ref|XP_009110401.1| PREDICTED: U-box domain-containing protein 35-like [Brassica 
rapa]
Length=699

 Score =   306 bits (785),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 198/531 (37%), Positives = 291/531 (55%), Gaps = 58/531 (11%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVDNQTQ------TSLQHKQQLEAQNKDLFVTFHCFCT  167
             SQ+A+KW  ++++    + +L+HV  + +      T   H  Q EA     F+ F  FC 
Sbjct  25    SQHALKWALDHIVGDSPNCILLHVQTKLRIGEGENTEAPHDNQEEAHK--FFLPFRGFCA  82

Query  168   RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAP  344
             +K I   ++L+   DIA A+ DY++  +I N+V+G+S R++FLK+ K  D+PT   K  P
Sbjct  83    KKGIRATELLLHDIDIANAIVDYINKNSISNIVIGASARNTFLKKFKSVDVPTTLLKTTP  142

Query  345   DFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDE  524
             D C+V+++SK K+ + R A+RP        PQ      + Q+   I +   P+S  S D 
Sbjct  143   DTCSVYIVSKDKLLTSRQASRPQT------PQHNPQPSKQQSLLSILSDPGPTSFTSTDS  196

Query  525   KHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSS  704
                                 R+++   P R       +    +LS   S +R S +  +S
Sbjct  197   G-------------------RSSSALPPTRHYKPCLNMSSPGELSNELSSNRNSVESNAS  237

Query  705   FLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLEL  884
             F S     GR+     SS  S     +  G D    +  + +  EN   E+E+RRL+LEL
Sbjct  238   FYSIL---GRS-TYGGSSHSSTSLYDITDG-DEEGLSGGNITEQENQNLELEVRRLRLEL  292

Query  885   Q---KTMDL----------YSTACKEALTAKQKTSELQRWrveeerrineeevnekskss  1025
             Q    TM             S   +E   A++   EL     ++ +            + 
Sbjct  293   QHFNATMGRDTAPHHQAAPESEKLEETKIAREMLRELSEMDKQKTQSAIHANEAAHRLAE  352

Query  1026  vtset------kktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCIL  1187
             +  +       +     +NM   V YRRY+I ++E+AT+ FS++ KIGEGGYGPVFK +L
Sbjct  353   IEKQKRRLVEMQAKFNEQNMSNTVSYRRYSIKDVEDATDGFSDALKIGEGGYGPVFKAVL  412

Query  1188  DHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVD  1367
             ++T+VA+K+L+ D +QG +QFQQEVE+LSCMR PNMV+LLGACPEYGCLVYEYM +G+++
Sbjct  413   ENTSVAIKILKSDVSQGLKQFQQEVEVLSCMRRPNMVILLGACPEYGCLVYEYMENGTLE  472

Query  1368  DRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             DRL  + + PPLSW+ R RIAAE+ TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  473   DRLFCKDDTPPLSWRARCRIAAEIATGLLFLHQAKPEPLVHRDLKPANILL  523



>ref|XP_006340592.1| PREDICTED: U-box domain-containing protein 52-like [Solanum tuberosum]
Length=770

 Score =   306 bits (783),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 236/338 (70%), Gaps = 24/338 (7%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ---------------HKQQLEAQNKDL  140
            SQYAIKW T+NL+ +GQ++VL+HV  +   S                 H Q LE Q K+L
Sbjct  45   SQYAIKWATDNLVKRGQTLVLIHVVTKPIASQYGNCGGVHVVDGNLSPHGQNLEKQTKEL  104

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++  D+ KALT+Y+S AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  105  FLTFHCFCTRKDIRCLDVILEDADVPKALTEYLSSAAIQNLVLGASRHGFIRRLKVTDIP  164

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN--PDIRTKN  494
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ ++Q+++E   +       T  
Sbjct  165  SSVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKKIQQLEEHVHSGGFTPTATNR  224

Query  495  APSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSG  674
            A       D    RSF  ++S  +  P   R   R IP R  + ++  E D+DLSFVSSG
Sbjct  225  AIHIGSVGDRSQRRSFVTDDSRKIGSPFDRR---RVIPSR--IFSDLSEADTDLSFVSSG  279

Query  675  SRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLENDEA  851
             RPS DR SS + + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFS SS E D+ 
Sbjct  280  -RPSTDRTSSLMYDGMDSGRISQISTSSDSSFGSERLGARGSELSSFNDFSLSSFETDDG  338

Query  852  EVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  339  EAEMRRLKMELQRTMDLYSTACKEALTAKQKSVELNLW  376


 Score =   264 bits (675),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V  RYRRY I+EIEEAT+ FS+S K+GEGGYGPV+KC LDHT VAVKVLRPDAAQGR QF
Sbjct  450   VDFRYRRYNIEEIEEATQFFSDSLKVGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQF  509

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPP-LSWQVRFRI  1427
             QQEVE+LS MRHPNMV+LLGACPEYGCL+YEYMA+GS+++RLM RG+K   LSWQ+RFRI
Sbjct  510   QQEVEVLSRMRHPNMVLLLGACPEYGCLIYEYMANGSLEERLMRRGDKKSTLSWQLRFRI  569

Query  1428  AAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AAE+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  570   AAEIATGLLFLHQTKPEPLVHRDLKPGNILL  600



>ref|XP_009793818.1| PREDICTED: U-box domain-containing protein 52-like isoform X4 
[Nicotiana sylvestris]
Length=781

 Score =   300 bits (767),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 245/340 (72%), Gaps = 23/340 (7%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------------QHKQQLEAQNKDL  140
            SQYAIKW T+NL+++GQ++VL+HV  +  +S                 H Q LE Q K+L
Sbjct  43   SQYAIKWATDNLVNRGQTLVLIHVVTKPASSSYGNCGGVHVVDGNLSAHGQNLEKQTKEL  102

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++ +D+ KALT+YVS AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  103  FLTFHCFCTRKDIRCLDVILEDSDVTKALTEYVSSAAIQNLVLGASRHGFIRRLKVTDIP  162

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQ---AQNNPDIRTK  491
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ Q+Q+++EQ   A   P  RT+
Sbjct  163  STVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKQIQQLEEQVNSAGTTPTARTR  222

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             A  +    D    RSF  +ES+ +   S      RGI P R+  ++  E D+DLSFVSS
Sbjct  223  -AIHAGSVVDRSQRRSFISDESKKIGFGSRSPFDRRGILPSRIF-SDLSEADTDLSFVSS  280

Query  672  GSRPSGDRMSSFL-SETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            G RPS D  SS L  + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFSSSS E D
Sbjct  281  G-RPSTDHTSSMLFHDGMDSGRISQISTSSDSSFGSERLGPRGSELSSFNDFSSSSFETD  339

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  340  DGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSEELNVW  379


 Score =   267 bits (683),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIEEAT+ F++S KIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  456   RYRRYSIEEIEEATQFFTDSLKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQE  515

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS MRHPNMV+LLGACPEYGCLVYEYMA+GS+++RLM RG+K  LSWQ+RFRIAAE+
Sbjct  516   VEVLSRMRHPNMVLLLGACPEYGCLVYEYMANGSLEERLMRRGDKRSLSWQLRFRIAAEI  575

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  576   ATGLLFLHQTKPEPLVHRDLKPGNILL  602



>ref|XP_009793816.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Nicotiana sylvestris]
Length=806

 Score =   300 bits (768),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 247/340 (73%), Gaps = 27/340 (8%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------------QHKQQLEAQNKDL  140
            SQYAIKW T+NL+++GQ++VL+HV  +  +S                 H Q LE Q K+L
Sbjct  43   SQYAIKWATDNLVNRGQTLVLIHVVTKPASSSYGNCGGVHVVDGNLSAHGQNLEKQTKEL  102

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++ +D+ KALT+YVS AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  103  FLTFHCFCTRKDIRCLDVILEDSDVTKALTEYVSSAAIQNLVLGASRHGFIRRLKVTDIP  162

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQ---AQNNPDIRTK  491
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ Q+Q+++EQ   A   P  RT+
Sbjct  163  STVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKQIQQLEEQVNSAGTTPTARTR  222

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             A  +    D    RSF  +ES+ +  P  +R   RGI P R+  ++  E D+DLSFVSS
Sbjct  223  -AIHAGSVVDRSQRRSFISDESKKIGSP-FDR---RGILPSRIF-SDLSEADTDLSFVSS  276

Query  672  GSRPSGDRMSSFL-SETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            G RPS D  SS L  + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFSSSS E D
Sbjct  277  G-RPSTDHTSSMLFHDGMDSGRISQISTSSDSSFGSERLGPRGSELSSFNDFSSSSFETD  335

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  336  DGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSEELNVW  375


 Score =   268 bits (684),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIEEAT+ F++S KIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  452   RYRRYSIEEIEEATQFFTDSLKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQE  511

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS MRHPNMV+LLGACPEYGCLVYEYMA+GS+++RLM RG+K  LSWQ+RFRIAAE+
Sbjct  512   VEVLSRMRHPNMVLLLGACPEYGCLVYEYMANGSLEERLMRRGDKRSLSWQLRFRIAAEI  571

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  572   ATGLLFLHQTKPEPLVHRDLKPGNILL  598



>ref|XP_009793817.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 
[Nicotiana sylvestris]
Length=801

 Score =   300 bits (767),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 245/340 (72%), Gaps = 23/340 (7%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------------QHKQQLEAQNKDL  140
            SQYAIKW T+NL+++GQ++VL+HV  +  +S                 H Q LE Q K+L
Sbjct  43   SQYAIKWATDNLVNRGQTLVLIHVVTKPASSSYGNCGGVHVVDGNLSAHGQNLEKQTKEL  102

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++ +D+ KALT+YVS AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  103  FLTFHCFCTRKDIRCLDVILEDSDVTKALTEYVSSAAIQNLVLGASRHGFIRRLKVTDIP  162

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQ---AQNNPDIRTK  491
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ Q+Q+++EQ   A   P  RT+
Sbjct  163  STVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKQIQQLEEQVNSAGTTPTARTR  222

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             A  +    D    RSF  +ES+ +   S      RGI P R+  ++  E D+DLSFVSS
Sbjct  223  -AIHAGSVVDRSQRRSFISDESKKIGFGSRSPFDRRGILPSRIF-SDLSEADTDLSFVSS  280

Query  672  GSRPSGDRMSSFL-SETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            G RPS D  SS L  + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFSSSS E D
Sbjct  281  G-RPSTDHTSSMLFHDGMDSGRISQISTSSDSSFGSERLGPRGSELSSFNDFSSSSFETD  339

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  340  DGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSEELNVW  379


 Score =   268 bits (684),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIEEAT+ F++S KIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  456   RYRRYSIEEIEEATQFFTDSLKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQE  515

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS MRHPNMV+LLGACPEYGCLVYEYMA+GS+++RLM RG+K  LSWQ+RFRIAAE+
Sbjct  516   VEVLSRMRHPNMVLLLGACPEYGCLVYEYMANGSLEERLMRRGDKRSLSWQLRFRIAAEI  575

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  576   ATGLLFLHQTKPEPLVHRDLKPGNILL  602



>ref|XP_009793815.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Nicotiana sylvestris]
Length=810

 Score =   300 bits (767),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 245/340 (72%), Gaps = 23/340 (7%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------------QHKQQLEAQNKDL  140
            SQYAIKW T+NL+++GQ++VL+HV  +  +S                 H Q LE Q K+L
Sbjct  43   SQYAIKWATDNLVNRGQTLVLIHVVTKPASSSYGNCGGVHVVDGNLSAHGQNLEKQTKEL  102

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++ +D+ KALT+YVS AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  103  FLTFHCFCTRKDIRCLDVILEDSDVTKALTEYVSSAAIQNLVLGASRHGFIRRLKVTDIP  162

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQ---AQNNPDIRTK  491
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ Q+Q+++EQ   A   P  RT+
Sbjct  163  STVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKQIQQLEEQVNSAGTTPTARTR  222

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             A  +    D    RSF  +ES+ +   S      RGI P R+  ++  E D+DLSFVSS
Sbjct  223  -AIHAGSVVDRSQRRSFISDESKKIGFGSRSPFDRRGILPSRIF-SDLSEADTDLSFVSS  280

Query  672  GSRPSGDRMSSFL-SETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            G RPS D  SS L  + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFSSSS E D
Sbjct  281  G-RPSTDHTSSMLFHDGMDSGRISQISTSSDSSFGSERLGPRGSELSSFNDFSSSSFETD  339

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  340  DGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSEELNVW  379


 Score =   267 bits (683),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIEEAT+ F++S KIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  456   RYRRYSIEEIEEATQFFTDSLKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQE  515

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS MRHPNMV+LLGACPEYGCLVYEYMA+GS+++RLM RG+K  LSWQ+RFRIAAE+
Sbjct  516   VEVLSRMRHPNMVLLLGACPEYGCLVYEYMANGSLEERLMRRGDKRSLSWQLRFRIAAEI  575

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  576   ATGLLFLHQTKPEPLVHRDLKPGNILL  602



>ref|XP_009610864.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 
[Nicotiana tomentosiformis]
Length=801

 Score =   299 bits (765),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 189/340 (56%), Positives = 245/340 (72%), Gaps = 23/340 (7%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------------QHKQQLEAQNKDL  140
            SQYAIKW T+NL+++GQ++VL+HV  +  +S                 H Q LE Q K+L
Sbjct  43   SQYAIKWATDNLVNRGQTLVLIHVVTKPTSSSYGNCGGVHVVDGNLSAHGQNLEKQTKEL  102

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++ +D+ KALT+YVS AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  103  FLTFHCFCTRKDIRCLDVILEDSDVTKALTEYVSSAAIQNLVLGASRHGFIRRLKVTDIP  162

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN---PDIRTK  491
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ Q+Q+++EQ  +    P  RT+
Sbjct  163  STVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKQIQQLEEQVNSGGITPTARTR  222

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             A  +    D    RSF  +ES+ +   S      RGI P R+  ++  E D+DLSFVSS
Sbjct  223  -AIHAGSVVDRSQRRSFISDESKKIGFGSRSPFDRRGILPSRIF-SDLSEADTDLSFVSS  280

Query  672  GSRPSGDRMSSFL-SETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            G RPS D  SS L  + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFSSSS E D
Sbjct  281  G-RPSTDHTSSMLYHDGMDSGRISQISTSSDSSFGSERLGARGSELSSFNDFSSSSFETD  339

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  340  DGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSEELNVW  379


 Score =   261 bits (668),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIEEAT  F++S KIGEGGYGPV+KC LDHT VA+K+LRPDAAQGR QFQQE
Sbjct  456   RYRRYSIEEIEEATHFFTDSLKIGEGGYGPVYKCYLDHTPVAIKILRPDAAQGRSQFQQE  515

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS MRHPNMV+LLGACPEYGCLVYEYMA+GS+++RLM  G+K  LSWQ+RFRIAAE+
Sbjct  516   VEVLSRMRHPNMVLLLGACPEYGCLVYEYMANGSLEERLMRCGDKRSLSWQLRFRIAAEI  575

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNIL+
Sbjct  576   ATGLLFLHQTKPEPLVHRDLKPGNILV  602



>ref|XP_009610856.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Nicotiana tomentosiformis]
Length=806

 Score =   299 bits (765),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 247/340 (73%), Gaps = 27/340 (8%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------------QHKQQLEAQNKDL  140
            SQYAIKW T+NL+++GQ++VL+HV  +  +S                 H Q LE Q K+L
Sbjct  43   SQYAIKWATDNLVNRGQTLVLIHVVTKPTSSSYGNCGGVHVVDGNLSAHGQNLEKQTKEL  102

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++ +D+ KALT+YVS AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  103  FLTFHCFCTRKDIRCLDVILEDSDVTKALTEYVSSAAIQNLVLGASRHGFIRRLKVTDIP  162

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN---PDIRTK  491
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ Q+Q+++EQ  +    P  RT+
Sbjct  163  STVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKQIQQLEEQVNSGGITPTARTR  222

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             A  +    D    RSF  +ES+ +  P  +R   RGI P R+  ++  E D+DLSFVSS
Sbjct  223  -AIHAGSVVDRSQRRSFISDESKKIGSP-FDR---RGILPSRIF-SDLSEADTDLSFVSS  276

Query  672  GSRPSGDRMSSFL-SETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            G RPS D  SS L  + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFSSSS E D
Sbjct  277  G-RPSTDHTSSMLYHDGMDSGRISQISTSSDSSFGSERLGARGSELSSFNDFSSSSFETD  335

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  336  DGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSEELNVW  375


 Score =   261 bits (667),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIEEAT  F++S KIGEGGYGPV+KC LDHT VA+K+LRPDAAQGR QFQQE
Sbjct  452   RYRRYSIEEIEEATHFFTDSLKIGEGGYGPVYKCYLDHTPVAIKILRPDAAQGRSQFQQE  511

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS MRHPNMV+LLGACPEYGCLVYEYMA+GS+++RLM  G+K  LSWQ+RFRIAAE+
Sbjct  512   VEVLSRMRHPNMVLLLGACPEYGCLVYEYMANGSLEERLMRCGDKRSLSWQLRFRIAAEI  571

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNIL+
Sbjct  572   ATGLLFLHQTKPEPLVHRDLKPGNILV  598



>ref|XP_009610849.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Nicotiana tomentosiformis]
Length=810

 Score =   299 bits (765),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 189/340 (56%), Positives = 245/340 (72%), Gaps = 23/340 (7%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL---------------QHKQQLEAQNKDL  140
            SQYAIKW T+NL+++GQ++VL+HV  +  +S                 H Q LE Q K+L
Sbjct  43   SQYAIKWATDNLVNRGQTLVLIHVVTKPTSSSYGNCGGVHVVDGNLSAHGQNLEKQTKEL  102

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIP  320
            F+TFHCFCTRK+I CLD++++ +D+ KALT+YVS AAI+NLVLG+SRH F++RLKVTDIP
Sbjct  103  FLTFHCFCTRKDIRCLDVILEDSDVTKALTEYVSSAAIQNLVLGASRHGFIRRLKVTDIP  162

Query  321  TLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN---PDIRTK  491
            +  SK APDFCTV+VISKSKISSV+NA+RPAP ASPL+ Q+Q+++EQ  +    P  RT+
Sbjct  163  STVSKGAPDFCTVYVISKSKISSVKNASRPAPMASPLYKQIQQLEEQVNSGGITPTARTR  222

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
             A  +    D    RSF  +ES+ +   S      RGI P R+  ++  E D+DLSFVSS
Sbjct  223  -AIHAGSVVDRSQRRSFISDESKKIGFGSRSPFDRRGILPSRIF-SDLSEADTDLSFVSS  280

Query  672  GSRPSGDRMSSFL-SETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            G RPS D  SS L  + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFSSSS E D
Sbjct  281  G-RPSTDHTSSMLYHDGMDSGRISQISTSSDSSFGSERLGARGSELSSFNDFSSSSFETD  339

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  340  DGEAEMRRLKMELQRTMDLYSTACKEALTAKQKSEELNVW  379


 Score =   261 bits (668),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIEEAT  F++S KIGEGGYGPV+KC LDHT VA+K+LRPDAAQGR QFQQE
Sbjct  456   RYRRYSIEEIEEATHFFTDSLKIGEGGYGPVYKCYLDHTPVAIKILRPDAAQGRSQFQQE  515

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS MRHPNMV+LLGACPEYGCLVYEYMA+GS+++RLM  G+K  LSWQ+RFRIAAE+
Sbjct  516   VEVLSRMRHPNMVLLLGACPEYGCLVYEYMANGSLEERLMRCGDKRSLSWQLRFRIAAEI  575

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNIL+
Sbjct  576   ATGLLFLHQTKPEPLVHRDLKPGNILV  602



>ref|XP_007152997.1| hypothetical protein PHAVU_004G177800g [Phaseolus vulgaris]
 gb|ESW24991.1| hypothetical protein PHAVU_004G177800g [Phaseolus vulgaris]
Length=788

 Score =   296 bits (758),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 224/323 (69%), Gaps = 32/323 (10%)
 Frame = +3

Query  645   DSDLSFVSSGSRPSGDRMSSFLSETVES-------GRTPRLssssdgsfgsgRLGKGNDL  803
             DSD+SFVSSG RPS DR+   + + ++S       GR   +S S   SF S    +G + 
Sbjct  271   DSDISFVSSG-RPSIDRIFPTMYDDLDSASSGMATGRYSCVSDSDARSFASSLSSQGYNS  329

Query  804   NSFTDFSSS----SLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrv  971
             N    F+SS    S   D+ E+EMRRLKLEL++TMD+Y++ACKEA++AKQ+  E+QRW+ 
Sbjct  330   NDDYSFTSSQPRLSDCTDDVEMEMRRLKLELKQTMDMYNSACKEAMSAKQRAMEVQRWKA  389

Query  972   eeerrineeevnekskssvtsetkktgggenMPVPVR-------------------YRRY  1094
             EE++++ + +  + S + +    +     E   +  +                   YRRY
Sbjct  390   EEQKKLEDSQTGDASTTRLMEMEQNRIREEIAALEAQKRMSHVERKKPSEGFGTAMYRRY  449

Query  1095  TIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILS  1274
             +I+EIE+AT  FS+S KIGEGGYGPV++  LD T VA+KVL+PDA QGREQFQQEVE+LS
Sbjct  450   SIEEIEKATNMFSDSVKIGEGGYGPVYRGELDCTQVAIKVLKPDADQGREQFQQEVEVLS  509

Query  1275  CMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRG-NKPPLSWQVRFRIAAEMGTGL  1451
             C+RHPNMV+L+GACPEYGCLVYEYMA+GS+DD L  +G ++P L WQ+RF+IAAE+ TGL
Sbjct  510   CIRHPNMVLLVGACPEYGCLVYEYMANGSLDDCLFRKGSSRPALPWQLRFQIAAEIATGL  569

Query  1452  LFLHQNKPDPIVHRDLKPGNILL  1520
             LFLHQ KP+P+VHRDLKPGNILL
Sbjct  570   LFLHQTKPEPLVHRDLKPGNILL  592



>ref|XP_010319966.1| PREDICTED: U-box domain-containing protein 52-like [Solanum lycopersicum]
Length=783

 Score =   296 bits (757),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 182/338 (54%), Positives = 235/338 (70%), Gaps = 24/338 (7%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ-----HKQQLEAQNKDLFVTFHCFCTR  170
            SQYAIKW T+NL+ +GQ++VL+HV  +   S       H Q LE Q K+LF+TFHCFCTR
Sbjct  33   SQYAIKWATDNLVKRGQTLVLIHVVTKPIASQYGNLSPHGQNLEKQTKELFLTFHCFCTR  92

Query  171  KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDF  350
            K+I CLD++++  D+ KALT+Y+S AAI+NLVLG+SRH F++RLKVTDIP+  SK APDF
Sbjct  93   KDIRCLDVILEDADVPKALTEYLSSAAIQNLVLGASRHGFIRRLKVTDIPSSVSKGAPDF  152

Query  351  CTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK-NAPSSLRSF-DE  524
            CTV+VISKSKISSV+NA+RPA   SPL+ Q+Q+++E   +     T  N    + S  D 
Sbjct  153  CTVYVISKSKISSVKNASRPASMESPLYKQIQQLEEHVHSGGYTPTATNRAIHIGSVGDR  212

Query  525  KHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSS  704
               RSF  ++S  V  P   R   R IP R  + ++  E D+DLSFVSSG RPS DR SS
Sbjct  213  SQRRSFVSDDSRKVGSPFDRR---RVIPSR--IFSDLSEADTDLSFVSSG-RPSTDRTSS  266

Query  705  FLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEN----------DEA  851
             + + ++SGR  ++S+SSD SFGS RLG +G++L+SF DFS  S E           D+ 
Sbjct  267  LMYDGMDSGRISQISTSSDSSFGSERLGARGSELSSFNDFSLPSFETVSLPSLYDTQDDG  326

Query  852  EVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            E EMRRLK+ELQ+TMDLYSTACKEALTAKQK+ EL  W
Sbjct  327  EAEMRRLKMELQRTMDLYSTACKEALTAKQKSVELNLW  364


 Score =   264 bits (674),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V  RYRRY I+EIEEAT  FS+S K+GEGGYGPV+KC LDHT VA+KVLRPDAAQGR QF
Sbjct  438   VDFRYRRYNIEEIEEATHFFSDSLKVGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQF  497

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGN-KPPLSWQVRFRI  1427
             QQEVE+LS MRHPNMV+LLGACPEYGCL+YEYMA+GS+++RLM RG+ K  LSWQ+RFRI
Sbjct  498   QQEVEVLSRMRHPNMVLLLGACPEYGCLIYEYMANGSLEERLMRRGDKKSALSWQLRFRI  557

Query  1428  AAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AAE+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  558   AAEIATGLLFLHQTKPEPLVHRDLKPGNILL  588



>dbj|BAB11488.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=684

 Score =   290 bits (741),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 196/476 (41%), Positives = 273/476 (57%), Gaps = 36/476 (8%)
 Frame = +3

Query  177   IHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCT  356
             I+C D++++    AK + DYV   AIE L+LGSS+ + L+R K  D+ +   K AP FCT
Sbjct  30    INCQDVVVEDVSAAKGIVDYVQQNAIETLILGSSKMTLLRRFKAADVSSTVMKKAPSFCT  89

Query  357   VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
             V+VISK KIS +R+AT   P ++   P ++       +N ++  +   +  R+ DE  + 
Sbjct  90    VYVISKGKISFLRSATSSPPHSN--MPSMRHHSHAQTSNMNVERRQQ-TMQRTHDEIKIE  146

Query  537   ---SFKLEESESVSRPSIERA----ATRGIP---------------PRRMLGAETVEGDS  650
                 F     E V +PSI  +     + G P               PR  + +E   G++
Sbjct  147   IKSPFSRRGYEGVYQPSITDSDISFVSSGRPSVDQMFPSLYDDVDVPRLSVTSEY--GEN  204

Query  651   DLSFVSSGSRPSGDRMSSFL---SETVESGRTP-RLssssdgsfgsgRLGK--GNDLNSF  812
              LSF ++ S+ S D  S +    S + ESGR    L    +      RL     + +  +
Sbjct  205   RLSFATTYSKQSIDLGSPYAPNSSTSFESGRQSFSLQGQDELETEMRRLKMELKHTMEMY  264

Query  813   TDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRWrveeerrin  992
                   ++   +A  E+ + K E +  ++    + + A+   ++  E  R  +E      
Sbjct  265   NSACKEAISAKKAANELLKWKAEKEHKLEEVRLSKEAAMAMAEREKEKSRAAMEAAVAAQ  324

Query  993   eeevnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPV  1172
             +    E  K        +     +    +RYR+YTI+EIEEATE FS SRK+GEGGYGPV
Sbjct  325   KLSDLEAEKRKHIETVDEKKRAVS---SLRYRKYTIEEIEEATEDFSPSRKVGEGGYGPV  381

Query  1173  FKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMA  1352
             +K  LD+T VA+KVLRPDAAQGR QFQ+EVE+L+CMRHPNMV+LLGACPEYGCLVYEYMA
Sbjct  382   YKGTLDYTKVAIKVLRPDAAQGRSQFQREVEVLTCMRHPNMVLLLGACPEYGCLVYEYMA  441

Query  1353  HGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GS+DD L  RGN P LSWQ+RFRIA+E+ TGL FLHQ KP+P+VHRDLKPGNILL
Sbjct  442   NGSLDDCLFRRGNSPILSWQLRFRIASEIATGLHFLHQMKPEPLVHRDLKPGNILL  497



>ref|XP_011019963.1| PREDICTED: U-box domain-containing protein 34-like [Populus euphratica]
Length=673

 Score =   289 bits (739),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 195/477 (41%), Positives = 258/477 (54%), Gaps = 77/477 (16%)
 Frame = +3

Query  288   FLKRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQ  467
             F+++ K TD+P   SK AP FC+V+VISK KISSVR+A+ P P   P HP   ++Q  A 
Sbjct  7     FIRKFKTTDVPGNVSKGAPGFCSVYVISKGKISSVRSASGPPP---PKHPIQTQMQSTAS  63

Query  468   N-------------NPDIRTKNAPSSLRSFDE---------------KHMRSFKLEESES  563
             N              P +R + +P +L+   E               K+  S    +   
Sbjct  64    NMSDTVETPFKSSLAPRVRER-SPYTLQGLQEDMEIKSPFTRRGGIAKYEPSIPDSDISF  122

Query  564   VS--RPSIER-------AATRGIPPRRMLGAET-----VEGDSDLSFVSSGSRPSGDR--  695
             VS  RPSI+        A   G+ PR     ET     +   SD  + S GS  SG++  
Sbjct  123   VSSGRPSIDHTFPAIYDAFETGMTPRLSNAFETGMTPRLSNGSDYEYRSFGSLYSGNKSI  182

Query  696   ----MSSFLSETVESGRTP----RLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEA  851
                   +F S + ESG T     +     +      RL     ++ ++     +L   + 
Sbjct  183   DASSQYNFSSTSQESGNTSWSSSQNMDDMEAEMRRLRLELKQTMDMYSSACREALTAKQK  242

Query  852   EVEMRRLKLELQKTMDLYSTA--------------CKEALTAKQKTSELQRWrveeerri  989
               E+   KLE Q+  +    A              CK A+ A + +  +    +++    
Sbjct  243   ARELHHWKLEEQQRSEGARLAEEAALQLVAKERFKCKAAIEAAESSQRIAELELQKRLNA  302

Query  990   neeevnekskssvtsetkktgggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGP  1169
                   E  + +    +            +RYR+YTI+EIE AT+ FS S KIGEGGYGP
Sbjct  303   EMIAQKEFQERNKALASIANSD-------LRYRKYTIEEIEAATDEFSNSLKIGEGGYGP  355

Query  1170  VFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYM  1349
             V+K  LDHT VA+KVLRPDAA GR QFQQEVE+LSC+RHPNMV+LLGACPEYGCLVYEYM
Sbjct  356   VYKSYLDHTPVAIKVLRPDAAHGRSQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEYM  415

Query  1350  AHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             A+GS++D L +RGN PPLSWQ+RFRIAAE+GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  416   ANGSLEDCLFHRGNSPPLSWQLRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILL  472



>gb|EYU39578.1| hypothetical protein MIMGU_mgv1a004000mg [Erythranthe guttata]
Length=550

 Score =   279 bits (714),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY I+EIEEATE+F+ESRKIGEGGYGPVFKC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  197   LRYRRYPIEEIEEATEYFAESRKIGEGGYGPVFKCYLDHTPVAVKVLRPDAAQGRSQFQQ  256

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSCMRHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN  PL+WQ+RFRIAAE
Sbjct  257   EVEVLSCMRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTRPLTWQLRFRIAAE  316

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGL FLHQ KP+P+VHRDLKPGNILL
Sbjct  317   IATGLHFLHQTKPEPLVHRDLKPGNILL  344


 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 83/122 (68%), Gaps = 10/122 (8%)
 Frame = +3

Query  627  AETVEGDSDLSFVSSGSRPSGDR-------MSSFLSETVES--GRTPRLssssdgsfgsg  779
            +E  E D+D+SF+SS  RPS DR       MS+ L ++V+S    +   +SS      + 
Sbjct  3    SELPEYDTDISFISS-DRPSTDRGSIVIDPMSNMLFDSVDSCRTSSRISTSSDSSFGSTR  61

Query  780  RLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
               K ++L+S TDFSSSSLENDE E EM+RLKLELQKTM+LYSTACKEALTAKQK  EL 
Sbjct  62   SATKFSELSSCTDFSSSSLENDEVEAEMKRLKLELQKTMELYSTACKEALTAKQKAVELH  121

Query  960  RW  965
            RW
Sbjct  122  RW  123



>ref|XP_006390621.1| hypothetical protein EUTSA_v10019640mg, partial [Eutrema salsugineum]
 gb|ESQ27907.1| hypothetical protein EUTSA_v10019640mg, partial [Eutrema salsugineum]
Length=672

 Score =   280 bits (717),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 184/516 (36%), Positives = 273/516 (53%), Gaps = 46/516 (9%)
 Frame = +3

Query  6     SQYAIKWTTENLLSKGQSVVLVHVD-NQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
             SQ+A+KW  EN++      VL+HV        LQH  Q +      F+ F  FC RK I 
Sbjct  22    SQHALKWAVENIIVDSPHCVLLHVQQGNAGAHLQHDNQDDEH--QFFLPFRGFCARKGII  79

Query  183   CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRH-SFLKRLKVTDIPTLTSKAAPDFCTV  359
               ++++  TDI+ A+  Y+++ ++ N+V+G+S H SF K+ K           +PD  T 
Sbjct  80    AKEVILRNTDISNAIVTYITNNSVSNIVVGASAHNSFFKKFK-----------SPDVSTT  128

Query  360   FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRS  539
              +            T P   A  +  + + ++ ++ + P   T+    S   ++ +H  S
Sbjct  129   LLK-----------TAPETCAVFVVSKGKLLKSKSASQPQKHTRQQDLSSLLYNYEHTSS  177

Query  540   FKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSET  719
                 +SE  S  S     T+   P+  L        S    +S  S+   D  S  +  T
Sbjct  178   VNSSDSERESSVS-----TKHNKPKSALSQSNSPRISPPPSLSEISQSETDNGSYGVVST  232

Query  720   VESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQ----  887
               S      S+++  S  S      + +N F +      +N   E E+RRL+LEL+    
Sbjct  233   ASSYTISESSNTNGSSISSTSTESPHAVN-FVE-----QQNQNLEAEVRRLRLELKQFNP  286

Query  888   ---KTMDLYSTACKEALTAKQKTSELQ--RWrveeerrineeevnekskssvtsetkktg  1052
                K     + +  EA+   +  SE +  R    +   I +     +S+     E +   
Sbjct  287   SKGKDTTNQNESLDEAIELPRALSEEKNKRHSAIQAAEIAKRLAKMESQKRRLLEMQAKL  346

Query  1053  ggenMPVPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAA  1232
               + M   V YRRY+I ++E AT  FS++ KIGEGGYGPV+K +LD+T+VA+K+L+    
Sbjct  347   EKQRMANKVSYRRYSIKDVESATNGFSDALKIGEGGYGPVYKAVLDYTSVAIKILKSGIT  406

Query  1233  QGREQFQQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQ  1412
             QG +QFQQE+E+LS MRHPNMV+LLGACPEYGCLVYEYM +G+++DRL  + N PPLSW+
Sbjct  407   QGLKQFQQEIEVLSSMRHPNMVILLGACPEYGCLVYEYMENGTLEDRLFCKNNTPPLSWR  466

Query  1413  VRFRIAAEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              RFRIA+E+ TGLLFLH  KP+P+VHRDLKP NILL
Sbjct  467   ARFRIASEIATGLLFLHHAKPEPLVHRDLKPANILL  502



>ref|XP_002518240.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF44126.1| ATP binding protein, putative [Ricinus communis]
Length=802

 Score =   283 bits (724),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+Y+I+EIE ATE FSESRKIGEGGYGPV+KC LDHT+VA+KVLRPDAAQGR QFQQ
Sbjct  468   IRYRKYSIEEIEAATEFFSESRKIGEGGYGPVYKCYLDHTSVAIKVLRPDAAQGRSQFQQ  527

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DDRL  RGN PPLSWQ+RFRIAAE
Sbjct  528   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPPLSWQLRFRIAAE  587

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  588   IGTSLLFLHQTKPEPLVHRDLKPANILL  615


 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 206/375 (55%), Gaps = 66/375 (18%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQT-------SLQHKQQLEAQN----------  131
            +SQ A+KW  +++L KGQ+V+L+HV  ++ +       S     Q+   N          
Sbjct  30   SSQSALKWAIDHILHKGQTVLLIHVKLKSISMSSAYSLSTPRMNQIADANGESMLVCRDP  89

Query  132  ----KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKR  299
                K+LF+ F CFCTRK+I C D++++ TDIAKAL +Y +  AIE LV+G+S  S L R
Sbjct  90   DSLTKELFLPFRCFCTRKDIQCKDVVLEETDIAKALVEYATRTAIETLVVGASNKSGLFR  149

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN--  473
             K TD P    K APDFCTV+VISK KI S R+A+RP P  SP+H QL       QN   
Sbjct  150  FKATDTPGSVLKGAPDFCTVYVISKGKIQSTRSASRPPPSLSPMHTQLVN-----QNGVK  204

Query  474  ----------PDIRTKNAPSSLRSFDEK---HMRSFKLEESESVSRPSIERAATRGIPPR  614
                      P I+  N  ++ R   EK          EESES   P   R         
Sbjct  205  PLPPPTEILLPQIQNPNPTTAFRRVVEKPPLEQPRRSNEESESFRSPFTRRGLN-----G  259

Query  615  RMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESG-RTPRLsss----sdgsfgsg  779
            +  G  ++  D+D+SFVSSG RPS DRM     + +E G R  RLS+     S  SF S 
Sbjct  260  KSYGELSIP-DTDISFVSSG-RPSIDRMFPAFYDVLEMGARNQRLSNVSDIDSIQSFESM  317

Query  780  RLGKGN-DLN--SFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACK  920
            + G+ + D+N  S  +FSS S ++          D+ E EMRRLKLEL++TM++YSTACK
Sbjct  318  QFGRRSIDINIGSPPEFSSMSYDSDRLSTASQPMDDVEAEMRRLKLELKQTMEMYSTACK  377

Query  921  EALTAKQKTSELQRW  965
            EALTAK+KT ELQ W
Sbjct  378  EALTAKEKTRELQLW  392



>gb|EYU25756.1| hypothetical protein MIMGU_mgv1a001768mg [Erythranthe guttata]
Length=761

 Score =   281 bits (719),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+Y+I+EIE ATE+F+ESRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  456   LRYRKYSIEEIETATEYFTESRKIGEGGYGPVYKCNLDHTQVAVKVLRPDAAQGRSQFQQ  515

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DDRL  RGN P L WQ+RFRIAAE
Sbjct  516   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPVLPWQLRFRIAAE  575

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  576   IGTGLLFLHQTKPEPLVHRDLKPGNILL  603


 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 138/368 (38%), Positives = 197/368 (54%), Gaps = 60/368 (16%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT---------SLQHKQQLEAQNKDLFVTFHC  158
            SQ A+KW  ++LL KG++V L+HV  +T +         S    +    Q K+LF+ F C
Sbjct  25   SQAALKWAVDHLLGKGKTVALLHVKQRTSSAPLGSHVAFSDNDGKVAADQFKELFLPFRC  84

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKA  338
            FCTRK+I   +++I+ TDIA+A+ DYV +  IE LV+GS+  +   R K  D+P   +K 
Sbjct  85   FCTRKDIQVNEVVIEDTDIARAICDYVKNNTIETLVVGSTVKNGFVRFKTVDVPGSVTKG  144

Query  339  APDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNP-------------D  479
            APDFCTV+VISK K+S+VR+A       S L  +     + A +NP              
Sbjct  145  APDFCTVYVISKGKVSTVRSAV------SSLSKEAPRSSQNASSNPTSGQNDARYMQGNG  198

Query  480  IRTKNAPSSLRSFDEK--HMRSFKLEESESVSRPSIERAA--TRG--IPPRRMLGAETVE  641
            +R  ++PS+ R++  +   +++  L    ++      R++  TRG      R  G  ++ 
Sbjct  199  MRAISSPSNTRNWVARWSKLQTLVLHPGNNLVYILHPRSSPFTRGNCKASNRSYGELSMP  258

Query  642  GDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDL------  803
             + D+SFVSS  RPS +RM  F S   +    PRL   S+ S    RL  G+        
Sbjct  259  DNMDISFVSS-VRPSNERM--FPSLEQDMMMAPRL---SNSSDTENRLSFGSPFSNARSS  312

Query  804  ---NSFTDFSSSSLEN-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
               NSF   SSSS E+           D+ E EMRRLK EL++TMD+YSTAC+EALTAKQ
Sbjct  313  DANNSFGVCSSSSQESGNFSWSGSQSLDDVEAEMRRLKQELKQTMDMYSTACREALTAKQ  372

Query  942  KTSELQRW  965
            K  EL RW
Sbjct  373  KALELHRW  380



>emb|CAN69465.1| hypothetical protein VITISV_023046 [Vitis vinifera]
Length=768

 Score =   281 bits (719),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE FSESRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  421   VRYRKYTIEEIESATEFFSESRKIGEGGYGPVYKCNLDHTQVAIKVLRPDAAQGRSQFQQ  480

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RG+ PPLSWQ+RFRIAAE
Sbjct  481   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGDSPPLSWQLRFRIAAE  540

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  541   IGTGLLFLHQTKPEPLVHRDLKPANILL  568


 Score =   202 bits (513),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 149/342 (44%), Positives = 204/342 (60%), Gaps = 46/342 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHK-----QQLEAQNKDLFVTFHCFCTR  170
            SQ A+KW  +N+L++GQ+VVL+HV  +   S  +       +L+   K+LF+ F CFCTR
Sbjct  28   SQSALKWAIDNILNRGQTVVLIHVKLKQSHSHSYPTGDEVAKLDHYTKELFLPFRCFCTR  87

Query  171  KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPD  347
            K+I C D++++ TD+ KAL +YVS +AIE LV+G+ ++  FL+R K  DIP   +K APD
Sbjct  88   KDIQCKDVILEDTDVVKALIEYVSHSAIEVLVVGAPAKGGFLRRFKAIDIPGSITKGAPD  147

Query  348  FCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEK  527
            FCTV+VISK KISS R+A+R AP  SPL  Q+        +  D+   +APSS       
Sbjct  148  FCTVYVISKGKISSTRSASRAAPAISPLRNQIMNQGSIRPDPSDLPIPHAPSS-----RG  202

Query  528  HMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM-SS  704
            H     LEE E+      + A   G    R+           +SFVSSG RPS DRM   
Sbjct  203  H---HSLEEQEA------QMADHMGKFHYRI---------RYISFVSSG-RPSTDRMFPP  243

Query  705  FLSETVESGRT-PRLssss---dgsfgsgRLG-KGNDLNSFTDFSSSSLEND--------  845
            F    ++  R+ PRLS+SS   + +F S ++G K  ++ S  +F + S END        
Sbjct  244  FYDSNIDIIRSNPRLSNSSDMDNQTFESSQMGRKSMEIGSPPEFLAISQENDRTSWSSQS  303

Query  846  --EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
              + E EMRRLKLEL++TMD+YSTACKEAL+AKQK  ELQRW
Sbjct  304  AEDVEAEMRRLKLELKQTMDMYSTACKEALSAKQKARELQRW  345



>gb|EPS65707.1| hypothetical protein M569_09070, partial [Genlisea aurea]
Length=726

 Score =   280 bits (716),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRYTI+EIE ATE+FS SRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  432   VRYRRYTIEEIEMATEYFSSSRKIGEGGYGPVYKCYLDHTQVAVKVLRPDAAQGRSQFQQ  491

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN P LSWQ+RF+IAAE
Sbjct  492   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPVLSWQLRFKIAAE  551

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  552   IATGLLFLHQTKPEPLVHRDLKPGNILL  579


 Score =   154 bits (390),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 134/359 (37%), Positives = 191/359 (53%), Gaps = 60/359 (17%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS-----------------LQHKQQLEAQNK  134
            SQ A+KW  ++LLSKG++V L+HV  Q QTS                    K  +++Q K
Sbjct  19   SQTALKWAVDHLLSKGKNVTLLHV-RQRQTSSPGINKKIAMKIWDGVRFAGKVVVDSQAK  77

Query  135  DLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVT  311
            D F+ F CFCTRK+I   +++I+  DIA+A+  YV +  IE LV+G+S ++ F++R K  
Sbjct  78   DFFLPFRCFCTRKDIQVNEVVIEDMDIARAICQYVKNNLIETLVVGTSVKNGFIRRFKSV  137

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK  491
            D P   +K+AP+FCTV+VI+K KISSVR AT                   A +     ++
Sbjct  138  DTPATITKSAPEFCTVYVIAKGKISSVRAATS----------SAAPATTDAVSRGSYISQ  187

Query  492  NAP-------SSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDS  650
            +AP        S+R   +++ +        +V +       TRG    +    E    +S
Sbjct  188  SAPRSVLEDGESIRQVGKQNQKIVNWHCRTNVPQFFCRSPFTRG----KCSYGEISMPES  243

Query  651  DLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG----NDLNSFTD  818
            D+SFVSS +RPS +R  +F +   +    PRLSSSSD      R+  G    N   S   
Sbjct  244  DISFVSS-TRPSNER--AFQTIDQDMFMAPRLSSSSDNDS---RISFGSPFSNPRASDAM  297

Query  819  FSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +SSSS E+          D+ E EMRRLK EL++TM +YSTACKEAL+A+QK  EL RW
Sbjct  298  YSSSSQESGNFSWSSQSLDDVEAEMRRLKNELRQTMHMYSTACKEALSAQQKAMELHRW  356



>ref|XP_010252203.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Nelumbo nucifera]
Length=795

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE+FSE+RKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR+QFQQE
Sbjct  447   RYRKYTIEEIEAATEYFSETRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRQQFQQE  506

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN P LSWQVRFRIAAE+
Sbjct  507   VEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPVLSWQVRFRIAAEI  566

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  567   GTGLLFLHQTKPEPLVHRDLKPANILL  593


 Score =   230 bits (586),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 214/352 (61%), Gaps = 41/352 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT------------------SLQHKQQLEAQN  131
            SQY++KW  +++L KGQ+V+L+HV+ +  T                  +  ++Q+ + Q 
Sbjct  28   SQYSLKWAVDHILGKGQTVILIHVNQKASTLPSPTGSQVSISDVRDDVASTYRQEQDGQT  87

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVT  311
            K+LF+ F CFCTRK+I C D++I+  DIAKAL +YVS   IENLV+G+S  +   R K T
Sbjct  88   KELFLPFRCFCTRKDIQCKDVVIEDVDIAKALIEYVSHNVIENLVVGASTKNGFMRFKST  147

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK  491
            D+ T  SK APDFCTV+VISK KISSVR+A+RPAP  SPL  QLQ   + +  +  + + 
Sbjct  148  DVATTVSKGAPDFCTVYVISKGKISSVRSASRPAPTVSPLRNQLQAQNQLSIKSEPVESN  207

Query  492  NAPSS-----LRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDL  656
            N+ SS     L  F+    R+    E ES+  P       RG+  +     E    DSD+
Sbjct  208  NSYSSRGAAPLSPFEPP--RNSIHSELESMKSP----FTRRGLNGKSY--GEISLPDSDI  259

Query  657  SFVSSGSRPSGDRMSSFLSETVESGRTPRLssss---dgsfgsgRLGKGNDLNSFTDFSS  827
            SFVSSG RPS DRM   + + +ES RTPRLS+ S     SF S + G  +DL+S    SS
Sbjct  260  SFVSSG-RPSVDRMFPPIYDHLESSRTPRLSNCSDLDLQSFESVQSGPKSDLHSMHGISS  318

Query  828  SSLEN------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             S E+      ++ E EMRRLKLEL++TMD+YSTACKEALTAKQK  EL RW
Sbjct  319  FSHESDSSQTMEDVEAEMRRLKLELKQTMDMYSTACKEALTAKQKARELHRW  370



>ref|XP_010252202.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Nelumbo nucifera]
Length=796

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE+FSE+RKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR+QFQQE
Sbjct  448   RYRKYTIEEIEAATEYFSETRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRQQFQQE  507

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN P LSWQVRFRIAAE+
Sbjct  508   VEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPVLSWQVRFRIAAEI  567

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  568   GTGLLFLHQTKPEPLVHRDLKPANILL  594


 Score =   233 bits (593),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 161/353 (46%), Positives = 218/353 (62%), Gaps = 42/353 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT------------------SLQHKQQLEAQN  131
            SQY++KW  +++L KGQ+V+L+HV+ +  T                  +  ++Q+ + Q 
Sbjct  28   SQYSLKWAVDHILGKGQTVILIHVNQKASTLPSPTGSQVSISDVRDDVASTYRQEQDGQT  87

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
            K+LF+ F CFCTRK+I C D++I+  DIAKAL +YVS   IENLV+G S+++ F++R K 
Sbjct  88   KELFLPFRCFCTRKDIQCKDVVIEDVDIAKALIEYVSHNVIENLVVGASTKNGFMRRFKS  147

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            TD+ T  SK APDFCTV+VISK KISSVR+A+RPAP  SPL  QLQ   + +  +  + +
Sbjct  148  TDVATTVSKGAPDFCTVYVISKGKISSVRSASRPAPTVSPLRNQLQAQNQLSIKSEPVES  207

Query  489  KNAPSS-----LRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
             N+ SS     L  F+    R+    E ES+  P       RG+  +     E    DSD
Sbjct  208  NNSYSSRGAAPLSPFEPP--RNSIHSELESMKSP----FTRRGLNGKSY--GEISLPDSD  259

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssss---dgsfgsgRLGKGNDLNSFTDFS  824
            +SFVSSG RPS DRM   + + +ES RTPRLS+ S     SF S + G  +DL+S    S
Sbjct  260  ISFVSSG-RPSVDRMFPPIYDHLESSRTPRLSNCSDLDLQSFESVQSGPKSDLHSMHGIS  318

Query  825  SSSLEN------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S S E+      ++ E EMRRLKLEL++TMD+YSTACKEALTAKQK  EL RW
Sbjct  319  SFSHESDSSQTMEDVEAEMRRLKLELKQTMDMYSTACKEALTAKQKARELHRW  371



>ref|XP_010648456.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
52 [Vitis vinifera]
Length=810

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE FSESRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  465   VRYRKYTIEEIESATEFFSESRKIGEGGYGPVYKCNLDHTQVAIKVLRPDAAQGRSQFQQ  524

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RG+ PPLSWQ+RFRIAAE
Sbjct  525   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGDSPPLSWQLRFRIAAE  584

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  585   IGTGLLFLHQTKPEPLVHRDLKPANILL  612


 Score =   209 bits (533),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 156/364 (43%), Positives = 212/364 (58%), Gaps = 46/364 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHK-----QQLEAQNKDLFVTFHCFCTR  170
            SQ A+KW  +N+L++GQ+VVL+HV  +   S  +       +L+   K+LF+ F CFCTR
Sbjct  28   SQSALKWAIDNILNRGQTVVLIHVKLKQSHSHSYPTGDEVAKLDHYTKELFLPFRCFCTR  87

Query  171  KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDF  350
            K+I C D++++ TD+ KAL +YVS +AIE LV+G+       R K  DIP   +K APDF
Sbjct  88   KDIQCKDVILEDTDVVKALIEYVSHSAIEVLVVGAPAKGGFLRFKAIDIPGSITKGAPDF  147

Query  351  CTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKH  530
            CTV+VISK KISS R+A+R AP  SPL  Q+        +  D+   +APSS   F    
Sbjct  148  CTVYVISKGKISSTRSASRAAPAISPLRNQIMNQGSIRPDPSDLPIPHAPSSRGWFTXSI  207

Query  531  MRSFKL--------EESESVSRPSIE--RAA-----------TRGI--PPRRMLGAETVE  641
               F+L        +   +V +P +E  R++           TRG   P  R  G E   
Sbjct  208  CFFFELLWKXAISDDPISAVEKPPVEPPRSSHDDFEHIKSPFTRGARGPNGRSYG-EISL  266

Query  642  GDSDLSFVSSGSRPSGDRM-SSFLSETVESGRT-PRLssss---dgsfgsgRLG-KGNDL  803
             DSD+SFVSSG RPS DRM   F    ++  R+ PRLS+SS   + +F S ++G K  ++
Sbjct  267  PDSDISFVSSG-RPSTDRMFPPFYDSNIDIIRSNPRLSNSSDMDNQTFESSQMGRKSMEI  325

Query  804  NSFTDFSSSSLEND----------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
             S  +F + S END          + E EMRRLKLEL++TMD+YSTACKEAL+AKQK  E
Sbjct  326  GSPPEFLAISQENDRTSWSSQSAEDVEAEMRRLKLELKQTMDMYSTACKEALSAKQKARE  385

Query  954  LQRW  965
            LQRW
Sbjct  386  LQRW  389



>ref|XP_008361051.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=778

 Score =   279 bits (713),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE ATE F+ESRKIGEGGYGPV++C LDHT VAVKVLRPDAAQGR QF Q
Sbjct  453   VRYRRYSIEEIEAATEFFTESRKIGEGGYGPVYRCYLDHTPVAVKVLRPDAAQGRSQFNQ  512

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN PPLSWQ+RF+IAAE
Sbjct  513   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPPLSWQLRFKIAAE  572

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  573   IGTGLLFLHQAKPEPLVHRDLKPANILL  600


 Score =   189 bits (480),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 136/360 (38%), Positives = 198/360 (55%), Gaps = 48/360 (13%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHV--------------DNQTQTSLQHKQQL-----EA  125
             SQ A+KW  +NL+  GQSV+L+HV              ++  +++    QQ      ++
Sbjct  27   NSQCALKWAIDNLIKPGQSVLLIHVKIKPPLFSQSPSLSNSTPRSNPNWDQQFVCKEPDS  86

Query  126  QNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLK  305
            Q ++L   F  FC RKNI C DI+++ +D+ KAL +Y + ++IE+LV+G+S  +   R K
Sbjct  87   QTRELIRPFRVFCARKNIQCRDIVLEDSDVTKALVEYJTQSSIEHLVVGASAKTGFLRFK  146

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
             +DIP   SKAAPDFC V+V++K K+ S R A+RPAP  SPL          A+  P + 
Sbjct  147  ASDIPGSISKAAPDFCNVYVVAKQKLQSRRAASRPAPATSPLRNPAFNHTPSAKPEPYVF  206

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
              +         E   +S   +E ++   P   +       P     A+    D+D+SFV
Sbjct  207  PPSGNKGNEKPPEPQRKSH--DEMDNFRSPFTRKG------PNGKSYADLPMPDTDISFV  258

Query  666  SSGSRPSGDRM-SSFLSETVESGRT--PRLssssd-----gsfgsgRLGKGN-DLNSF-T  815
            SSG RPS DR+  +F +E ++SGR   PR+S+S++             G+ + D NS   
Sbjct  259  SSG-RPSIDRIFPAFYNENLDSGRVTPPRMSNSTEIDLNHSFESMQYFGRRSVDXNSSPP  317

Query  816  DFSSSSLEND----------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             FSS S ++D          E E EMRRLKLEL++TM++YSTACKEAL+AKQK  ELQRW
Sbjct  318  TFSSVSQDSDRLSSASQPMEEVEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRW  377



>ref|XP_008219968.1| PREDICTED: U-box domain-containing protein 52 [Prunus mume]
Length=773

 Score =   278 bits (711),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTIDEIE ATE F+ESRKIGEGGYGPV++C LDHT VA+KVLRPDAAQGR QF Q
Sbjct  449   VRYRKYTIDEIEAATEFFAESRKIGEGGYGPVYRCYLDHTPVAIKVLRPDAAQGRSQFNQ  508

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN PPLSWQ+RFRIAAE
Sbjct  509   EVEVLSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPPLSWQLRFRIAAE  568

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNIL+
Sbjct  569   IGTGLLFLHQAKPEPLVHRDLKPGNILI  596


 Score =   198 bits (503),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 136/359 (38%), Positives = 210/359 (58%), Gaps = 50/359 (14%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
             SQ A+KW  ++L+ +GQ+V+L+HV             +  +++    Q L     + Q 
Sbjct  27   NSQSALKWCIDSLVKQGQTVLLIHVKIKPPVFSQSPSLSNPRSNPNWDQHLVCKDPDPQT  86

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVT  311
            K+LF+ F  +CTRKNI C DI+++ +D+AKAL +YV+ +AIE+LV+G+S  +   R K++
Sbjct  87   KELFLPFRVYCTRKNIQCKDIVLEDSDVAKALNEYVTQSAIEHLVVGASAKTGFLRFKIS  146

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK  491
            D+P   SK APDFC V+V+SK K+ S R+A+RPAP  SP+   ++     A++ P +   
Sbjct  147  DVPGNVSKGAPDFCNVYVVSKGKLQSRRSASRPAPSISPIRAPVRSHTPSAKSEPYV---  203

Query  492  NAPSSLRSFD---EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
              PS ++  +   E H +S   +E E+   P   +       P     A+    D+D+S+
Sbjct  204  FPPSGMKGHEKPPEPHRKSH--DEMENFRSPFTRKG------PNGKSYADLPMPDTDISY  255

Query  663  VSSGSRPSGDRMSSFLSETVESGRT--PRLssssd-----gsfgsgRLGKGN-DLNS---  809
            VSSG RPS DR+     + ++SGR   PR+S+S++             G+ + D++S   
Sbjct  256  VSSG-RPSIDRIFPAFYDNLDSGRVTPPRMSNSTEIDLNHSFESMQYFGRRSVDVSSSPP  314

Query  810  -FTDFS------SSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             F+  S      SS+ + ++ E EMRRLKLEL++TM++YSTACKEALTAKQK  ELQRW
Sbjct  315  TFSSVSQDSDRLSSASQMEDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRW  373



>ref|XP_009385916.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   277 bits (709),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTIDEIE AT+ F+++RKIGEGGYGPVF+C LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  400   LRYRKYTIDEIEAATDRFAKNRKIGEGGYGPVFRCYLDHTEVAVKVLRPDAAQGRSQFQQ  459

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN PP+ WQ RFRIAAE
Sbjct  460   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPPMPWQYRFRIAAE  519

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  520   IGTGLLFLHQTKPEPLVHRDLKPANILL  547


 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 123/325 (38%), Positives = 190/325 (58%), Gaps = 26/325 (8%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
            +SQ A+KW  +N+++K Q ++L+HV+  T+ S  +++   A   +L V F CFC RK+++
Sbjct  23   SSQAALKWALDNVVTKNQILILIHVN--TKASPGNQEDAAAAVHELLVPFRCFCQRKDVN  80

Query  183  CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
            C+DI++D TD+ +A+ D+V+ AAIE LV+G+SR  F++  +  DI T  SK+ PDFCT +
Sbjct  81   CVDIVLDDTDVTRAVVDFVAQAAIEKLVVGASRSGFIRSFRGADISTGISKSVPDFCTTY  140

Query  363  viskskissvRNATRPAPFASPLHPQLQ-EIQEQAQNNPDIRTKNAPSSLRSFDEKHMRS  539
            +++K K+S+ RNA R AP  SPL  +LQ +   +A N+ D R  +A     +F    +R 
Sbjct  141  IVTKGKLSTTRNAIRAAPTVSPLRAKLQNQANRRASNSTDHRHGDA-----AFGTHKLR-  194

Query  540  FKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMS---SFL  710
               ++++++  P         I  +  LG     GDSD SF SS    +   ++   S++
Sbjct  195  ---KQTQTIESP---------INRKTRLGTAIFSGDSDASFASSSRTSTDRSLAQRFSYM  242

Query  711  SETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLELQK  890
            S+  +  R+     S   SFG+   G G    S    SS +   D  E EM RL+LELQ+
Sbjct  243  SDGTD--RSSESVQSPTKSFGAYSYGTGFSSLSHDSSSSEASVRDYVEAEMNRLRLELQQ  300

Query  891  TMDLYSTACKEALTAKQKTSELQRW  965
            TMD+YS+ACKEA+ AKQK  EL  W
Sbjct  301  TMDMYSSACKEAIVAKQKAMELHLW  325



>ref|XP_011094049.1| PREDICTED: U-box domain-containing protein 35-like [Sesamum indicum]
Length=772

 Score =   278 bits (710),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE F++SRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  426   VRYRKYTIEEIEAATEFFTKSRKIGEGGYGPVYKCYLDHTEVAVKVLRPDAAQGRSQFQQ  485

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  RGN P L WQ+RFRIAAE
Sbjct  486   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRRGNTPVLPWQLRFRIAAE  545

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  546   IGTGLLFLHQTKPEPLVHRDLKPGNILL  573


 Score =   194 bits (492),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 148/352 (42%), Positives = 195/352 (55%), Gaps = 61/352 (17%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQH-----KQQLEAQNKDLFVTFHCFCTR  170
            SQ A+KW  ++LL+KG+SV L+HV  +T   L +     K  L+ Q K+LF+ F CFCTR
Sbjct  28   SQAALKWAVDHLLAKGKSVALLHVKQKTSAPLGNHADGGKVALDNQAKELFLPFRCFCTR  87

Query  171  KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPD  347
            K+I   ++L++ TDIA++L DYV +  IE+LV+G+S +  F++R K  DIP   SK AP+
Sbjct  88   KDIQVNEVLLEDTDIARSLCDYVKNNNIEHLVVGASVKSGFVRRFKTADIPGNVSKLAPE  147

Query  348  FCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR------TKNAPSSL  509
            FCTV+VISK K +S+R A+       P     +E      N PD R      T+  P S 
Sbjct  148  FCTVYVISKGKAASIRAAS-----GGPT----KEGSRSLHNAPDPRYMQSNGTRGGPMSP  198

Query  510  RSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSG  689
             +      R+   EE +S+  P     A R          E    DSD+SFVSSG RPS 
Sbjct  199  FAG-----RTVPTEEVDSIKSPFTRGKANRSF-------GELSMTDSDISFVSSG-RPSS  245

Query  690  DRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG--------------------NDLNS  809
            DRM S L + +     PRLSSSSD      RL  G                    N+  +
Sbjct  246  DRMMSALEQDMMMA--PRLSSSSDTEN---RLSFGSPFARSSDANSSFGVYSSSSNESGN  300

Query  810  FTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            F+   S SLE+ EAE  MRRLK EL++TMD+YS+ACKEALTAKQK  EL RW
Sbjct  301  FSWSGSQSLEDVEAE--MRRLKQELKQTMDMYSSACKEALTAKQKAMELHRW  350



>gb|KDP33410.1| hypothetical protein JCGZ_06981 [Jatropha curcas]
Length=771

 Score =   278 bits (710),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE F+ESRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  439   IRYRKYTIEEIEAATEFFAESRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQ  498

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM +GS++DRL  RGN P LSWQ+RFRIAAE
Sbjct  499   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMGNGSLEDRLFRRGNTPVLSWQLRFRIAAE  558

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ+KP+P+VHRDLKP NILL
Sbjct  559   IGTGLLFLHQSKPEPLVHRDLKPANILL  586


 Score =   166 bits (421),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 184/364 (51%), Gaps = 73/364 (20%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQL--------------EAQNKDLF  143
            SQ A+KW  +++L +G SV+L+HV  + ++S     Q+              + Q KDLF
Sbjct  29   SQNALKWAIDHILQRGTSVILIHV--KIKSSSMRGNQIADPNGDCILVCKNPDPQTKDLF  86

Query  144  VTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPT  323
            + F CFCTRK++              ++ +Y +  AIE LVLG+S  +   R K+TD+P 
Sbjct  87   LPFRCFCTRKDV--------------SIIEYTTHTAIETLVLGASNKTGFLRFKITDVPG  132

Query  324  LTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQ---EIQEQAQNNPDIRTKN  494
               K APDF TV+VISK KI S R A+RPAP  SPLH QL        +          N
Sbjct  133  TVLKGAPDFTTVYVISKGKIQSTRPASRPAPAISPLHNQLSIKPAPPPEPIVPQPPINNN  192

Query  495  APSSLRSFDEKHMRSFKLEESESVS-RPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
              ++ R  ++  +   +    ES + R    R    G    +  G  +V  D+D+SFVSS
Sbjct  193  INNNKRVVEKPPLEQPRRSHDESDTFRSPFTRRGVNG----KSYGELSVP-DTDISFVSS  247

Query  672  GSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSF-------------  812
            G RPS DRM     + ++ GRT RLS+ SD       +  GN   S              
Sbjct  248  G-RPSVDRMFPAFYDALDIGRTSRLSNVSD-------VDCGNSFESMPYGRRSIDIASGS  299

Query  813  -TDF------------SSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
              DF            SS+S   ++ E EMRRLKLEL++TM++YSTACKEALTAKQK  E
Sbjct  300  PPDFMSSMSYESTDRLSSASQGMEDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKARE  359

Query  954  LQRW  965
            LQ W
Sbjct  360  LQIW  363



>ref|XP_010913853.1| PREDICTED: U-box domain-containing protein 35-like [Elaeis guineensis]
Length=765

 Score =   277 bits (708),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE+FSE R IGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  425   VRYRKYTIEEIEVATEYFSEKRNIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQ  484

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN PP+ WQ RFRIAAE
Sbjct  485   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPPIPWQYRFRIAAE  544

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  545   IGTGLLFLHQTKPEPLVHRDLKPANILL  572


 Score =   197 bits (501),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 188/341 (55%), Gaps = 34/341 (10%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQN--KDLFVTFHCFCTRKNI  179
            SQ A+KW  +N++++G ++ L+HV N+     Q      A +  KDLFV F CFCTRKN+
Sbjct  22   SQSALKWALDNIVTRGHTITLIHVINKHAPPGQQDDPASAGSHAKDLFVPFRCFCTRKNV  81

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             C DI+++ TDIAKA+ ++VS AAIE LV+G+       R + TD+ T  SK APDFCTV
Sbjct  82   QCKDIILEDTDIAKAIIEFVSHAAIEKLVVGAPSKGGFVRFRTTDVSTSVSKGAPDFCTV  141

Query  360  FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNA----PSSLRSFDEK  527
            ++ISK K+SS+RNA RPAP  SP   Q+       Q+   IR ++     P  +R   E 
Sbjct  142  YIISKGKVSSMRNAVRPAPTVSPFRAQI-------QSQSSIRNEHVDPPHPHGVRG--EA  192

Query  528  HMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS-------------  668
             + ++ ++      R    R  TR    R    AE++ G+SD+SFVS             
Sbjct  193  ALGTWNVQSEREPIRSPFTR-GTRASTGRSY--AESI-GESDISFVSGGRASIDRSDISF  248

Query  669  -SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDL-NSFTDFSSSSLEN  842
              G RPS DR+ +     V           S      G    G    +   D +SSSL  
Sbjct  249  MGGGRPSIDRIFNQRMSNVSDSLDNSFEMQSPRRSVVGGFSCGTAFSSMSQDSTSSSLTM  308

Query  843  DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            ++ E EM+RL+LEL++TMD+YSTACKEALTAKQK  EL RW
Sbjct  309  EDVEAEMKRLRLELKQTMDMYSTACKEALTAKQKAMELHRW  349



>emb|CBI24063.3| unnamed protein product [Vitis vinifera]
Length=616

 Score =   273 bits (699),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESRKIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  423   LRYRKYTIEEIEAATELFSESRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQ  482

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  RGN P L WQ+RF+IAAE
Sbjct  483   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDHLFRRGNTPVLPWQLRFQIAAE  542

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  543   IGTGLLFLHQTKPEPLVHRDLKPGNILL  570


 Score =   206 bits (525),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 202/350 (58%), Gaps = 55/350 (16%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV------------------DNQTQTSLQHKQQLEAQN  131
            SQYA+KW  ++LLSKGQSV L+H+                  D     +  +KQQL+ Q 
Sbjct  23   SQYALKWAVDHLLSKGQSVTLLHIKQKASSIPNPLGNQVAISDVNEDVARAYKQQLDNQA  82

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
            ++LF+ F CFC RK+I C +++++GTDI KA+ D+V+ ++IE LV+G+ SR  F++R K 
Sbjct  83   RELFLPFRCFCMRKDIQCNEVILEGTDITKAIIDFVTASSIEILVVGAPSRSGFIRRFKT  142

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPF------ASPLHPQLQEIQEQAQN  470
            TD+P+   KAAPDFCTV+VISK KI+SVR+ATRP P       AS LH      Q QA  
Sbjct  143  TDVPSSVLKAAPDFCTVYVISKGKITSVRSATRPVPNPSPPPTASSLH------QNQASP  196

Query  471  NPDIRTKNAPSSLRSFDEKHMRSFKLEESES-----VSRPSIERAATRGIPPRRMLGAET  635
             PD      P+       KH RS +  E  S     ++   I+   TRG         E 
Sbjct  197  TPD------PTEAHL---KHNRSTRASERSSFGLRNLNDLEIKSPFTRGRASLSKSYGEL  247

Query  636  VEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFT  815
               ++D+SFVSSG RPS D +  F S     GR+  L+ S D S  S   G+        
Sbjct  248  SVPETDISFVSSG-RPSIDHIFPFSSFASSGGRSSELNYSLDLSSSSNESGR-------L  299

Query  816  DFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             ++S S+E+ EA  EMRRLKLEL++TMD+YSTACKEAL+AKQ   EL RW
Sbjct  300  SWASQSMEDVEA--EMRRLKLELKQTMDMYSTACKEALSAKQTARELHRW  347



>ref|XP_008781718.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008781719.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Phoenix 
dactylifera]
Length=749

 Score =   276 bits (706),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE+FSE RKIGEGGYGPV+KC L+HT VA+KVLRPDAAQGR QFQQ
Sbjct  410   VRYRKYTIEEIEVATEYFSEKRKIGEGGYGPVYKCYLEHTPVAIKVLRPDAAQGRSQFQQ  469

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSCMRHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  +GN PP+ WQ RFRIAAE
Sbjct  470   EVEILSCMRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFQQGNTPPIPWQHRFRIAAE  529

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  530   IGTGLLFLHQTKPEPLVHRDLKPANILL  557


 Score =   214 bits (546),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 138/330 (42%), Positives = 193/330 (58%), Gaps = 27/330 (8%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQ---LEAQNKDLFVTFHCFCTRKN  176
            SQ A+KW  +N++ +GQ++ L+HV N    +  H++      + +KDLFV F CFCTRKN
Sbjct  22   SQNALKWALDNIVDRGQTITLIHV-NTKHPAPGHQEDPTFAGSHSKDLFVPFRCFCTRKN  80

Query  177  IHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCT  356
            + C DI+++ T+IAKA+ ++VS AAIE LV+G+   S   R + TD+ T  SK APDFCT
Sbjct  81   VQCKDIILEDTEIAKAIIEFVSHAAIEKLVVGAPSKSGFGRFRTTDVSTSISKGAPDFCT  140

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNA----PSSLRSFDE  524
            V++ISK K+SS+RNA R AP  SP   Q+       QN   IR+++     P  +R   E
Sbjct  141  VYIISKGKVSSMRNAVRAAPAVSPFRAQI-------QNQTSIRSEHVDPHHPHGVRG--E  191

Query  525  KHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVE--GDSDLSFVSSGSRPSGDRM  698
              + ++ ++      R  I    TRG   R + G    E  GDSD+SFV SG RPS +R+
Sbjct  192  AALENWNVQS----EREPIRSPFTRGT--RVLTGKSYTESIGDSDISFV-SGGRPSINRI  244

Query  699  SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFT-DFSSSSLENDEAEVEMRRLK  875
             +  S  +  G        S      G    G   +S + D + SSL  ++ E EM+RL+
Sbjct  245  FNQRSSNMSDGLDSSFEMQSPHKSVGGGFSCGTAFSSMSQDSTPSSLTMEDVEAEMKRLR  304

Query  876  LELQKTMDLYSTACKEALTAKQKTSELQRW  965
            LEL++TMD+YSTACKEALTAKQK  EL  W
Sbjct  305  LELKQTMDMYSTACKEALTAKQKAKELHHW  334



>ref|XP_008466286.1| PREDICTED: U-box domain-containing protein 52 isoform X2 [Cucumis 
melo]
Length=720

 Score =   275 bits (704),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESR+IGEGGYGPV+KC LDHT VA+KVLRPDA QGR QF+Q
Sbjct  388   IRYRKYTIEEIEAATEFFSESRRIGEGGYGPVYKCDLDHTPVAIKVLRPDATQGRSQFKQ  447

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL+ RGN PPLSWQ+RF+IAAE
Sbjct  448   EVEVLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLLRRGNTPPLSWQLRFKIAAE  507

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  508   IGTALLFLHQTKPEPLVHRDLKPANILL  535


 Score =   187 bits (476),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 179/301 (59%), Gaps = 24/301 (8%)
 Frame = +3

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKR  299
            EA  KDLF+ F CFCTRK+I C D++++ TD+AKA+ +Y ++  IEN+V+G+S  S   R
Sbjct  16   EASVKDLFLPFRCFCTRKDIQCKDVVLEDTDVAKAIIEYAANTTIENIVVGASAKSGFLR  75

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD  479
             K TD+P    K APDFC VFVISK KI S+R+A+RPAP    L  QL +      + PD
Sbjct  76   FKATDVPGSIVKGAPDFCNVFVISKGKIQSMRSASRPAPTVGALRGQLAQQCSTKSDTPD  135

Query  480  IRTKNAPSSLRSFDEKHMR-SFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDL  656
                ++ S+  S D+  +    K ++     R    R      P    L  +    DSD+
Sbjct  136  FPVSHSASARVSLDKPPLDLPNKSQDEADFMRSPFTRKGYNYKPSYGDLPMQ----DSDI  191

Query  657  SFVSSGSRPSGDRMSSFLSET---VESGRTPRLssss----dgsfgsgRLGKGN-DLNSF  812
            SFVSSG RPS DR+   L E+   V     P++SSS+      SF S +LG+ + D+N  
Sbjct  192  SFVSSG-RPSIDRIFPTLYESQDMVGRATPPQISSSTDLDLTRSFESLQLGRMSLDMNFP  250

Query  813  TDFSSSSLEND----------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
            ++FSS S ++D          + E EMRRLKLEL++TM++YSTACKEALTAKQK  ELQR
Sbjct  251  SEFSSISQDSDRLSISSQSMEDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQR  310

Query  963  W  965
            W
Sbjct  311  W  311



>ref|XP_011006665.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Populus 
euphratica]
Length=719

 Score =   275 bits (704),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE AT++FS++ KIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  386   VRYRRYSIEEIEAATDYFSQALKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQ  445

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L C+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL  RGN PPLSWQ+RFRIAAE
Sbjct  446   EVEVLCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAE  505

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  506   IGTGLLFLHQTKPEPLVHRDLKPANILL  533


 Score =   182 bits (463),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 169/297 (57%), Gaps = 30/297 (10%)
 Frame = +3

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKV  308
            +KDLF+ F CFCTRK+I+C D++++ TD+AKAL +YV+  AIE L++G+S      R K 
Sbjct  26   SKDLFLPFRCFCTRKDINCKDVVLEDTDVAKALIEYVTQTAIETLIVGASAKGGFLRFKA  85

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQE----IQEQAQNNP  476
             D+    SK APDFCTV+VI+K KI S+R A+R AP  S LH QL +          +NP
Sbjct  86   ADVAGSVSKGAPDFCTVYVIAKGKIQSMRAASRSAPVNSSLHNQLNQNSTTTASMDAHNP  145

Query  477  DIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDL  656
                K A         K      + ++ES   P   R  T      +  G  +V  D+D+
Sbjct  146  RTHVKRAEKPPLELPRK-----SVGDTESFRSPFTRRGLT-----GKSYGELSVP-DTDI  194

Query  657  SFVSSGSRPSGDRMSSFLSETVESGRT-PRLssssdgsfgs---------gRLGKGNDLN  806
            SFVSSG RPS DR+     +  E+ RT PRLS+ SD                L KG    
Sbjct  195  SFVSSG-RPSIDRIFPAFYDNTETNRTPPRLSNFSDIDSNYSFESLHHGRTSLDKGGFSP  253

Query  807  SFTDFSSSSLE----NDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
              + FS+ S +     D+ E EMRRLKLEL++TM++YS+ACKEALTAKQKT ELQRW
Sbjct  254  ELSTFSNESDQMPSAADDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKTRELQRW  310



>ref|XP_011006664.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Populus 
euphratica]
Length=720

 Score =   275 bits (703),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE AT++FS++ KIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  387   VRYRRYSIEEIEAATDYFSQALKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQ  446

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L C+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL  RGN PPLSWQ+RFRIAAE
Sbjct  447   EVEVLCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAE  506

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  507   IGTGLLFLHQTKPEPLVHRDLKPANILL  534


 Score =   182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/296 (43%), Positives = 172/296 (58%), Gaps = 27/296 (9%)
 Frame = +3

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKV  308
            +KDLF+ F CFCTRK+I+C D++++ TD+AKAL +YV+  AIE L++G+S      R K 
Sbjct  26   SKDLFLPFRCFCTRKDINCKDVVLEDTDVAKALIEYVTQTAIETLIVGASAKGGFLRFKA  85

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
             D+    SK APDFCTV+VI+K KI S+R A+R AP  S LH QL    + +     +  
Sbjct  86   ADVAGSVSKGAPDFCTVYVIAKGKIQSMRAASRSAPVNSSLHNQL---NQNSTTTASMDA  142

Query  489  KNAPSSLRSFDEK---HMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLS  659
             N  + ++   EK    +    + ++ES   P   R  T      +  G  +V  D+D+S
Sbjct  143  HNPRTHVKRVAEKPPLELPRKSVGDTESFRSPFTRRGLT-----GKSYGELSVP-DTDIS  196

Query  660  FVSSGSRPSGDRMSSFLSETVESGRT-PRLssssdgsfgs---------gRLGKGNDLNS  809
            FVSSG RPS DR+     +  E+ RT PRLS+ SD                L KG     
Sbjct  197  FVSSG-RPSIDRIFPAFYDNTETNRTPPRLSNFSDIDSNYSFESLHHGRTSLDKGGFSPE  255

Query  810  FTDFSSSSLE----NDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             + FS+ S +     D+ E EMRRLKLEL++TM++YS+ACKEALTAKQKT ELQRW
Sbjct  256  LSTFSNESDQMPSAADDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKTRELQRW  311



>ref|XP_010429418.1| PREDICTED: U-box domain-containing protein 34-like [Camelina 
sativa]
Length=369

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  44    VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  103

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+R+ IAAE
Sbjct  104   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRYIIAAE  163

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  164   IGTGLLFLHQAKPEPLVHRDLKPGNILL  191



>ref|XP_011006666.1| PREDICTED: U-box domain-containing protein 35 isoform X3 [Populus 
euphratica]
Length=718

 Score =   275 bits (703),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE AT++FS++ KIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  385   VRYRRYSIEEIEAATDYFSQALKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQ  444

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L C+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL  RGN PPLSWQ+RFRIAAE
Sbjct  445   EVEVLCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAE  504

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  505   IGTGLLFLHQTKPEPLVHRDLKPANILL  532


 Score =   182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/296 (43%), Positives = 172/296 (58%), Gaps = 27/296 (9%)
 Frame = +3

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKV  308
            +KDLF+ F CFCTRK+I+C D++++ TD+AKAL +YV+  AIE L++G+S      R K 
Sbjct  24   SKDLFLPFRCFCTRKDINCKDVVLEDTDVAKALIEYVTQTAIETLIVGASAKGGFLRFKA  83

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
             D+    SK APDFCTV+VI+K KI S+R A+R AP  S LH QL    + +     +  
Sbjct  84   ADVAGSVSKGAPDFCTVYVIAKGKIQSMRAASRSAPVNSSLHNQL---NQNSTTTASMDA  140

Query  489  KNAPSSLRSFDEK---HMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLS  659
             N  + ++   EK    +    + ++ES   P   R  T      +  G  +V  D+D+S
Sbjct  141  HNPRTHVKRVAEKPPLELPRKSVGDTESFRSPFTRRGLT-----GKSYGELSVP-DTDIS  194

Query  660  FVSSGSRPSGDRMSSFLSETVESGRT-PRLssssdgsfgs---------gRLGKGNDLNS  809
            FVSSG RPS DR+     +  E+ RT PRLS+ SD                L KG     
Sbjct  195  FVSSG-RPSIDRIFPAFYDNTETNRTPPRLSNFSDIDSNYSFESLHHGRTSLDKGGFSPE  253

Query  810  FTDFSSSSLE----NDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             + FS+ S +     D+ E EMRRLKLEL++TM++YS+ACKEALTAKQKT ELQRW
Sbjct  254  LSTFSNESDQMPSAADDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKTRELQRW  309



>ref|XP_004305796.1| PREDICTED: U-box domain-containing protein 35-like [Fragaria 
vesca subsp. vesca]
Length=766

 Score =   276 bits (705),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             +YRRY I+EIE ATEHF+ SRKIGEGGYGPV+KC LDHT+VAVKVLRPDAAQGR QFQQE
Sbjct  450   KYRRYGIEEIEAATEHFTPSRKIGEGGYGPVYKCYLDHTSVAVKVLRPDAAQGRSQFQQE  509

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             ++ILSC+RHPNMV+LLGACPEYG LVYEYMA+GS++DRL  +GN PPLSWQ+RFRIAAE+
Sbjct  510   IDILSCIRHPNMVLLLGACPEYGVLVYEYMANGSLEDRLTRKGNTPPLSWQIRFRIAAEI  569

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  570   ATGLLFLHQTKPEPLVHRDLKPGNILL  596


 Score =   223 bits (569),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 211/347 (61%), Gaps = 39/347 (11%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ---------------HKQQLEAQNKDL  140
            SQ A++W  E +L++G++VVL+HV ++  TS                 HK+QLE+  K L
Sbjct  35   SQNALRWAAETILNRGRTVVLIHVIHRQNTSNSSNALICDSNNPPTSPHKEQLESMTKSL  94

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDI  317
            F+TFHC+CTRK+I CLD++++ TDIAKALT+YVS AAIE LVLG+ ++H F+ R K + +
Sbjct  95   FLTFHCYCTRKDIQCLDVVLEDTDIAKALTEYVSYAAIETLVLGAPTKHGFM-RFKSSSM  153

Query  318  PTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNA  497
             +  SK APDFCTV+ ISK KISS RN++R AP+ SPL   ++ I  Q      +  K +
Sbjct  154  ASSVSKGAPDFCTVYAISKGKISSQRNSSRAAPYRSPLLSTIETINNQ------VAAKAS  207

Query  498  PSSLRSFDEKHMRSFKLEE-SESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSG  674
             +   S   K   SFK     +   R    R    G    R+ G  + E +SD+SF+SS 
Sbjct  208  ETPKSSIYLKAKPSFKPRNLPDDPFRSPFSRGGG-GFTKGRISGGFS-ESESDISFISS-  264

Query  675  SRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEN----  842
             R S DR SS + E ++ GR  R+S+SSD SFGS R+    DLN+  +FS  S +     
Sbjct  265  DRASTDRASSVMYEYIDQGRGGRISTSSDHSFGSVRMTPRFDLNAMNEFSMVSQDTSLTS  324

Query  843  --------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
                    DE E EMRRLKLEL++TMD+YSTAC+EALTAKQK  EL 
Sbjct  325  SSWSSQNLDEVEAEMRRLKLELKQTMDMYSTACREALTAKQKEMELH  371



>ref|XP_007225224.1| hypothetical protein PRUPE_ppa001920mg [Prunus persica]
 gb|EMJ26423.1| hypothetical protein PRUPE_ppa001920mg [Prunus persica]
Length=741

 Score =   275 bits (704),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTIDEIE ATE F+ESRKIGEGGYGPV++C LDHT VA+KVLRPDAAQGR QF Q
Sbjct  417   VRYRKYTIDEIEAATEFFTESRKIGEGGYGPVYRCYLDHTPVAIKVLRPDAAQGRSQFNQ  476

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS++D L+ RGN PPLSWQ+RFRIAAE
Sbjct  477   EVEVLSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLLRRGNSPPLSWQLRFRIAAE  536

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNIL+
Sbjct  537   IGTGLLFLHQAKPEPLVHRDLKPGNILI  564


 Score =   195 bits (495),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 136/344 (40%), Positives = 197/344 (57%), Gaps = 52/344 (15%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQ----TQTSLQHKQQLEAQNKDLFVTFHCFCTR  170
             SQ A+KW  ++L+ +GQ+V+L+HV  +    +Q+        + Q K+LF+ F  +CTR
Sbjct  27   NSQSALKWCIDSLVKQGQTVLLIHVKIKPPVFSQSPSLSTPNPDPQTKELFLPFRVYCTR  86

Query  171  KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDF  350
            KNI C DI+++ +DIAKAL +YV+ +AIE+LV+G+S  +   R K++D+P   SK APDF
Sbjct  87   KNIQCKDIVLEDSDIAKALNEYVTQSAIEHLVVGASAKTGFLRFKISDVPGNVSKGAPDF  146

Query  351  CTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKH  530
            C V+V+SK K+ S R+A+RPAP  SP+                     AP       E H
Sbjct  147  CNVYVVSKGKLQSRRSASRPAPSISPIR--------------------APVRHEKPPEPH  186

Query  531  MRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFL  710
             +S   +E E+   P   +       P     A+    D+D+S+VSSG RPS DR+    
Sbjct  187  RKSH--DEMENFRSPFTRKG------PNGKSYADLPMPDTDISYVSSG-RPSIDRIFPAF  237

Query  711  SETVESGRT--PRLssssd-----gsfgsgRLGKGN-DLNSF-TDFSSSSLEND------  845
             + ++SGR   PR+SSS++             G+ + D++S    FSS S ++D      
Sbjct  238  YDNLDSGRITPPRMSSSTEIDLNHSFESMQYFGRRSVDVSSSPPTFSSVSQDSDRLSSAS  297

Query  846  ----EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                + E EMRRLKLEL++TM++YSTACKEALTAKQK  ELQRW
Sbjct  298  QPMEDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRW  341



>ref|XP_006450025.1| hypothetical protein CICLE_v10013950mg [Citrus clementina]
 gb|ESR63265.1| hypothetical protein CICLE_v10013950mg [Citrus clementina]
Length=731

 Score =   275 bits (702),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI++IEEAT+ F+ESRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  416   LRYRRYTIEDIEEATQFFTESRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQR  475

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E+E+LSC+RHPNMV+LLGACPEYG +VYEY+A+GS+DDR+  RGN PPLSWQ RFRIAAE
Sbjct  476   EIEVLSCIRHPNMVLLLGACPEYGIIVYEYLANGSLDDRIFRRGNTPPLSWQQRFRIAAE  535

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  536   IATGLLFLHQTKPEPLVHRDLKPGNILL  563


 Score =   245 bits (625),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 218/350 (62%), Gaps = 65/350 (19%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQ---------TSLQHKQQLEAQNKDLFVTFH  155
            +SQ+A+KW  +NLL++GQ+VVL+HV  +T          T+  H++Q + Q +DLF+TF 
Sbjct  27   SSQHALKWAVDNLLNRGQTVVLIHVAQRTSVSSVSSNCATTNPHQKQPDKQIRDLFLTFR  86

Query  156  CFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTS  332
            C+CTRK+I C D+L++  DI KA+T+YVS AAIE+LVLG+ SRH F+++ K  D+P+  S
Sbjct  87   CYCTRKDIKCFDVLLEDVDIVKAITEYVSFAAIEDLVLGAPSRHGFMRKFKA-DVPSSVS  145

Query  333  KAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLR  512
            KAAPDFC ++V+SK KISS RNA+R APF SPL  QLQ     +QN  DI          
Sbjct  146  KAAPDFCNIYVVSKGKISSKRNASRSAPFTSPLLDQLQ-----SQN--DI----------  188

Query  513  SFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLG------AETVEGDSDLSFVSSG  674
                          S++ SR S+     RG+ P R  G       ++ E D+D+SFVSSG
Sbjct  189  --------------SDTQSRYSMN---LRGLSPARGRGFDRKSFMDSSESDTDISFVSSG  231

Query  675  SRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS--------  827
             RPS D   S   E V+ GR  R+S+SS+ S GS RLG + +D +S  D SS        
Sbjct  232  -RPSSDHSPSMHYEFVDVGRNSRISTSSEHSLGSFRLGLRYSDRSSPYDLSSISQDSGAT  290

Query  828  ----SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                SS   DE E EMRRLKLEL++TMD+YSTACKEAL AKQK  ELQRW
Sbjct  291  SCSCSSQNLDEVEAEMRRLKLELKQTMDMYSTACKEALVAKQKALELQRW  340



>ref|XP_008781717.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Phoenix 
dactylifera]
Length=770

 Score =   275 bits (704),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE+FSE RKIGEGGYGPV+KC L+HT VA+KVLRPDAAQGR QFQQ
Sbjct  431   VRYRKYTIEEIEVATEYFSEKRKIGEGGYGPVYKCYLEHTPVAIKVLRPDAAQGRSQFQQ  490

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSCMRHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  +GN PP+ WQ RFRIAAE
Sbjct  491   EVEILSCMRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFQQGNTPPIPWQHRFRIAAE  550

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  551   IGTGLLFLHQTKPEPLVHRDLKPANILL  578


 Score =   214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/330 (42%), Positives = 193/330 (58%), Gaps = 27/330 (8%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQ---LEAQNKDLFVTFHCFCTRKN  176
            SQ A+KW  +N++ +GQ++ L+HV N    +  H++      + +KDLFV F CFCTRKN
Sbjct  43   SQNALKWALDNIVDRGQTITLIHV-NTKHPAPGHQEDPTFAGSHSKDLFVPFRCFCTRKN  101

Query  177  IHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCT  356
            + C DI+++ T+IAKA+ ++VS AAIE LV+G+   S   R + TD+ T  SK APDFCT
Sbjct  102  VQCKDIILEDTEIAKAIIEFVSHAAIEKLVVGAPSKSGFGRFRTTDVSTSISKGAPDFCT  161

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNA----PSSLRSFDE  524
            V++ISK K+SS+RNA R AP  SP   Q+       QN   IR+++     P  +R   E
Sbjct  162  VYIISKGKVSSMRNAVRAAPAVSPFRAQI-------QNQTSIRSEHVDPHHPHGVRG--E  212

Query  525  KHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVE--GDSDLSFVSSGSRPSGDRM  698
              + ++ ++      R  I    TRG   R + G    E  GDSD+SFV SG RPS +R+
Sbjct  213  AALENWNVQS----EREPIRSPFTRGT--RVLTGKSYTESIGDSDISFV-SGGRPSINRI  265

Query  699  SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFT-DFSSSSLENDEAEVEMRRLK  875
             +  S  +  G        S      G    G   +S + D + SSL  ++ E EM+RL+
Sbjct  266  FNQRSSNMSDGLDSSFEMQSPHKSVGGGFSCGTAFSSMSQDSTPSSLTMEDVEAEMKRLR  325

Query  876  LELQKTMDLYSTACKEALTAKQKTSELQRW  965
            LEL++TMD+YSTACKEALTAKQK  EL  W
Sbjct  326  LELKQTMDMYSTACKEALTAKQKAKELHHW  355



>ref|XP_009396581.1| PREDICTED: U-box domain-containing protein 35-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   275 bits (703),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI+EIE AT++F+E RKIGEGGYGPV++C LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  412   LRYRRYTIEEIEVATDYFAEERKIGEGGYGPVYRCTLDHTPVAIKVLRPDAAQGRSQFQQ  471

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEIL C+RHPNMV+LLGACPEYGCLVYEYMA+GS+DDRL  RGN PP+ WQ RFRIAAE
Sbjct  472   EVEILCCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNTPPIPWQHRFRIAAE  531

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ +P+P+VHRDLKP NILL
Sbjct  532   IGTGLLFLHQTRPEPLVHRDLKPANILL  559


 Score =   206 bits (524),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 135/331 (41%), Positives = 194/331 (59%), Gaps = 30/331 (9%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQN-KDLFVTFHCFCTRKNIH  182
            SQ A KW  +N+++KGQ++ LVHV+ +  +  +      A   +++FV F CFCTRKN+ 
Sbjct  25   SQSAFKWALDNVVTKGQTLTLVHVNTKPSSGYEDDAAAVANTIREIFVPFRCFCTRKNVQ  84

Query  183  CLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDFCTV  359
            C D++++ TD+AKA+T++V++AA+E LV+GSS R  F++  + TD+ T   K  PDFC+V
Sbjct  85   CKDVVLEDTDVAKAITEFVTNAAVEKLVIGSSSRSGFVRSFRSTDLSTTICKGVPDFCSV  144

Query  360  FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSF--DEKHM  533
            ++ISK K+SS+RNA RP P  S L  Q   IQ QA   PD  ++NA +  R     +  +
Sbjct  145  YIISKGKVSSMRNAVRPPPPVSLLRNQ---IQGQASVKPDTLSQNAKNGTRGPVPSDAAL  201

Query  534  RSFKLE-ESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSG---SRPSGDRMS  701
              + L+ ++ES+  P      TRG              DSD+SFVSSG    R    R+S
Sbjct  202  TPWNLQKDNESIKSP-----FTRGGRASTTRSYGESMADSDVSFVSSGRSSERSYPPRLS  256

Query  702  SFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEN---DEAEVEMRRL  872
            +       S  +PR             +G  +  N F+  S  S  +   ++ E E+RRL
Sbjct  257  NLSDSYERSFESPR-----------RSVGAVSSANGFSSVSHESSSSQNMEDVEAEIRRL  305

Query  873  KLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            KLEL++TMD+YSTACKEALTAKQKT ELQRW
Sbjct  306  KLELKQTMDMYSTACKEALTAKQKTMELQRW  336



>ref|XP_006371832.1| hypothetical protein POPTR_0018s04050g, partial [Populus trichocarpa]
 gb|ERP49629.1| hypothetical protein POPTR_0018s04050g, partial [Populus trichocarpa]
Length=737

 Score =   274 bits (701),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY I+EIE AT++FSESRKIGEGGYGPV+K  LDHT+VA+KVLRPDAAQGR QFQQ
Sbjct  437   VRYRRYPIEEIEAATDYFSESRKIGEGGYGPVYKGYLDHTSVAIKVLRPDAAQGRSQFQQ  496

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L C+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL  RGN PPLSWQ+RFRIAAE
Sbjct  497   EVEVLCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAE  556

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  557   IGTGLLFLHQTKPEPLVHRDLKPANILL  584


 Score =   192 bits (489),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 199/345 (58%), Gaps = 34/345 (10%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ----HKQQL----EAQNKDLFVTFHC  158
            +SQ A+KW  +NLL KGQ+V+L+HV+ ++  S       K Q     +  +KDLF+ F C
Sbjct  27   SSQIALKWAIDNLLVKGQTVILIHVNLKSSLSSHSSSPKKNQFVGSKDPDSKDLFLPFRC  86

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKA  338
            FCTRK+I C D++++ TD+AKAL +YV+   IE L++G S      R K  DI    S+ 
Sbjct  87   FCTRKDISCKDVMLEDTDVAKALIEYVTQTLIETLIVGGSTKGGFLRFKAADIAGSVSRG  146

Query  339  APDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSF  518
            APDFCTV+VISK KI S+R A+RPAP  S +H QL  + +       + T   P+ ++  
Sbjct  147  APDFCTVYVISKGKIQSMRPASRPAPVTS-VHSQL--LNQNGTMPASMDTHIPPTPVKRA  203

Query  519  DEKHMRSFK--LEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGD  692
            ++  +   +  + E+ES   P   R         +  G  +V  DSD+SFVSSG R S D
Sbjct  204  EKPPLEPPRRSIGETESFRSPFTRRGLN-----GKSYGELSVP-DSDISFVSSG-RASID  256

Query  693  RMSSFLSETVESGRT-PRLssss--dgsfgsgRLGKGN---DLNSFT-DFSSSSLENDE-  848
             +     +  E+ RT PRLS+ S  D ++    L  G    D   F+ + S  S E+D+ 
Sbjct  257  SIFPAFYDNTETSRTPPRLSNISDFDSNYSFESLHYGRRSMDQGGFSPELSPFSHESDQL  316

Query  849  ------AEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                   E EMRRLKLEL++TM++YS+ACKEALTAKQK  ELQRW
Sbjct  317  PSAAEDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKAKELQRW  361



>ref|XP_008466285.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Cucumis 
melo]
Length=774

 Score =   275 bits (703),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESR+IGEGGYGPV+KC LDHT VA+KVLRPDA QGR QF+Q
Sbjct  442   IRYRKYTIEEIEAATEFFSESRRIGEGGYGPVYKCDLDHTPVAIKVLRPDATQGRSQFKQ  501

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL+ RGN PPLSWQ+RF+IAAE
Sbjct  502   EVEVLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLLRRGNTPPLSWQLRFKIAAE  561

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  562   IGTALLFLHQTKPEPLVHRDLKPANILL  589


 Score =   210 bits (534),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 203/341 (60%), Gaps = 26/341 (8%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD--NQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ A+KW  ++LL +G +V L+HV   + + ++ + K   EA  KDLF+ F CFCTRK+I
Sbjct  30   SQGALKWAIDHLLQRGHTVFLIHVKLKSPSNSTQKMKPDPEASVKDLFLPFRCFCTRKDI  89

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             C D++++ TD+AKA+ +Y ++  IEN+V+G+S  S   R K TD+P    K APDFC V
Sbjct  90   QCKDVVLEDTDVAKAIIEYAANTTIENIVVGASAKSGFLRFKATDVPGSIVKGAPDFCNV  149

Query  360  FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR-  536
            FVISK KI S+R+A+RPAP    L  QL +      + PD    ++ S+  S D+  +  
Sbjct  150  FVISKGKIQSMRSASRPAPTVGALRGQLAQQCSTKSDTPDFPVSHSASARVSLDKPPLDL  209

Query  537  SFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSE  716
              K ++     R    R      P    L  +    DSD+SFVSSG RPS DR+   L E
Sbjct  210  PNKSQDEADFMRSPFTRKGYNYKPSYGDLPMQ----DSDISFVSSG-RPSIDRIFPTLYE  264

Query  717  T---VESGRTPRLssss----dgsfgsgRLGKGN-DLNSFTDFSSSSLEND---------  845
            +   V     P++SSS+      SF S +LG+ + D+N  ++FSS S ++D         
Sbjct  265  SQDMVGRATPPQISSSTDLDLTRSFESLQLGRMSLDMNFPSEFSSISQDSDRLSISSQSM  324

Query  846  -EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             + E EMRRLKLEL++TM++YSTACKEALTAKQK  ELQRW
Sbjct  325  EDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRW  365



>ref|XP_009779108.1| PREDICTED: U-box domain-containing protein 35-like [Nicotiana 
sylvestris]
Length=794

 Score =   275 bits (703),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE+F+ SRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  459   RYRKYTIEEIEAATENFAASRKIGEGGYGPVYKCYLDHTQVAIKVLRPDAAQGRSQFQQE  518

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DDRL  RGN P L WQ+RFRIAAE+
Sbjct  519   VEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDRLFRRGNTPVLPWQLRFRIAAEV  578

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GT LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  579   GTSLLFLHQTKPEPLVHRDLKPGNILL  605


 Score =   199 bits (505),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 142/357 (40%), Positives = 198/357 (55%), Gaps = 40/357 (11%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ-----------HKQQLEAQNKDLFVTF  152
            SQ+A+KW  +NLL KG++V L+HV  +   SL            ++   ++Q K+LF+ F
Sbjct  29   SQHALKWAVDNLLGKGKTVTLLHVRLRPSNSLPNADVNDGTPRVYRSDPDSQAKELFLPF  88

Query  153  HCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLT  329
             CFC RKNIH  +++I+G DIA +++DYV+    ENLV+G+ SR+ F+ R K  D+P+  
Sbjct  89   RCFCNRKNIHVNEVVIEGIDIANSISDYVAANITENLVMGAASRNGFVSRFKTMDVPSSV  148

Query  330  SKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSL  509
            SK AP FCTV+VI+K K+ S+RNA+ P P   P   Q Q           I  + APS+ 
Sbjct  149  SKTAPGFCTVYVIAKGKVLSIRNASAPVPNPPPSLLQNQTSSSLGAKLGFIEARYAPSN-  207

Query  510  RSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSG  689
             S      RS     S +     I+    RG P  R  G  +V  +SD+SFVSS +RPS 
Sbjct  208  DSRGSMADRSPYAPRSSTEDSDFIKSPFNRGKPVNRSYGDLSV-AESDISFVSS-NRPSS  265

Query  690  DRMSSFLSETVESGRTPRLssss------------dgsfgsgRLGKGND-----LNSFTD  818
            DR     S++ + G  PRLS+SS            + S    RL  G+      L+    
Sbjct  266  DRTFPISSDSYDLGLPPRLSNSSDTDNRFSAPRLSNSSETDSRLSFGSSFSATRLSEVNA  325

Query  819  FSSSSLEN--------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            FSS+S ++        ++ E EMRRLK EL++TMD+YSTACKEAL+AK K  EL RW
Sbjct  326  FSSNSFDSANGSTNNLEDIEAEMRRLKQELKQTMDMYSTACKEALSAKHKALELHRW  382



>ref|XP_011002967.1| PREDICTED: U-box domain-containing protein 35-like [Populus euphratica]
Length=756

 Score =   274 bits (701),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY I+EIE AT++FSESRKIGEGGYGPV+K  LDHT+VA+KVLRPDAAQGR QFQQ
Sbjct  437   VRYRRYPIEEIEAATDYFSESRKIGEGGYGPVYKGYLDHTSVAIKVLRPDAAQGRSQFQQ  496

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L C+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL  RGN PPLSWQ+RFRIAAE
Sbjct  497   EVEVLCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNTPPLSWQLRFRIAAE  556

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  557   IGTGLLFLHQTKPEPLVHRDLKPANILL  584


 Score =   193 bits (490),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 197/345 (57%), Gaps = 34/345 (10%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL--------QHKQQLEAQNKDLFVTFHC  158
            +SQ A+KW  +NLL KGQ+V+L+HV+ ++  S         Q     +  +KDLF+ F C
Sbjct  27   SSQIALKWAIDNLLVKGQTVILIHVNLKSSLSSHSSSPKMNQFVDSKDPDSKDLFLPFRC  86

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKA  338
            FCTRK+I C D++++ TD+AKAL +YV+   IE L++G S      R K  DI    SK 
Sbjct  87   FCTRKDISCKDVMLEDTDVAKALIEYVTQTLIETLIVGGSTKGGFLRFKAADIAGNVSKG  146

Query  339  APDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSF  518
            APDFCTV+VISK KI S+R A RPAP  S +H QL  + +       + T   P+ ++  
Sbjct  147  APDFCTVYVISKGKIQSMRPAFRPAPVTS-VHSQL--LNQNGTMPASMDTHIPPTPVKRA  203

Query  519  DEKHMRSFK--LEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGD  692
            ++  +   +  + E+ES   P   R         +  G  +V  DSD+SFVSSG R S D
Sbjct  204  EKPPLEPPRRSIGETESFRSPFTRRGLN-----GKSYGELSVP-DSDISFVSSG-RASID  256

Query  693  RMSSFLSETVESGRT-PRLssss--dgsfgsgRLGKGN---DLNSFT-DFSSSSLENDE-  848
             +     +  E+ RT PRLS+ S  D ++    L  G    D   F+ + S  S E+D+ 
Sbjct  257  SIFPAFYDNTETSRTPPRLSNISDFDSNYSFESLHYGRRSMDQGGFSPELSPFSHESDQL  316

Query  849  ------AEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                   E EMRRLKLEL++TM++YS+ACKEALTAKQK  ELQRW
Sbjct  317  PSAAEDVEAEMRRLKLELKQTMEMYSSACKEALTAKQKAKELQRW  361



>ref|XP_003603561.1| U-box domain-containing protein [Medicago truncatula]
Length=831

 Score =   276 bits (705),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V VRYR+YTI+EIE AT  FS+S KIGEGGYGPVFKC+LDHT VAVKVLRPDAAQGR QF
Sbjct  445   VDVRYRKYTIEEIEAATNFFSQSLKIGEGGYGPVFKCLLDHTPVAVKVLRPDAAQGRSQF  504

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIA  1430
             Q+EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS++D L  RGN P LSWQ+RF+IA
Sbjct  505   QREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLFRRGNSPSLSWQLRFKIA  564

Query  1431  AEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AE+GTGLLFLHQ KP+PIVHRDLKPGNILL
Sbjct  565   AEIGTGLLFLHQTKPEPIVHRDLKPGNILL  594


 Score =   199 bits (507),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 143/353 (41%), Positives = 199/353 (56%), Gaps = 42/353 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV-----------------DNQTQTSLQHKQQLEAQNK  134
            SQ A+KW  +NLL++  +V+L+HV                        L   ++ EAQNK
Sbjct  28   SQNALKWVVDNLLTRNATVILIHVRVSAPSLPSSPSFFTIRSGINANGLTICKEPEAQNK  87

Query  135  DLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVT  311
            ++F+ +  FCTRK+I C D+L++  D++KAL +Y S A IE+L+LGSS + S LKR KV+
Sbjct  88   NIFLPYRVFCTRKDIQCKDVLLEDADVSKALIEYASQAGIEHLILGSSTKTSLLKRFKVS  147

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEI-QEQAQNNPDIRT  488
            DIP   SK APDFCTV+VI K KI S+R+A+RPAP  SPL      I Q+Q+  N  +  
Sbjct  148  DIPGTVSKGAPDFCTVYVIGKGKIQSMRSASRPAPNISPLQVSQTTIEQDQSDINLVLEQ  207

Query  489  KNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
                 +  S+D       KL++     R    R   +G   ++ +  E  + D D+SFVS
Sbjct  208  SEKEQARNSYDAAQR---KLQDGTDSFRSPFTR---KGYNTKQYM--ENYKPDGDISFVS  259

Query  669  SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN-DLNSF--TDFSSSSLE  839
            SG R S DRM   L    E G     SS SD ++    +  G   L S   T+F+S S +
Sbjct  260  SG-RSSTDRMLPPLHNNSEPGPWISCSSESDVNYSFESIIHGRMSLESTIPTEFTSLSFD  318

Query  840  N-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +           D+ E EMRRLKLEL++TM++Y+TACKEALTA+QK  ELQ+W
Sbjct  319  SERLSSSSSQAVDDMEAEMRRLKLELKQTMEMYNTACKEALTAQQKAVELQKW  371



>gb|AES73812.2| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=795

 Score =   275 bits (703),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V VRYR+YTI+EIE AT  FS+S KIGEGGYGPVFKC+LDHT VAVKVLRPDAAQGR QF
Sbjct  445   VDVRYRKYTIEEIEAATNFFSQSLKIGEGGYGPVFKCLLDHTPVAVKVLRPDAAQGRSQF  504

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIA  1430
             Q+EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS++D L  RGN P LSWQ+RF+IA
Sbjct  505   QREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLFRRGNSPSLSWQLRFKIA  564

Query  1431  AEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AE+GTGLLFLHQ KP+PIVHRDLKPGNILL
Sbjct  565   AEIGTGLLFLHQTKPEPIVHRDLKPGNILL  594


 Score =   199 bits (506),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 143/353 (41%), Positives = 199/353 (56%), Gaps = 42/353 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV-----------------DNQTQTSLQHKQQLEAQNK  134
            SQ A+KW  +NLL++  +V+L+HV                        L   ++ EAQNK
Sbjct  28   SQNALKWVVDNLLTRNATVILIHVRVSAPSLPSSPSFFTIRSGINANGLTICKEPEAQNK  87

Query  135  DLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVT  311
            ++F+ +  FCTRK+I C D+L++  D++KAL +Y S A IE+L+LGSS + S LKR KV+
Sbjct  88   NIFLPYRVFCTRKDIQCKDVLLEDADVSKALIEYASQAGIEHLILGSSTKTSLLKRFKVS  147

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEI-QEQAQNNPDIRT  488
            DIP   SK APDFCTV+VI K KI S+R+A+RPAP  SPL      I Q+Q+  N  +  
Sbjct  148  DIPGTVSKGAPDFCTVYVIGKGKIQSMRSASRPAPNISPLQVSQTTIEQDQSDINLVLEQ  207

Query  489  KNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
                 +  S+D       KL++     R    R   +G   ++ +  E  + D D+SFVS
Sbjct  208  SEKEQARNSYDAAQR---KLQDGTDSFRSPFTR---KGYNTKQYM--ENYKPDGDISFVS  259

Query  669  SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN-DLNSF--TDFSSSSLE  839
            SG R S DRM   L    E G     SS SD ++    +  G   L S   T+F+S S +
Sbjct  260  SG-RSSTDRMLPPLHNNSEPGPWISCSSESDVNYSFESIIHGRMSLESTIPTEFTSLSFD  318

Query  840  N-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +           D+ E EMRRLKLEL++TM++Y+TACKEALTA+QK  ELQ+W
Sbjct  319  SERLSSSSSQAVDDMEAEMRRLKLELKQTMEMYNTACKEALTAQQKAVELQKW  371



>gb|KDO48984.1| hypothetical protein CISIN_1g040785mg [Citrus sinensis]
Length=782

 Score =   275 bits (702),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI++IEEAT+ F+ESRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  436   LRYRRYTIEDIEEATQFFTESRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQR  495

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E+E+LSC+RHPNMV+LLGACPEYG +VYEY+A+GS+DDR+  RGN PPLSWQ RFRIAAE
Sbjct  496   EIEVLSCIRHPNMVLLLGACPEYGIIVYEYLANGSLDDRIFRRGNTPPLSWQQRFRIAAE  555

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  556   IATGLLFLHQTKPEPLVHRDLKPGNILL  583


 Score =   248 bits (633),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 220/350 (63%), Gaps = 45/350 (13%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQ---------------TSLQHKQQLEAQNKD  137
            +SQ+A+KW  +NLL++GQ+VVL+HV  +T                T+  H++Q + Q +D
Sbjct  27   SSQHALKWAADNLLNRGQTVVLIHVAQRTSVSSVSSQSQVYDASATTNPHQKQPDKQIRD  86

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTD  314
            LF+TF C+CTRK+I C D+L++  DI KA+T+YVS AAIE+LVLG+ SRH F+++ K  D
Sbjct  87   LFLTFRCYCTRKDIKCFDVLLEDVDIVKAITEYVSFAAIEDLVLGAPSRHGFIRKFKA-D  145

Query  315  IPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKN  494
            +P+  SKAAPDFC ++V+SK KISS RNA+R APF SPL  QL     Q+QN  DI    
Sbjct  146  VPSSVSKAAPDFCNIYVVSKGKISSKRNASRSAPFTSPLLDQL-----QSQN--DISDTQ  198

Query  495  APSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSG  674
            +  S+   D    +  ++   ES   P    A  RG   +  +  ++ E D+D+SFVSSG
Sbjct  199  SRYSMNLRDRTSFKP-RMSFEESAKSP----ARGRGFDRKSFM--DSSESDTDISFVSSG  251

Query  675  SRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS--------  827
             RPS D   S   E V+ GR  R+S+SS+ S GS RLG + ND +S  D SS        
Sbjct  252  -RPSSDHSPSMHYEFVDVGRNSRISTSSEHSLGSFRLGLRYNDRSSPYDLSSISQDSGAT  310

Query  828  ----SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                SS   DE E EMRRLKLEL++TMD+YSTACKEAL AKQK  ELQRW
Sbjct  311  SCSCSSQNLDEVEAEMRRLKLELKQTMDMYSTACKEALVAKQKALELQRW  360



>ref|XP_010263442.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=793

 Score =   275 bits (702),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE+F+E+RKIGEGGYGPV+K  LDHTAVA+KVLRPDAAQGR QFQQ
Sbjct  448   IRYRKYTIEEIEAATEYFAENRKIGEGGYGPVYKSYLDHTAVAIKVLRPDAAQGRSQFQQ  507

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  +GN P LSWQVRFRIAAE
Sbjct  508   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRKGNTPVLSWQVRFRIAAE  567

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  568   IATGLLFLHQTKPEPLVHRDLKPANILL  595


 Score =   235 bits (599),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 162/367 (44%), Positives = 213/367 (58%), Gaps = 70/367 (19%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-------------------QHKQQLEAQ  128
            SQYA+KW  E++L KGQ+V+L+HV NQ  +S+                    ++++ ++Q
Sbjct  29   SQYALKWAVEHILGKGQTVILIHV-NQKASSIPNPMGSHVSITDVREDVASAYRREQDSQ  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLK  305
             K+LF+ F CFCTRK+I C D++I+ +D+AKAL +YV++ +IENLV+G SSR+SFL+R +
Sbjct  88   TKELFLPFRCFCTRKDIQCKDVVIEDSDVAKALIEYVTNYSIENLVVGASSRNSFLRRFR  147

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD--  479
              D+PT  SK APDFCTV+VISK KISSVR+A+RPAP  SPL  QLQ +Q Q    PD  
Sbjct  148  SADVPTSVSKGAPDFCTVYVISKGKISSVRSASRPAPTISPLRAQLQ-MQNQNSIKPDPA  206

Query  480  --------IRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAET  635
                      +   P +  +FD   M     EE E+   P   R A  G    R  G E 
Sbjct  207  PEQPFSQHSNSTRGPVNNVAFDPPRMSLH--EELENFRSPFTCRKAPNG----RSYG-EL  259

Query  636  VEGDSDLSFVSSGSRPSGDR-MSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLN--  806
               DSD+SFVSSG RPS DR  +  L + +ES RTP             RL   +DL+  
Sbjct  260  PMPDSDISFVSSG-RPSVDRAFAPSLYDHMESVRTP-------------RLSNASDLDGR  305

Query  807  SFTDFSSSSLEN--------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQK  944
            SF    S    +              ++ E EMRRLKLEL++TMD+YSTACKEALTAKQK
Sbjct  306  SFESMQSMGFSSISQDSSSSWPSQSMEDVEAEMRRLKLELKQTMDMYSTACKEALTAKQK  365

Query  945  TSELQRW  965
              EL RW
Sbjct  366  ARELHRW  372



>ref|NP_178015.2| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
 gb|AEE36181.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=680

 Score =   272 bits (695),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+DEIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  360   VRYRKYTVDEIEEATSNFAESQKVGEGGYGPVFRGFLDHTSVAVKVLRPDAAQGRSQFQK  419

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  420   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  479

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  480   IATGLLFLHQTKPEPIVHRDLKPGNVLL  507


 Score =   191 bits (484),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 193/302 (64%), Gaps = 32/302 (11%)
 Frame = +3

Query  117  LEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFL  293
            +E   KDLFV+FHC+C+RK I+C DIL++  D  +A+T+YVS +AIENLV+GS SR+ F+
Sbjct  1    MEKIAKDLFVSFHCYCSRKEINCRDILLEDADKVRAITEYVSSSAIENLVVGSASRNGFM  60

Query  294  KRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN  473
            +R K TD+PT  SK+APDFC V+VISK KI+SVRNA+RPAP+ + +  Q  EI     + 
Sbjct  61   RRFK-TDLPTTVSKSAPDFCNVYVISKGKIASVRNASRPAPYQNSM--QQCEIDNHHPHT  117

Query  474  PDIRTK--NAPSSLRSFDEKHMRSFKLEESESVSRPSI-----ERAATRGIPPRRMLGAE  632
            PD   K  + P+S  S   +  +S + + S  V R          +    I P       
Sbjct  118  PDKAPKYHDHPNSAGSTPSRPRKSVEADRSPLVKRKPYGDFYDSDSDLSFISP-------  170

Query  633  TVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGND---  800
            +   DSD+SF+SSG RPS +R SSF  +  ES RT R+S+SS+ S GS RLG K +D   
Sbjct  171  SSHRDSDISFISSG-RPSVER-SSFSLDFPESARTSRMSTSSEQSIGSNRLGIKFSDPDF  228

Query  801  LNSFTDFSS--------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL  956
            LN  + FS         SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +EL
Sbjct  229  LNESSTFSEESGRTSSYSSQSLDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATEL  288

Query  957  QR  962
            Q+
Sbjct  289  QK  290



>dbj|BAC42581.1| unknown protein [Arabidopsis thaliana]
Length=680

 Score =   272 bits (695),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+DEIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  360   VRYRKYTVDEIEEATSNFAESQKVGEGGYGPVFRGFLDHTSVAVKVLRPDAAQGRSQFQK  419

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  420   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  479

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  480   IATGLLFLHQTKPEPIVHRDLKPGNVLL  507


 Score =   191 bits (484),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 193/302 (64%), Gaps = 32/302 (11%)
 Frame = +3

Query  117  LEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFL  293
            +E   KDLFV+FHC+C+RK I+C DIL++  D  +A+T+YVS +AIENLV+GS SR+ F+
Sbjct  1    MEKIAKDLFVSFHCYCSRKEINCRDILLEDADKVRAITEYVSSSAIENLVVGSASRNGFM  60

Query  294  KRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN  473
            +R K TD+PT  SK+APDFC V+VISK KI+SVRNA+RPAP+ + +  Q  EI     + 
Sbjct  61   RRFK-TDLPTTVSKSAPDFCNVYVISKGKIASVRNASRPAPYQNSM--QQCEIDNHHPHT  117

Query  474  PDIRTK--NAPSSLRSFDEKHMRSFKLEESESVSRPSI-----ERAATRGIPPRRMLGAE  632
            PD   K  + P+S  S   +  +S + + S  V R          +    I P       
Sbjct  118  PDKAPKYHDHPNSAGSTPSRPRKSVEADRSPLVKRKPYGDFYDSDSDLSFISP-------  170

Query  633  TVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGND---  800
            +   DSD+SF+SSG RPS +R SSF  +  ES RT R+S+SS+ S GS RLG K +D   
Sbjct  171  SSHRDSDISFISSG-RPSVER-SSFSLDFPESARTSRMSTSSEQSIGSNRLGIKFSDPDF  228

Query  801  LNSFTDFSS--------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL  956
            LN  + FS         SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +EL
Sbjct  229  LNESSTFSEESGRTSSYSSQSLDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATEL  288

Query  957  QR  962
            Q+
Sbjct  289  QK  290



>ref|XP_006483740.1| PREDICTED: U-box domain-containing protein 52-like [Citrus sinensis]
Length=802

 Score =   275 bits (702),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+++RKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  461   VRYRKYSIEEIEAATEFFTDTRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQ  520

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRLM RG  PPLSWQ+RF+IAAE
Sbjct  521   EVEILSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLMRRGQSPPLSWQLRFKIAAE  580

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  581   IGTALLFLHQTKPEPLVHRDLKPANILL  608


 Score =   209 bits (533),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 213/372 (57%), Gaps = 68/372 (18%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV----------------------DNQTQTSLQHKQQL  119
            SQ AIKW  +N+L+KGQ++VL+HV                      D     SL  K   
Sbjct  30   SQNAIKWAIDNILTKGQTLVLIHVKIRSASLSPSPSLISPRMNQICDVSGDGSLVCKDP-  88

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRH-SFLK  296
            + Q +++F+ F CFCTRK+I C D++++ TD+AKAL +YVS  AIE LV+G+S +  FL+
Sbjct  89   DPQTREIFLPFRCFCTRKDIQCKDVVLEDTDVAKALIEYVSQTAIETLVVGASNNKGFLR  148

Query  297  RLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN--  470
            R K TD+P   SK APDFCTV+VISK KISS+R+A+RPAP  SPL  Q+     Q +   
Sbjct  149  RFKTTDVPGNVSKGAPDFCTVYVISKGKISSMRSASRPAPAVSPLRNQIIIRPPQPERPA  208

Query  471  ---------NPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRML  623
                      P  R +  P    + D +  RS    +  +  +   +RAA    PP    
Sbjct  209  PQPPPIRVPTPTERPQMEPPRKSNDDAEFFRSPFTRKQFNGKQGGEQRAA----PPH---  261

Query  624  GAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVE--SGRTP-RLssssdgsfg----sgR  782
                   D+D+SFVSSG RPS DR+     + +E  + RTP RLS+ SD        S +
Sbjct  262  -------DTDISFVSSG-RPSIDRIFPAFFDNIENSANRTPPRLSNLSDMESNNSFESMQ  313

Query  783  LGKGN-DLNSFTDFSSSSLEND----------EAEVEMRRLKLELQKTMDLYSTACKEAL  929
            +G+ + D+ S + FSS+S END          + E EMRRL+LEL++TM++YSTACKEAL
Sbjct  314  IGRRSLDIGSPSGFSSASGENDRSSSASQGLDDVEAEMRRLRLELKQTMEMYSTACKEAL  373

Query  930  TAKQKTSELQRW  965
            TAKQK +ELQRW
Sbjct  374  TAKQKATELQRW  385



>ref|XP_006303100.1| hypothetical protein CARUB_v100212851mg, partial [Capsella rubella]
 gb|EOA35998.1| hypothetical protein CARUB_v100212851mg, partial [Capsella rubella]
Length=661

 Score =   271 bits (693),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  342   VRYRKYTVEEIEEATSNFAESQKVGEGGYGPVFRGFLDHTSVAVKVLRPDAAQGRSQFQK  401

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  402   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFRRGNTPPITWQLRFRIAAE  461

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  462   IATGLLFLHQTKPEPIVHRDLKPGNVLL  489


 Score =   162 bits (410),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 127/289 (44%), Positives = 177/289 (61%), Gaps = 44/289 (15%)
 Frame = +3

Query  177  IHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFC  353
            I+C DIL++  D  +A+T+YVS  A+ENLV+G+ SR+ F++R K TD+PT  SKAAPDFC
Sbjct  1    INCRDILLEDADKVRAITEYVSSYAVENLVVGAASRNGFMRRFK-TDLPTTVSKAAPDFC  59

Query  354  TVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHM  533
            +V+VISK KI+SVRNA+RPAP+ + +  Q  EI     + PD     AP       + H 
Sbjct  60   SVYVISKGKIASVRNASRPAPYHTSM--QQCEIDNHYPHTPD----KAP-------KHHD  106

Query  534  RSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS------------SGS  677
             S     + S  R S+E   TR    +R    +  + DSDLSF+S            S  
Sbjct  107  HSNSAGSTPSRPRRSVEADPTRSPLVKRKPYGDLYDSDSDLSFISPSSHRDSDISFISSG  166

Query  678  RPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-------NDLNSFTD------  818
            RPS +R SSF  +  ES RT R+S+SS+ S GS RLG         N+ ++F++      
Sbjct  167  RPSVER-SSFSLDFPESARTSRISTSSEQSIGSHRLGLKFSDPGFPNESSTFSEESGRTS  225

Query  819  -FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             +SS SL  D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  226  SYSSQSL--DDVEAEMKRLRLELKQTMDMYSTACKEALSARQEATELQK  272



>ref|XP_006582487.1| PREDICTED: U-box domain-containing protein 52-like [Glycine max]
Length=791

 Score =   274 bits (700),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V +RYRRYTI+EIE AT+ F+ES KIGEGGYGPVFKC+LDHT VAVKVLRPDA QGR QF
Sbjct  456   VDIRYRRYTIEEIEAATDFFAESLKIGEGGYGPVFKCLLDHTPVAVKVLRPDAQQGRSQF  515

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIA  1430
             Q+EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  +G+ PPL WQ+RF+IA
Sbjct  516   QREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRQGSTPPLPWQLRFKIA  575

Query  1431  AEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AE+GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  576   AEIGTGLLFLHQTKPEPLVHRDLKPGNILL  605


 Score =   180 bits (456),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 198/365 (54%), Gaps = 55/365 (15%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQT---------------------------QTSLQ  104
            SQ A+KW  +NLL+K  +V+L+HV                                TSL 
Sbjct  28   SQNALKWAVDNLLTKSATVILIHVKLLAPILSPSPSLFTPISLVALAGISALLGDDTSLV  87

Query  105  HKQQLEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-R  281
             K+  E  NK++F+ +  FCTRK+I C D+L++ +DI+KAL +Y S A IE+LVLGSS +
Sbjct  88   SKEP-EGNNKNVFLPYRVFCTRKDIQCTDVLLEDSDISKALIEYASQAGIEHLVLGSSTK  146

Query  282  HSFLKRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQ  461
             S LKR KV+D P   SK APDFCTV+VI+K KI ++R+A+RPAP   P    L +   +
Sbjct  147  TSLLKRFKVSDTPGAVSKGAPDFCTVYVIAKGKIQTMRSASRPAPAIVP--NLLSQASVR  204

Query  462  AQNNPDI---RTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAE  632
              ++P++   ++     +  SFD    R  + +ESE+   P   R    G    R  G  
Sbjct  205  KDSDPNVLLAQSIKEQETRHSFDAALPRRSQ-DESETFRSP-FTRKGYSG----RQYG-N  257

Query  633  TVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN---DL  803
            T + D D+SF S+G +   +   S  S+T  S     L S  DGSF    +  G    + 
Sbjct  258  TPKPDMDISFPSTGRKSIENFFPSLNSDTGMSNPRLSLGSDIDGSFSFESMHHGRKSMET  317

Query  804  NSFTDFSSSSLEN-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTS  950
             +  +FSS S E+           D+ E EMRRLKLEL++TM+LY+TACKEA TA+QK  
Sbjct  318  GTPPEFSSLSFESDRHSSSTSQAVDDMEAEMRRLKLELKQTMELYNTACKEAFTAQQKAV  377

Query  951  ELQRW  965
            EL++W
Sbjct  378  ELKKW  382



>ref|XP_010527112.1| PREDICTED: U-box domain-containing protein 52-like [Tarenaya 
hassleriana]
Length=782

 Score =   274 bits (700),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPVFKC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  457   VRYRKYSIEEIERATEFFAEKYKIGEGGYGPVFKCFLDHTPVAVKVLRPDAAQGRSQFQQ  516

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL  RGN PPLSWQ RFRI+AE
Sbjct  517   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRRGNSPPLSWQTRFRISAE  576

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  577   IGTGLLFLHQTKPEPLVHRDLKPANILL  604


 Score =   202 bits (515),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 209/351 (60%), Gaps = 39/351 (11%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQ-----------TSLQHK--------QQLEAQ  128
            SQ A+KW  ++LL +GQSVVL+HV  Q             + L H         ++ E  
Sbjct  39   SQNALKWAVDHLLQRGQSVVLIHVKIQPSSLSPSPSLNSTSKLSHIDDDASLVCKEPEGP  98

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLK  305
             ++LF+ F CFCTRK+I C ++L++ +D+AKAL +YV+ A IE LV+G SS+  FL+  K
Sbjct  99   FRELFLPFRCFCTRKDIQCKEVLVEESDVAKALVEYVNQAGIEVLVIGTSSKSGFLRFSK  158

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDI  482
             TDIP   ++AAPDFCTV+VISK KIS++R+A+R AP  +PL  QLQ+   +  Q  P  
Sbjct  159  PTDIPGTITRAAPDFCTVYVISKGKISTMRSASRAAPSVAPLRSQLQQPNLKPPQPLPSP  218

Query  483  RTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
             T    +  +SF+ +      L  S+S  R  + R    G         +    +SD+SF
Sbjct  219  STTAYRAERQSFESQRKSIDTL--SDSSFRSPLTRRGKHGSS-----NGDLSVPESDISF  271

Query  663  VSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG--NDLNSFTDFSS---  827
            VSSG RPS DR+ +  +++  S   PRLS+ SD SF +   G+   + +NS  DFSS   
Sbjct  272  VSSG-RPSVDRIYANFNDSEPSRTPPRLSNFSDASFDTMSYGRKSLDIMNSPPDFSSFES  330

Query  828  -----SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                 +S   D+ E EMRRLKLEL++TM++YSTACKEALTAKQK  ELQRW
Sbjct  331  ERFSSASQTMDDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAMELQRW  381



>emb|CDY40035.1| BnaC05g12800D [Brassica napus]
Length=762

 Score =   273 bits (699),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T +F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  433   VRYRKYTVHEIEEGTGNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFQK  492

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  493   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  552

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  553   IATGLLFLHQTKPEPIVHRDLKPGNVLL  580


 Score =   221 bits (564),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 154/353 (44%), Positives = 218/353 (62%), Gaps = 52/353 (15%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TSQ AIKWT ENL S+GQ++ L+HV  ++Q+S        H QQ++ Q KDLFV+FHC+C
Sbjct  27   TSQNAIKWTMENLTSRGQTLALIHVAPKSQSSSDIEDGTMHMQQMDKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHCLD+L++  D  KA+ +YV+ +AIENLVLG+ SR SF++R K TD+PT  SKAA
Sbjct  87   SRKEIHCLDVLLEDADKVKAIVEYVTVSAIENLVLGAPSRSSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQL--QEIQEQAQNNPDIRTKNAPSSLRS  515
            PDFC V+VISK KISS+R+++RPAP+ S +      QE     + +    T     + RS
Sbjct  146  PDFCNVYVISKGKISSLRSSSRPAPYKSTVLSDFENQETAASEKKHKPANTTPITRARRS  205

Query  516  FD------------EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLS  659
             D            + H++  K + S+S S  S   A+ +G               S+ S
Sbjct  206  VDSDGPRPGFVKLPQGHIK-MKGDFSDSESEFSFISASQQG---------------SENS  249

Query  660  FVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSL  836
            F+SSG+  S DR  SF  +  +S RT R+S+SS+ S GS RLG K  DL    + S++S 
Sbjct  250  FISSGTPSSIDR-CSFTYDLPDSARTSRMSTSSEQSIGSHRLGIKFTDLGFLNNSSTASE  308

Query  837  EN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
            E+            D+ E +MRRL+LEL++TMD+YS+AC+EALTA+Q+ +EL+
Sbjct  309  ESGRTSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARQEATELK  361



>emb|CDP12490.1| unnamed protein product [Coffea canephora]
Length=800

 Score =   274 bits (701),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRYTIDEIE AT+HFSESRKIGEGGYGPV+KC LDHT VA+KVLRPDA+QGR QFQQ
Sbjct  483   VRYRRYTIDEIETATDHFSESRKIGEGGYGPVYKCNLDHTPVAIKVLRPDASQGRAQFQQ  542

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM +GS+DDRL  RG  P L WQ+RFRIAAE
Sbjct  543   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMPNGSLDDRLFRRGQTPVLPWQLRFRIAAE  602

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  603   IGTCLLFLHQTKPEPLVHRDLKPANILL  630


 Score =   181 bits (459),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 194/359 (54%), Gaps = 51/359 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL----------------QHKQQLEAQNKD  137
            SQYA+KW  +NL+ KG+ V L+HV  +  +S                 +  +  + Q+K+
Sbjct  61   SQYALKWAVDNLVGKGKYVTLIHVKQKQPSSASLVSHIALADANDSIQRSYKDADGQSKE  120

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTD  314
            LF+ F CFCTRK+I   +++I+  DIAK + DYV    +ENLVLG+ S+ +F++R K  D
Sbjct  121  LFLPFRCFCTRKDIRVNEVMIEDLDIAKGICDYVRANFVENLVLGAPSKSAFVRRFKTND  180

Query  315  IPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNP---DIR  485
            + +  SK APDFC VF ISK K+SSVR A+ P P     +P  ++ Q Q   NP   D R
Sbjct  181  VASTVSKVAPDFCNVFTISKGKLSSVRAASCPVP-----NPPPRQGQNQGTTNPVLSDAR  235

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
              +  S +R F   H +S     + +    SI+   TRG    R  G  ++  DSD+SF+
Sbjct  236  LMHG-SGVRGFS--HDKSPIAPRTLAEDMDSIKSPFTRGKTQNRSSGDFSLP-DSDISFI  291

Query  666  SSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG------KGNDLNSFTDFSS  827
            SSG R S D +   L +  +    PRL S+   +  +   G      +  D +S   F S
Sbjct  292  SSG-RSSMDHLFP-LPDIQDMAFPPRL-SNGSETENTSNFGSSFSGPRTPDTSSSGTFPS  348

Query  828  SSLEN-------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             + EN             ++ E EMRRLK EL++TM++YSTACKEAL AKQK  ELQRW
Sbjct  349  RTHENGSISWSSSSSQSQEDVEAEMRRLKQELKQTMEMYSTACKEALLAKQKALELQRW  407



>ref|XP_009149113.1| PREDICTED: U-box domain-containing protein 35-like [Brassica 
rapa]
 emb|CDY35116.1| BnaA06g11260D [Brassica napus]
Length=762

 Score =   273 bits (698),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T++F+ESRK+GEGGYGPV++  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  433   VRYRKYTVHEIEEGTDNFAESRKVGEGGYGPVYRGHLDHTSVAVKVLRPDAAQGRSQFQK  492

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  493   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  552

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  553   IATGLLFLHQTKPEPIVHRDLKPGNVLL  580


 Score =   224 bits (570),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 217/352 (62%), Gaps = 50/352 (14%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TSQ AIKWT ENL S+GQ++ L+HV  ++Q+S        H QQ++ Q KDLFV+FHC+C
Sbjct  27   TSQNAIKWTMENLTSRGQTLALIHVAPKSQSSSDIEDGTMHMQQMDKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHCLD+L++  D  KA+ +YV+ +AIENLVLG+ SR SF++R K TD+PT  SKAA
Sbjct  87   SRKEIHCLDVLLEDADKVKAIVEYVTVSAIENLVLGAPSRSSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQL--QEIQEQAQNNPDIRTKNAPSSLRS  515
            PDFC V+VISK KISS+R+++RPAP+ S +      QE     + +    T     + RS
Sbjct  146  PDFCNVYVISKGKISSLRSSSRPAPYKSTVLSDFENQETAASEKKHKPANTTPITRARRS  205

Query  516  FDEKHMRS--FKLEE---------SESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
             D    R    KL +         S+S S  S   A+ +G               S+ SF
Sbjct  206  VDSDGPRPGFVKLPQGNMKMIGDFSDSGSEFSFISASQQG---------------SENSF  250

Query  663  VSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLE  839
            +SSG+  SGDR  SF  +  +S RT R+S+SS+ S GS RLG K  DL    + S++S E
Sbjct  251  ISSGTPTSGDR-CSFTYDLPDSARTSRMSTSSEQSIGSHRLGIKFTDLGFLNNSSTASEE  309

Query  840  N------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
            +            D+ E +MRRL+LEL++TMD+YS+AC+EALTA+Q+ +EL+
Sbjct  310  SGRTSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARQEATELK  361



>ref|XP_010656706.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Vitis vinifera]
Length=825

 Score =   275 bits (702),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESRKIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  483   LRYRKYTIEEIEAATELFSESRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQ  542

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  RGN P L WQ+RF+IAAE
Sbjct  543   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDHLFRRGNTPVLPWQLRFQIAAE  602

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  603   IGTGLLFLHQTKPEPLVHRDLKPGNILL  630


 Score =   194 bits (494),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 155/401 (39%), Positives = 208/401 (52%), Gaps = 97/401 (24%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV------------------DNQTQTSLQHKQQLEAQN  131
            SQYA+KW  ++LLSKGQSV L+H+                  D     +  +KQQL+ Q 
Sbjct  23   SQYALKWAVDHLLSKGQSVTLLHIKQKASSIPNPLGNQVAISDVNEDVARAYKQQLDNQA  82

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVT  311
            ++LF+ F CFC RK+I C +++++GTDI KA+ D+V+ ++IE LV+G+   S   R K T
Sbjct  83   RELFLPFRCFCMRKDIQCNEVILEGTDITKAIIDFVTASSIEILVVGAPSRSGFIRFKTT  142

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPF------ASPLHPQLQEIQEQAQNN  473
            D+P+   KAAPDFCTV+VISK KI+SVR+ATRP P       AS LH      Q QA   
Sbjct  143  DVPSSVLKAAPDFCTVYVISKGKITSVRSATRPVPNPSPPPTASSLH------QNQASPT  196

Query  474  PDIRTKNAPSSLRSFDEKHMRSFKLEESES-----VSRPSIERAATRGIPPRRMLGAETV  638
            PD    +          KH RS +  E  S     ++   I+   TRG         E  
Sbjct  197  PDPTEAHL---------KHNRSTRASERSSFGLRNLNDLEIKSPFTRGRASLSKSYGELS  247

Query  639  EGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdg-----------------s  767
              ++D+SFVSSG RPS D +  F  + +++G  P LS+SS+                  S
Sbjct  248  VPETDISFVSSG-RPSIDHIFPFSYDNLDTGMNPWLSNSSEMNPRLSNSSDLNTRLSIGS  306

Query  768  fgsgRLGKGNDLN------------SFT-------------DFSSSSLEN----------  842
              + RL   +DLN            SF              D SSSS E+          
Sbjct  307  EMNPRLSNSSDLNTRLSNGSELDCRSFASSGGRSSELNYSLDLSSSSNESGRLSWASQSM  366

Query  843  DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            ++ E EMRRLKLEL++TMD+YSTACKEAL+AKQ   EL RW
Sbjct  367  EDVEAEMRRLKLELKQTMDMYSTACKEALSAKQTARELHRW  407



>ref|XP_006296408.1| hypothetical protein CARUB_v10025585mg [Capsella rubella]
 gb|EOA29306.1| hypothetical protein CARUB_v10025585mg [Capsella rubella]
Length=806

 Score =   274 bits (701),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE+F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  485   VRYRKYSIEEIESATEYFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  544

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  545   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  604

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  605   IGTGLLFLHQAKPEPLVHRDLKPGNILL  632


 Score =   209 bits (532),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 215/382 (56%), Gaps = 62/382 (16%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ A+KW  +NLL +GQSV+LVHV             + +   L  +  L     E  +
Sbjct  29   SSQLALKWAVDNLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQESSLVCRDPEGLS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K+LF+ F CFCTRK+I C D+L++ TD+AKAL +Y + AAIE LV+GSS +  FL+  K 
Sbjct  89   KELFLPFRCFCTRKDIQCQDVLLEETDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDIR  485
            TDIP   +K+APDFCTV+VISK KI ++R+A+R AP  +PL   +Q    +  Q  P   
Sbjct  149  TDIPGTITKSAPDFCTVYVISKGKIQTMRSASRSAPMTAPLRNPVQPPSLKPPQPMPSTS  208

Query  486  TKNAPSSLRSFDEKHMRSFK------LEESESVSRPSIERAATRGIPPRRM---------  620
            T    +  RSF+ +  RS +      +E+ +  S   ++R +   +  R M         
Sbjct  209  TNTMRAERRSFESQQRRSVEDPQRRSMEDLQRRSVEDLQRRSMEDLQRRSMDDQSESFRS  268

Query  621  ----LGAETVEGD-----SDLSFVSSGSRPSGDRM-SSFLSETVESGRTP-RLssssdgs  767
                 G     GD     SD+SF+SSG RPS DR+  S      +  RTP RLS+ SD  
Sbjct  269  PFTRRGNGRSYGDLSVPESDISFISSG-RPSIDRIFPSLYDNNNDPNRTPPRLSNFSDMD  327

Query  768  fgsgRLGKGN------DLNSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMD  899
            +GS      N      D++S T+ S+ S EN          D+ E EMRRLKLEL++TM+
Sbjct  328  YGSNFDQSSNYGRRSVDMSSPTNMSTGSFENERFSSASQSIDDVEAEMRRLKLELKQTME  387

Query  900  LYSTACKEALTAKQKTSELQRW  965
            +YSTACKEALTAKQK +ELQRW
Sbjct  388  MYSTACKEALTAKQKATELQRW  409



>gb|KHN18232.1| U-box domain-containing protein 52 [Glycine soja]
Length=784

 Score =   274 bits (700),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V +RYRRYTI+EIE AT+ F+ES KIGEGGYGPVFKC+LDHT VAVKVLRPDA QGR QF
Sbjct  449   VDIRYRRYTIEEIEAATDFFAESLKIGEGGYGPVFKCLLDHTPVAVKVLRPDAQQGRSQF  508

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIA  1430
             Q+EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  +G+ PPL WQ+RF+IA
Sbjct  509   QREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRQGSTPPLPWQLRFKIA  568

Query  1431  AEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AE+GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  569   AEIGTGLLFLHQTKPEPLVHRDLKPGNILL  598


 Score =   182 bits (462),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 198/358 (55%), Gaps = 48/358 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQT--------------------QTSLQHKQQLEA  125
            SQ A+KW  +NLL+K  +V+L+HV                         TSL  K+  E 
Sbjct  28   SQNALKWAVDNLLTKSATVILIHVKLLAPILSPSPSLFTPRISALLGDDTSLVSKEP-EG  86

Query  126  QNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRL  302
             NK++F+ +  FCTRK+I C D+L++ +DI+KAL +Y S A IE+LVLGSS + S LKR 
Sbjct  87   NNKNVFLPYRVFCTRKDIQCTDVLLEDSDISKALIEYASQAGIEHLVLGSSTKTSLLKRF  146

Query  303  KVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI  482
            KV+D P   SK APDFCTV+VI+K KI ++R+A+RPAP   P    L +   +  ++P++
Sbjct  147  KVSDTPGAVSKGAPDFCTVYVIAKGKIQTMRSASRPAPAIVP--NLLSQASVRKDSDPNV  204

Query  483  ---RTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
               ++     +  SFD    R  + +ESE+   P   R    G    R  G  T + D D
Sbjct  205  LLAQSIKEQETRHSFDAALPRRSQ-DESETFRSP-FTRKGYSG----RQYG-NTPKPDMD  257

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN---DLNSFTDFS  824
            +SF S+G +   +   S  S+T  S     L S  DGSF    +  G    +  +  +FS
Sbjct  258  ISFPSTGRKSIENFFPSLNSDTGMSNPRLSLGSDIDGSFSFESMHHGRKSMETGTPPEFS  317

Query  825  SSSLEN-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S S E+           D+ E EMRRLKLEL++TM+LY+TACKEA TA+QK  EL++W
Sbjct  318  SLSFESDRHSSSTSQAVDDMEAEMRRLKLELKQTMELYNTACKEAFTAQQKAVELKKW  375



>ref|XP_008782816.1| PREDICTED: U-box domain-containing protein 35-like [Phoenix dactylifera]
Length=749

 Score =   273 bits (698),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE+FSE RKIGEGGYGPV++C LDHT  A+KVLRPDAAQGR QFQQ
Sbjct  409   VRYRKYTIEEIEVATEYFSEKRKIGEGGYGPVYRCYLDHTPAAIKVLRPDAAQGRSQFQQ  468

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN PP+ WQ RFRIAAE
Sbjct  469   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPPIPWQHRFRIAAE  528

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  529   ISTGLLFLHQTKPEPLVHRDLKPANILL  556


 Score =   204 bits (518),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 193/336 (57%), Gaps = 40/336 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEA--QNKDLFVTFHCFCTRKNI  179
            SQ A+KW  +N++++GQ++ L+HV+++   S   +    A   +KDLFV F CFCTRKN+
Sbjct  22   SQNALKWALDNIVTRGQTITLIHVNSKHTGSGAQEDHASAGSHSKDLFVPFRCFCTRKNV  81

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
            HC D++++ TDIAKA+ ++VS+AAIE LV+G+   S   R + TD+ T  SK APDFCTV
Sbjct  82   HCKDVILEDTDIAKAIIEFVSNAAIEKLVVGAPSKSGFVRFRTTDVATNISKGAPDFCTV  141

Query  360  FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRS  539
            ++ISK K+SS+RNA R AP  SP   Q+       QN+  I+T++     RS+  K   +
Sbjct  142  YIISKGKVSSMRNAVRSAPAVSPYRAQI-------QNHASIKTEHVDPP-RSYGIKGGAA  193

Query  540  FKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGD-------RM  698
             +    +S   P I    TRG              DSD+SFV SG R S D        M
Sbjct  194  LEARNVQSEREP-IRSPFTRGARASNAKSYAESIADSDISFV-SGGRTSIDGIFNQRLSM  251

Query  699  SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEN-------DEAEV  857
            S  L  + E  ++PR             +G G      T FSS S ++       ++ E 
Sbjct  252  SDGLDSSFEM-QSPR-----------RSVGGGYSFG--TAFSSISQDSTSSSHAMEDVEA  297

Query  858  EMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            EM+RL+LEL++TM++YSTACKEALTAKQK  EL RW
Sbjct  298  EMKRLRLELKQTMEMYSTACKEALTAKQKAMELHRW  333



>ref|XP_010656705.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Vitis vinifera]
 emb|CAN79719.1| hypothetical protein VITISV_012742 [Vitis vinifera]
Length=826

 Score =   274 bits (701),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESRKIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  484   LRYRKYTIEEIEAATELFSESRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQ  543

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  RGN P L WQ+RF+IAAE
Sbjct  544   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDHLFRRGNTPVLPWQLRFQIAAE  603

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  604   IGTGLLFLHQTKPEPLVHRDLKPGNILL  631


 Score =   199 bits (505),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 157/402 (39%), Positives = 212/402 (53%), Gaps = 98/402 (24%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV------------------DNQTQTSLQHKQQLEAQN  131
            SQYA+KW  ++LLSKGQSV L+H+                  D     +  +KQQL+ Q 
Sbjct  23   SQYALKWAVDHLLSKGQSVTLLHIKQKASSIPNPLGNQVAISDVNEDVARAYKQQLDNQA  82

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
            ++LF+ F CFC RK+I C +++++GTDI KA+ D+V+ ++IE LV+G+ SR  F++R K 
Sbjct  83   RELFLPFRCFCMRKDIQCNEVILEGTDITKAIIDFVTASSIEILVVGAPSRSGFIRRFKT  142

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPF------ASPLHPQLQEIQEQAQN  470
            TD+P+   KAAPDFCTV+VISK KI+SVR+ATRP P       AS LH      Q QA  
Sbjct  143  TDVPSSVLKAAPDFCTVYVISKGKITSVRSATRPVPNPSPPPTASSLH------QNQASP  196

Query  471  NPDIRTKNAPSSLRSFDEKHMRSFKLEESES-----VSRPSIERAATRGIPPRRMLGAET  635
             PD    +          KH RS +  E  S     ++   I+   TRG         E 
Sbjct  197  TPDPTEAHL---------KHNRSTRASERSSFGLRNLNDLEIKSPFTRGRASLSKSYGEL  247

Query  636  VEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdg-----------------  764
               ++D+SFVSSG RPS D +  F  + +++G  P LS+SS+                  
Sbjct  248  SVPETDISFVSSG-RPSIDHIFPFSYDNLDTGMNPWLSNSSEMNPRLSNSSDLNTRLSIG  306

Query  765  sfgsgRLGKGNDLN------------SFT-------------DFSSSSLEN---------  842
            S  + RL   +DLN            SF              D SSSS E+         
Sbjct  307  SEMNPRLSNSSDLNTRLSNGSELDCRSFASSGGRSSELNYSLDLSSSSNESGRLSWASQS  366

Query  843  -DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             ++ E EMRRLKLEL++TMD+YSTACKEAL+AKQ   EL RW
Sbjct  367  MEDVEAEMRRLKLELKQTMDMYSTACKEALSAKQTARELHRW  408



>ref|XP_010656707.1| PREDICTED: U-box domain-containing protein 52-like isoform X3 
[Vitis vinifera]
Length=806

 Score =   274 bits (700),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESRKIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  464   LRYRKYTIEEIEAATELFSESRKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQ  523

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  RGN P L WQ+RF+IAAE
Sbjct  524   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDHLFRRGNTPVLPWQLRFQIAAE  583

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  584   IGTGLLFLHQTKPEPLVHRDLKPGNILL  611


 Score =   206 bits (524),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 155/382 (41%), Positives = 212/382 (55%), Gaps = 78/382 (20%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV------------------DNQTQTSLQHKQQLEAQN  131
            SQYA+KW  ++LLSKGQSV L+H+                  D     +  +KQQL+ Q 
Sbjct  23   SQYALKWAVDHLLSKGQSVTLLHIKQKASSIPNPLGNQVAISDVNEDVARAYKQQLDNQA  82

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
            ++LF+ F CFC RK+I C +++++GTDI KA+ D+V+ ++IE LV+G+ SR  F++R K 
Sbjct  83   RELFLPFRCFCMRKDIQCNEVILEGTDITKAIIDFVTASSIEILVVGAPSRSGFIRRFKT  142

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPF------ASPLHPQLQEIQEQAQN  470
            TD+P+   KAAPDFCTV+VISK KI+SVR+ATRP P       AS LH      Q QA  
Sbjct  143  TDVPSSVLKAAPDFCTVYVISKGKITSVRSATRPVPNPSPPPTASSLH------QNQASP  196

Query  471  NPDIRTKNAPSSLRSFDEKHMRSFKLEESES-----VSRPSIERAATRGIPPRRMLGAET  635
             PD    +          KH RS +  E  S     ++   I+   TRG         E 
Sbjct  197  TPDPTEAHL---------KHNRSTRASERSSFGLRNLNDLEIKSPFTRGRASLSKSYGEL  247

Query  636  VEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLsss-------sdgsfgsgRL---  785
               ++D+SFVSSG RPS D +  F  + +++G  P LS+S       S+ S  + RL   
Sbjct  248  SVPETDISFVSSG-RPSIDHIFPFSYDNLDTGMNPWLSNSSEMNPRLSNSSDLNTRLSNG  306

Query  786  ------------GKGNDLNSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMD  899
                        G+ ++LN   D SSSS E+          ++ E EMRRLKLEL++TMD
Sbjct  307  SELDCRSFASSGGRSSELNYSLDLSSSSNESGRLSWASQSMEDVEAEMRRLKLELKQTMD  366

Query  900  LYSTACKEALTAKQKTSELQRW  965
            +YSTACKEAL+AKQ   EL RW
Sbjct  367  MYSTACKEALSAKQTARELHRW  388



>ref|XP_009618440.1| PREDICTED: U-box domain-containing protein 35 [Nicotiana tomentosiformis]
Length=794

 Score =   274 bits (700),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE AT++F+ SRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  459   RYRKYTIEEIEAATDNFAASRKIGEGGYGPVYKCCLDHTQVAIKVLRPDAAQGRSQFQQE  518

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DDRL  RGN P L WQ+RFRIAAE+
Sbjct  519   VEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDRLFRRGNTPVLPWQLRFRIAAEV  578

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GT LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  579   GTSLLFLHQTKPEPLVHRDLKPGNILL  605


 Score =   197 bits (500),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 143/357 (40%), Positives = 196/357 (55%), Gaps = 40/357 (11%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV-----------DNQTQTSLQHKQQLEAQNKDLFVTF  152
            SQYA+KW  +NLL KG+SV L+HV           D    T   ++   ++Q K+LF+ F
Sbjct  29   SQYALKWAVDNLLGKGKSVTLLHVKLRPSNSIPNADVNDGTPRVYRSDPDSQAKELFLPF  88

Query  153  HCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLT  329
             CFC RKNIH  +++I+G DIA +++DYV+    ENLV+G+ SR+ F+ R K  D+P+  
Sbjct  89   RCFCNRKNIHVNEVVIEGIDIANSISDYVAANVTENLVVGAASRNGFVSRFKTMDVPSSV  148

Query  330  SKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSL  509
            SK AP FCTV+VI+K K+ S+RNA+ P P   P   Q Q           I  + APS+ 
Sbjct  149  SKIAPGFCTVYVIAKGKVLSIRNASAPVPNPPPSLLQNQTSSSLGAKLGFIEARYAPSN-  207

Query  510  RSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSG  689
             S      RS     S +     I+    RG P  R  G  +V  +SD+SFVSS +RPS 
Sbjct  208  DSRGSMADRSPYAPRSSTEDSDFIKSPFNRGKPVNRSYGDLSV-AESDISFVSS-NRPSS  265

Query  690  DRMSSFLSETVESGRTPRLssss------------dgsfgsgRLGKGND-----LNSFTD  818
            D      S++ + G  PRLS+SS            + S    RL  G+      L+    
Sbjct  266  DCTFPISSDSHDLGLPPRLSNSSDTDNRFSAPRLSNSSETDSRLSFGSSFSATRLSEVNA  325

Query  819  FSSSSLEN--------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            FSS+S ++        ++ E EMRRLK EL++TMD+YSTACKEAL+AK K  EL RW
Sbjct  326  FSSNSFDSANGSTNNLEDIEAEMRRLKQELKQTMDMYSTACKEALSAKHKALELHRW  382



>ref|XP_006416783.1| hypothetical protein EUTSA_v10009494mg, partial [Eutrema salsugineum]
 gb|ESQ35136.1| hypothetical protein EUTSA_v10009494mg, partial [Eutrema salsugineum]
Length=713

 Score =   272 bits (695),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEEAT +F++SRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  414   VRYRKYTVQEIEEATGNFADSRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  473

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  474   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  533

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  534   IATGLLFLHQTKPEPIVHRDLKPGNVLL  561


 Score =   235 bits (600),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 218/340 (64%), Gaps = 44/340 (13%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TSQ A+KWT +NL S+GQ++ L+HV  ++Q+S      + HKQQ+E Q KDLFV+FHC+C
Sbjct  28   TSQNALKWTMDNLTSRGQTLALIHVAPKSQSSSDIEEGILHKQQMEKQTKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+C+D+L++  D  KA+ +YV+ +AIENLVLG+ SR+SF++R K TD+PT  SKAA
Sbjct  88   SRKEINCMDVLLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFK-TDLPTSVSKAA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK KISSVRNA+RPAP+ S +  +     E   N    +T  A        
Sbjct  147  PDFCNVYVISKGKISSVRNASRPAPYRSSVPSEFDNNHETFANQKKHKTGFAKPP-----  201

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMS  701
            + HMR    + S+S S  S   A+               + +SD+SF SSG RPS DR S
Sbjct  202  QAHMRLMG-DFSDSESEFSFISAS---------------QHESDISFASSG-RPSADR-S  243

Query  702  SFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEN------------  842
            SF  +  ES RT R+S+SS+ S GS RLG K  DL    + S+ S E+            
Sbjct  244  SFTYDLPESARTSRMSTSSEQSIGSHRLGIKFTDLGYLNNSSTVSDESGRTSCSYSSQSL  303

Query  843  DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
            D+ E +MRRL+LEL++TMD+YS+AC+EALTA+ + +ELQ+
Sbjct  304  DDVEAQMRRLRLELKQTMDMYSSACREALTARHEATELQK  343



>ref|XP_010419304.1| PREDICTED: U-box domain-containing protein 52-like, partial [Camelina 
sativa]
Length=535

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  210   VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  269

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+R+ IAAE
Sbjct  270   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRYIIAAE  329

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  330   IGTGLLFLHQAKPEPLVHRDLKPGNILL  357


 Score = 94.0 bits (232),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 81/124 (65%), Gaps = 18/124 (15%)
 Frame = +3

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTP-RLssssdgsfgsgRLGKGN------DL  803
            +SD+SFVSSG RPS DR+   L +  +  RTP RLS+ SD  +GS      N      D+
Sbjct  12   ESDISFVSSG-RPSIDRIFPSLYDNNDPNRTPPRLSNFSDMDYGSNFDQSSNYGRRSMDM  70

Query  804  NSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
            NS TD SS S E+          D+ E EMRRLKLEL++TM++YSTACKEALTAKQK +E
Sbjct  71   NSPTDMSSGSFESERFSSASQTIDDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATE  130

Query  954  LQRW  965
            LQRW
Sbjct  131  LQRW  134



>ref|XP_007217395.1| hypothetical protein PRUPE_ppa025268mg [Prunus persica]
 gb|EMJ18594.1| hypothetical protein PRUPE_ppa025268mg [Prunus persica]
Length=776

 Score =   273 bits (698),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             +YRRY I+EIE+ATEHF+ SRKIGEGGYGPVFKC LDHT VAVKVLRPDAAQGR QFQ+E
Sbjct  432   KYRRYAIEEIEQATEHFAPSRKIGEGGYGPVFKCYLDHTPVAVKVLRPDAAQGRTQFQKE  491

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             ++ILSC+RHPNMV+LLGACPEYG LVYEYMA+GS++D L+ RGN P LSWQ+RFRIAAE+
Sbjct  492   IDILSCIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLIKRGNNPALSWQLRFRIAAEI  551

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  552   GTGLLFLHQTKPEPLVHRDLKPGNILL  578


 Score =   227 bits (578),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 158/352 (45%), Positives = 212/352 (60%), Gaps = 63/352 (18%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ------------------HKQQLEAQN  131
            SQ A++W  EN++++GQ+VVL+HV  ++ ++                     KQQLE   
Sbjct  35   SQNALRWAAENVITRGQTVVLLHVVQKSSSTSSLAGNNALICDVSNPSQSPRKQQLEKMT  94

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
            KDLF+TFHC+CTRK+I+CLDI+++ TDIAKA+T+YVS AAIENLVLG+ ++H F+ R K 
Sbjct  95   KDLFLTFHCYCTRKDINCLDIVLEDTDIAKAVTEYVSYAAIENLVLGAPAKHGFI-RFKT  153

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            + IP+  SK APDFCTV+VISK KISSVRNA+R AP++SPL  Q+  + +Q+   P+   
Sbjct  154  SSIPSSVSKGAPDFCTVYVISKGKISSVRNASRAAPYSSPLVNQIDSLNKQSFKPPETPR  213

Query  489  KNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
             N    L                            TRG      +     E +SD+SF+S
Sbjct  214  YNNILGL----------------------------TRGGFSNGRISGGFSESESDISFIS  245

Query  669  SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEND  845
            S  R S DR SS   + +++ R  R+S+SSD SFGS   G K  DL+S  DFSS S E++
Sbjct  246  S-ERASTDRASSVTYDFMDTNRG-RISTSSDQSFGSMHQGPKFADLSSLHDFSSVSHESN  303

Query  846  ------------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                        E E EMRRLKLEL++TMD+YSTAC+EAL+AKQK  EL  W
Sbjct  304  LTSSSWSSQNLEEVESEMRRLKLELKQTMDMYSTACREALSAKQKEMELHNW  355



>gb|EYU22082.1| hypothetical protein MIMGU_mgv1a001807mg [Erythranthe guttata]
Length=757

 Score =   273 bits (697),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE+F++SRKIGEGGYGPV+KC LDHT VAVKVLRPDA QGR QFQQE
Sbjct  431   RYRKYTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATQGRSQFQQE  490

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VEILSC+RHPNMV+LLGACPEYGCLVYEYM+ GS+DD L  RG  PPLSWQ RFRI+AE+
Sbjct  491   VEILSCIRHPNMVLLLGACPEYGCLVYEYMSSGSLDDCLFKRGKNPPLSWQHRFRISAEI  550

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  551   GTGLLFLHQTKPEPLVHRDLKPGNILL  577


 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 129/351 (37%), Positives = 180/351 (51%), Gaps = 56/351 (16%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQ-----------------TQTSLQHKQQLEAQNK  134
            SQ A+KW  +NLL KGQ+V+LVHV  +                   T        EA  K
Sbjct  29   SQIALKWAVDNLLVKGQTVILVHVKVKQPPSGFSPSPSLGGAWSNMTDPNEDAGDEALLK  88

Query  135  DLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVT  311
            +LF+ F  FCTRK+I+C DI++D TD+ +A+ ++V  + I+ LVLG++ + + + R K  
Sbjct  89   ELFLPFRVFCTRKDINCYDIVLDDTDVTRAIVEFVKQSTIDVLVLGATVKGNSIFRFKAK  148

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN------  473
            DIP    K APDFC V+VI+K KISS R A+RP P  S   P   +I  QA +       
Sbjct  149  DIPGSVLKGAPDFCNVYVINKGKISSTRAASRPPP--SIFSPLRNQILSQANSKFYGSDP  206

Query  474  -----PDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETV  638
                       +     R   E   R+ +  E+  +  P   R A  G         +  
Sbjct  207  PMPSSTSSSRSSYSGHSRPGSEPSPRA-RQNEANFIKSPFSHRKAPNG------KAYDLS  259

Query  639  EGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTD  818
              D+D+SFVSS  R S D   +F SE+ +   TP             RL   +D + +  
Sbjct  260  PPDNDISFVSS--RRSVDMFPTF-SESYDGAPTP------------PRLSGFSDAD-YQG  303

Query  819  FSSSS--LENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            F S S   ++DE E EMRRLK EL++TM++YSTACKEAL+A++K  ELQRW
Sbjct  304  FDSWSHGRKSDEVEAEMRRLKQELKQTMEMYSTACKEALSAREKAKELQRW  354



>ref|XP_009616384.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Nicotiana tomentosiformis]
Length=789

 Score =   273 bits (698),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE AT++F+++RKIGEGGYGPV+KC LDHT VAVKVLRPDAA GR+QFQQE
Sbjct  459   RYRKYTIEEIESATDYFAQTRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAHGRQQFQQE  518

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS++DRL +RG  PPLSWQ RFRIAAE+
Sbjct  519   VEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFHRGKTPPLSWQQRFRIAAEI  578

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ+KP+P+VHRDLKPGNILL
Sbjct  579   ATGLLFLHQSKPEPLVHRDLKPGNILL  605


 Score =   171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 139/360 (39%), Positives = 193/360 (54%), Gaps = 47/360 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD-NQTQTSLQH----------------KQQLEAQNK  134
            SQ A+KWT ++LL++GQ+V+L+HV   Q+ TS                     +L+ Q K
Sbjct  30   SQIALKWTVDHLLARGQTVLLIHVKLKQSATSTGQSTPTKSNQISDEAGSGNSELDPQTK  89

Query  135  DLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTD  314
            +LF+ F  FCTRK++ C D+++D TD+ KA+ +YV+   IE L+LG++    L R K  D
Sbjct  90   ELFLPFRVFCTRKDVQCHDVVLDDTDVVKAIVEYVNRTGIEVLILGATTRGGLLRFKAKD  149

Query  315  IPTLTSKAAPDFCTV-FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK  491
            IP    K  PDFCTV  +   +KI+S R A+RPAPF  PL  QL +         +  T 
Sbjct  150  IPGGILKGVPDFCTVHVISKSAKIASTRAASRPAPFVHPLRHQLMQPASTKFAPFEGSTP  209

Query  492  NAPSSLRSFDEKHM------RSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            +A SS   F            S    ++ ++  P   R    G P       E    D+D
Sbjct  210  SAASSRGPFSGGPKPVCDPPPSTLQSDTMNIKSPFTHRKGPNGKP------YEISLPDTD  263

Query  654  LSFVSSGSRPSGDRMSSFLSETVESG--RTPRLssss---dgsfgsgRLGKGN-DLNSFT  815
            +S+VSSG RPS D + S  S+  + G    PRLS  S     SF S + G+ + D  +  
Sbjct  264  ISYVSSG-RPSIDNIYSSFSDGYDGGGPTPPRLSGFSDFETQSFDSTQFGRRSVDTLTPP  322

Query  816  DFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + S SS+E+          D+ E EMRRLK EL++TM+LYSTAC+EALTAKQK  ELQRW
Sbjct  323  ELSHSSIESDRPSVSQGPVDDMEAEMRRLKQELKQTMELYSTACREALTAKQKAMELQRW  382



>gb|EPS69919.1| hypothetical protein M569_04840, partial [Genlisea aurea]
Length=714

 Score =   271 bits (694),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +3

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
             P+RYRRYTI+EIEEAT  FSES KIGEGGYGPVFKC LDHT VAVKVLRPDAAQG+ QF 
Sbjct  422   PLRYRRYTIEEIEEATMFFSESLKIGEGGYGPVFKCHLDHTPVAVKVLRPDAAQGKIQFH  481

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             QEVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA GS++DRL+ RGN  PLSWQVRFRIAA
Sbjct  482   QEVEVLSCLRHPNMVLLLGACPEYGCLVYEYMAKGSLEDRLIRRGNTQPLSWQVRFRIAA  541

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGL FLHQ KP+P+VHRDLKP NILL
Sbjct  542   EVATGLQFLHQTKPEPLVHRDLKPANILL  570


 Score =   228 bits (580),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 215/339 (63%), Gaps = 24/339 (7%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHV-------------DNQTQTSLQHKQQLEAQNKDLF  143
            +SQYA++W  +NL++KGQ+++L+HV             ++  +T+    + L+   + +F
Sbjct  20   SSQYALRWAIDNLVAKGQTIILIHVVRNSSNCKDDSGVNDLVETTSADVESLDDHTRQIF  79

Query  144  VTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPT  323
            VTFHCFCTRK+I+C +++++  DI++A+ +YV+ AAIENLVLG+SRH FL++LK+ D+P 
Sbjct  80   VTFHCFCTRKDINCFNVVLEDADISRAIVEYVAHAAIENLVLGASRHGFLRKLKMVDVPN  139

Query  324  LTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAP-  500
               KA+PDFCT +VIS+SKISSVRNA+R APF SPL  QL + Q+    +    T   P 
Sbjct  140  SICKASPDFCTAYVISRSKISSVRNASRAAPFTSPL--QLHQTQKTIGTSLSSSTCPIPR  197

Query  501  --SSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSG  674
              S+ R  +   ++    ++ +S++         RG  P  +   +  E DSD+SFVSS 
Sbjct  198  HMSTARGIERTPLKPH-FDDGDSLNCNRSPFCKIRGHSPSML--PDLHESDSDISFVSS-  253

Query  675  SRPSGDRMSSFLSETVESGRT--PRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDE  848
            +RPS D       +  +S R      SS S     +    K ++L+S TDFSSSSLEND+
Sbjct  254  NRPSTDTCMDLNFDGTDSWRNSNASTSSESSFGSSTRSWTKFSELSSGTDFSSSSLENDD  313

Query  849  AEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             E EMRRLK+ELQKTM++YSTAC+EALTAK K  EL RW
Sbjct  314  GEAEMRRLKIELQKTMEMYSTACREALTAKHKAVELHRW  352



>ref|XP_009118123.1| PREDICTED: U-box domain-containing protein 52-like [Brassica 
rapa]
Length=751

 Score =   272 bits (696),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T++F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  422   VRYRKYTVHEIEEGTDNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  481

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  482   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMARGSLDDRLFRRGNTPPISWQLRFRIAAE  541

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  542   IATGLLFLHQTKPEPIVHRDLKPGNVLL  569


 Score =   219 bits (558),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 218/347 (63%), Gaps = 51/347 (15%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TS+ A+KWT ENL ++GQ++ L+HV  ++Q+S        H Q ++ Q KDLFV+FHC+C
Sbjct  27   TSKIALKWTLENLTTRGQTLALIHVAPKSQSSSDIEDGTMHMQHMDKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I CLD+L++  D  KA+ +YV+ +AIENLVLG+ SR SF++R K TD+PT  SKAA
Sbjct  87   SRKEIQCLDVLLEDVDKVKAIVEYVTISAIENLVLGAPSRSSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI-RTKNAPSSLRSF  518
            PDFC V+VISK K+SS+R+++RPAP+    HP +       +N P I  T  +P + RS 
Sbjct  146  PDFCNVYVISKGKVSSLRSSSRPAPY----HPSVLS-DFDFENKPKIANTPASPRARRSV  200

Query  519  DEK-------HMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGS  677
            D++       HM+    + S+S S  S   A+ +G               S+ SF+SSG+
Sbjct  201  DKRFTKPPQGHMKLIG-DFSDSESEYSFISASHQG---------------SENSFISSGT  244

Query  678  RPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEN----  842
              S DR  SF  +  +S RT R+S+SS+ S GS RLG K  DL    + S+ S E+    
Sbjct  245  PSSADR-CSFSYDLPDSARTSRMSTSSEQSIGSHRLGIKFTDLGFLNNSSTVSEESGRTS  303

Query  843  --------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
                    D+ E +MRRL+LEL++TMD+YS+ACKEALTA+Q+ +EL+
Sbjct  304  CSYSSQSLDDVESQMRRLRLELKQTMDMYSSACKEALTARQEATELK  350



>ref|XP_004501223.1| PREDICTED: U-box domain-containing protein 34-like [Cicer arietinum]
Length=794

 Score =   273 bits (698),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V +RYR+YTI+EIE AT  FS+S KIGEGGYGPVFKC+LDHT VAVKVLRPDAAQGR QF
Sbjct  454   VDIRYRKYTIEEIEAATNFFSQSLKIGEGGYGPVFKCLLDHTPVAVKVLRPDAAQGRSQF  513

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIA  1430
             Q+EVE+LSC+RHPNMV+LLGACPEYGCLVYEY+++GS+DD L ++GN PPLSWQ RF+IA
Sbjct  514   QREVEVLSCIRHPNMVLLLGACPEYGCLVYEYLSNGSLDDCLFHKGNSPPLSWQRRFKIA  573

Query  1431  AEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AE+ TGLLFLHQ KP+PIVHRDLKPGNILL
Sbjct  574   AEISTGLLFLHQTKPEPIVHRDLKPGNILL  603


 Score =   199 bits (507),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 207/360 (58%), Gaps = 48/360 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDN---------------------QTQTSLQHKQQLE  122
            SQ A+KW  +NLLS+  +V+L+HV                        +  SL   ++ E
Sbjct  29   SQNALKWAIDNLLSRNSTVILIHVKVLAPFLSPSPSLFTLRSGISILNSNESLTIGKEAE  88

Query  123  AQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKR  299
             QNK++F+ +  FCTRK+I C D+L++  D++KAL +Y + A IE+LVLGSS + S LKR
Sbjct  89   TQNKNIFLPYRVFCTRKDIQCKDVLLEDADVSKALIEYATQAGIEHLVLGSSAKTSLLKR  148

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQE-QAQNNP  476
             KV+DIP   SK APDFCTV+VI K KI S+R+A+RPAP  SPL      I   Q+  N 
Sbjct  149  FKVSDIPGTVSKGAPDFCTVYVIGKGKIHSMRSASRPAPTISPLQVNPTTITPYQSDTNV  208

Query  477  DIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDL  656
             +          SFD+        + +ES + P       +G   ++ +  E+   DSD+
Sbjct  209  VLSHSEKEQERHSFDDGAPHKSH-DGTESFTSPFTR----KGYNGKQYM--ESSMTDSDI  261

Query  657  SFVSSGSRPSGDRMSSFLSETVESGRT-PRLssssd--gsfgsgRLGKGNDLNSFT---D  818
            SF+S+G R S DRM   L    E+G + PRLSSSS+  G++    + +G   + F+   +
Sbjct  262  SFISTG-RASIDRMLPPLCNNSEAGMSNPRLSSSSEPDGNYSFESIYQGKMSSDFSIPPE  320

Query  819  FSSSSLEN-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            F+S S ++           D+ E EMRRLKLEL++TM++Y+TACKEALTA+QK  ELQRW
Sbjct  321  FTSLSFDSERLSSSSSQAVDDMEAEMRRLKLELKQTMEMYNTACKEALTAQQKAVELQRW  380



>ref|XP_009801055.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Nicotiana sylvestris]
Length=788

 Score =   273 bits (697),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE AT++F+++RKIGEGGYGPV+KC LDHT VAVKVLRPDAA GR+QFQQE
Sbjct  458   RYRKYTIEEIESATDYFAQTRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAHGRQQFQQE  517

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS++DRL +RG  PPLSWQ RFRIAAE+
Sbjct  518   VEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFHRGKTPPLSWQQRFRIAAEI  577

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ+KP+P+VHRDLKPGNILL
Sbjct  578   ATGLLFLHQSKPEPLVHRDLKPGNILL  604


 Score =   171 bits (432),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 138/371 (37%), Positives = 195/371 (53%), Gaps = 70/371 (19%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV------DNQTQTSLQHKQ----------QLEAQNKD  137
            SQ A+KWT ++LL++GQ+V+L+HV      ++  Q+  +  Q          +L+ Q K+
Sbjct  30   SQIALKWTVDHLLARGQTVLLIHVKLKQSANSSGQSPTKSNQISDEAGSGNSELDPQTKE  89

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDI  317
            LF+ F  FCTRK++ C D+++D TD+ KA+ +YV+   IE L+LG++    L R KV DI
Sbjct  90   LFLPFRVFCTRKDVQCHDVVLDDTDVVKAIVEYVNRTGIEVLILGATTRGGLLRFKVKDI  149

Query  318  PTLTSKAAPDFCTV-FviskskissvRNATRPAPFASPLHPQLQE---------------  449
            P    K  PDFCTV  +    KI+S R A+RPAPF  PL  QL +               
Sbjct  150  PGGILKGVPDFCTVHVISKSGKIASTRAASRPAPFVHPLRHQLMQPASTKFAPFEGSTPS  209

Query  450  ---IQEQAQNNPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRM  620
                +      P       PS+L+S            ++ ++  P   R    G P    
Sbjct  210  AASARGPYSGGPKPVCDPPPSTLQS------------DTMNIKSPFTHRKGPNGKP----  253

Query  621  LGAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESG--RTPRLssss---dgsfgsgRL  785
               E    D+D+S+VSSG RPS D + S  S+  + G    PRLS  S     SF S + 
Sbjct  254  --YEISLPDTDISYVSSG-RPSIDNIYSSFSDGYDGGGPTPPRLSGFSDFETQSFDSTQF  310

Query  786  GKGN-DLNSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALT  932
            G+ + D  +  + S SS+E+          D+ E EMRRLK EL++TM+LYSTAC+EALT
Sbjct  311  GRRSVDTLTPPELSLSSIESDRPSISQGPVDDMEAEMRRLKQELKQTMELYSTACREALT  370

Query  933  AKQKTSELQRW  965
            AKQK  ELQRW
Sbjct  371  AKQKAMELQRW  381



>emb|CDY50990.1| BnaA09g56190D [Brassica napus]
Length=751

 Score =   272 bits (695),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T++F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  422   VRYRKYTVHEIEEGTDNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  481

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  482   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMARGSLDDRLFRRGNTPPISWQLRFRIAAE  541

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  542   IATGLLFLHQTKPEPIVHRDLKPGNVLL  569


 Score =   219 bits (557),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 218/347 (63%), Gaps = 51/347 (15%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TS+ A+KWT ENL ++GQ++ L+HV  ++Q+S        H Q ++ Q KDLFV+FHC+C
Sbjct  27   TSKIALKWTLENLTTRGQTLALIHVAPKSQSSSDIEDGTMHMQHMDKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I CLD+L++  D  KA+ +YV+ +AIENLVLG+ SR SF++R K TD+PT  SKAA
Sbjct  87   SRKEIQCLDVLLEDVDKVKAIVEYVTISAIENLVLGAPSRSSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI-RTKNAPSSLRSF  518
            PDFC V+VISK K+SS+R+++RPAP+    HP +       +N P I  T  +P + RS 
Sbjct  146  PDFCNVYVISKGKVSSLRSSSRPAPY----HPSVLS-DFDFENKPKIANTPASPRARRSV  200

Query  519  DEK-------HMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGS  677
            D++       HM+    + S+S S  S   A+ +G               S+ SF+SSG+
Sbjct  201  DKRFTKPPQGHMKLIG-DFSDSESEYSFISASHQG---------------SENSFISSGT  244

Query  678  RPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEN----  842
              S DR  SF  +  +S RT R+S+SS+ S GS RLG K  DL    + S+ S E+    
Sbjct  245  PSSADR-CSFSYDLPDSARTSRMSTSSEQSIGSHRLGIKFTDLGFLNNSSTVSEESGRTS  303

Query  843  --------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
                    D+ E +MRRL+LEL++TMD+YS+ACKEALTA+Q+ +EL+
Sbjct  304  CSYSSQSLDDVESQMRRLRLELKQTMDMYSSACKEALTARQEATELK  350



>ref|NP_001185432.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
 gb|AEE36182.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=754

 Score =   272 bits (695),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+DEIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  431   VRYRKYTVDEIEEATSNFAESQKVGEGGYGPVFRGFLDHTSVAVKVLRPDAAQGRSQFQK  490

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  491   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  550

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  551   IATGLLFLHQTKPEPIVHRDLKPGNVLL  578


 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 222/346 (64%), Gaps = 39/346 (11%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-------QHKQQLEAQNKDLFVTFHCFC  164
            SQ+A+KWT +NL S+GQ++ L+HV  ++ +S        Q KQQ+E   KDLFV+FHC+C
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVLCRSHSSSDLEEGTPQQKQQMEKIAKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+C DIL++  D  +A+T+YVS +AIENLV+GS SR+ F++R K TD+PT  SK+A
Sbjct  88   SRKEINCRDILLEDADKVRAITEYVSSSAIENLVVGSASRNGFMRRFK-TDLPTTVSKSA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK--NAPSSLRS  515
            PDFC V+VISK KI+SVRNA+RPAP+ + +  Q  EI     + PD   K  + P+S  S
Sbjct  147  PDFCNVYVISKGKIASVRNASRPAPYQNSM--QQCEIDNHHPHTPDKAPKYHDHPNSAGS  204

Query  516  FDEKHMRSFKLEESESVSRPSI-----ERAATRGIPPRRMLGAETVEGDSDLSFVSSGSR  680
               +  +S + + S  V R          +    I P       +   DSD+SF+SSG R
Sbjct  205  TPSRPRKSVEADRSPLVKRKPYGDFYDSDSDLSFISP-------SSHRDSDISFISSG-R  256

Query  681  PSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGND---LNSFTDFSS-------  827
            PS +R SSF  +  ES RT R+S+SS+ S GS RLG K +D   LN  + FS        
Sbjct  257  PSVER-SSFSLDFPESARTSRMSTSSEQSIGSNRLGIKFSDPDFLNESSTFSEESGRTSS  315

Query  828  -SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  316  YSSQSLDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQK  361



>ref|XP_006404968.1| hypothetical protein EUTSA_v10000051mg [Eutrema salsugineum]
 gb|ESQ46421.1| hypothetical protein EUTSA_v10000051mg [Eutrema salsugineum]
Length=801

 Score =   273 bits (697),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  476   VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  535

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  536   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  595

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  596   IGTGLLFLHQAKPEPLVHRDLKPGNILL  623


 Score =   207 bits (526),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 151/372 (41%), Positives = 212/372 (57%), Gaps = 52/372 (14%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV             + +   L     L     E  +
Sbjct  30   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQDSSLVCRDPEGAS  89

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K++F+ F CFCTRK+I C D+L++  D+AKAL +Y + AAIE LV+GSS +  FL+  K 
Sbjct  90   KEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKP  149

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            TDIP   +K APDFCTV+VISK KIS++R+A+R AP  +PL   +Q    +        +
Sbjct  150  TDIPGTIAKTAPDFCTVYVISKGKISTMRSASRSAPTTAPLRSPIQPPSLKPPQPVPSTS  209

Query  489  KNAPSSLRSFDEKHMRSFKLEESESV---SRPSIERAATRGI--------PPRRMLGAET  635
             N  +  RSF+ +  RS + ++  S+    R S+E    R +         P    G   
Sbjct  210  TNMRAERRSFESQQRRSMEEQQRRSMEDQQRRSMEDQQRRSMEDQSESFRSPFTRRGYGR  269

Query  636  VEGD-----SDLSFVSSGSRPSGDRMSSFLSETVESGRTP-RLssssdgsfgsgRLGKGN  797
              GD     SD+SFVSSG RPS DR+   + +  +  RTP RLS+ SD  +        N
Sbjct  270  SYGDLSVPESDISFVSSG-RPSIDRIFPNIYDNNDPNRTPPRLSNFSDMDYSPSIDQSSN  328

Query  798  ------DLNSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEAL  929
                  D++S TD+SS S ++          D+ E EMRRLKLEL++T+++YSTACKEAL
Sbjct  329  YGRRSVDISSPTDYSSGSFDSNERFSSASAMDDVESEMRRLKLELKQTIEMYSTACKEAL  388

Query  930  TAKQKTSELQRW  965
            TAKQK +ELQRW
Sbjct  389  TAKQKATELQRW  400



>ref|XP_010106940.1| U-box domain-containing protein 35 [Morus notabilis]
 gb|EXC12822.1| U-box domain-containing protein 35 [Morus notabilis]
Length=769

 Score =   272 bits (695),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESRKIGEGGYGPV++C L HT VA+KVLRPDAAQGR QFQQ
Sbjct  430   IRYRKYTIEEIEMATEDFSESRKIGEGGYGPVYRCELGHTPVAIKVLRPDAAQGRSQFQQ  489

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+GCLVYEYMAHGS++DRL  RGN P L WQ+RFRI+AE
Sbjct  490   EVEVLSCIRHPNMVLLLGACPEFGCLVYEYMAHGSLEDRLFRRGNTPVLPWQLRFRISAE  549

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  550   IGTGLLFLHQTKPEPLVHRDLKPANILL  577


 Score =   180 bits (456),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 136/360 (38%), Positives = 202/360 (56%), Gaps = 69/360 (19%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQT------------------SLQHKQQLEAQ  128
            +SQYA+KWT ++L+++GQ+VVL+H+ N+  +                  +  +KQQLE Q
Sbjct  26   SSQYALKWTVDHLITRGQTVVLLHIKNRASSVPNPFGNFVSVNEVSEDVARTYKQQLENQ  85

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLK  305
             KDLF+ F CFCTRK+I C +++++  DI+KA+ +YVS  +IE LVLG +SR+S +KR K
Sbjct  86   AKDLFLPFRCFCTRKDIKCDEVILEDLDISKAIINYVSANSIETLVLGAASRNSLVKRFK  145

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
             TD+P+  S+ AP+FCTV+VI+K KISSVR+A+ PAP  S            + + P  +
Sbjct  146  TTDVPSSVSRGAPEFCTVYVIAKGKISSVRSASSPAPTRS----NSSRYNSHSSHPPRDQ  201

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
             +   +  +  DE   RS      + ++  S E            L  ET     D+S+V
Sbjct  202  RQLNHTPHQQHDEMDFRS-PFARGKGLTNKSYE------------LSPET-----DISYV  243

Query  666  SSGSRPSGDRMSSFLSETVE-SGRTPRLssssdgsfgsgRL--------GKGNDLNS---  809
            S G RPS       L ++++  G +P  S+SSD                 K  D+ S   
Sbjct  244  SHG-RPS-------LYDSIDFQGMSPSFSTSSDFDAPRSSFTSSSPFSGNKSIDITSSHY  295

Query  810  -FTDFSSSSLEN-------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             FTD+S+ S  +       D+ + EM+RL+LEL++TMD+YS+ACKEALTAK+   EL RW
Sbjct  296  DFTDYSNDSTNSSSSQNNVDDVDAEMKRLRLELKQTMDMYSSACKEALTAKKTAIELHRW  355



>ref|XP_011082098.1| PREDICTED: U-box domain-containing protein 34-like isoform X3 
[Sesamum indicum]
Length=634

 Score =   269 bits (688),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE+F++SRKIGEGGYGPV+KC LDHT VAVKVLRPDA  GR QFQQE
Sbjct  308   RYRKYTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATHGRSQFQQE  367

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VEILSC+RHPNMV+LLGACPEYGCLVYEYM++GS++D L+ RG  PPLSWQ RFRIAAE+
Sbjct  368   VEILSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLVQRGKTPPLSWQHRFRIAAEI  427

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  428   GTGLLFLHQTKPEPLVHRDLKPANILL  454


 Score = 90.9 bits (224),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 121/252 (48%), Gaps = 53/252 (21%)
 Frame = +3

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAP-FASPLHPQLQEIQEQAQNNPDI  482
            + DI     K  PDFCTV+VI K KISS + A RPAP   SPL  Q+  +Q  ++ N   
Sbjct  1    MKDIAGTVLKGVPDFCTVYVIHKGKISSTKAACRPAPSILSPLRNQIM-LQANSKYNGMD  59

Query  483  RTKNAPSSLRSFDEKHMRS-------FKLEESESVSRPSIERAATRGIPPRRMLGAETVE  641
            ++  + ++ RS    H R         +  +S  +  P   R A  G         E   
Sbjct  60   QSMGSSANSRSSVTGHSRPGSEPSPRARQNDSNFIKSPFTHRRAPNG------KAYELST  113

Query  642  GDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNS----  809
             ++D+SFVSSG R S D   ++ SE+ E   TP             RL   +D++S    
Sbjct  114  PETDISFVSSGRR-SVDVYPTY-SESFEGSLTP------------PRLSGFSDVDSQGYD  159

Query  810  -FT-------------------DFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEAL  929
             +T                   D + S    DE E EMRRLK EL++TMD+YSTACKEAL
Sbjct  160  SWTTGRRSLDILPLDLAASPEPDKAFSGQTMDEVEAEMRRLKQELKQTMDMYSTACKEAL  219

Query  930  TAKQKTSELQRW  965
            +A++K  ELQRW
Sbjct  220  SAREKAKELQRW  231



>ref|XP_009616383.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Nicotiana tomentosiformis]
Length=811

 Score =   273 bits (697),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE AT++F+++RKIGEGGYGPV+KC LDHT VAVKVLRPDAA GR+QFQQE
Sbjct  481   RYRKYTIEEIESATDYFAQTRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAHGRQQFQQE  540

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS++DRL +RG  PPLSWQ RFRIAAE+
Sbjct  541   VEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFHRGKTPPLSWQQRFRIAAEI  600

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ+KP+P+VHRDLKPGNILL
Sbjct  601   ATGLLFLHQSKPEPLVHRDLKPGNILL  627


 Score =   162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 193/382 (51%), Gaps = 69/382 (18%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD-NQTQTSLQH-------------------------  107
            SQ A+KWT ++LL++GQ+V+L+HV   Q+ TS                            
Sbjct  30   SQIALKWTVDHLLARGQTVLLIHVKLKQSATSTGQSTPTTCLDLDCPMDYLLSDLTETCD  89

Query  108  -------------KQQLEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDA  248
                           +L+ Q K+LF+ F  FCTRK++ C D+++D TD+ KA+ +YV+  
Sbjct  90   TESNQISDEAGSGNSELDPQTKELFLPFRVFCTRKDVQCHDVVLDDTDVVKAIVEYVNRT  149

Query  249  AIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTV-FviskskissvRNATRPAPFAS  425
             IE L+LG++    L R K  DIP    K  PDFCTV  +   +KI+S R A+RPAPF  
Sbjct  150  GIEVLILGATTRGGLLRFKAKDIPGGILKGVPDFCTVHVISKSAKIASTRAASRPAPFVH  209

Query  426  PLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHM------RSFKLEESESVSRPSIER  587
            PL  QL +         +  T +A SS   F            S    ++ ++  P   R
Sbjct  210  PLRHQLMQPASTKFAPFEGSTPSAASSRGPFSGGPKPVCDPPPSTLQSDTMNIKSPFTHR  269

Query  588  AATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESG--RTPRLssss-  758
                G P       E    D+D+S+VSSG RPS D + S  S+  + G    PRLS  S 
Sbjct  270  KGPNGKP------YEISLPDTDISYVSSG-RPSIDNIYSSFSDGYDGGGPTPPRLSGFSD  322

Query  759  --dgsfgsgRLGKGN-DLNSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMD  899
                SF S + G+ + D  +  + S SS+E+          D+ E EMRRLK EL++TM+
Sbjct  323  FETQSFDSTQFGRRSVDTLTPPELSHSSIESDRPSVSQGPVDDMEAEMRRLKQELKQTME  382

Query  900  LYSTACKEALTAKQKTSELQRW  965
            LYSTAC+EALTAKQK  ELQRW
Sbjct  383  LYSTACREALTAKQKAMELQRW  404



>gb|AAC17071.1| Similar to protein serine/threonine kinase NPK15 gb|D31737 from 
Nicotiana tabacum [Arabidopsis thaliana]
Length=772

 Score =   272 bits (695),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+DEIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  452   VRYRKYTVDEIEEATSNFAESQKVGEGGYGPVFRGFLDHTSVAVKVLRPDAAQGRSQFQK  511

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  512   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  571

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  572   IATGLLFLHQTKPEPIVHRDLKPGNVLL  599


 Score =   217 bits (552),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 222/358 (62%), Gaps = 42/358 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-------QHKQQLEAQNKDLFVTFHCFC  164
            SQ+A+KWT +NL S+GQ++ L+HV  ++ +S        Q KQQ+E   KDLFV+FHC+C
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVLCRSHSSSDLEEGTPQQKQQMEKIAKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV--------TDI  317
            +RK I+C DIL++  D  +A+T+YVS +AIENLV+GS SR+ F++ L +        TD+
Sbjct  88   SRKEINCRDILLEDADKVRAITEYVSSSAIENLVVGSASRNGFMRILFLMTLSRRFKTDL  147

Query  318  PTLTSKAAPDFCTVFviskskissvRNATRPAPFASPL--------HPQLQEIQEQAQNN  473
            PT  SK+APDFC V+VISK KI+SVRNA+RPAP+ + +        HP   +   +  ++
Sbjct  148  PTTVSKSAPDFCNVYVISKGKIASVRNASRPAPYQNSMQQCEIDNHHPHTPDKAPKYHDH  207

Query  474  PDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGI---PPRRMLGAETVEG  644
            P+          +S +    R++KL    S+  P ++R                + +   
Sbjct  208  PNSAGSTPSRPRKSVEADRYRNWKL-VVMSLRSPLVKRKPYGDFYDSDSDLSFISPSSHR  266

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGND---LNSF  812
            DSD+SF+SSG RPS +R SSF  +  ES RT R+S+SS+ S GS RLG K +D   LN  
Sbjct  267  DSDISFISSG-RPSVER-SSFSLDFPESARTSRMSTSSEQSIGSNRLGIKFSDPDFLNES  324

Query  813  TDFSS--------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
            + FS         SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  325  STFSEESGRTSSYSSQSLDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQK  382



>gb|KCW80744.1| hypothetical protein EUGRSUZ_C02137 [Eucalyptus grandis]
Length=732

 Score =   271 bits (693),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE ATE F ESRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QF Q
Sbjct  405   VRYRRYSIEEIENATEFFLESRKIGEGGYGPVYKCYLDHTLVAIKVLRPDAAQGRSQFLQ  464

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MA+GS+DDRL  RGN  PLSWQ+RF+IAA 
Sbjct  465   EVEVLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLDDRLFCRGNTRPLSWQLRFKIAAG  524

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  525   IGTGLLFLHQAKPEPLVHRDLKPGNILL  552


 Score =   217 bits (552),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 143/327 (44%), Positives = 196/327 (60%), Gaps = 31/327 (9%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQT--QTSLQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ A+KWT +NLL +GQ V+LVHV  ++     L    + E   K+LF+ F CFCTRK+I
Sbjct  27   SQNALKWTIDNLLQRGQVVILVHVKVKSLPTAPLGSSPRHELDPKELFLPFRCFCTRKDI  86

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHS-FLKRLKVTDIPTLTSKAAPDFCT  356
             C DIL++ TD+AKAL +YVS  +IENLVLGSS  S FL+  K TD+P+  +K APDFCT
Sbjct  87   QCKDILLEDTDVAKALIEYVSHNSIENLVLGSSSKSGFLRTFKATDVPSSVAKGAPDFCT  146

Query  357  VFviskskissvRNATRPAPFASPLHPQL--QEIQEQAQNNPDIRTKNAPSSLR--SFDE  524
            V+VI+K KI+++R+ATRPAP ASPL  Q+  Q +    Q+ P +   N+    R  + + 
Sbjct  147  VYVITKGKITTMRSATRPAPMASPLSNQIHNQLVPRAHQSEPRVPQTNSIRGERFCTLNL  206

Query  525  KHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSS  704
            + +  F                 TRG      L  E    D+D+SFVSSG R S DRM  
Sbjct  207  RFLSPF-----------------TRGKGSNGRLYGEVGTPDTDISFVSSG-RQSVDRMFP  248

Query  705  FLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLEL  884
               + ++ G +PRLS++S+  +      +G D       S  S   D+ E EM+RLK EL
Sbjct  249  SFYDNLDGGYSPRLSNTSNTDYR-----QGFDAALLAQRSVDS-SIDDVEAEMKRLKQEL  302

Query  885  QKTMDLYSTACKEALTAKQKTSELQRW  965
            ++TM++YS ACK+AL+AKQK  ELQ W
Sbjct  303  KQTMEMYSKACKDALSAKQKAIELQHW  329



>ref|XP_007014562.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 2 [Theobroma cacao]
 gb|EOY32181.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 2 [Theobroma cacao]
Length=563

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI+EIE ATEHFS SRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQG  QF Q
Sbjct  219   LRYRRYTIEEIEAATEHFSPSRKIGEGGYGPVYKCNLDHTPVAIKVLRPDAAQGESQFHQ  278

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+G+++DRL  R N P L WQVRFRIAAE
Sbjct  279   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGNLEDRLFRRNNTPVLPWQVRFRIAAE  338

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  339   IATGLLFLHQTKPEPLVHRDLKPANILL  366


 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 69/124 (56%), Gaps = 21/124 (17%)
 Frame = +3

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDF-  821
            D D+SFVSSG RPS DRM   L + +E G TPRLS SSD    S   G     N   DF 
Sbjct  25   DCDISFVSSG-RPSTDRMFPSLYDNLEYG-TPRLSVSSDYDNRS--FGSSYSGNRSMDFS  80

Query  822  ----------------SSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
                            S SS   D+ E EMRRL+ EL++TMD+YS ACKEALTAKQ+  E
Sbjct  81   SSQYELSSSSLESGRTSWSSQNMDDVEAEMRRLRQELKQTMDMYSAACKEALTAKQRAKE  140

Query  954  LQRW  965
            L  W
Sbjct  141  LHSW  144



>emb|CDY70022.1| BnaCnng66370D, partial [Brassica napus]
Length=399

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  73    VRYRKYTVEEIEEATSNFDESKKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  132

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  +GN PP++WQ+RFRIAAE
Sbjct  133   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMQGNTPPITWQLRFRIAAE  192

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKP N+LL
Sbjct  193   IATGLLFLHQTKPEPIVHRDLKPANVLL  220



>ref|XP_002890187.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66446.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=757

 Score =   271 bits (694),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T +F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  433   VRYRKYTVQEIEEGTANFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  492

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  493   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  552

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  553   IATGLLFLHQTKPEPIVHRDLKPGNVLL  580


 Score =   235 bits (599),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 221/363 (61%), Gaps = 70/363 (19%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ------HKQQLEAQNKDLFVTFHCFC  164
            +SQ AIKWT ENL ++GQ++ L+HV  ++Q+SL       HKQQ+E Q KDLFV+FHCFC
Sbjct  27   SSQNAIKWTLENLATRGQTLALIHVLPKSQSSLDIEEGITHKQQMEKQTKDLFVSFHCFC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHCLD++++  D  KA+ +YV+ +AIENLVLG+ SR+SF++R K TD+PT  SK A
Sbjct  87   SRKEIHCLDVVLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFK-TDLPTSVSKTA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI------RTKNAPS  503
            PDFC V+VISK KISS+RNA+RPAP+    HP +  +  +  N+  I      +T N P+
Sbjct  146  PDFCNVYVISKGKISSLRNASRPAPY----HPSV--LLSEVDNHETIALERKHKTANTPA  199

Query  504  SLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGD------------  647
              R                   R S++   TR   P+   G   + GD            
Sbjct  200  LPR------------------GRRSVDSDGTRLGLPKPPHGHMKLVGDFSDSESEFSFIS  241

Query  648  -----SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNS  809
                 SDLSF+SSG RPS DR SSF  +  ES RT R+S+SS+ S GS RLG K  DL+ 
Sbjct  242  ASQQESDLSFISSG-RPSVDR-SSFTYDLPESARTSRMSTSSEQSIGSHRLGIKFTDLSY  299

Query  810  F------------TDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
                         T  S SS   D+ E +MRRL+LEL++TMD+YS+AC+EALTA+ + +E
Sbjct  300  LNGSSTVSDESGRTSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARHEATE  359

Query  954  LQR  962
            LQ+
Sbjct  360  LQK  362



>ref|XP_009801054.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Nicotiana sylvestris]
Length=810

 Score =   272 bits (696),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE AT++F+++RKIGEGGYGPV+KC LDHT VAVKVLRPDAA GR+QFQQE
Sbjct  480   RYRKYTIEEIESATDYFAQTRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAHGRQQFQQE  539

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS++DRL +RG  PPLSWQ RFRIAAE+
Sbjct  540   VEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDRLFHRGKTPPLSWQQRFRIAAEI  599

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ+KP+P+VHRDLKPGNILL
Sbjct  600   ATGLLFLHQSKPEPLVHRDLKPGNILL  626


 Score =   161 bits (407),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 193/393 (49%), Gaps = 92/393 (23%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------DNQTQTSL--------------------  101
            SQ A+KWT ++LL++GQ+V+L+HV          Q+ T+                     
Sbjct  30   SQIALKWTVDHLLARGQTVLLIHVKLKQSANSSGQSPTTCLDLDYPMDYLLSDLTETCDT  89

Query  102  ----------QHKQQLEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAA  251
                          +L+ Q K+LF+ F  FCTRK++ C D+++D TD+ KA+ +YV+   
Sbjct  90   ESNQISDEAGSGNSELDPQTKELFLPFRVFCTRKDVQCHDVVLDDTDVVKAIVEYVNRTG  149

Query  252  IENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTV-FviskskissvRNATRPAPFASP  428
            IE L+LG++    L R KV DIP    K  PDFCTV  +    KI+S R A+RPAPF  P
Sbjct  150  IEVLILGATTRGGLLRFKVKDIPGGILKGVPDFCTVHVISKSGKIASTRAASRPAPFVHP  209

Query  429  LHPQLQE------------------IQEQAQNNPDIRTKNAPSSLRSFDEKHMRSFKLEE  554
            L  QL +                   +      P       PS+L+S            +
Sbjct  210  LRHQLMQPASTKFAPFEGSTPSAASARGPYSGGPKPVCDPPPSTLQS------------D  257

Query  555  SESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESG-  731
            + ++  P   R    G P       E    D+D+S+VSSG RPS D + S  S+  + G 
Sbjct  258  TMNIKSPFTHRKGPNGKP------YEISLPDTDISYVSSG-RPSIDNIYSSFSDGYDGGG  310

Query  732  -RTPRLssss---dgsfgsgRLGKGN-DLNSFTDFSSSSLEN----------DEAEVEMR  866
               PRLS  S     SF S + G+ + D  +  + S SS+E+          D+ E EMR
Sbjct  311  PTPPRLSGFSDFETQSFDSTQFGRRSVDTLTPPELSLSSIESDRPSISQGPVDDMEAEMR  370

Query  867  RLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            RLK EL++TM+LYSTAC+EALTAKQK  ELQRW
Sbjct  371  RLKQELKQTMELYSTACREALTAKQKAMELQRW  403



>ref|XP_009106610.1| PREDICTED: U-box domain-containing protein 35 [Brassica rapa]
Length=758

 Score =   271 bits (694),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  427   VRYRKYTVEEIEEATSNFDESRKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  486

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  487   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  546

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  547   IATGLLFLHQTKPEPIVHRDLKPGNVLL  574


 Score =   213 bits (543),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 215/352 (61%), Gaps = 56/352 (16%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS--LQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ+A++WT ENL S+GQ++ L+HV +++ +S  ++  QQ +   KDL V+FHC+C+RK I
Sbjct  29   SQHALRWTIENLASRGQTISLIHVLSKSHSSSDIEDAQQGDKIAKDLLVSFHCYCSRKEI  88

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCT  356
            +C ++L++  D  +A+ ++VS + IENLV+G+ SR+SF++R K TD+PT  SK+APDFC 
Sbjct  89   NCQNVLLEDADKVRAIIEHVSTSGIENLVVGAPSRNSFMRRFK-TDLPTTVSKSAPDFCN  147

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
            V+VISK KI+SVRNATRPAPF S +  +  E + Q    P   + +A S           
Sbjct  148  VYVISKGKIASVRNATRPAPFKSSM--KSSEYENQQPVTPSDHSHSAVS-----------  194

Query  537  SFKLEESESVSRP--SIERAATRGIPPRRMLG--AETVEGDSDLSFVS------------  668
                    + SRP  S E   TR    RR +    +  + DSDLSF+S            
Sbjct  195  --------TPSRPSKSAEADTTRSPLGRRQVKPYGDLYDSDSDLSFISPSSHRESHDISF  246

Query  669  -SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-----KGNDLNSFTDFSS-  827
             S  RPS DR SSF  +  ESGR+ R+S+SS+ S GS RLG      G   +S T FS  
Sbjct  247  ISSGRPSVDR-SSFTLDFPESGRSSRISTSSEQSIGSHRLGIKFSDPGFPNDSSTTFSEE  305

Query  828  -------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                   SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ S LQ+
Sbjct  306  SGGTSSYSSQSVDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQASALQK  357



>gb|KFK42273.1| hypothetical protein AALP_AA2G234500 [Arabis alpina]
Length=766

 Score =   271 bits (694),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  435   VRYRKYTVEEIEEATSNFAESQKVGEGGYGPVFRGFLDHTSVAVKVLRPDAAQGRSQFQK  494

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  495   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFRRGNTPPITWQLRFRIAAE  554

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  555   IATGLLFLHQTKPEPIVHRDLKPGNVLL  582


 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 158/355 (45%), Positives = 220/355 (62%), Gaps = 53/355 (15%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV------DNQTQTSLQH-KQQLEAQNKDLFVTFHCFC  164
            SQ+A+KWT +NL S+GQ++ L+HV       + T+ S  H KQQ E  +KDLFV+FHC+C
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVVSRSYSSSDTEESTPHQKQQSEKSSKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+C DIL++  D  +A+ +YVS +AIENLV+G +SR+ F++R K TD+PT  SK+A
Sbjct  88   SRKEINCRDILLEDVDKVRAIIEYVSTSAIENLVVGAASRNGFMRRFK-TDLPTTLSKSA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK KI+SVRNA+RPAPF    H   Q +      +P    K +        
Sbjct  147  PDFCNVYVISKGKIASVRNASRPAPF----HHSTQSLDFDNNQHPVTPEKIS--------  194

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLG--AETVEGDSDLSFVS---------  668
             KH  +     + S  R S+E   TR    +R +    +  + DSDLSF+S         
Sbjct  195  -KHDHTNSAGHTPSRPRKSVEYDPTRSPLVKRQMKPYGDFYDSDSDLSFISPSSHRESDI  253

Query  669  ---SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-------NDLNSFTD  818
               S  RPS DR SSF  +  ESGR+ R+S+SS+ S GS RLG         ND ++F++
Sbjct  254  SFISSGRPSVDR-SSFTIDFPESGRSSRISTSSEQSIGSHRLGIKFSDPGLPNDSSTFSE  312

Query  819  -------FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                   +SS SL  D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  313  ESGRTSSYSSQSL--DDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQK  365



>ref|XP_009398619.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=725

 Score =   271 bits (692),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI++IE ATE+F+E+RKIGEGGYGPV++C LDHT VA+K LRPDA+QGR QFQQ
Sbjct  406   LRYRKYTIEDIEAATENFAENRKIGEGGYGPVYRCYLDHTPVAIKALRPDASQGRSQFQQ  465

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN PP+ WQ RFRIAAE
Sbjct  466   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLYRRGNTPPIPWQHRFRIAAE  525

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  526   IGTGLLFLHQTKPEPLVHRDLKPANILL  553


 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/332 (39%), Positives = 190/332 (57%), Gaps = 33/332 (10%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
            +SQ A+KW  +N+  KGQ++ LVHV   T+ S  H++ + +    L V F CFC RKN+ 
Sbjct  22   SSQNALKWALDNVAVKGQTIFLVHV--ITKLSAGHQEDVTSAASQLLVPFRCFCKRKNVR  79

Query  183  CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
            C DI+++ TD+AKA+ D+VS A +E L++G+S+  F++  + TD+ T   K+ PDFCTV+
Sbjct  80   CKDIILEDTDLAKAIVDFVSHAGVEKLIVGASKGGFVRSFRYTDVSTNICKSVPDFCTVY  139

Query  363  viskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD---IRTKNAPSSLRSFDEKHM  533
            +ISK KISS+RNA R AP  +PL  Q   I +Q  + P+    +         +F+ +++
Sbjct  140  IISKGKISSMRNAVRSAPVVTPLRSQ---ILKQPSSVPEPVVYQNSQGTKGNAAFETRNL  196

Query  534  RSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM-----  698
                 +E ES+  P       +    +     ET+ G SD  F SSG +PS D +     
Sbjct  197  ----YKEKESIRSPLNSTTRVQSTKSKE----ETMSG-SDEPFFSSG-KPSIDHLFPQRL  246

Query  699  ---SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRR  869
               S  L  + ES ++P     S     S R G     +  ++ S SS  ++E + EM R
Sbjct  247  SCISDGLDCSFESVQSPH---RSSLDAYSSRSG----FSPRSNGSFSSQMSEEVKAEMNR  299

Query  870  LKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            LKLEL++TMD+YSTAC+EALTAKQK  EL RW
Sbjct  300  LKLELKQTMDMYSTACREALTAKQKAMELHRW  331



>ref|XP_006468244.1| PREDICTED: U-box domain-containing protein 35-like [Citrus sinensis]
Length=775

 Score =   271 bits (694),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI++IEEAT+ F+ES KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  429   LRYRRYTIEDIEEATQFFTESLKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQR  488

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E+E+LSC+RHPNMV+LLGACPEYG +VYEY+A+GS+DDR+  RGN PPLSWQ RFRIAAE
Sbjct  489   EIEVLSCIRHPNMVLLLGACPEYGIIVYEYLANGSLDDRIFRRGNTPPLSWQQRFRIAAE  548

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  549   IATGLLFLHQTKPEPLVHRDLKPGNILL  576


 Score =   253 bits (646),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 221/343 (64%), Gaps = 38/343 (11%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ--------HKQQLEAQNKDLFVTFHC  158
            +SQ+A+KW  +NLL++GQ+VVL+HV  +T + +         H++Q + Q +DLF+TF C
Sbjct  27   SSQHALKWAADNLLNRGQTVVLIHVAQRTSSQVYDASATTNPHQKQPDKQIRDLFLTFRC  86

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSK  335
            +CTRK+I+C D+L++  DI KA+T+YVS AAIE+LVLG+ SRH F+++ K  D+P+  SK
Sbjct  87   YCTRKDINCFDVLLEDVDIVKAITEYVSFAAIEDLVLGAPSRHGFIRKFKA-DVPSSVSK  145

Query  336  AAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRS  515
            AAPDFC ++V+SK KISS RNA+R APF SPL  QL     Q+QN  DI    +  S+  
Sbjct  146  AAPDFCNIYVVSKGKISSKRNASRSAPFTSPLLDQL-----QSQN--DISDTQSRYSMNL  198

Query  516  FDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDR  695
             D    R  ++   ES   P    A  RG   +  +  ++ E D+D+SFVSSG RPS D 
Sbjct  199  RDRTSFRP-RMSFEESAKSP----ARGRGFDRKSFM--DSSESDTDISFVSSG-RPSSDH  250

Query  696  MSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS------------SSL  836
              S   E V+ GR  R+S+SS+ S GS RLG + ND +S  D SS            SS 
Sbjct  251  SPSMHYEFVDVGRNSRISTSSEHSLGSFRLGLRYNDRSSPYDLSSISQDSGATSCSCSSQ  310

Query  837  ENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
              DE E EMRRLKLEL++TMD+YSTACKEAL AKQK  ELQRW
Sbjct  311  NLDEVEAEMRRLKLELKQTMDMYSTACKEALVAKQKALELQRW  353



>ref|XP_006389938.1| hypothetical protein EUTSA_v10018168mg [Eutrema salsugineum]
 gb|ESQ27224.1| hypothetical protein EUTSA_v10018168mg [Eutrema salsugineum]
Length=764

 Score =   271 bits (693),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F+ES+K+GEGGYGPVFK  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  437   VRYRKYTVEEIEEATSNFAESQKVGEGGYGPVFKGFLDHTSVAVKVLRPDAAQGRSQFQK  496

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  497   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  556

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKP N+LL
Sbjct  557   IATGLLFLHQTKPEPIVHRDLKPANVLL  584


 Score =   227 bits (579),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 222/355 (63%), Gaps = 51/355 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-------QHKQQLEAQNKDLFVTFHCFC  164
            SQ+A+KWT +NL S+GQ++ L+HV +++ +S        Q KQQ E   KDLFV+FHC+C
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVLSKSHSSSDVEEATPQQKQQAEKLAKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+C DIL++  D  +A+ +YVS +AIENLV+G +SR+ F++R K TD+PT  SK+A
Sbjct  88   SRKEINCRDILLEDADKVRAIVEYVSASAIENLVVGAASRNGFMRRFK-TDLPTTVSKSA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK KI+SVRNA+RPAP+ + +  QL E   Q    P+   K+         
Sbjct  147  PDFCNVYVISKGKIASVRNASRPAPYQNSM--QLSEFDNQHPITPEKVPKH---------  195

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRR--MLG--AETVEGDSDLSFVS-------  668
              H  +     + S  R S+E  ATR    +R  M+    +  + DSDLSF+S       
Sbjct  196  --HDHTNSAGSTPSKPRKSVESDATRSPLVKRQGMMKPYGDLCDSDSDLSFISPSSHRDS  253

Query  669  -----SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGND---LNSFTDF  821
                 S  RPS DR SSF  +  ESGR+ R+S+SS+ S GS RLG K +D   LN  + F
Sbjct  254  DISFISSGRPSVDR-SSFTLDFPESGRSSRISTSSEQSIGSHRLGIKFSDPGFLNGSSTF  312

Query  822  SS--------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
            S         SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  313  SEESGRTSSYSSQSLDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQK  367



>emb|CDX81778.1| BnaC08g38230D [Brassica napus]
Length=733

 Score =   271 bits (692),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y++ EIEE T++F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  422   VRYRKYSVHEIEEGTDNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  481

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  482   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMARGSLDDRLFRRGNTPPISWQLRFRIAAE  541

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  542   IATGLLFLHQTKPEPIVHRDLKPGNVLL  569


 Score =   204 bits (519),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 210/353 (59%), Gaps = 63/353 (18%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TS+ A+KWT ENL S+GQ++ L+HV  ++Q+S        H Q ++ Q KDLFV+FHC+C
Sbjct  27   TSKIALKWTLENLTSRGQTLALIHVAPKSQSSSDIEDGTMHMQHMDKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I CLD+L++  D  KA+ +YV+ +AIENLVLG+ SR SF++R K TD+PT  SKAA
Sbjct  87   SRKEIQCLDVLLEDVDKVKAIVEYVTISAIENLVLGAPSRSSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK K+SS+R+++RPAP+    HP +       +N P I   N P S R   
Sbjct  146  PDFCNVYVISKGKVSSLRSSSRPAPY----HPSVLS-DFDFENKPKI--VNTPVSPR---  195

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPS-----  686
                            R S++   T+       L  +  + +S+ SF+S+  + S     
Sbjct  196  ---------------PRRSVDTRFTKPTQGHMKLIGDFSDSESEYSFISASHQGSENSFI  240

Query  687  -------GDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDL----NSFT-----  815
                    DR  S   +  +S RT R+S+SS+ S GS RLG K  DL    NS T     
Sbjct  241  SSGTSSSADR-CSLTYDLPDSARTSRMSTSSEQSIGSHRLGIKFTDLGFLNNSSTVSEDS  299

Query  816  -----DFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
                  +SS SL  D+ E +MRRL+LEL++TMD+YS+ACKEALTA+Q+ +EL+
Sbjct  300  GRTSCSYSSQSL--DDVEAQMRRLRLELKQTMDMYSSACKEALTARQEATELK  350



>ref|XP_009398618.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=734

 Score =   271 bits (692),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI++IE ATE+F+E+RKIGEGGYGPV++C LDHT VA+K LRPDA+QGR QFQQ
Sbjct  406   LRYRKYTIEDIEAATENFAENRKIGEGGYGPVYRCYLDHTPVAIKALRPDASQGRSQFQQ  465

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN PP+ WQ RFRIAAE
Sbjct  466   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLYRRGNTPPIPWQHRFRIAAE  525

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  526   IGTGLLFLHQTKPEPLVHRDLKPANILL  553


 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/332 (39%), Positives = 190/332 (57%), Gaps = 33/332 (10%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
            +SQ A+KW  +N+  KGQ++ LVHV   T+ S  H++ + +    L V F CFC RKN+ 
Sbjct  22   SSQNALKWALDNVAVKGQTIFLVHVI--TKLSAGHQEDVTSAASQLLVPFRCFCKRKNVR  79

Query  183  CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
            C DI+++ TD+AKA+ D+VS A +E L++G+S+  F++  + TD+ T   K+ PDFCTV+
Sbjct  80   CKDIILEDTDLAKAIVDFVSHAGVEKLIVGASKGGFVRSFRYTDVSTNICKSVPDFCTVY  139

Query  363  viskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD---IRTKNAPSSLRSFDEKHM  533
            +ISK KISS+RNA R AP  +PL  Q   I +Q  + P+    +         +F+ +++
Sbjct  140  IISKGKISSMRNAVRSAPVVTPLRSQ---ILKQPSSVPEPVVYQNSQGTKGNAAFETRNL  196

Query  534  RSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM-----  698
                 +E ES+  P       +    +     ET+ G SD  F SSG +PS D +     
Sbjct  197  ----YKEKESIRSPLNSTTRVQSTKSKE----ETMSG-SDEPFFSSG-KPSIDHLFPQRL  246

Query  699  ---SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRR  869
               S  L  + ES ++P     S     S R G     +  ++ S SS  ++E + EM R
Sbjct  247  SCISDGLDCSFESVQSPH---RSSLDAYSSRSG----FSPRSNGSFSSQMSEEVKAEMNR  299

Query  870  LKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            LKLEL++TMD+YSTAC+EALTAKQK  EL RW
Sbjct  300  LKLELKQTMDMYSTACREALTAKQKAMELHRW  331



>ref|XP_006382208.1| hypothetical protein POPTR_0006s29380g, partial [Populus trichocarpa]
 gb|ERP60005.1| hypothetical protein POPTR_0006s29380g, partial [Populus trichocarpa]
Length=784

 Score =   271 bits (694),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE AT++FS+S KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  469   VRYRRYSIEEIEAATDYFSQSLKIGEGGYGPVYKSYLDHTPVAIKVLRPDAAQGRSQFQQ  528

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L C+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL  RGN PPLSWQ+RFRIAAE
Sbjct  529   EVEVLCCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFCRGNSPPLSWQLRFRIAAE  588

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  589   IGTGLLFLHQTKPEPLVHRDLKPANILL  616


 Score =   205 bits (521),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 149/385 (39%), Positives = 206/385 (54%), Gaps = 84/385 (22%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHK----QQLEAQN-------KDLFVTF  152
            SQ A+KWT +NLL KGQ+V+L+HV+ ++  S  +      Q+   N       KDLF+ F
Sbjct  28   SQIALKWTIDNLLVKGQTVILIHVNLKSSLSSYYASPRLNQISDSNGTSSPDSKDLFLPF  87

Query  153  HCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLT  329
             CFCTRK+I+C D++++ TD+AKALT+YV+  AIE L++G S++  FL+R K  D+    
Sbjct  88   RCFCTRKDINCKDVVLEDTDVAKALTEYVTQTAIETLIVGASAKGGFLRRFKAADVAGSV  147

Query  330  SKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ----EQAQNNPDIR----  485
            SK APDFCTV+VI+K KI S+R A+R +P  S LH QL +          + P  R    
Sbjct  148  SKGAPDFCTVYVIAKGKIQSMRAASRSSPVNSSLHNQLNQNSTTPASMDAHTPRTRVKRG  207

Query  486  ----------------TKNAPSS-------LRSFDEK---HMRSFKLEESESVSRPSIER  587
                            +K+AP          +S  EK    +    + ++ES   P   R
Sbjct  208  QRFCFLLLFLCIYFPCSKSAPIDHLELLMYFQSVAEKPPLELPRKSVGDTESFRSPFTRR  267

Query  588  AATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgs  767
              T      +  G  +V  D+D+SFVSSG RPS DR+     +  E+ RTP         
Sbjct  268  GLT-----GKSYGELSVP-DTDISFVSSG-RPSIDRIFPAFYDNTETSRTP---------  311

Query  768  fgsgRLGKGNDLNSFTDFSS-----SSLENDE--------------AEVEMRRLKLELQK  890
                RL   +D++S   F S      SL+ DE               E EMRRLKLEL++
Sbjct  312  ---PRLSNFSDIDSNYSFESLHHGRKSLDQDEMQKLTCGAVKSQDDVEAEMRRLKLELKQ  368

Query  891  TMDLYSTACKEALTAKQKTSELQRW  965
            TM++YS+AC+EALTAKQKT ELQRW
Sbjct  369  TMEMYSSACREALTAKQKTRELQRW  393



>gb|AFX60112.1| phytophthora resistance protein RpsWD15-2 [Glycine max]
Length=602

 Score =   267 bits (683),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE AT  F+ES+KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  286   VRYRKYTIEEIEAATNFFTESQKIGEGGYGPVYKCHLDHTPVAVKVLRPDAAQGRSQFQR  345

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM +GS+DDRL  RGN  P+ WQ+RFRIAAE
Sbjct  346   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMPNGSLDDRLFCRGNTHPIPWQLRFRIAAE  405

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  406   IGTGLLFLHQTKPEPLVHRDLKPANILL  433


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 111/218 (51%), Gaps = 36/218 (17%)
 Frame = +3

Query  393  RNATRPAPFASPLHPQLQEIQEQAQNN----PDIRTKNAPSSLRSFDEKHMRSFKLEESE  560
            R+A+R AP  SPL  QL     ++ ++    P +     P   RSF+    RS   +++ 
Sbjct  2    RSASRAAPAFSPLQNQLSHASARSDHSEPRGPLVNGAKGPER-RSFEAPPRRS---QDAP  57

Query  561  SVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFL--------SE  716
              S      +  RG+  +     E    DSD+SFVSS  RPS D +   L        SE
Sbjct  58   RKSNDGTTDSFRRGMYDKSY--GEISVPDSDISFVSS-RRPSTDPLFPSLYNNNNNNHSE  114

Query  717  TVESGRTPRLssssdg-----sfgsgRLGKGN-DLNSFT--------DFSSSSLEN-DEA  851
            T  S   PRLS SSD      SF S   G+ + D++S            SSS+L   D+ 
Sbjct  115  TGIS--NPRLSYSSDTDGNNYSFESMHFGRRSMDISSDFSSFSQESEGLSSSALRGVDDV  172

Query  852  EVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            E EMRRLKLEL++T++LY+ A KEALTA+QK  ELQRW
Sbjct  173  EAEMRRLKLELKQTIELYNNAYKEALTAQQKAVELQRW  210



>ref|XP_010928974.1| PREDICTED: U-box domain-containing protein 35-like [Elaeis guineensis]
Length=777

 Score =   271 bits (694),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE+FSE RKIGEGGYGPV+K  LDHTA A+KVLRPDAAQGR QFQQ
Sbjct  432   VRYRKYTIEEIEAATENFSEKRKIGEGGYGPVYKGYLDHTAAAIKVLRPDAAQGRSQFQQ  491

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  +GN PP+ WQ RFRIAAE
Sbjct  492   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRQGNTPPIPWQHRFRIAAE  551

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLH+ KP+P+VHRDLKP NILL
Sbjct  552   IGTGLLFLHETKPEPLVHRDLKPANILL  579


 Score =   205 bits (521),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 190/334 (57%), Gaps = 36/334 (11%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEA--QNKDLFVTFHCFCTRKNI  179
            SQ A+KW  +N+++KGQ++ L+HV+ +     Q +    A  Q+K+ FV F CFCTRKN+
Sbjct  45   SQNALKWALDNVVTKGQTITLIHVNTKPTGLGQQEDPASAGSQSKEFFVPFRCFCTRKNV  104

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
            HC DI+++ TDIA+A+ ++VS AAIE LV+G+   S   R + TD  T  SKAAPDFCTV
Sbjct  105  HCKDIILEDTDIARAIIEFVSQAAIEKLVVGAPSKSGFVRFRTTDTATNISKAAPDFCTV  164

Query  360  FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRS  539
            ++ISK K+SS+RNA RP P  SPL   +Q        + D    +      +   +H++S
Sbjct  165  YIISKGKVSSMRNAVRPPPAFSPLRSHIQSQASIKAEHVDPPLSSGVKGEAALQARHVQS  224

Query  540  FKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDR-------M  698
                E E +  P      TRG              +SD+SFV SG RPS DR       M
Sbjct  225  ----EREPIRSPF-----TRGPYAYNAKAHTDSIANSDISFV-SGGRPSIDRIFNPRLSM  274

Query  699  SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNS-----FTDFSSSSLENDEAEVEM  863
            S  L ++ E  ++PR             +G G    +       D +SSSL  ++ E EM
Sbjct  275  SDGLDDSFEM-QSPR-----------KSMGGGYSFGTGFSSISQDSTSSSLNMEDVEAEM  322

Query  864  RRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +RL+LEL++TM++YSTACKEALTAKQK  EL RW
Sbjct  323  KRLRLELKQTMEMYSTACKEALTAKQKAMELHRW  356



>ref|XP_010429760.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=752

 Score =   271 bits (692),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  428   VRYRKYTVEEIEEATSNFAESQKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  487

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  488   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFRRGNTPPITWQLRFRIAAE  547

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  548   IATGLLFLHQTKPEPIVHRDLKPGNVLL  575


 Score =   226 bits (577),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 158/349 (45%), Positives = 225/349 (64%), Gaps = 48/349 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS--LQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ+A+KWT +NL S+GQ++ L+HV +++ +S  L+   QLE   KDLFV+FHC+C+RK I
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVLSRSHSSSDLEEGTQLEKIAKDLFVSFHCYCSRKEI  87

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAPDFCT  356
            +C DIL++  D  +A+T+YVS +AIENLV+G +SR+ F++R K TD+PT  SK+APDFC+
Sbjct  88   NCQDILLEDADKVRAITEYVSSSAIENLVVGAASRNGFMRRFK-TDLPTTVSKSAPDFCS  146

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHM-  533
            V+VISK KI+SVRNA+RPAP+ + +  Q  EI     + P+     AP        KH  
Sbjct  147  VYVISKGKIASVRNASRPAPYHNSM--QQCEIDNHYPHTPE----KAP--------KHQD  192

Query  534  RSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS------------SGS  677
            +S     + S  R S+E  ATR    +R    +  + DSDLSF+S            S  
Sbjct  193  QSNSAGSTPSRPRRSVEYDATRLPLVKRKPYGDLYDSDSDLSFISPSSHRESDISFISSG  252

Query  678  RPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-------NDLNSFTD------  818
            RPS +R SSF  +  ES RT R+S+SS+ S GS RLG         N+ ++F++      
Sbjct  253  RPSVER-SSFSLDFPESARTSRMSTSSEQSIGSHRLGLKFSDPGFPNESSTFSEESGRAS  311

Query  819  -FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             +SS SL  D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  312  SYSSQSL--DDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQK  358



>gb|KGN60182.1| hypothetical protein Csa_3G882930 [Cucumis sativus]
Length=775

 Score =   271 bits (693),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE FSESR+IGEGGYGPV+KC LDHT VA+KVLRPDA QGR QF+Q
Sbjct  443   IRYRKYTIEEIEAATEFFSESRRIGEGGYGPVYKCDLDHTPVAIKVLRPDATQGRSQFKQ  502

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRL+ RGN P LSWQ+RF+IAAE
Sbjct  503   EVEVLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLLRRGNTPALSWQLRFKIAAE  562

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  563   IGTALLFLHQTKPEPLVHRDLKPANILL  590


 Score =   213 bits (541),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 147/342 (43%), Positives = 208/342 (61%), Gaps = 27/342 (8%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD--NQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ A+KW  ++LL +G +V L+HV   + + ++ + K   EA  KDLF+ F CFCTRK+I
Sbjct  30   SQGALKWAIDHLLQRGHTVFLMHVKLKSPSNSTQKMKSDPEANVKDLFLPFRCFCTRKDI  89

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
             C DI+++ TD+AKA+ +Y ++  IEN+V+G+S  S   R KVTDIP    K APDFC V
Sbjct  90   QCKDIVLEDTDVAKAIIEYAANTTIENIVVGASARSGFLRFKVTDIPGSIVKGAPDFCNV  149

Query  360  FviskskissvRNATRPAPFASPLH-PQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
            FVISK KI ++R+A+RPAP  S L  P  Q+  ++  + PD    ++ ++  S D+  + 
Sbjct  150  FVISKGKIQTMRSASRPAPTVSALRGPLAQQSSKKLSDTPDFPVSHSATARVSLDKPPLD  209

Query  537  -SFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLS  713
               K ++     R    R      P    L  +    DSD+SFVSSG RPS DR+   L 
Sbjct  210  LPNKSQDEADYMRSPFTRKGYNYKPSYGDLPMQ----DSDISFVSSG-RPSIDRIFPTLY  264

Query  714  ETVESG---RTPRLssss----dgsfgsgRLGKGN-DLNSFTDFSSSSLEND--------  845
            E+ + G     P++SSS+      SF S +LG+ + D+N  ++FSS S ++D        
Sbjct  265  ESQDMGGRATPPQISSSTDLDLTRSFESLQLGRMSVDMNFPSEFSSISQDSDRLSISSQS  324

Query  846  --EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
              + E EMRRLKLEL++TM++YSTACKEALTAKQK  ELQRW
Sbjct  325  MEDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRW  366



>ref|XP_009417309.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=737

 Score =   270 bits (691),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             V+YR+YTIDEIE ATE+F+ESRKIGEGGYGPV+KC LDHT  AVKVLRPDAAQG+ QFQQ
Sbjct  400   VKYRKYTIDEIEVATEYFAESRKIGEGGYGPVYKCYLDHTQAAVKVLRPDAAQGKLQFQQ  459

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILS +RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN PP+ WQ RFRIAAE
Sbjct  460   EVEILSFIRHPNMVILLGACPEYGCLVYEYMANGSLEDRLLRRGNTPPIPWQHRFRIAAE  519

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  520   IGTALLFLHQTKPEPLVHRDLKPANILL  547


 Score =   200 bits (509),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 199/332 (60%), Gaps = 40/332 (12%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
            +SQ A+KW  +N++   QS++LVHV+  T+ S   +Q   +  K++ + F CFC RK+++
Sbjct  22   SSQGALKWALDNVVGADQSLLLVHVN--TKASSGPQQDAASAAKEVLLPFRCFCRRKDVN  79

Query  183  CLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
            C DI+++ TD+ KA+ D+VS AAIE LV+G+SR  F++  + TDI T  SK  PDFCTV+
Sbjct  80   CKDIVLENTDVPKAIVDFVSHAAIEKLVVGASRSGFVRSFRSTDISTNISKNVPDFCTVY  139

Query  363  viskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK-NAPSSLRSFDEKHMRS  539
            +I+K K+SSVRNA RPAP  SPL  ++Q     A    D R + +APS   +        
Sbjct  140  IITKGKVSSVRNAVRPAPAISPLLVKIQSQATHASGPLDHRNRGDAPSETYNL-------  192

Query  540  FKLEESESVSRPSIERAATRGIPPRRMLGA----ETVEGDSDLSFVSSGSRPSGDRM---  698
               +++ES+  P       RG+   + L A    ET+ G SD+SFVSSG RPS DR    
Sbjct  193  --YKDTESMKSP-----FNRGM---QFLTARYSSETMSG-SDVSFVSSG-RPSFDRAFPT  240

Query  699  -SSFLSE--TVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRR  869
             SS++S   + ES ++PR           G    G   +S +  S SS  ++  E EM R
Sbjct  241  RSSYMSSDRSFESVQSPR--------RSVGAYSSGTGFSSLSHDSFSSEASESIEAEMNR  292

Query  870  LKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            L+LEL+ TMD+YSTACKEAL+AKQK  EL RW
Sbjct  293  LRLELKHTMDMYSTACKEALSAKQKAMELHRW  324



>ref|XP_010459224.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=763

 Score =   271 bits (693),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T++F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  434   VRYRKYTVQEIEEGTDNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  493

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  494   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  553

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  554   IATGLLFLHQTKPEPIVHRDLKPGNVLL  581


 Score =   230 bits (587),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 156/357 (44%), Positives = 217/357 (61%), Gaps = 57/357 (16%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL------QHKQQLEAQNKDLFVTFHCFC  164
            +SQ AIKWT ENL S+GQ++ L+HV  ++Q+SL       HKQQ+E Q KDLFV+FHC+C
Sbjct  27   SSQNAIKWTLENLASRGQTLALIHVLPKSQSSLDIEEGISHKQQMEKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHC D++++  D  KA+ +YV+ ++IENLVLG+ SR+SF++R K TD+P   SKAA
Sbjct  87   SRKEIHCQDVVLEDADKVKAIVEYVTVSSIENLVLGAPSRNSFMRRFK-TDLPASVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK KISSVRNA+RPAP+    HP      E   +   +  K+  ++ ++  
Sbjct  146  PDFCNVYVISKGKISSVRNASRPAPY----HPSALNESESHHDTIPLERKHKTANTQALH  201

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGD-----------------S  650
                            R S++   TR   P+   G   + GD                 S
Sbjct  202  R--------------GRRSVDSDVTRLGVPKPPQGHMKLVGDFSDSESEFSFISASQHES  247

Query  651  DLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS  827
            D+SF+SS  RPS DR SSF  +  ES R+ R+S+SSD S GS RLG K  DL+     S+
Sbjct  248  DISFISSSGRPSVDR-SSFTYDLPESARSSRMSTSSDQSIGSHRLGIKFTDLSYLNGSST  306

Query  828  SSLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             S E+            D+ E +MRRL+LEL++TMD+YS+AC+EALTA+ + +ELQ+
Sbjct  307  VSEESGRNSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARHEATELQK  363



>ref|XP_006579059.1| PREDICTED: U-box domain-containing protein 52-like [Glycine max]
 gb|KHN10260.1| U-box domain-containing protein 52 [Glycine soja]
Length=785

 Score =   271 bits (693),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  1071  VPVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQF  1250
             V VRYRRYTI+EIE AT+ F+ES KIGEGGYGPVFKC+LDHT VAVKVLRPDA QGR QF
Sbjct  449   VDVRYRRYTIEEIEAATDFFAESLKIGEGGYGPVFKCLLDHTPVAVKVLRPDAQQGRSQF  508

Query  1251  QQEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIA  1430
             Q+EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  +G+ PPL WQ+RF+IA
Sbjct  509   QREVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFRKGSTPPLPWQLRFKIA  568

Query  1431  AEMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             AE+GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  569   AEIGTGLLFLHQTKPEPLVHRDLKPANILL  598


 Score =   188 bits (477),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 197/361 (55%), Gaps = 56/361 (16%)
 Frame = +3

Query  9    QYAIKWTTENLLSKGQSVVLVHVDNQT--------------------QTSLQHKQQLEAQ  128
            Q A+KW  +NLL++  +V+L+HV                         TSL  K+  E  
Sbjct  29   QNALKWAVDNLLTRSSTVILIHVKLLAPTLSPSPSLFTPRISALLGDDTSLVSKEP-EGN  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLK  305
            NK++F+ +  FCTRK+I C D+L++ +DI+KAL +Y S A IE+LVLGSS + S LKR K
Sbjct  88   NKNVFLPYRVFCTRKDIQCKDVLLEDSDISKALIEYASQAGIEHLVLGSSTKTSLLKRFK  147

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
            V+DIP   SK APDFCTV+VI+K KI +VR+A+RPAP   P       +  QA    D  
Sbjct  148  VSDIPGAVSKGAPDFCTVYVIAKGKIQTVRSASRPAPAIVP------NLLSQASVRTDHS  201

Query  486  TKNAPSSLRSFDEKHMRSF-------KLEESESVSRPSIERAATRGIPPRRMLGAETVEG  644
              N P + +S  E+   SF        L+ESE    P       +G   R+    +T + 
Sbjct  202  DPNVPLT-QSIKEQERHSFDAAAPRRSLDESEPFRSP----FTWKGYNGRQY--GDTPKP  254

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG---NDLNSFT  815
            D D+SFVS+G +   +   S  S++  S     L S  DGSF    +  G    +  +  
Sbjct  255  DKDISFVSTGRKSIENLFPSLNSDSGFSNHRLSLGSDIDGSFSLESMHDGRKSTETGTPP  314

Query  816  DFSSSSLENDE-----------AEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
            +F S S E+D+            E EMRRLKLEL++TM+LY+TACKEA+TA+QK  ELQ+
Sbjct  315  EFPSLSFESDQHSSSTSQAVDDMEAEMRRLKLELKQTMELYNTACKEAVTAQQKAVELQK  374

Query  963  W  965
            W
Sbjct  375  W  375



>ref|XP_002880578.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56837.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=788

 Score =   271 bits (693),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  463   VRYRKYSIEEIELATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  522

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  523   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  582

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  583   IGTGLLFLHQAKPEPLVHRDLKPGNILL  610


 Score =   218 bits (556),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 210/360 (58%), Gaps = 40/360 (11%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV             + +   L     L     E  +
Sbjct  29   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLNNSPSLHASSAKLSQDSSLVCRDPEGIS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K+LF+ F CFCTRK+I C D+L++ +D+AKAL +YV+ AAIE LV+GSS +  FL+  K 
Sbjct  89   KELFLPFRCFCTRKDIQCQDVLLEESDVAKALVEYVNQAAIEVLVVGSSSKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDIR  485
            TDIP   +K APDFCTV++ISK KI ++R+A+R AP  +PL   +Q    +  Q  P   
Sbjct  149  TDIPGNITKNAPDFCTVYIISKGKIQTMRSASRSAPMTAPLRSPVQPPSLKPPQPMPSTF  208

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESV---SRPSIERAATRGIPPRRMLGAETVEGD---  647
              +  ++ RSF+    RS + ++  S+    R S+E  +     P    G     GD   
Sbjct  209  ANSMRAARRSFESNQRRSVEDQQRRSMEDQQRRSMEDQSESFRSPFTRRGNGKSYGDLSV  268

Query  648  --SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN-------D  800
              SD+SF+SSG RPS DR+   L +  +  RTP   S+      S  L + +       D
Sbjct  269  PESDISFISSG-RPSIDRIFPSLYDNNDPTRTPPRLSNFSDMDYSSNLDQSSNYGRRSVD  327

Query  801  LNSFTDF-----SSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            LNS TDF     SS+S   D+ E EMRRLKLEL++TM++YSTACKEALTAKQK +ELQRW
Sbjct  328  LNSPTDFESERFSSASQSIDDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRW  387



>ref|XP_010476794.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=763

 Score =   271 bits (692),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T++F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  434   VRYRKYTVQEIEEGTDNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  493

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  494   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  553

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  554   IATGLLFLHQTKPEPIVHRDLKPGNVLL  581


 Score =   226 bits (577),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 156/357 (44%), Positives = 215/357 (60%), Gaps = 57/357 (16%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL------QHKQQLEAQNKDLFVTFHCFC  164
            +SQ AIKWT ENL S+GQ++ L+HV  ++Q SL       HKQQLE Q KDLFV+FHC+C
Sbjct  27   SSQNAIKWTLENLASRGQTLALIHVLPKSQCSLDIEEGISHKQQLEKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHC D++++  D  KA+ +YV+ ++IENLVLG+ SR+SF++R K TD+P   SKAA
Sbjct  87   SRKEIHCQDVVLEDVDKVKAIVEYVTVSSIENLVLGAPSRNSFMRRFK-TDLPASVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK KISSVRNA+RPAP+    HP      E   +   I  K+  ++ ++  
Sbjct  146  PDFCNVYVISKGKISSVRNASRPAPY----HPSALNESESHHDTIPIERKHKTANTQALH  201

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGD-----------------S  650
                            R S++   TR   P+   G   + GD                 S
Sbjct  202  R--------------GRRSVDSDGTRLGVPKPPQGHMKLVGDFSDSESEFSFISASQHES  247

Query  651  DLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS  827
            D+SF+SS  R S DR SSF  +  +S R+ R+S+SSD S GS RLG K  DL+     S+
Sbjct  248  DISFISSSGRQSVDR-SSFTYDLPDSARSSRMSTSSDQSIGSHRLGIKFTDLSYLNGSST  306

Query  828  SSLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             S E+            D+ E +MRRL+LEL++TMD+YS+AC+EALTA+ + +ELQ+
Sbjct  307  VSEESGRNSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARHEATELQK  363



>ref|XP_010417508.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=727

 Score =   270 bits (690),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  433   VRYRKYTVEEIEEATSNFAESQKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  492

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  493   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFRRGNTPPITWQLRFRIAAE  552

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  553   IATGLLFLHQTKPEPIVHRDLKPGNVLL  580


 Score =   232 bits (592),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 224/352 (64%), Gaps = 51/352 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-------QHKQQLEAQNKDLFVTFHCFC  164
            SQ+A+KWT +NL S+GQ++ L+HV +++ +S        Q +QQLE   KDLFV+FHC+C
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVLSKSHSSSDLEDGTPQQRQQLEKIAKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+C DIL++  D  +A+T+YVS +AIENLV+G +SR+ F++R K TD+PT  SK+A
Sbjct  88   SRKEINCQDILLEDADKVRAITEYVSSSAIENLVVGAASRNGFMRRFK-TDLPTTVSKSA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC+V+VISK KI+SVRNA+RPAP+ + +  Q  EI     + PD     AP+      
Sbjct  147  PDFCSVYVISKGKIASVRNASRPAPYHNSM--QQCEIDNHYPHTPD----KAPN------  194

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS-----------  668
              H  S     + S  R S+E  ATR    RR    +  + DSDLSF+S           
Sbjct  195  -HHDHSNSAGNTPSRPRRSVESDATRSPLVRRKPYGDLYDSDSDLSFISPSSHRESDISF  253

Query  669  -SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-------NDLNSFTD--  818
             S  RPS +R SSF  +  ES RT R+S+SS+ S GS RLG         N+ ++F++  
Sbjct  254  ISSGRPSVER-SSFSLDFPESARTSRMSTSSEQSIGSHRLGLKFSDPGFPNESSTFSEES  312

Query  819  -----FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
                 +SS SL  D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ
Sbjct  313  GRTSSYSSQSL--DDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQ  362



>ref|XP_010498006.1| PREDICTED: U-box domain-containing protein 35-like [Camelina 
sativa]
Length=766

 Score =   271 bits (692),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT+ EIEE T++F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  437   VRYRKYTVQEIEEGTDNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  496

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  497   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  556

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  557   IATGLLFLHQTKPEPIVHRDLKPGNVLL  584


 Score =   230 bits (587),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 156/357 (44%), Positives = 217/357 (61%), Gaps = 57/357 (16%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL------QHKQQLEAQNKDLFVTFHCFC  164
            +SQ AIKWT ENL S+GQ++ L+HV  ++Q+SL       HKQQ+E Q KDLFV+FHC+C
Sbjct  27   SSQNAIKWTLENLASRGQTLALIHVLPKSQSSLDIEEGISHKQQMEKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHC D++++  D  KA+ +YV+ ++IENLVLG+ SR+SF++R K TD+P   SKAA
Sbjct  87   SRKEIHCQDVVLEDADKVKAIVEYVTVSSIENLVLGAPSRNSFMRRFK-TDLPASVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK KISSVRNA+RPAP+    HP      E   +   +  K+  ++ ++  
Sbjct  146  PDFCNVYVISKGKISSVRNASRPAPY----HPSALNESESHHDTIPLERKHKTANTQALH  201

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGD-----------------S  650
                            R S++   TR   P+   G   + GD                 S
Sbjct  202  R--------------GRRSVDSDGTRLGVPKPPQGHMKLVGDFSDSESEFSFISASQHES  247

Query  651  DLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS  827
            D+SF+SS  RPS DR SSF  +  ES R+ R+S+SSD S GS RLG K  DL+     S+
Sbjct  248  DISFISSSGRPSVDR-SSFTYDLPESARSSRMSTSSDQSIGSHRLGIKFTDLSYLNGSST  306

Query  828  SSLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             S E+            D+ E +MRRL+LEL++TMD+YS+AC+EALTA+ + +ELQ+
Sbjct  307  VSEESGRNSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARHEATELQK  363



>ref|XP_002309024.1| kinase family protein [Populus trichocarpa]
 gb|EEE92547.1| kinase family protein [Populus trichocarpa]
Length=687

 Score =   269 bits (687),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE AT+ FS S KIGEGGYGPV++  LDHT VA+KVLRPDAA GR QFQQ
Sbjct  350   LRYRKYTIEEIEAATDEFSNSLKIGEGGYGPVYRSYLDHTPVAIKVLRPDAAHGRSQFQQ  409

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++D L +RGN PPLSWQ+RFRIAAE
Sbjct  410   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLFHRGNSPPLSWQLRFRIAAE  469

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  470   IGTGLLFLHQTKPEPLVHRDLKPGNILL  497


 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 106/166 (64%), Gaps = 19/166 (11%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-----------------QHKQQLEAQN  131
            +SQ+A+KWT ++LL++GQ++ L+H+  Q  +S+                  + +Q+ +Q 
Sbjct  22   SSQHALKWTVDHLLTRGQALTLLHI-KQNLSSIPTPCVPPLLHVNDDVANMYSKQITSQA  80

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
            K LF+ F CFCTRK I C +++++  D+AK + +YV+  AIE L+LG SS+   +++ K 
Sbjct  81   KSLFLPFRCFCTRKEIKCNEVVVEKMDVAKGIIEYVTTNAIEILILGSSSKGGLVRKFKT  140

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQ  446
            TDIP   SK AP FC+V+VISK KISSVR+A+ P P    +  Q+Q
Sbjct  141  TDIPGNVSKGAPGFCSVYVISKGKISSVRSASGPPPPKHSIQTQMQ  186


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 11/73 (15%)
 Frame = +3

Query  780  RLGKGNDLNSFTDFSSSSLEN-----------DEAEVEMRRLKLELQKTMDLYSTACKEA  926
            R  K  D +S  +FSS+S E+           D+ E EMRRL+LEL++TMD+YS+AC+EA
Sbjct  202  RGNKSIDSSSQYNFSSTSQESSNTSWSSSQNMDDMESEMRRLRLELKQTMDMYSSACREA  261

Query  927  LTAKQKTSELQRW  965
            LTAKQK  EL  W
Sbjct  262  LTAKQKARELHHW  274



>ref|XP_010112125.1| U-box domain-containing protein 35 [Morus notabilis]
 gb|EXC32750.1| U-box domain-containing protein 35 [Morus notabilis]
Length=801

 Score =   271 bits (693),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+Y+IDEIE AT  F ESRKIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  448   IRYRKYSIDEIEAATGSFQESRKIGEGGYGPVYKGYLDHTPVAIKVLRPDAAQGRSQFQQ  507

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSCMRHPNMV+LLGACPEYGCLVYE+MA+GS++DRL  +GN  PLSWQ+RFRIAAE
Sbjct  508   EVEILSCMRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLFRQGNTRPLSWQLRFRIAAE  567

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ+KP+P+VHRDLKP NILL
Sbjct  568   IGTGLLFLHQSKPEPLVHRDLKPANILL  595


 Score =   211 bits (537),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 145/355 (41%), Positives = 202/355 (57%), Gaps = 42/355 (12%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD---------------NQTQTSLQHKQQLEAQNKD  137
             SQ A+ W  +NLL +G++V+L+HV+               N  + SL   ++ +AQ K 
Sbjct  26   NSQNALIWAIDNLLQRGRTVILIHVEIKHVSHSSASNVCNYNAREESLVLCKEPDAQTKK  85

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDI  317
            L + F CFCTRK+I C DI+++  D+AKALT+YVS AAIENLVLG+S  +   R KVTDI
Sbjct  86   LLLPFRCFCTRKDIQCKDIMLEDIDVAKALTEYVSQAAIENLVLGASARNGFLRFKVTDI  145

Query  318  PTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNA  497
            P+  +K APDFC V+VISK K+ S R+A RPAP  SPL  + +  +  + N+  +    +
Sbjct  146  PSSVTKGAPDFCNVYVISKGKVQSQRSALRPAPANSPLRFEFE--KTSSLNSEPLEPNVS  203

Query  498  P---SSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
            P   +S++ F++      K  +     R    R   +G    R  G E    DSD+SF+S
Sbjct  204  PLPTASMKGFEKPPEPLRKSHDDIDSIRSPFTRIGLKG----RSHG-ELPMPDSDISFIS  258

Query  669  SGSRPSGDRMSSFLSETVESGR-TPR--------LssssdgsfgsgRLGKGNDLNSFTDF  821
            SG RPS D +    ++ ++SGR TPR        L+ S +      R      L+ F+ F
Sbjct  259  SG-RPSVDHVYQSFNDNLDSGRTTPRVSNGTDVDLNGSFESMQFGWRSVDNYSLSEFSSF  317

Query  822  SS-------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S        SS   D+ E EMRRLKLEL++TM++YSTACKEAL A +K  ELQRW
Sbjct  318  SQDSDNLSCSSQAIDDVEAEMRRLKLELKQTMEMYSTACKEALAANKKAVELQRW  372



>ref|NP_173120.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
 gb|AEE29493.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
Length=758

 Score =   270 bits (691),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y++ EIEE T +F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  433   VRYRKYSVQEIEEGTANFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  492

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  493   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMARGSLDDRLFRRGNTPPISWQLRFRIAAE  552

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  553   IATGLLFLHQTKPEPIVHRDLKPGNVLL  580


 Score =   227 bits (579),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 223/363 (61%), Gaps = 70/363 (19%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ------HKQQLEAQNKDLFVTFHCFC  164
            +SQ AIKWT ENL ++GQ++ L+HV  ++Q+SL       HKQQ+E Q KDLFV+FHC+C
Sbjct  27   SSQNAIKWTLENLATRGQTLALIHVLPKSQSSLDIEEGITHKQQMEKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHCLD++++  D  KA+ +YV+ +AIENLVLG+ SR+SF++R K TD+PT  SKAA
Sbjct  87   SRKEIHCLDVVLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQ-LQEI--QEQAQNNPDIRTKNAPSSLR  512
            PDFC V+VISK KISS+RNA+R AP+    HP  L E+   E        +T N P+  +
Sbjct  146  PDFCNVYVISKGKISSLRNASRLAPY----HPSVLSEVDDHETIAIERKHKTANTPALPK  201

Query  513  SFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGD---------------  647
                               R SI+   TR   P+   G   + GD               
Sbjct  202  ------------------GRRSIDSDVTRLGLPKPPHGHMKLMGDFSDSESEFSFISASQ  243

Query  648  ---SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDL----  803
               SDLSF+SSG RPS DR SSF  +  ES RT R+S+SS+ S GS RLG K  DL    
Sbjct  244  QESSDLSFISSG-RPSVDR-SSFTYDLPESARTSRMSTSSEQSIGSHRLGIKFTDLSYLN  301

Query  804  --NSFTD--------FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
              +S +D        FSS SL  ++ E +M+RL+LEL++TMD+YS+AC+EALTA+ + +E
Sbjct  302  GSSSVSDESGRTSCSFSSQSL--NDVEAQMKRLRLELKQTMDMYSSACREALTARNEATE  359

Query  954  LQR  962
            LQ+
Sbjct  360  LQK  362



>ref|XP_006304388.1| hypothetical protein CARUB_v10010903mg [Capsella rubella]
 gb|EOA37286.1| hypothetical protein CARUB_v10010903mg [Capsella rubella]
Length=758

 Score =   270 bits (691),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y++ EIEE T +F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  435   VRYRKYSVQEIEEGTNNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  494

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  495   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAE  554

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  555   IATGLLFLHQTKPEPIVHRDLKPGNVLL  582


 Score =   236 bits (603),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 164/358 (46%), Positives = 221/358 (62%), Gaps = 59/358 (16%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL------QHKQQLEAQNKDLFVTFHCFC  164
            +SQ AIKWT ENL S+GQ++ L+HV  ++Q+SL       HKQQ+E Q KDLFV+FHC+C
Sbjct  28   SSQNAIKWTLENLASRGQTLALIHVLPKSQSSLDIEEGISHKQQMEKQTKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHCLD++++  D  KA+ +YV+ +AIENLVLG+ SR+SF++R K TD+PT  SKAA
Sbjct  88   SRKEIHCLDVVLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFK-TDLPTSVSKAA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQ-LQEIQEQAQNNPDIRTKNAPSSLRSF  518
            PDFC V+VISK KISSVRN++RPAP+    HP  L E  E   +   I  K+ P++  + 
Sbjct  147  PDFCNVYVISKGKISSVRNSSRPAPY----HPSVLNEPSETHHDTIAIERKHKPANTPAV  202

Query  519  DEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGD-----------------  647
                             R S++   TR   P+   G   + GD                 
Sbjct  203  PR--------------GRRSVDSDVTRLGLPKPPHGHMKLVGDFSDSESEFSYISASQQE  248

Query  648  SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSF----  812
            SD+SF+SSG RPS DR SSF  +  ES RT R+S+SSD S GS RLG K  D++      
Sbjct  249  SDISFISSG-RPSVDR-SSFTYDLPESARTSRMSTSSDQSIGSHRLGIKFTDMSYLNGSS  306

Query  813  --------TDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                    T  S SS   D+ E +MRRL+LEL++TMD+YS+AC+EALTA+ + +ELQ+
Sbjct  307  TVSDDSGRTSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARHEATELQK  364



>ref|XP_009590276.1| PREDICTED: U-box domain-containing protein 52 isoform X3 [Nicotiana 
tomentosiformis]
Length=685

 Score =   269 bits (687),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRYTI+EIE AT++F+++ KIGEGGYGPV+KC +DHT VAVKVLRPDAA GR+QFQQE
Sbjct  369   RYRRYTIEEIETATDYFAQANKIGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQE  428

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYE+M++GS++DRL  RG  PPLSWQ RFRIAAE+
Sbjct  429   VEVLSCIRHPNMVLLLGACPEYGCLVYEFMSNGSLEDRLFQRGKTPPLSWQQRFRIAAEI  488

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             G GLLFLHQ+KP+PIVHRDLKP NILL
Sbjct  489   GAGLLFLHQSKPEPIVHRDLKPANILL  515


 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 116/284 (41%), Positives = 163/284 (57%), Gaps = 30/284 (11%)
 Frame = +3

Query  177  IHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDFC  353
            I C D++++  D+ KA+ +YV+  AIE L+LG++ +   L+R KV DIP    K  PDFC
Sbjct  18   IQCYDVVLEDVDVVKAIVEYVNRTAIEVLILGAAAKGGLLRRFKVKDIPGNVVKGVPDFC  77

Query  354  TVFvisks-kissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPS--SL----R  512
            TV+VISK+ KIS+ R+A+R APF  PL  Q  + Q  A++N    + N PS  SL    +
Sbjct  78   TVYVISKNGKISATRSASRLAPFIHPLRHQFMQ-QGNAKSNTTEDSLNTPSRGSLSGIPK  136

Query  513  SFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGD  692
               +  M + +  ++ ++  P   R    G P       E  + D+D+SFVSSG RPS D
Sbjct  137  PVSDLPMSNLQ-SDTLNMKSPFTHRKGPNGKP------YEISQPDTDISFVSSG-RPSID  188

Query  693  RMSSFLSETVESGRTP-RLssssdgsfgsgR---LGKGNDLNSFTDFSSSSLENDEAE--  854
             M    ++  +SG TP RLS  SD    +     LG+ +     ++ S  S+E D A   
Sbjct  189  NMFPSFADNYDSGATPPRLSGFSDFEAQNFEPIPLGRRSLDIMPSELSFLSMEGDRASFS  248

Query  855  -------VEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                    EMRRLKLEL++TM++YSTACKEALTA+QK  ELQRW
Sbjct  249  STPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKAMELQRW  292



>gb|KFK32639.1| hypothetical protein AALP_AA6G269400 [Arabis alpina]
Length=794

 Score =   271 bits (692),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  469   VRYRKYSIEEIERATEFFAEKCKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  528

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS+DDRL   GN PPLSWQ RFRIAAE
Sbjct  529   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLDDRLFRLGNSPPLSWQTRFRIAAE  588

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  589   IGTGLLFLHQAKPEPLVHRDLKPANILL  616


 Score =   213 bits (543),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 215/370 (58%), Gaps = 55/370 (15%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV             + +   L     L     E  +
Sbjct  30   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQDTSLVCRDPEGAS  89

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
            K+LF+ F CFCTRK+I C D+L++  D+AKAL +Y + AAIE LV+G SS+  FL+  K 
Sbjct  90   KELFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGTSSKGGFLRFNKP  149

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLH-----PQLQEIQEQAQNN  473
            TDIP    K APDFCTV+VISK KIS++R+A+R AP  +PL      P L+  Q     +
Sbjct  150  TDIPGAIVKTAPDFCTVYVISKGKISTMRSASRSAPMNAPLRSPVQPPSLKPPQPVPSTS  209

Query  474  PDIRTKNAPSSLRSFDEKHMRSFKLEES---ESVSRPSIERAATRGIPPRRMLGAETVEG  644
             ++R +      RSF+ +  RS + ++    E + R S+E  +     P    G     G
Sbjct  210  TNMRVER-----RSFESQQRRSIEDQQRRSMEDLQRRSMEDQSESFRSPFTRRGNGRSYG  264

Query  645  D-----SDLSFVSSGSRPSGDRMSSFLSE--TVESGRTP-RLssssdgsfgsgRLGKGN-  797
            D     SD+SFVSSG RPS DR+   L +    +  RTP RLS+ SD  +GS      N 
Sbjct  265  DLSVVESDISFVSSG-RPSIDRIFPNLYDLNNNDPNRTPPRLSNFSDMDYGSSFDQSSNY  323

Query  798  -----DLNSFTDFSSSSLEN---------DEAEVEMRRLKLELQKTMDLYSTACKEALTA  935
                 D++S TDFSS S EN         D+ E EMRRLKLEL++TM++YSTACKEALTA
Sbjct  324  GRRSVDISSPTDFSSGSFENERFSSASAMDDVEAEMRRLKLELKQTMEMYSTACKEALTA  383

Query  936  KQKTSELQRW  965
            KQK +ELQRW
Sbjct  384  KQKATELQRW  393



>ref|XP_002889221.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65480.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   270 bits (690),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  433   VRYRKYTVEEIEEATSNFAESQKVGEGGYGPVFRGFLDHTSVAVKVLRPDAAQGRSQFQK  492

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  493   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  552

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  553   IATGLLFLHQTKPEPIVHRDLKPGNVLL  580


 Score =   229 bits (584),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 223/353 (63%), Gaps = 51/353 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-------QHKQQLEAQNKDLFVTFHCFC  164
            SQ+A+KWT +NL S+GQ++ L+HV +++ +S        Q +QQ E   KDLFV+FHC+C
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVLSRSHSSSDLEEGTPQQRQQSEKIAKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+C DIL++  D  +A+T+YVS +AIENLV+GS SR+ F++R K TD+PT  SK+A
Sbjct  88   SRKEINCRDILLEDADKVRAITEYVSSSAIENLVVGSASRNGFMRRFK-TDLPTTVSKSA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC V+VISK KI+SVRNA+RPAP+ + +  Q  EI     + PD     AP       
Sbjct  147  PDFCNVYVISKGKIASVRNASRPAPYQNSM--QHCEIDNHHPHTPD----KAP-------  193

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS-----------  668
            + H  S     + S  R S+E  ATR    +R    +  + DSDLSF+S           
Sbjct  194  KHHDHSNSAGSTPSRPRKSVEVDATRSPLVKRKPYGDLYDSDSDLSFISPSSHRDSDISF  253

Query  669  -SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-------NDLNSFTD--  818
             S  RPS +R SSF  +  ES RT R+S+SS+ S GS RLG         N+ ++F++  
Sbjct  254  ISSGRPSVER-SSFSLDFPESARTSRMSTSSEQSIGSHRLGIKFSDPGFPNESSTFSEES  312

Query  819  -----FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                 +SS SL  D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  313  GRTSSYSSQSL--DDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQK  363



>ref|XP_010417189.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=803

 Score =   271 bits (693),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  478   VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  537

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+R+RIAAE
Sbjct  538   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRYRIAAE  597

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  598   IGTGLLFLHQAKPEPLVHRDLKPGNILL  625


 Score =   216 bits (551),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 160/375 (43%), Positives = 217/375 (58%), Gaps = 55/375 (15%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV             + +   L  +  L     E  +
Sbjct  29   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNSPSLHASSAKLSQESSLVCRDPEGLS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K+LF+ F CFCTRK+I C D+L++ TD+AKAL +Y + AAIE LV+GSS +  FL+  K 
Sbjct  89   KELFLPFRCFCTRKDIQCQDVLLEETDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDIR  485
            TDIP   +K+APDFCTV+VISK KI ++R+A+R AP ++PL   +Q    +  Q  P   
Sbjct  149  TDIPGTITKSAPDFCTVYVISKGKIQTMRSASRSAPISAPLRNPVQPPSLKPPQPMPSTS  208

Query  486  TKNAPSSLRSFDEKHMRSFK-------LEESESVS------RPSIERAATRGIPPRRMLG  626
              N  +  RSF+ +  RS +       +E+ +  S      R S+E  +     P    G
Sbjct  209  ANNMRAERRSFESQQRRSIEDQQQRRSIEDHQRRSMEDHHQRRSMEDQSESFRSPFTRRG  268

Query  627  AETVEGD-----SDLSFVSSGSRPSGDRMSSFLSETVESGRTP-RLssssdgsfgsgRLG  788
                 GD     SD+SFVSSG RPS DR+   L +  +  RTP RLS+ SD  +GS    
Sbjct  269  NGRSYGDLSVPESDISFVSSG-RPSIDRIFPSLYDNNDPNRTPPRLSNFSDMDYGSNFDQ  327

Query  789  KGN------DLNSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACK  920
              N      D+NS TD SS S E+          D+ E EMRRLKLEL++TM++YSTACK
Sbjct  328  SSNYGRRSMDMNSPTDMSSGSFESERFSSASQTIDDVEAEMRRLKLELKQTMEMYSTACK  387

Query  921  EALTAKQKTSELQRW  965
            EALTAKQK +ELQRW
Sbjct  388  EALTAKQKATELQRW  402



>ref|XP_010537753.1| PREDICTED: U-box domain-containing protein 35-like [Tarenaya 
hassleriana]
Length=790

 Score =   270 bits (691),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRYT++EIEE T++F+ES+K+GEGGYGPVFK  LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  443   VRYRRYTVEEIEEGTKNFAESQKVGEGGYGPVFKGYLDHTPVAVKVLRPDAAQGRSQFQK  502

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EV++LSC+RHPNMV+LLGACPE+G LVYE+MA GS++DRL  RGN PPL+WQ+RFRIAAE
Sbjct  503   EVDVLSCIRHPNMVLLLGACPEFGILVYEFMAKGSLEDRLFRRGNTPPLTWQLRFRIAAE  562

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             M TGLLFLHQ KP+PIVHRDLKPGNILL
Sbjct  563   MATGLLFLHQTKPEPIVHRDLKPGNILL  590


 Score =   233 bits (593),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 156/355 (44%), Positives = 216/355 (61%), Gaps = 49/355 (14%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL----------QHKQQLEAQNKDLFVTF  152
            +SQ+A+KWT ENL S+GQ++ L+HV  +T ++           Q+KQQ+E Q +DLFV+F
Sbjct  27   SSQHALKWTIENLASRGQTIALIHVLPKTHSASGNGDLEEGTPQYKQQIEKQTRDLFVSF  86

Query  153  HCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLT  329
            HC+CTRK IHCLDI++   D  KA+ +YV   AIENLVLG+ SR+ F++R K  D+PT  
Sbjct  87   HCYCTRKEIHCLDIVLHDADRVKAIAEYVLSTAIENLVLGAPSRNGFMRRFK-NDLPTSV  145

Query  330  SKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSL  509
            SK+APDFC+V+ +      S+R ATRPAPF S L   L EI     NN  +  K + S  
Sbjct  146  SKSAPDFCSVY-VISKGKVSLRGATRPAPFHSSL---LCEID---SNNSTVAEKKSKSET  198

Query  510  RSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS-------  668
            +       R+ K  + ++ +R  + +   +G    R+L  +  + D+D+SF+S       
Sbjct  199  QPVGSTPPRARKSVDLDAAARLPLAKRTGQG----RIL-TDFTDSDTDISFISASHPESD  253

Query  669  ----SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSF-------  812
                S  RPS DR SSF  +  ESGRT R+S+SS+ S GS RLG K +DL          
Sbjct  254  ISFISSGRPSVDR-SSFTIDLPESGRTSRISTSSEYSIGSHRLGIKFSDLGLLNEISSVS  312

Query  813  -----TDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                 T  S SS   D+ E EMRRL+LEL++TMD+YSTACKEAL+A+Q+ +ELQR
Sbjct  313  EESERTSCSYSSQSFDDVEAEMRRLRLELKQTMDMYSTACKEALSARQQATELQR  367



>ref|XP_008228017.1| PREDICTED: U-box domain-containing protein 34-like [Prunus mume]
Length=798

 Score =   271 bits (692),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             +YRRY I+EIE+ATEHF+ SRKIGEGGYGPVFKC LDHT VAVKVLRPDAAQGR QFQ+E
Sbjct  451   KYRRYAIEEIEQATEHFAPSRKIGEGGYGPVFKCYLDHTPVAVKVLRPDAAQGRTQFQKE  510

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             ++ILSC+RHPNMV+LLGACPEYG LVYEYMA+GS++D L+ RGN P LSWQ+RFRIAAE+
Sbjct  511   IDILSCIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLIKRGNNPALSWQLRFRIAAEI  570

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  571   ATGLLFLHQTKPEPLVHRDLKPGNILL  597


 Score =   229 bits (583),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 159/354 (45%), Positives = 224/354 (63%), Gaps = 48/354 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-----------------QHKQQLEAQNK  134
            SQ A++W  EN++++GQ+V+L+HV  ++ ++                  Q  ++LE   K
Sbjct  35   SQNALRWAAENVITRGQTVILLHVVQKSSSTSSCNLSLSLSLSLSLSLSQVTRRLEKMTK  94

Query  135  DLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVT  311
            DLF+TFHC+CTRK+I+CLDI+++  DIAKA+T+YVS AAIENLVLG+ ++H F+ R K +
Sbjct  95   DLFLTFHCYCTRKDINCLDIVLEDADIAKAVTEYVSYAAIENLVLGAPAKHGFI-RFKTS  153

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK  491
             IP+  SK APDFCTV+VISK KISSVRNA+R AP++SPL  Q+  + +Q+   P+    
Sbjct  154  SIPSSVSKGAPDFCTVYVISKGKISSVRNASRAAPYSSPLVNQIDSLNKQSFKPPETPRY  213

Query  492  N---APSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
            N     ++  SF  ++++       +  +R  + R    G    R+ G  + E +SD+SF
Sbjct  214  NNMYLKAARPSFKPRNLQ-------DEANRLGLTRG---GFSNGRISGGFS-ESESDISF  262

Query  663  VSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLE  839
            +SS  R S DR SS   + +++ R  RLS+SSD S GS R G K  DL+S  DFSS S E
Sbjct  263  ISS-ERASTDRASSVTYDFMDTNRG-RLSTSSDQSVGSMRQGPKFADLSSLHDFSSVSHE  320

Query  840  N------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +            DE E EMRRLKLEL++TMD+YSTAC+EAL+AKQK  EL  W
Sbjct  321  SNLTSSSWSSQNLDEVESEMRRLKLELKQTMDMYSTACREALSAKQKEMELHNW  374



>ref|NP_180014.2| adenine nucleotide alpha hydrolase domain-containing protein 
kinase [Arabidopsis thaliana]
 gb|ABE65860.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC07567.1| adenine nucleotide alpha hydrolase domain-containing protein 
kinase [Arabidopsis thaliana]
Length=788

 Score =   270 bits (691),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I++IE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  463   VRYRKYSIEDIELATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  522

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  523   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  582

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  583   IGTGLLFLHQAKPEPLVHRDLKPGNILL  610


 Score =   219 bits (559),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 151/360 (42%), Positives = 209/360 (58%), Gaps = 40/360 (11%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  +NLL +GQSV+LVHV             + +   L     L     E  +
Sbjct  29   SSQHALKWAVDNLLQRGQSVILVHVKLRPSPLNNSASLHASSAKLSQDSSLVCRDPEGIS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K++F+ F CFCTRK+I C D+L++ +D+AKAL +YV+ AAIE LV+GSS +  FL+  K 
Sbjct  89   KEIFLPFRCFCTRKDIQCQDVLLEESDVAKALVEYVNQAAIEVLVVGSSSKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDIR  485
            TDIP   +K APDFCTV++ISK KI ++R+A+R AP  +PL   +Q    +  Q  P   
Sbjct  149  TDIPGSITKNAPDFCTVYIISKGKIQTMRSASRSAPMTAPLRSSVQPPSLKPPQPMPSTS  208

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESV---SRPSIERAATRGIPPRRMLGAETVEGD---  647
              +  +  RSF+    RS + ++  S+    R SI+  +     P    G     GD   
Sbjct  209  ANSLRADRRSFESNQRRSVEDQQRRSMEDQQRRSIDDQSESFRSPFTRRGNGRSYGDLTV  268

Query  648  --SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN-------D  800
              SD+SF+SSG RPS DR+   L +  +  RTP   S+      S  L + +       D
Sbjct  269  PESDISFISSG-RPSIDRIFPSLYDNNDPSRTPPRLSNFSDMDYSSSLDQSSNYGRRSVD  327

Query  801  LNSFTDF-----SSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +NS TDF     SS+S   D+ E EMRRLKLEL++TM++YSTACKEALTAKQK +ELQRW
Sbjct  328  MNSPTDFESERFSSASQSIDDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRW  387



>ref|XP_010050906.1| PREDICTED: U-box domain-containing protein 52 [Eucalyptus grandis]
Length=827

 Score =   271 bits (693),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE ATE F ESRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QF Q
Sbjct  459   VRYRRYSIEEIENATEFFLESRKIGEGGYGPVYKCYLDHTLVAIKVLRPDAAQGRSQFLQ  518

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MA+GS+DDRL  RGN  PLSWQ+RF+IAA 
Sbjct  519   EVEVLSCIRHPNMVLLLGACPEYGCLVYEFMANGSLDDRLFCRGNTRPLSWQLRFKIAAG  578

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  579   IGTGLLFLHQAKPEPLVHRDLKPGNILL  606


 Score =   209 bits (531),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 206/364 (57%), Gaps = 51/364 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQT----------------------QTSLQHKQQL  119
            SQ A+KWT +NLL +GQ V+LVHV  ++                           H    
Sbjct  27   SQNALKWTIDNLLQRGQVVILVHVKVKSLPTAPLGSSPTGIYGGWFQLFDANKALHMAGH  86

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHS-FLK  296
            E   K+LF+ F CFCTRK+I C DIL++ TD+AKAL +YVS  +IENLVLGSS  S FL+
Sbjct  87   ELDPKELFLPFRCFCTRKDIQCKDILLEDTDVAKALIEYVSHNSIENLVLGSSSKSGFLR  146

Query  297  RLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQL--QEIQEQAQN  470
              K TD+P+  +K APDFCTV+VI+K KI+++R+ATRPAP ASPL  Q+  Q +    Q+
Sbjct  147  TFKATDVPSSVAKGAPDFCTVYVITKGKITTMRSATRPAPMASPLSNQIHNQLVPRAHQS  206

Query  471  NPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDS  650
             P +   N   S+R F  + M     + ++S+    I    TRG      L  E    D+
Sbjct  207  EPRVPQTN---SIRGF-ARAMNEMPHKSNDSLD--FIRSPFTRGKGSNGRLYGEVGTPDT  260

Query  651  DLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfg----sgRLGKGN-------  797
            D+SFVSSG R S DRM     + ++ G +PRLS++S+  +     +  L + +       
Sbjct  261  DISFVSSG-RQSVDRMFPSFYDNLDGGYSPRLSNTSNTDYRQGFDAALLAQRSVDSSIVR  319

Query  798  DLNSFTDFSSSSL--------ENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
            +++  + FS  S           D+ E EM+RLK EL++TM++YS ACK+AL+AKQK  E
Sbjct  320  EVSPMSHFSQESERSYSYSSPNTDDVEAEMKRLKQELKQTMEMYSKACKDALSAKQKAIE  379

Query  954  LQRW  965
            LQ W
Sbjct  380  LQHW  383



>ref|XP_007011461.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
 gb|EOY29080.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
Length=765

 Score =   270 bits (690),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE FSE  KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  431   RYRKYTIEEIEAATEFFSEVLKIGEGGYGPVYKGRLDHTPVAIKVLRPDAAQGRSQFQQE  490

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYE+M++GS++DRL  RGN PPLSWQ+RFRIAAE+
Sbjct  491   VEVLSCIRHPNMVLLLGACPEYGCLVYEFMSNGSLEDRLFRRGNTPPLSWQLRFRIAAEI  550

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+PIVHRDLKP NILL
Sbjct  551   GTGLLFLHQTKPEPIVHRDLKPANILL  577


 Score =   200 bits (509),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 197/337 (58%), Gaps = 27/337 (8%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHC  185
            SQ A+KW  ++LL KG +VVL+HV  + +        L     +LF+ F CFCTRK+IHC
Sbjct  28   SQNALKWAIDHLLQKGHTVVLIHV--KVKPFSLSTSPLPTPRTELFLPFRCFCTRKDIHC  85

Query  186  LDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVFv  365
             D++++ TD+AKAL +YV+ AAIE LV+G+S  +   R K  DIP + SK APDFC+V+V
Sbjct  86   KDVVLEETDVAKALIEYVTQAAIEVLVVGASTKTGFLRFKAADIPGMVSKGAPDFCSVYV  145

Query  366  iskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRSFK  545
            ISK KISS+R+++RPAP  SPL   L          P+     A +SLR    +     K
Sbjct  146  ISKGKISSMRSSSRPAPAISPLRNHLLNQSSLKPTPPESHILPA-NSLRVEKPRLEPPRK  204

Query  546  LEES-ESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSETV  722
              +S ES   P   R       P   +       D+D+SFV+SG RPS DRM     +  
Sbjct  205  SSDSMESFRSPFTRRGLNGKSYPNLHI------PDTDISFVTSG-RPSIDRMFPPFYDNQ  257

Query  723  ESGRT-PRLssssdgsf----gsgRLG-KGNDLNSFTDFSSSSLEN----------DEAE  854
            E+ RT PRLS+ SD        S + G K  D++S  + SS+S ++          D+ E
Sbjct  258  ETIRTAPRLSNVSDIESNISFESMQFGRKSVDISSPPNISSASQDSDKLSNSSASMDDVE  317

Query  855  VEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             EMRRLKLEL++TM++YS+ACKEALTAKQK  ELQ W
Sbjct  318  AEMRRLKLELKQTMEMYSSACKEALTAKQKARELQLW  354



>ref|XP_011082097.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Sesamum indicum]
Length=722

 Score =   269 bits (687),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE+F++SRKIGEGGYGPV+KC LDHT VAVKVLRPDA  GR QFQQE
Sbjct  396   RYRKYTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATHGRSQFQQE  455

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VEILSC+RHPNMV+LLGACPEYGCLVYEYM++GS++D L+ RG  PPLSWQ RFRIAAE+
Sbjct  456   VEILSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLVQRGKTPPLSWQHRFRIAAEI  515

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  516   GTGLLFLHQTKPEPLVHRDLKPANILL  542


 Score =   152 bits (383),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 115/314 (37%), Positives = 166/314 (53%), Gaps = 53/314 (17%)
 Frame = +3

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKR  299
            +AQ K+LF+ F  +CTRK+I C D+++D TD+A++L ++V  +AI+ LV+G++    + R
Sbjct  27   DAQLKELFLPFRVYCTRKDIQCYDVVLDDTDVARSLIEFVKQSAIDMLVVGATAKGSIFR  86

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAP-FASPLHPQLQEIQEQAQNNP  476
             K+ DI     K  PDFCTV+VI K KISS + A RPAP   SPL  Q+  +Q  ++ N 
Sbjct  87   FKMKDIAGTVLKGVPDFCTVYVIHKGKISSTKAACRPAPSILSPLRNQIM-LQANSKYNG  145

Query  477  DIRTKNAPSSLRSFDEKHMRS-------FKLEESESVSRPSIERAATRGIPPRRMLGAET  635
              ++  + ++ RS    H R         +  +S  +  P   R A  G         E 
Sbjct  146  MDQSMGSSANSRSSVTGHSRPGSEPSPRARQNDSNFIKSPFTHRRAPNG------KAYEL  199

Query  636  VEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDL----  803
               ++D+SFVSSG R S D   ++ SE+ E   TP             RL   +D+    
Sbjct  200  STPETDISFVSSGRR-SVDVYPTY-SESFEGSLTP------------PRLSGFSDVDSQG  245

Query  804  -NSFT-------------------DFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKE  923
             +S+T                   D + S    DE E EMRRLK EL++TMD+YSTACKE
Sbjct  246  YDSWTTGRRSLDILPLDLAASPEPDKAFSGQTMDEVEAEMRRLKQELKQTMDMYSTACKE  305

Query  924  ALTAKQKTSELQRW  965
            AL+A++K  ELQRW
Sbjct  306  ALSAREKAKELQRW  319



>gb|AAG09082.1|AC026237_3 Similar to protein kinases [Arabidopsis thaliana]
Length=784

 Score =   270 bits (690),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y++ EIEE T +F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  459   VRYRKYSVQEIEEGTANFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  518

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN PP+SWQ+RFRIAAE
Sbjct  519   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMARGSLDDRLFRRGNTPPISWQLRFRIAAE  578

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  579   IATGLLFLHQTKPEPIVHRDLKPGNVLL  606


 Score =   225 bits (574),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 165/372 (44%), Positives = 228/372 (61%), Gaps = 62/372 (17%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ------HKQQLEAQNKDLFVTFHCFC  164
            +SQ AIKWT ENL ++GQ++ L+HV  ++Q+SL       HKQQ+E Q KDLFV+FHC+C
Sbjct  27   SSQNAIKWTLENLATRGQTLALIHVLPKSQSSLDIEEGITHKQQMEKQTKDLFVSFHCYC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK IHCLD++++  D  KA+ +YV+ +AIENLVLG+ SR+SF++R K TD+PT  SKAA
Sbjct  87   SRKEIHCLDVVLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQ-LQEIQEQAQNNPDIRTKNA-----PS  503
            PDFC V+VISK KISS+RNA+R AP+    HP  L E+ +      + + K A     P 
Sbjct  146  PDFCNVYVISKGKISSLRNASRLAPY----HPSVLSEVDDHETIAIERKHKTANTPALPK  201

Query  504  SLRSFDEKHMRSFKLEESESVSRPSIERAATRGI---------PPR---RMLG-------  626
              RS D    R F     E+     +      G          PP    +++G       
Sbjct  202  GRRSIDSDVTR-FSSVSIENFRISYVYNFLNLGFDFCRLGLPKPPHGHMKLMGDFSDSES  260

Query  627  -----AETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-  788
                 + + +  SDLSF+SSG RPS DR SSF  +  ES RT R+S+SS+ S GS RLG 
Sbjct  261  EFSFISASQQESSDLSFISSG-RPSVDR-SSFTYDLPESARTSRMSTSSEQSIGSHRLGI  318

Query  789  KGNDL------NSFTD--------FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEA  926
            K  DL      +S +D        FSS SL  ++ E +M+RL+LEL++TMD+YS+AC+EA
Sbjct  319  KFTDLSYLNGSSSVSDESGRTSCSFSSQSL--NDVEAQMKRLRLELKQTMDMYSSACREA  376

Query  927  LTAKQKTSELQR  962
            LTA+ + +ELQ+
Sbjct  377  LTARNEATELQK  388



>gb|AAD18110.1| putative protein kinase [Arabidopsis thaliana]
Length=816

 Score =   270 bits (691),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I++IE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  463   VRYRKYSIEDIELATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  522

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  523   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  582

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  583   IGTGLLFLHQAKPEPLVHRDLKPGNILL  610


 Score =   219 bits (559),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 151/360 (42%), Positives = 209/360 (58%), Gaps = 40/360 (11%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  +NLL +GQSV+LVHV             + +   L     L     E  +
Sbjct  29   SSQHALKWAVDNLLQRGQSVILVHVKLRPSPLNNSASLHASSAKLSQDSSLVCRDPEGIS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K++F+ F CFCTRK+I C D+L++ +D+AKAL +YV+ AAIE LV+GSS +  FL+  K 
Sbjct  89   KEIFLPFRCFCTRKDIQCQDVLLEESDVAKALVEYVNQAAIEVLVVGSSSKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDIR  485
            TDIP   +K APDFCTV++ISK KI ++R+A+R AP  +PL   +Q    +  Q  P   
Sbjct  149  TDIPGSITKNAPDFCTVYIISKGKIQTMRSASRSAPMTAPLRSSVQPPSLKPPQPMPSTS  208

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESV---SRPSIERAATRGIPPRRMLGAETVEGD---  647
              +  +  RSF+    RS + ++  S+    R SI+  +     P    G     GD   
Sbjct  209  ANSLRADRRSFESNQRRSVEDQQRRSMEDQQRRSIDDQSESFRSPFTRRGNGRSYGDLTV  268

Query  648  --SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN-------D  800
              SD+SF+SSG RPS DR+   L +  +  RTP   S+      S  L + +       D
Sbjct  269  PESDISFISSG-RPSIDRIFPSLYDNNDPSRTPPRLSNFSDMDYSSSLDQSSNYGRRSVD  327

Query  801  LNSFTDF-----SSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +NS TDF     SS+S   D+ E EMRRLKLEL++TM++YSTACKEALTAKQK +ELQRW
Sbjct  328  MNSPTDFESERFSSASQSIDDVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRW  387



>gb|AID16034.1| putative universal stress protein [Catharanthus roseus]
Length=770

 Score =   269 bits (688),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE AT++F++S KIGEGGYGPV+KC LDHT VAVKVLRPDAAQG+ QFQQ
Sbjct  439   IRYRKYTIEEIESATDYFNQSLKIGEGGYGPVYKCNLDHTPVAVKVLRPDAAQGKSQFQQ  498

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHP+MV+LLGACPEYGCLVYEYM++GS++DRL  RGN PPLSWQ RFRIAAE
Sbjct  499   EVEVLSCIRHPHMVLLLGACPEYGCLVYEYMSNGSLEDRLFRRGNTPPLSWQHRFRIAAE  558

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +G GLLFLHQ KP+P+VHRDLKP NILL
Sbjct  559   IGMGLLFLHQTKPEPLVHRDLKPANILL  586


 Score =   195 bits (495),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 140/360 (39%), Positives = 198/360 (55%), Gaps = 52/360 (14%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHV-----------------------DNQTQTSLQHKQ  113
             SQ A+KW  ENLL++GQ+++L+HV                        N +  +     
Sbjct  19   ASQSALKWAVENLLARGQTILLIHVKIRPGSSSLFSSSSLTMPRLNPISNPSDENGTPGG  78

Query  114  QLEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFL  293
             ++A+ K+LF+ +  +CTRK+I C DI+++ +D  KAL ++VS   +E LVLGS+  +  
Sbjct  79   DIDAETKELFLPYRVYCTRKDIICQDIVLEDSDTVKALLEFVSRTGVEILVLGSATKNSF  138

Query  294  KRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN-  470
             R K  DIP    K  PDFC+V+VISK KI S R A+RPAP    +HP  Q+I +QA + 
Sbjct  139  FRFKAKDIPASVLKGVPDFCSVYVISKGKILSTRTASRPAP---AIHPLRQQILQQANSM  195

Query  471  --------NPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLG  626
                     P I ++    S+       M +    E+ S+  P   R    G  P  ++G
Sbjct  196  SAVSEASLQPPINSRGGAKSVSDLPFPQMSN----ENFSIKSPFNNRKGPNGR-PYELIG  250

Query  627  AETVEGDSDLSFVSSGSRPSGDRM-SSFLSETVESGRT-PRLssssdgsfgsgRLGKGN-  797
            +     DSD+SFVSSG RPS D +  +   E+ E+G T PRLSS S+    S  LG    
Sbjct  251  SL----DSDISFVSSG-RPSIDNLFPANFHESFETGTTPPRLSSFSEMENQSFDLGYPGR  305

Query  798  -DLNSFTDFSSSSLEN---DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
              +++ T   SS +     D+ E EMRRLKLEL++TMD+YSTACKEAL+AKQ+  ELQRW
Sbjct  306  RSVDTLTPPDSSYVSTDSMDDVEAEMRRLKLELKQTMDMYSTACKEALSAKQRAMELQRW  365



>ref|XP_010542113.1| PREDICTED: U-box domain-containing protein 52 [Tarenaya hassleriana]
Length=867

 Score =   271 bits (693),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VR+R+YTI+EIE+ATE+FS+SRKIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  517   VRFRKYTIEEIEQATENFSDSRKIGEGGYGPVYKGTLDHTPVAIKVLRPDAAQGRSQFQQ  576

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L+CMRHPNMV+L+GACPEYGCLVYEYMA+GS+DDRL  R N P L WQ+RFRIAAE
Sbjct  577   EVEVLTCMRHPNMVLLVGACPEYGCLVYEYMANGSLDDRLSRRSNTPVLPWQLRFRIAAE  636

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  637   IATGLLFLHQTKPEPLVHRDLKPGNILL  664


 Score =   135 bits (340),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 101/266 (38%), Positives = 143/266 (54%), Gaps = 53/266 (20%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD---------NQTQTSLQHKQQLEAQNKDLFVTFHC  158
            SQ A+KW  +NL+++ Q++ LVHV          + +  S +H   +    KDLF+ F C
Sbjct  27   SQNALKWAIDNLITRAQTLTLVHVRVKHVPTPPFSGSTPSAKHGDDV----KDLFLPFRC  82

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKA  338
            FC RK+I+C D+++D  D +K L +YV++  IE LVLG+S+ + L R K  D+P+   K 
Sbjct  83   FCARKDINCEDVILDDVDASKGLINYVTENTIETLVLGASKTNLL-RFKAPDVPSSVMKG  141

Query  339  APDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI------------  482
            AP+FCTV+VIS+ KISS R AT   P   PL PQ Q++Q Q +N  DI            
Sbjct  142  APNFCTVYVISRGKISSARPATCSPP--RPLVPQ-QQLQTQPRNRADIGYPKPYTNARAD  198

Query  483  RTKNAPSSLRSFDEKHMRS-FKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLS  659
            R + AP  ++  DE  +RS F     E   +P I                     DSD+S
Sbjct  199  RRQQAPQRMQ--DEMEIRSVFSRRGYEGTYQPLIM--------------------DSDIS  236

Query  660  FVSSGSRPSGDRMSSFLSETVESGRT  737
            FVSSG RPS D+M    S+ ++ G T
Sbjct  237  FVSSG-RPSVDQMFPAFSDNLDVGLT  261



>ref|XP_007161331.1| hypothetical protein PHAVU_001G060600g [Phaseolus vulgaris]
 gb|ESW33325.1| hypothetical protein PHAVU_001G060600g [Phaseolus vulgaris]
Length=779

 Score =   270 bits (689),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI+ IE AT  F+ES+KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  446   LRYRRYTIESIEAATNFFTESQKIGEGGYGPVYKCFLDHTPVAVKVLRPDAAQGRSQFQR  505

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DD L  RGN PP+SWQ+RF+IAAE
Sbjct  506   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDCLFCRGNAPPISWQLRFKIAAE  565

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  566   IGTGLLFLHQTKPEPLVHRDLKPANILL  593


 Score =   176 bits (447),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 140/359 (39%), Positives = 187/359 (52%), Gaps = 55/359 (15%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQL------------------EAQN  131
            SQ A+KWT ++LL+KG +VVL+HV ++  +SL     L                  + Q 
Sbjct  28   SQSALKWTIDHLLTKGSNVVLIHVKHKP-SSLYPSVSLVNPRANGIGEHALVCKDPDEQT  86

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVT  311
            K++F  +  FC RK+IHC D +I+  D+AKAL +Y S  AIE+LV+GSS      R K+ 
Sbjct  87   KEVFHPYRVFCARKDIHCKDTVIEDVDVAKALIEYASQYAIEHLVIGSSHKGGFLRFKIA  146

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTK  491
            D+P   SK APDFCTV+V++K KI S+R+A+R AP  SPL   L       Q  P +   
Sbjct  147  DVPGTVSKGAPDFCTVYVVAKGKIQSMRSASRAAPAFSPLQNLL------TQPEPRLPLA  200

Query  492  NAPSSL--RSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
            N    L  RSF+     S   + S+S   P       RG+   R    E    ++D+SFV
Sbjct  201  NNVKGLERRSFEAPPRVSH--DGSDSFRSPFTR----RGVNNDRY--GEISMPETDISFV  252

Query  666  SSGSRPSGDRMSSFLSETVESGRT----PRLssssdgsfgsgRLGKGNDLNSFTDF----  821
            SS  R S DR+   +        T    PRLS SSD    +      +      D     
Sbjct  253  SS-RRSSTDRLFPSMHSNNNHSETGISNPRLSYSSDIDGTNYSFESIHFGRRSMDISSDF  311

Query  822  -----------SSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                       S++S   D+ E EMRRLKLEL++TM++YS ACKEALTAKQKT ELQRW
Sbjct  312  SSFSQESEGLSSTTSQGMDDVEAEMRRLKLELEQTMEMYSNACKEALTAKQKTVELQRW  370



>ref|XP_010472730.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=760

 Score =   269 bits (688),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F+ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  433   VRYRKYTVEEIEEATSNFAESQKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  492

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA G+++DRL  RGN PP++WQ+RFRIAAE
Sbjct  493   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGNLEDRLFRRGNTPPITWQLRFRIAAE  552

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  553   IATGLLFLHQTKPEPIVHRDLKPGNVLL  580


 Score =   232 bits (591),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 225/353 (64%), Gaps = 51/353 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSL-------QHKQQLEAQNKDLFVTFHCFC  164
            SQ+A+KWT +NL S+GQ++ L+HV +++ +S        Q +QQLE   KDLFV+FHC+C
Sbjct  28   SQHALKWTIDNLASRGQTISLIHVLSKSHSSSDLEDGTPQQRQQLEKIAKDLFVSFHCYC  87

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+C DIL++  D  KA+T+YVS +AIENLV+G +SR+ F++R K TD+PT  SK+A
Sbjct  88   SRKEINCQDILLEDADKVKAITEYVSSSAIENLVVGAASRNGFMRRFK-TDLPTTVSKSA  146

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFD  521
            PDFC+V+VISK KI+SVR+A+RPAP+ + +  Q  EI     + PD     AP       
Sbjct  147  PDFCSVYVISKGKIASVRHASRPAPYHNSM--QQCEIDNHYPHTPD----KAP-------  193

Query  522  EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS-----------  668
            + H  S     + S  R S+E  ATR    RR    +  + DSDLSF+S           
Sbjct  194  KHHDHSNSAGNTPSRPRRSVESDATRSPFVRRKPYGDLYDSDSDLSFISPSSHRESDISF  253

Query  669  -SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-------NDLNSFTD--  818
             S  RPS +R SSF  +  ES RT R+S+SS+ S GS RLG         N+ ++F++  
Sbjct  254  ISSGRPSVER-SSFSLDFPESARTSRMSTSSEQSIGSHRLGLQFSDPGFPNESSTFSEES  312

Query  819  -----FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                 +SS SL  D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ +ELQ+
Sbjct  313  GRTSSYSSQSL--DDVEAEMKRLRLELKQTMDMYSTACKEALSARQQATELQK  363



>ref|XP_009762627.1| PREDICTED: U-box domain-containing protein 34-like, partial [Nicotiana 
sylvestris]
Length=434

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIE AT++F+++ KIGEGGYGPV+KC +DHT VAVKVLRPDAA GR+QFQQE
Sbjct  118   RYRRYSIEEIETATDYFAQANKIGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQE  177

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+L+C+RHP+MV+LLGACPEYGCLVYE+M++GS++D L  RG  PPLSWQ RFRIAAE+
Sbjct  178   VEVLNCIRHPHMVLLLGACPEYGCLVYEFMSNGSLEDLLFQRGKTPPLSWQQRFRIAAEI  237

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             G GLLFLHQ+KP+PIVHRDLKP NILL
Sbjct  238   GAGLLFLHQSKPEPIVHRDLKPANILL  264


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  843  DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            D+   EMRRLKLEL++TM++YSTACKEALTA+Q   ELQRW
Sbjct  1    DDVAAEMRRLKLELKQTMEMYSTACKEALTAQQMAMELQRW  41



>ref|XP_010548526.1| PREDICTED: U-box domain-containing protein 35 isoform X2 [Tarenaya 
hassleriana]
Length=781

 Score =   269 bits (688),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  K+GEGGYGPV+KC LDHT VAVKVL PDAAQGR QFQQ
Sbjct  458   VRYRKYSIEEIERATEFFAEKYKVGEGGYGPVYKCFLDHTPVAVKVLSPDAAQGRSQFQQ  517

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYEYMA+GS++DRL  RGN PPLSWQ RFRI+AE
Sbjct  518   EVEVLSCIRHPNMVLLLGACPECGCLVYEYMANGSLEDRLFRRGNSPPLSWQTRFRISAE  577

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGL+FLHQ KP+P+VHRDLKP NILL
Sbjct  578   IGTGLMFLHQTKPEPLVHRDLKPANILL  605


 Score =   207 bits (526),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 204/356 (57%), Gaps = 43/356 (12%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHK--------QQLE  122
            TSQ A+KWT ++LL +GQSV+L+HV             N     L           +  E
Sbjct  33   TSQNALKWTVDHLLQRGQSVILIHVKLRPSPLSSSPSLNGNSAKLNQINGDASLVCRDPE  92

Query  123  AQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKR  299
               K+L++ F CFCTRK+I C D+L++ +D+AKAL +YV+ A IE LV+G SSR+ F + 
Sbjct  93   GPYKELYLPFRCFCTRKDIQCKDVLLEDSDVAKALVEYVNQAGIEVLVIGTSSRNGFFRF  152

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD  479
             K  DIP   ++ APDFCTV+VISK KIS++R+A+R  P  +PL  QL +   +      
Sbjct  153  NKPADIPGTVTRTAPDFCTVYVISKGKISTMRSASRSPPSVAPLRSQLHQANSKPPQPSP  212

Query  480  IRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLS  659
              +     + R   E   RS   ++S+S  R  + R   +G    R  G E    +SD+S
Sbjct  213  SPSSTNIKAQRQSFESQRRSVD-DQSDSSFRSPLTRRGMQG----RSYG-ELCVPESDIS  266

Query  660  FVSSGSRPSGDRMSSFLSETVESGRTPRLssss----dgsfgsgRLG-KGNDLNSFTDFS  824
            FVSSG RPS DR+ +  ++   S   PRLS+ S      SF +   G K  D+NS  DFS
Sbjct  267  FVSSG-RPSVDRLFANFNDFEPSRTPPRLSNLSDTDFGTSFEAMSYGRKSLDINSPPDFS  325

Query  825  SSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
            S S E+          DE E EMRRLKLEL++TM++YSTACKEALTAKQK +ELQR
Sbjct  326  SGSFESERFSSASQTMDEVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQR  381



>ref|XP_010325202.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Solanum lycopersicum]
Length=689

 Score =   267 bits (683),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE AT +F+ES KIGEGGYGPV+KC +DHT VAVKVLRPDAA GR+QFQQ
Sbjct  372   VRYRRYSIEEIESATNYFAESNKIGEGGYGPVYKCYMDHTHVAVKVLRPDAAHGRQQFQQ  431

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCL+YE+M++GS++DRL  +GN P LSWQ RFRIAAE
Sbjct  432   EVEVLSCIRHPNMVLLLGACPEYGCLIYEFMSNGSLEDRLFQKGNSPALSWQHRFRIAAE  491

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +G GLLFLHQ+KP+PIVHRDLKP NILL
Sbjct  492   IGAGLLFLHQSKPEPIVHRDLKPANILL  519


 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 171/305 (56%), Gaps = 32/305 (10%)
 Frame = +3

Query  114  QLEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFL  293
            +L+ Q K+LF+ F  FCTRK+I C D++++  D+ KA+ +Y++  AIE L+LG++    L
Sbjct  3    ELDPQLKELFLPFRVFCTRKDIQCHDVVLEDADVVKAIVEYINRTAIEVLILGAAAKGGL  62

Query  294  KRLKVTDIPTLTSKAAPDFCTVFvisks-kissvRNATRPAPFASPLHPQLQEIQEQAQN  470
             R K+ DIP    K APDFCTV+VISKS KISS R+A R APF  PL  Q  +      N
Sbjct  63   LRFKLKDIPGNVLKGAPDFCTVYVISKSGKISSTRSAARLAPFVHPLRHQFTQNGNVKSN  122

Query  471  N-------PDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGA  629
            +       P       P  +      ++ S    ++ ++  P   R    G P       
Sbjct  123  SFEDFNVPPRGSISGIPKPVSDMPMSNLHS----DTFNMKSPFTHRKGPNGKP------Y  172

Query  630  ETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRT-PRLssssdgsfgsgR---LGKGN  797
            E  + D+D+SFVSSG RPS D M    +++ +SG T PRLS  SD    S     +G+ +
Sbjct  173  EISQPDTDISFVSSG-RPSIDNMFPSFADSFDSGTTPPRLSGFSDYEGQSFEPMPMGRRS  231

Query  798  DLNSFTDFSSSSLEN---------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTS  950
                 ++ S  S+E          D+   EMRRLKLEL++TM++YSTACKEALTA+QK +
Sbjct  232  LDIMPSEMSLLSMEGDRPSFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKAT  291

Query  951  ELQRW  965
            ELQRW
Sbjct  292  ELQRW  296



>ref|XP_010548525.1| PREDICTED: U-box domain-containing protein 35 isoform X1 [Tarenaya 
hassleriana]
Length=783

 Score =   269 bits (688),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  K+GEGGYGPV+KC LDHT VAVKVL PDAAQGR QFQQ
Sbjct  458   VRYRKYSIEEIERATEFFAEKYKVGEGGYGPVYKCFLDHTPVAVKVLSPDAAQGRSQFQQ  517

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYEYMA+GS++DRL  RGN PPLSWQ RFRI+AE
Sbjct  518   EVEVLSCIRHPNMVLLLGACPECGCLVYEYMANGSLEDRLFRRGNSPPLSWQTRFRISAE  577

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGL+FLHQ KP+P+VHRDLKP NILL
Sbjct  578   IGTGLMFLHQTKPEPLVHRDLKPANILL  605


 Score =   207 bits (526),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 204/356 (57%), Gaps = 43/356 (12%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHK--------QQLE  122
            TSQ A+KWT ++LL +GQSV+L+HV             N     L           +  E
Sbjct  33   TSQNALKWTVDHLLQRGQSVILIHVKLRPSPLSSSPSLNGNSAKLNQINGDASLVCRDPE  92

Query  123  AQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKR  299
               K+L++ F CFCTRK+I C D+L++ +D+AKAL +YV+ A IE LV+G SSR+ F + 
Sbjct  93   GPYKELYLPFRCFCTRKDIQCKDVLLEDSDVAKALVEYVNQAGIEVLVIGTSSRNGFFRF  152

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD  479
             K  DIP   ++ APDFCTV+VISK KIS++R+A+R  P  +PL  QL +   +      
Sbjct  153  NKPADIPGTVTRTAPDFCTVYVISKGKISTMRSASRSPPSVAPLRSQLHQANSKPPQPSP  212

Query  480  IRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLS  659
              +     + R   E   RS   ++S+S  R  + R   +G    R  G E    +SD+S
Sbjct  213  SPSSTNIKAQRQSFESQRRSVD-DQSDSSFRSPLTRRGMQG----RSYG-ELCVPESDIS  266

Query  660  FVSSGSRPSGDRMSSFLSETVESGRTPRLssss----dgsfgsgRLG-KGNDLNSFTDFS  824
            FVSSG RPS DR+ +  ++   S   PRLS+ S      SF +   G K  D+NS  DFS
Sbjct  267  FVSSG-RPSVDRLFANFNDFEPSRTPPRLSNLSDTDFGTSFEAMSYGRKSLDINSPPDFS  325

Query  825  SSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
            S S E+          DE E EMRRLKLEL++TM++YSTACKEALTAKQK +ELQR
Sbjct  326  SGSFESERFSSASQTMDEVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQR  381



>ref|XP_008357473.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=778

 Score =   269 bits (688),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+ESRKIGEGGYGPV++C LDHT VA+KVLRPDAAQGR QF Q
Sbjct  451   VRYRKYSIEEIEAATEFFTESRKIGEGGYGPVYRCXLDHTPVAIKVLRPDAAQGRSQFNQ  510

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN P LSWQ+RF+IAAE
Sbjct  511   EVEVLSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWQLRFKIAAE  570

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  571   IGTGLLFLHQAKPEPLVHRDLKPANILL  598


 Score =   186 bits (471),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 141/372 (38%), Positives = 199/372 (53%), Gaps = 74/372 (20%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHV--------------DNQTQTSLQHKQQL-----EA  125
             SQ A+KW  ++L+  GQSV+L+HV              ++  +++    QQL     + 
Sbjct  27   NSQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWDQQLVCKDPDP  86

Query  126  QNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLK  305
            Q ++LF+ F  FCTRKNI C D++++ +D+ KAL +YV+  AIE+LV+G+S  +   R K
Sbjct  87   QTRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGASAKTGFLRFK  146

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
             +DIP   SK APDFC V+V+SK K+ S R A+RPAP  SPL    +      ++ P + 
Sbjct  147  ASDIPGNISKXAPDFCNVYVVSKQKLQSRRAASRPAPAVSPLRNPARNHTTSPKSEPYV-  205

Query  486  TKNAPSSLRSFDEKHMRSFKLEESE-SVSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
                P S    +EK     +    E    R    R    G        A+    D+D+SF
Sbjct  206  ---FPPSGNKGNEKPPEPPRQSHDEMDFFRSPFTRKGPNG-----KSYADLPMPDTDISF  257

Query  663  VSSGSRPSGDRM-SSFLSETVESGRT--PRLssssdgsfgsgRLGKGNDLN-SFTD----  818
            VSSG RPS DR+  +F +E ++SGR   PR+S+S++            DLN SF      
Sbjct  258  VSSG-RPSIDRIFPAFYNENLDSGRVTPPRMSNSTEV-----------DLNHSFESMQYF  305

Query  819  -----------------------FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEAL  929
                                    SS+S+E+ EA  EMRRLKLEL++TM++YSTACKEAL
Sbjct  306  GRRSVDVSSSPPXFSSVSQDSDRLSSASMEDMEA--EMRRLKLELKQTMEMYSTACKEAL  363

Query  930  TAKQKTSELQRW  965
            +AKQK  ELQRW
Sbjct  364  SAKQKAVELQRW  375



>ref|XP_010548527.1| PREDICTED: U-box domain-containing protein 35 isoform X3 [Tarenaya 
hassleriana]
Length=779

 Score =   269 bits (688),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  K+GEGGYGPV+KC LDHT VAVKVL PDAAQGR QFQQ
Sbjct  454   VRYRKYSIEEIERATEFFAEKYKVGEGGYGPVYKCFLDHTPVAVKVLSPDAAQGRSQFQQ  513

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYEYMA+GS++DRL  RGN PPLSWQ RFRI+AE
Sbjct  514   EVEVLSCIRHPNMVLLLGACPECGCLVYEYMANGSLEDRLFRRGNSPPLSWQTRFRISAE  573

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGL+FLHQ KP+P+VHRDLKP NILL
Sbjct  574   IGTGLMFLHQTKPEPLVHRDLKPANILL  601


 Score =   207 bits (528),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 206/353 (58%), Gaps = 41/353 (12%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD---------------NQTQ--TSLQHKQQLEAQN  131
            TSQ A+KWT ++LL +GQSV+L+HV                NQ     SL  +   E   
Sbjct  33   TSQNALKWTVDHLLQRGQSVILIHVKLRPSPLSSSPSLNELNQINGDASLVCRDP-EGPY  91

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
            K+L++ F CFCTRK+I C D+L++ +D+AKAL +YV+ A IE LV+G SSR+ F +  K 
Sbjct  92   KELYLPFRCFCTRKDIQCKDVLLEDSDVAKALVEYVNQAGIEVLVIGTSSRNGFFRFNKP  151

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
             DIP   ++ APDFCTV+VISK KIS++R+A+R  P  +PL  QL +   +        +
Sbjct  152  ADIPGTVTRTAPDFCTVYVISKGKISTMRSASRSPPSVAPLRSQLHQANSKPPQPSPSPS  211

Query  489  KNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
                 + R   E   RS   ++S+S  R  + R   +G    R  G E    +SD+SFVS
Sbjct  212  STNIKAQRQSFESQRRSVD-DQSDSSFRSPLTRRGMQG----RSYG-ELCVPESDISFVS  265

Query  669  SGSRPSGDRMSSFLSETVESGRTPRLssss----dgsfgsgRLG-KGNDLNSFTDFSSSS  833
            SG RPS DR+ +  ++   S   PRLS+ S      SF +   G K  D+NS  DFSS S
Sbjct  266  SG-RPSVDRLFANFNDFEPSRTPPRLSNLSDTDFGTSFEAMSYGRKSLDINSPPDFSSGS  324

Query  834  LEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
             E+          DE E EMRRLKLEL++TM++YSTACKEALTAKQK +ELQR
Sbjct  325  FESERFSSASQTMDEVEAEMRRLKLELKQTMEMYSTACKEALTAKQKATELQR  377



>ref|XP_011082095.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Sesamum indicum]
Length=780

 Score =   269 bits (688),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE+F++SRKIGEGGYGPV+KC LDHT VAVKVLRPDA  GR QFQQE
Sbjct  454   RYRKYTIEEIEVATEYFAQSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDATHGRSQFQQE  513

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VEILSC+RHPNMV+LLGACPEYGCLVYEYM++GS++D L+ RG  PPLSWQ RFRIAAE+
Sbjct  514   VEILSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLEDCLVQRGKTPPLSWQHRFRIAAEI  573

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  574   GTGLLFLHQTKPEPLVHRDLKPANILL  600


 Score =   177 bits (449),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 135/370 (36%), Positives = 190/370 (51%), Gaps = 71/370 (19%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD-NQTQTSLQHKQQL-----------------EAQN  131
            SQ A+KW  ENLL KGQ+V+LVHV    + T L     L                 +AQ 
Sbjct  29   SQVALKWAVENLLGKGQTVILVHVKLRHSMTGLTTSPSLPGSWPSNNSDITDEIGDDAQL  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVT  311
            K+LF+ F  +CTRK+I C D+++D TD+A++L ++V  +AI+ LV+G++    + R K+ 
Sbjct  89   KELFLPFRVYCTRKDIQCYDVVLDDTDVARSLIEFVKQSAIDMLVVGATAKGSIFRFKMK  148

Query  312  DIPTLTSKAAPDFCTVFviskskissvRNATRPAP-FASPLHPQLQEIQEQAQNNPDIRT  488
            DI     K  PDFCTV+VI K KISS + A RPAP   SPL  Q+  +Q  ++ N   ++
Sbjct  149  DIAGTVLKGVPDFCTVYVIHKGKISSTKAACRPAPSILSPLRNQIM-LQANSKYNGMDQS  207

Query  489  KNAPSSLRSFDEKHMRS-------FKLEESESVSRPSIERAATRGIPPRRMLGAETVEGD  647
              + ++ RS    H R         +  +S  +  P   R A  G         E    +
Sbjct  208  MGSSANSRSSVTGHSRPGSEPSPRARQNDSNFIKSPFTHRRAPNG------KAYELSTPE  261

Query  648  SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDL-----NSF  812
            +D+SFVSSG R S D   ++ SE+ E   TP             RL   +D+     +S+
Sbjct  262  TDISFVSSGRR-SVDVYPTY-SESFEGSLTP------------PRLSGFSDVDSQGYDSW  307

Query  813  T-------------------DFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTA  935
            T                   D + S    DE E EMRRLK EL++TMD+YSTACKEAL+A
Sbjct  308  TTGRRSLDILPLDLAASPEPDKAFSGQTMDEVEAEMRRLKQELKQTMDMYSTACKEALSA  367

Query  936  KQKTSELQRW  965
            ++K  ELQRW
Sbjct  368  REKAKELQRW  377



>ref|XP_009590275.1| PREDICTED: U-box domain-containing protein 52 isoform X2 [Nicotiana 
tomentosiformis]
Length=770

 Score =   269 bits (687),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRYTI+EIE AT++F+++ KIGEGGYGPV+KC +DHT VAVKVLRPDAA GR+QFQQE
Sbjct  454   RYRRYTIEEIETATDYFAQANKIGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQE  513

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYE+M++GS++DRL  RG  PPLSWQ RFRIAAE+
Sbjct  514   VEVLSCIRHPNMVLLLGACPEYGCLVYEFMSNGSLEDRLFQRGKTPPLSWQQRFRIAAEI  573

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             G GLLFLHQ+KP+PIVHRDLKP NILL
Sbjct  574   GAGLLFLHQSKPEPIVHRDLKPANILL  600


 Score =   180 bits (456),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 198/359 (55%), Gaps = 48/359 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD----------------NQ---TQTSLQHKQQLEAQ  128
            SQ A+KW  +NLL++GQ+V+L+HV                 NQ     T      +L+ Q
Sbjct  28   SQVALKWAIDNLLARGQTVILIHVKVKPSASQPPSHTTSRLNQMSDASTDGSGMSELDPQ  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKV  308
             K+LF+ F  FCTRK+I C D++++  D+ KA+ +YV+  AIE L+LG++    L R KV
Sbjct  88   LKELFLPFRVFCTRKDIQCYDVVLEDVDVVKAIVEYVNRTAIEVLILGAAAKGGLLRFKV  147

Query  309  TDIPTLTSKAAPDFCTVFvisks-kissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
             DIP    K  PDFCTV+VISK+ KIS+ R+A+R APF  PL  Q  + Q  A++N    
Sbjct  148  KDIPGNVVKGVPDFCTVYVISKNGKISATRSASRLAPFIHPLRHQFMQ-QGNAKSNTTED  206

Query  486  TKNAPS--SLRSFDEKHMRSFKLEESES----VSRPSIERAATRGIPPRRMLGAETVEGD  647
            + N PS  SL     K +    +   +S    +  P   R    G P       E  + D
Sbjct  207  SLNTPSRGSLSGI-PKPVSDLPMSNLQSDTLNMKSPFTHRKGPNGKP------YEISQPD  259

Query  648  SDLSFVSSGSRPSGDRMSSFLSETVESGRT-PRLssssdgsfgsgR---LGKGNDLNSFT  815
            +D+SFVSSG RPS D M    ++  +SG T PRLS  SD    +     LG+ +     +
Sbjct  260  TDISFVSSG-RPSIDNMFPSFADNYDSGATPPRLSGFSDFEAQNFEPIPLGRRSLDIMPS  318

Query  816  DFSSSSLENDEAE---------VEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + S  S+E D A           EMRRLKLEL++TM++YSTACKEALTA+QK  ELQRW
Sbjct  319  ELSFLSMEGDRASFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKAMELQRW  377



>ref|XP_008378145.1| PREDICTED: U-box domain-containing protein 35 [Malus domestica]
Length=776

 Score =   269 bits (687),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+ESRKIGEGGYGPV++C LDHT VA+KVLRPDAAQGR QF Q
Sbjct  451   VRYRKYSIEEIEAATEFFTESRKIGEGGYGPVYRCXLDHTPVAIKVLRPDAAQGRSQFNQ  510

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN P LSWQ+RF+IAAE
Sbjct  511   EVEVLSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWQLRFKIAAE  570

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  571   IGTGLLFLHQAKPEPLVHRDLKPANILL  598


 Score =   186 bits (471),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 141/371 (38%), Positives = 199/371 (54%), Gaps = 74/371 (20%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------------DNQTQTSLQHKQQL-----EAQ  128
            SQ A+KW  ++L+  GQSV+L+HV              ++  +++    QQL     + Q
Sbjct  28   SQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWDQQLVCKDPDPQ  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKV  308
             ++LF+ F  FCTRKNI C D++++ +D+ KAL +YV+  AIE+LV+G+S  +   R K 
Sbjct  88   TRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGASAKTGFLRFKA  147

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            +DIP   SK APDFC V+V+SK K+ S R A+RPAP  SPL    +      ++ P +  
Sbjct  148  SDIPGNISKXAPDFCNVYVVSKQKLQSRRAASRPAPAVSPLRNPARNHTTSPKSEPYV--  205

Query  489  KNAPSSLRSFDEKHMRSFKLEESE-SVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
               P S    +EK     +    E    R    R    G        A+    D+D+SFV
Sbjct  206  --FPPSGNKGNEKPPEPPRQSHDEMDFFRSPFTRKGPNG-----KSYADLPMPDTDISFV  258

Query  666  SSGSRPSGDRM-SSFLSETVESGRT--PRLssssdgsfgsgRLGKGNDLN-SFTD-----  818
            SSG RPS DR+  +F +E ++SGR   PR+S+S++            DLN SF       
Sbjct  259  SSG-RPSIDRIFPAFYNENLDSGRVTPPRMSNSTEV-----------DLNHSFESMQYFG  306

Query  819  ----------------------FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALT  932
                                   SS+S+E+ EA  EMRRLKLEL++TM++YSTACKEAL+
Sbjct  307  RRSVDVSSSPPXFSSVSQDSDRLSSASMEDMEA--EMRRLKLELKQTMEMYSTACKEALS  364

Query  933  AKQKTSELQRW  965
            AKQK  ELQRW
Sbjct  365  AKQKAVELQRW  375



>ref|XP_009590270.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590271.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590272.1| PREDICTED: U-box domain-containing protein 52 isoform X1 [Nicotiana 
tomentosiformis]
Length=771

 Score =   269 bits (687),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRYTI+EIE AT++F+++ KIGEGGYGPV+KC +DHT VAVKVLRPDAA GR+QFQQE
Sbjct  455   RYRRYTIEEIETATDYFAQANKIGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQE  514

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCLVYE+M++GS++DRL  RG  PPLSWQ RFRIAAE+
Sbjct  515   VEVLSCIRHPNMVLLLGACPEYGCLVYEFMSNGSLEDRLFQRGKTPPLSWQQRFRIAAEI  574

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             G GLLFLHQ+KP+PIVHRDLKP NILL
Sbjct  575   GAGLLFLHQSKPEPIVHRDLKPANILL  601


 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 200/360 (56%), Gaps = 49/360 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD----------------NQ---TQTSLQHKQQLEAQ  128
            SQ A+KW  +NLL++GQ+V+L+HV                 NQ     T      +L+ Q
Sbjct  28   SQVALKWAIDNLLARGQTVILIHVKVKPSASQPPSHTTSRLNQMSDASTDGSGMSELDPQ  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLK  305
             K+LF+ F  FCTRK+I C D++++  D+ KA+ +YV+  AIE L+LG++ +   L+R K
Sbjct  88   LKELFLPFRVFCTRKDIQCYDVVLEDVDVVKAIVEYVNRTAIEVLILGAAAKGGLLRRFK  147

Query  306  VTDIPTLTSKAAPDFCTVFvisks-kissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI  482
            V DIP    K  PDFCTV+VISK+ KIS+ R+A+R APF  PL  Q  + Q  A++N   
Sbjct  148  VKDIPGNVVKGVPDFCTVYVISKNGKISATRSASRLAPFIHPLRHQFMQ-QGNAKSNTTE  206

Query  483  RTKNAPS--SLRSFDEKHMRSFKLEESES----VSRPSIERAATRGIPPRRMLGAETVEG  644
             + N PS  SL     K +    +   +S    +  P   R    G P       E  + 
Sbjct  207  DSLNTPSRGSLSGI-PKPVSDLPMSNLQSDTLNMKSPFTHRKGPNGKP------YEISQP  259

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTP-RLssssdgsfgsgR---LGKGNDLNSF  812
            D+D+SFVSSG RPS D M    ++  +SG TP RLS  SD    +     LG+ +     
Sbjct  260  DTDISFVSSG-RPSIDNMFPSFADNYDSGATPPRLSGFSDFEAQNFEPIPLGRRSLDIMP  318

Query  813  TDFSSSSLENDEAE---------VEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            ++ S  S+E D A           EMRRLKLEL++TM++YSTACKEALTA+QK  ELQRW
Sbjct  319  SELSFLSMEGDRASFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKAMELQRW  378



>gb|KHN16699.1| U-box domain-containing protein 35 [Glycine soja]
Length=789

 Score =   269 bits (687),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
             PVRYR+YTI+EIEEAT+ FS S KIGEGGYGPV++  LDHT VA+KVL+PDAAQGR QFQ
Sbjct  441   PVRYRKYTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQ  500

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             QEVE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DD L  RGNKP L WQ+RFRIAA
Sbjct  501   QEVEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAA  560

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  561   EIATGLLFLHQTKPEPLVHRDLKPGNILL  589


 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 139/368 (38%), Positives = 196/368 (53%), Gaps = 67/368 (18%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHV-----------------DNQTQTSLQHKQQLEAQN  131
            TSQYA KW  +NLL K Q+++LVHV                 D     +  + QQ++ ++
Sbjct  25   TSQYAAKWAVDNLLPKDQALLLVHVRQKASSIPTPTGNLVSLDGNDDVTRAYMQQMDNES  84

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
            K+LF +F  FC RK+I C +IL++  DI+K L + +S  ++E LVLG+ SR   ++R ++
Sbjct  85   KELFASFRVFCNRKSIQCKEILLEDMDISKGLIEGISKYSVELLVLGAASRSGLVRRFRI  144

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRP-APFASPLHPQLQEIQE-QAQNNPDI  482
            +DIP+  SK AP FCTV++I+K KISSV+ AT P     S  +  +Q +Q  Q     D 
Sbjct  145  SDIPSAVSKGAPPFCTVYIIAKGKISSVKTATAPLTAKPSTRNNTMQPLQSFQTPERMDT  204

Query  483  RTKNAPSSLRSFDEKH---MRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            +    P   RS  EK    +R     E E +S        TR  P R     E+   DSD
Sbjct  205  QITRNPIPPRSSTEKPSYIVRQLPSNEDEIIS------PFTR--PGRGNCRYESTIPDSD  256

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFT------  815
            +SFVSSG RPS DR+   + + ++SG   RLS+           G   D+ SF       
Sbjct  257  ISFVSSG-RPSVDRLFPSMYDDMDSGMNTRLST-----------GSDFDVRSFGSSFSGA  304

Query  816  ------DFSSSSLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
                  D+S SS ++            +E E E+RRLKLEL++TM++YS+ CKEA TAKQ
Sbjct  305  KSIDHGDYSFSSQDSGTSMSSSMFSASEEVEAEVRRLKLELKQTMEMYSSVCKEATTAKQ  364

Query  942  KTSELQRW  965
            K  ELQRW
Sbjct  365  KALELQRW  372



>ref|XP_006450083.1| hypothetical protein CICLE_v10010213mg [Citrus clementina]
 gb|ESR63323.1| hypothetical protein CICLE_v10010213mg [Citrus clementina]
Length=1175

 Score =   273 bits (698),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+++RKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  842   VRYRKYSIEEIEAATEFFTDTRKIGEGGYGPVYKCYLDHTPVAIKVLRPDAAQGRSQFQQ  901

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYE+MA+GS++DRLM RG  PPLSWQ+RF+IAAE
Sbjct  902   EVEILSCIRHPNMVLLLGACPEYGCLVYEFMANGSLEDRLMRRGQSPPLSWQLRFKIAAE  961

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  962   IGTALLFLHQTKPEPLVHRDLKPANILL  989


 Score =   214 bits (545),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 153/354 (43%), Positives = 213/354 (60%), Gaps = 49/354 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVD----NQTQTSLQHKQQLEAQNKDLFVTFHCFCTRK  173
            SQ AIKW  +N+L+KGQ++VL+HV     + + +        + Q +++F+ F CFCTRK
Sbjct  428  SQNAIKWAIDNILTKGQTLVLIHVKIRSASLSPSPSLISPNPDPQTREIFLPFRCFCTRK  487

Query  174  NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRH-SFLKRLKVTDIPTLTSKAAPDF  350
            +I C D++++ TD+AKAL +YVS  AIE LV+G+S +  FL+R K TD+P   SK APDF
Sbjct  488  DIQCKDVVLEDTDVAKALIEYVSQTAIETLVVGASNNKGFLRRFKTTDVPGNVSKGAPDF  547

Query  351  CTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN-----------NPDIRTKNA  497
            CTV+VISK KISS+R+A+RPAP  SPL  Q+     Q +             P  R +  
Sbjct  548  CTVYVISKGKISSMRSASRPAPAVSPLRNQIIIRPPQPERPAPQPPPIRVPTPTERPQME  607

Query  498  PSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGS  677
            P    + D +  RS    +  +  +   +RAA    PP           D+D+SFVSSG 
Sbjct  608  PPRKSNDDAEFFRSPFTRKQFNGKQGGEQRAA----PPH----------DTDISFVSSG-  652

Query  678  RPSGDRMSSFLSETVE--SGRTP-RLs----sssdgsfgsgRLGKGN-DLNSFTDFSSSS  833
            RPS DR+     + +E  + RTP RLS      S+ SF S ++G+ + D+ S + FSS+S
Sbjct  653  RPSIDRIFPAFFDNIENSANRTPPRLSNLSDMESNNSFESMQIGRRSLDIGSPSGFSSAS  712

Query  834  LEND----------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             END          + E EMRRL+LEL++TM++YSTACKEALTAKQK +ELQRW
Sbjct  713  GENDRSSSASQGLDDVEAEMRRLRLELKQTMEMYSTACKEALTAKQKATELQRW  766



>ref|XP_006584790.1| PREDICTED: U-box domain-containing protein 35-like [Glycine max]
Length=789

 Score =   269 bits (687),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
             PVRYR+YTI+EIEEAT+ FS S KIGEGGYGPV++  LDHT VA+KVL+PDAAQGR QFQ
Sbjct  441   PVRYRKYTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQ  500

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             QEVE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DD L  RGNKP L WQ+RFRIAA
Sbjct  501   QEVEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAA  560

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  561   EIATGLLFLHQTKPEPLVHRDLKPGNILL  589


 Score =   180 bits (457),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 138/368 (38%), Positives = 196/368 (53%), Gaps = 67/368 (18%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHV-----------------DNQTQTSLQHKQQLEAQN  131
            TSQYA KW  +NLL K Q+++LVHV                 D     +  + QQ++ ++
Sbjct  25   TSQYAAKWAVDNLLPKDQALLLVHVRQKASSIPTPTGNLVSLDGNDDVTRAYMQQMDNES  84

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
            K+LF +F  FC RK+I C +IL++  DI+K L + +S  ++E LVLG+ SR   ++R ++
Sbjct  85   KELFASFRVFCNRKSIQCKEILLEDMDISKGLIEGISKYSVELLVLGAASRSGLVRRFRI  144

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRP-APFASPLHPQLQEIQE-QAQNNPDI  482
            +DIP+  SK AP FCTV++I+K KISSV+ +T P     S  +  +Q +Q  Q     D 
Sbjct  145  SDIPSAVSKGAPPFCTVYIIAKGKISSVKTSTAPLTAKPSTRNNTMQPLQSFQTPERMDT  204

Query  483  RTKNAPSSLRSFDEKH---MRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            +    P   RS  EK    +R     E E +S        TR  P R     E+   DSD
Sbjct  205  QITRNPIPPRSSTEKPSYIVRQLPSNEDEIIS------PFTR--PGRGNCRYESTIPDSD  256

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFT------  815
            +SFVSSG RPS DR+   + + ++SG   RLS+           G   D+ SF       
Sbjct  257  ISFVSSG-RPSVDRLFPSMYDDMDSGMNTRLST-----------GSDFDVRSFGSSFSGA  304

Query  816  ------DFSSSSLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
                  D+S SS ++            +E E E+RRLKLEL++TM++YS+ CKEA TAKQ
Sbjct  305  KSIDHGDYSFSSQDSGTSMSSSMFSASEEVEAEVRRLKLELKQTMEMYSSVCKEATTAKQ  364

Query  942  KTSELQRW  965
            K  ELQRW
Sbjct  365  KALELQRW  372



>ref|XP_009353332.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=776

 Score =   268 bits (686),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+ESRKIGEGGYGPV++C LDHT VA+KVLRPDAAQGR QF Q
Sbjct  451   VRYRKYSIEEIEAATEFFTESRKIGEGGYGPVYRCNLDHTPVAIKVLRPDAAQGRSQFNQ  510

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN P LSWQ+RF+IAAE
Sbjct  511   EVEVLSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWQLRFKIAAE  570

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  571   IGTGLLFLHQAKPEPLVHRDLKPANILL  598


 Score =   191 bits (484),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 202/358 (56%), Gaps = 48/358 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------------DNQTQTSLQHKQQL-----EAQ  128
            SQ A+KW  ++L+  GQSV+L+HV              ++  +++    QQL     + Q
Sbjct  28   SQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWDQQLVCKDPDPQ  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKV  308
             ++LF+ F  FCTRKNI C D++++ +D+ KAL +YV+  AIE+LV+G+S  +   R K 
Sbjct  88   TRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGASAKTGFLRFKA  147

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            +DIP   SKAAPDFC V+V+SK K+ S R A+RPAP  SPL    +      ++ P +  
Sbjct  148  SDIPGNLSKAAPDFCNVYVVSKQKLQSRRAASRPAPAVSPLRNPARNHTPSPKSEPYV--  205

Query  489  KNAPSSLRSFDEKHMRSFKLEESE-SVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
               P S    +EK     +    E    R    R    G        A+    D+D+SFV
Sbjct  206  --FPHSGNKGNEKPPEPPRQSHDEMDYFRSPFTRKGPNG-----KSYADLPTPDTDISFV  258

Query  666  SSGSRPSGDRM-SSFLSETVESGRT--PRLssssd-----gsfgsgRLGKGN-DLNSF-T  815
            SSG RPS DR+  +F +E ++SGR   PR+S+S++             G+ + D++S   
Sbjct  259  SSG-RPSIDRIFPAFYNENLDSGRVTPPRMSNSTEIDLNHSFESMQYFGRRSVDVSSSPP  317

Query  816  DFSSSSLEND--------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             FSS S ++D        + E EMRRLKLEL++TM++YSTACKEAL+AKQK  ELQRW
Sbjct  318  TFSSVSQDSDRLSSASMEDMEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRW  375



>ref|XP_010261770.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
 ref|XP_010261771.1| PREDICTED: U-box domain-containing protein 35-like [Nelumbo nucifera]
Length=806

 Score =   269 bits (687),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 180/253 (71%), Gaps = 25/253 (10%)
 Frame = +3

Query  831   SLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL-----------------Q  959
             SLE+ +AE  +RRLKLELQ+TMD+Y+ ACK+AL+A Q  ++L                 +
Sbjct  398   SLEDGDAE--LRRLKLELQQTMDVYNKACKDALSAHQMVNDLNSRRAEEAAIQMAENERE  455

Query  960   RWrveeerrineeevnekskssvtsetkktggge------nMPVPVRYRRYTIDEIEEAT  1121
             R+R   E     +    ++   + +E K     E      ++ V VRYRRYT  EI++AT
Sbjct  456   RYRTYPEASQIAQVAEIETNKRINAENKLLQEMENKKVFDSLSVDVRYRRYTAQEIQKAT  515

Query  1122  EHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEVEILSCMRHPNMVM  1301
             + FSE  KIGEGGYGPVFK  LDHT VA+K+L+ +A+QG  QFQQEVE+LSC+RHPNMV+
Sbjct  516   DCFSEDLKIGEGGYGPVFKGTLDHTLVAIKILQSNASQGMRQFQQEVEVLSCIRHPNMVL  575

Query  1302  LLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMGTGLLFLHQNKPDP  1481
             L+GACPEYG LVYE+MA+GS++DRL  R N PPLSWQ+RF+IAAE+ TGLLFLHQ KP+P
Sbjct  576   LMGACPEYGSLVYEFMANGSLEDRLFCRDNTPPLSWQLRFKIAAEVATGLLFLHQTKPEP  635

Query  1482  IVHRDLKPGNILL  1520
             +VHRDLKP NILL
Sbjct  636   LVHRDLKPANILL  648


 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 93/154 (60%), Gaps = 19/154 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT------------------SLQHKQQLEAQN  131
            SQ+A++WT ++L SK Q  +L+HV  +  T                  +    +Q + Q 
Sbjct  28   SQHALRWTADHLASKAQPFILLHVRKKPLTIPTPSGRQVPISEVNEEVAYAFLEQADLQT  87

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
            K++ + + C+C R+ +   +++ID TD+ +A+ +YV    I+ LVLG SSR++ ++  K 
Sbjct  88   KEILLPYQCYCNRRGLQYKEVIIDDTDVPRAIVNYVLQENIDKLVLGASSRNAIMRTFKG  147

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRP  410
             D+PT  SKAAP+FC+V+VISK +ISSVR AT P
Sbjct  148  ADVPTSVSKAAPEFCSVYVISKGRISSVRPATNP  181



>gb|KHM99859.1| U-box domain-containing protein 35 [Glycine soja]
Length=774

 Score =   268 bits (685),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +3

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
             P RYR+YTI+EIEEAT+ FS S KIGEGGYGPV++  LDHT VA+KVL+PDAAQGR QFQ
Sbjct  426   PARYRKYTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQ  485

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             QEVE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DD L  RGNKP L WQ+RFRIAA
Sbjct  486   QEVEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAA  545

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  546   EIATGLLFLHQTKPEPLVHRDLKPGNILL  574


 Score =   192 bits (488),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 138/355 (39%), Positives = 199/355 (56%), Gaps = 56/355 (16%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQT--SLQHKQQLEAQNKDLFVTFHCFCTRKN  176
            TSQYA KW  +NLL K Q+++L+HV  +  +  +  + QQ++ ++K+LF +F  FC RK+
Sbjct  25   TSQYAAKWAVDNLLPKDQALLLLHVRQRVSSIPTPTYMQQMDNESKELFASFRVFCNRKS  84

Query  177  IHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAPDFC  353
            I C +IL++  DI+K L + +S  ++E LVLG +SR   ++R + +D+P+L SK AP FC
Sbjct  85   IQCKEILLEDMDISKGLIEGISKYSVELLVLGAASRSGLVRRFRTSDVPSLVSKGAPPFC  144

Query  354  TVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN--NPDIRTKNAPSSLRSFDEK  527
            TV++I+K KISSV+ AT P     P      + Q+  Q     D +    P   R   EK
Sbjct  145  TVYIIAKGKISSVKTATAPLTAKPPARNNTMQPQQSLQTPERMDTQITRNPIPPRPSSEK  204

Query  528  H---MRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRM  698
                +R    +E E +S     R+  RG      +  E+   DSD+SFVSSG RPS DRM
Sbjct  205  PSYIVRQLSSDEDEIIS--PFTRSG-RG----NYISYESSIPDSDISFVSSG-RPSVDRM  256

Query  699  SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLN------SFT--------DFSSSSL  836
               + + ++SG              + RL  G+D +      SF+        D+S SS 
Sbjct  257  FPSMYDDMDSG--------------TNRLSTGSDFDVRSFGSSFSGAKSIDHGDYSFSSQ  302

Query  837  E------------NDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +            +DE E EMRRLKLEL++TM+LYS+ACKEA+TAKQK  ELQRW
Sbjct  303  DSGTSMSSSMFSASDEVEAEMRRLKLELKQTMELYSSACKEAMTAKQKALELQRW  357



>ref|XP_009334996.1| PREDICTED: U-box domain-containing protein 52 [Pyrus x bretschneideri]
Length=790

 Score =   268 bits (686),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             +YRRY+I+EIEEATEHFS SRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+E
Sbjct  444   KYRRYSIEEIEEATEHFSPSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQKE  503

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             ++ILSC+RHPNMV+LLGACPEYG LVYEYMA+GS+DD L  +GN P LSWQ+RF+IAAE+
Sbjct  504   IDILSCIRHPNMVLLLGACPEYGILVYEYMANGSLDDCLSRKGNTPALSWQLRFQIAAEV  563

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  564   ATGLLFLHQTKPEPLVHRDLKPGNILL  590


 Score =   218 bits (555),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 156/353 (44%), Positives = 216/353 (61%), Gaps = 48/353 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ------------------HKQQLEAQN  131
            SQ A++W  E+LL+KGQ+V+L+HV  +T +                     HKQQLE   
Sbjct  30   SQNALRWAAEHLLTKGQTVILLHVVQKTSSVCSSSGNNAIVCNINNPFQSPHKQQLEKMT  89

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKV  308
            KDLF+TFHC+C RK+I+C+DI+++ +DIAKA+T+Y S AAIENLVLG+ ++H F+ R K 
Sbjct  90   KDLFLTFHCYCARKDINCIDIILENSDIAKAVTEYASCAAIENLVLGAPTKHGFI-RFKS  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            + IP+  SK APDFCTV+VISK KI S R+A+RPA ++SPL  Q++ + +Q+    +   
Sbjct  149  SSIPSSVSKGAPDFCTVYVISKGKIHSERHASRPAAYSSPLLAQIEALNQQSAKAAETPG  208

Query  489  KNAPSSLR-SFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
            +N     R SF  +++        +  +R    R    G    R+ G  + E +S+ SF+
Sbjct  209  QNMYLKARPSFKPRNL-------PDEAARYIYTRGG--GFSNGRISGGFS-ESESERSFI  258

Query  666  SSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLEN  842
            SS  R S DR SS + E ++ G   RLS+ SD  FGS RLG K  +LN   +F S S E+
Sbjct  259  SS-DRASTDRASSVMYEYMDRG---RLSTVSDQGFGSMRLGPKFAELNFPQEFLSISHES  314

Query  843  D------------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +            E E EMRRLKLEL++TMD+YSTAC+EALTAKQK  EL  W
Sbjct  315  NQTSSSWSSENLEEVESEMRRLKLELKQTMDMYSTACREALTAKQKEMELHSW  367



>ref|XP_006601602.1| PREDICTED: U-box domain-containing protein 52-like [Glycine max]
Length=801

 Score =   268 bits (686),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE AT  F+ES+KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  468   VRYRKYTIEEIEAATNFFTESQKIGEGGYGPVYKCHLDHTPVAVKVLRPDAAQGRSQFQR  527

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS+DDRL  RGN  P+ WQ+RFRIAAE
Sbjct  528   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLDDRLFCRGNTHPIPWQLRFRIAAE  587

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  588   IGTGLLFLHQTKPEPLVHRDLKPANILL  615


 Score =   167 bits (424),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 141/368 (38%), Positives = 197/368 (54%), Gaps = 51/368 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQL----------------------  119
            SQ A+KW  ++LL+KG +VVL++V ++  +       +                      
Sbjct  28   SQNALKWAIDHLLTKGSNVVLLYVKHKPSSLSASASLMTPRVVANGIGHPEPSALVCHDP  87

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKR  299
            + + K++F  +  FC RK+IHC D++++  DI+KAL +Y S  AIE+LV+GSS      R
Sbjct  88   DDKTKEIFRPYRVFCARKDIHCKDVVLEDVDISKALIEYASQYAIEHLVIGSSNKGGFLR  147

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNN--  473
             KV DIP   SK APDFCTV+V++K KI S+R+A+R AP  SPL  QL     ++ ++  
Sbjct  148  FKVADIPGTVSKGAPDFCTVYVVAKGKIQSMRSASRAAPAFSPLQNQLSHASARSDHSEP  207

Query  474  --PDIRTKNAPSSLRSFDEKHMRSFKL-EESESVSRPSIERAATRGIPPRRMLGAETVEG  644
              P +     P   RSF+    RS     +S   +  S     TR     +  G  +V  
Sbjct  208  RGPLVNGAKGPER-RSFEAPPRRSQDAPRKSNDGTTDSFRSPFTRRGMYDKSYGEISVP-  265

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETV-----ESG-RTPRLssssdg-----sfgsgRLGK  791
            DSD+SFVSS  RPS D +   L         E+G   PRLS SSD      SF S   G+
Sbjct  266  DSDISFVSS-RRPSTDPLFPSLYNNNNNNHSETGISNPRLSYSSDTDGNNYSFESMHFGR  324

Query  792  GN-DLNSFT--------DFSSSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
             + D++S            SSS+L   D+ E EMRRLKLEL++T++LY+ A KEALTA+Q
Sbjct  325  RSMDISSDFSSFSQESEGLSSSALRGVDDVEAEMRRLKLELKQTIELYNNAYKEALTAQQ  384

Query  942  KTSELQRW  965
            K  ELQRW
Sbjct  385  KAVELQRW  392



>ref|XP_010472443.1| PREDICTED: U-box domain-containing protein 52-like [Camelina 
sativa]
Length=803

 Score =   268 bits (686),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  478   VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQQ  537

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+R+RIAAE
Sbjct  538   EVEVLSCIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRYRIAAE  597

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +G GLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  598   IGIGLLFLHQAKPEPLVHRDLKPGNILL  625


 Score =   214 bits (546),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 214/375 (57%), Gaps = 55/375 (15%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV             + +   L  +  L     E  +
Sbjct  29   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLTNIPSLHASSAKLSQESSLVCRDPEGIS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K+LF+ F CFCTRK+I C D+L++ TD+AKAL +Y + AAIE LV+GSS +  FL+  K 
Sbjct  89   KELFLPFRCFCTRKDIQCQDVLLEETDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDIR  485
            TDIP    K+APDFCTV+VISK KI ++R+A+R AP ++PL   +Q    +  Q  P   
Sbjct  149  TDIPGTIIKSAPDFCTVYVISKGKIQTMRSASRSAPISAPLRNPVQPPSLKPPQPMPSTS  208

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESVS-------------RPSIERAATRGIPPRRMLG  626
            T N  +  RSF+ +  RS + ++    +             R S+E  +     P    G
Sbjct  209  TNNMRAERRSFESQQRRSIEDQQQRRSTEDHQRRSMEDYHQRRSMEDQSESFKSPFTRRG  268

Query  627  AETVEGD-----SDLSFVSSGSRPSGDRMSSFLSETVESGRTP-RLssssdgsfgsgRLG  788
                 GD     SD+SFVSSG RPS DR+   L +  +  RTP RLS+ SD  +GS    
Sbjct  269  NGRSYGDLSVPESDISFVSSG-RPSIDRIFPSLYDNNDPNRTPPRLSNFSDMDYGSNFDQ  327

Query  789  KGN------DLNSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACK  920
              N      D+NS TD SS S E+          D+ E EMRRLKLEL++TM++YSTACK
Sbjct  328  SSNYGRRSMDMNSPTDMSSGSFESERFSSASQTIDDVEAEMRRLKLELKQTMEMYSTACK  387

Query  921  EALTAKQKTSELQRW  965
            EALTAK K +ELQRW
Sbjct  388  EALTAKHKATELQRW  402



>ref|XP_009396685.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=756

 Score =   268 bits (684),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI+EIE ATE+F+  RKIGEGGYGPV++C LDHT VAVKVLRPDAAQGR QFQQ
Sbjct  411   LRYRRYTIEEIEVATEYFANERKIGEGGYGPVYRCYLDHTPVAVKVLRPDAAQGRSQFQQ  470

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEIL C+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN PP+ WQ RFRI AE
Sbjct  471   EVEILCCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNTPPIPWQHRFRITAE  530

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +G  LLFLHQ KP+P+VHRDLKP NILL
Sbjct  531   IGMCLLFLHQTKPEPLVHRDLKPANILL  558


 Score =   201 bits (512),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 137/327 (42%), Positives = 198/327 (61%), Gaps = 25/327 (8%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIH  182
            +SQ A+KW  +N++++GQ++ L+HV+ +  +  +      A ++D+F+ F CFCTRK++ 
Sbjct  28   SSQSALKWALDNVVTRGQTLTLIHVNTRPSSGYRDDASSAAISRDVFIPFRCFCTRKDVQ  87

Query  183  CLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAPDFCTV  359
            C D++++ TD+A+A++D+++ AAIE LV+G SSR  F++  +  D+     K  PDFCTV
Sbjct  88   CKDVILEDTDVAEAISDFITHAAIEKLVVGSSSRGGFVRSFRTIDLSASICKGVPDFCTV  147

Query  360  FviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNP---DIRTKNAPSSLRSFDEKH  530
            ++ISK K+SS+RNA RP P  S L  Q   IQEQA  NP   D + KN P       E  
Sbjct  148  YIISKGKVSSMRNAVRPPPTISSLRNQ---IQEQASVNPEPQDHKPKNVP------HEAA  198

Query  531  MRSFKLE-ESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMS-S  704
            +  + L+ ++ES+  P      TRG           +  DSD+SFVSSG    G  M  S
Sbjct  199  LSPWCLQKDAESIKSP-----FTRGGRTSTTKSYGDLMLDSDISFVSSG----GTSMEHS  249

Query  705  FLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLENDEAEVEMRRLKLEL  884
            F   +     +  LS  S         G GNDL+SF+  SSSS   ++ E E+RRL+L+L
Sbjct  250  FPPRSSNVSDSFDLSFESLSRSLGSNSG-GNDLSSFSYESSSSQAMEDVEAEIRRLRLQL  308

Query  885  QKTMDLYSTACKEALTAKQKTSELQRW  965
            ++TMD+YSTACKEALTAKQK  ELQRW
Sbjct  309  KQTMDMYSTACKEALTAKQKAMELQRW  335



>ref|XP_003588643.1| Protein kinase catalytic domain-containing protein, partial [Medicago 
truncatula]
Length=500

 Score =   261 bits (667),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY I+EIE AT  F++S KIGEGGYGPV+KC+LDHT VAVKVLRPDA QGR QFQ+
Sbjct  167   VRYRRYAIEEIEAATSFFTDSLKIGEGGYGPVYKCLLDHTPVAVKVLRPDAQQGRSQFQR  226

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MA+GS+DD L  RGN  PL WQ+RF+IAAE
Sbjct  227   EVEVLSCIRHPNMVLLLGACPEYGCLVYEHMANGSLDDCLFCRGNTHPLPWQLRFKIAAE  286

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  287   IGTGLLFLHQTKPEPLVHRDLKPANILL  314


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  843  DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            D+ E EMRRLKLEL++TM++YSTACKEALTA+QK  ELQRW
Sbjct  51   DDVEAEMRRLKLELKQTMEMYSTACKEALTAQQKAVELQRW  91



>ref|XP_006843202.1| hypothetical protein AMTR_s00146p00101680 [Amborella trichopoda]
 gb|ERN04877.1| hypothetical protein AMTR_s00146p00101680 [Amborella trichopoda]
Length=759

 Score =   267 bits (683),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE ATE+FSES KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  402   VRYRKYTIEEIELATEYFSESLKIGEGGYGPVYKSTLDHTPVAIKVLRPDAAQGRMQFQQ  461

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS+DDRL  RGN P L W +RF+IAAE
Sbjct  462   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLDDRLFRRGNSPSLPWPLRFKIAAE  521

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  522   VATGLLFLHQTKPEPLVHRDLKPANILL  549


 Score = 89.7 bits (221),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +3

Query  105  HKQQLEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-R  281
            H +Q+EA  + LF+ +  FC+R+ +   +++++  +++K++ +Y++++ I+++V+GSS R
Sbjct  18   HLEQVEADMQQLFLPYRGFCSRRQMQHKEVVLEDYEVSKSIIEYLTNSCIDSIVVGSSSR  77

Query  282  HSFLKRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQ  446
            ++  K+ K  D+P+  +K AP+FCTV+VI K K+ S+R+A+RPAP +S   PQ Q
Sbjct  78   NALTKKFKPPDVPSCLTKGAPEFCTVYVICKGKVQSLRSASRPAPGSSKQAPQSQ  132


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  822  SSSSLEN-DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            SS S +N  + E E+RRLKLEL++TMD+YS+ACKEA+TAKQK  EL +W
Sbjct  278  SSFSAQNPKDVEAEVRRLKLELKQTMDMYSSACKEAITAKQKARELNQW  326



>ref|XP_006580498.1| PREDICTED: U-box domain-containing protein 35-like isoform X2 
[Glycine max]
Length=789

 Score =   268 bits (685),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +3

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
             P RYR+YTI+EIEEAT+ FS S KIGEGGYGPV++  LDHT VA+KVL+PDAAQGR QFQ
Sbjct  441   PARYRKYTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQ  500

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             QEVE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DD L  RGNKP L WQ+RFRIAA
Sbjct  501   QEVEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAA  560

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  561   EIATGLLFLHQTKPEPLVHRDLKPGNILL  589


 Score =   187 bits (474),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 140/370 (38%), Positives = 201/370 (54%), Gaps = 71/370 (19%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQT---------SLQ--------HKQQLEAQN  131
            TSQYA KW  +NLL K Q+++L+HV  +  +         SL+        + QQ++ ++
Sbjct  25   TSQYAAKWAVDNLLPKDQALLLLHVRQRVSSIPTPTGNLVSLEGNDDVARAYMQQMDNES  84

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
            K+LF +F  FC RK+I C +IL++  DI+K L + +S  ++E LVLG +SR   ++R + 
Sbjct  85   KELFASFRVFCNRKSIQCKEILLEDMDISKGLIEGISKYSVELLVLGAASRSGLVRRFRT  144

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN--NPDI  482
            +D+P+L SK AP FCTV++I+K KISSV+ AT P     P      + Q+  Q     D 
Sbjct  145  SDVPSLVSKGAPPFCTVYIIAKGKISSVKTATAPLTAKPPARNNTMQPQQSLQTPERMDT  204

Query  483  RTKNAPSSLRSFDEKH---MRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            +    P   R   EK    +R    +E E +S     R+  RG      +  E+   DSD
Sbjct  205  QITRNPIPPRPSSEKPSYIVRQLSSDEDEIIS--PFTRSG-RG----NYISYESSIPDSD  257

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLN------SFT  815
            +SFVSSG RPS DRM   + + ++SG              + RL  G+D +      SF+
Sbjct  258  ISFVSSG-RPSVDRMFPSMYDDMDSG--------------TNRLSTGSDFDVRSFGSSFS  302

Query  816  --------DFSSSSLE------------NDEAEVEMRRLKLELQKTMDLYSTACKEALTA  935
                    D+S SS +            +DE E EMRRLKLEL++TM+LYS+ACKEA+TA
Sbjct  303  GAKSIDHGDYSFSSQDSGTSMSSSMFSASDEVEAEMRRLKLELKQTMELYSSACKEAMTA  362

Query  936  KQKTSELQRW  965
            KQK  ELQRW
Sbjct  363  KQKALELQRW  372



>ref|XP_007014561.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOY32180.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
Length=799

 Score =   268 bits (685),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRYTI+EIE ATEHFS SRKIGEGGYGPV+KC LDHT VA+KVLRPDAAQG  QF Q
Sbjct  455   LRYRRYTIEEIEAATEHFSPSRKIGEGGYGPVYKCNLDHTPVAIKVLRPDAAQGESQFHQ  514

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+G+++DRL  R N P L WQVRFRIAAE
Sbjct  515   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGNLEDRLFRRNNTPVLPWQVRFRIAAE  574

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  575   IATGLLFLHQTKPEPLVHRDLKPANILL  602


 Score =   185 bits (469),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 141/371 (38%), Positives = 200/371 (54%), Gaps = 63/371 (17%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHV------------------DNQTQTSLQHKQQLEAQ  128
            +SQYA+KW  ++L+S+GQ++ L+HV                  D     +  +KQQL+ Q
Sbjct  23   SSQYALKWVVDHLMSRGQTITLLHVKTKPSSIPTPTGNHVNISDVNDDVAKAYKQQLDNQ  82

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLK  305
             K++F+ F CFC+RK+I C +I+++ TDIAKAL D+V  ++IE LVLG+ S+  F++R +
Sbjct  83   AKEVFLPFRCFCSRKDIKCNEIILEDTDIAKALIDFVLSSSIETLVLGAPSKSGFVRRFR  142

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
             +D+PT  SK APD+CTV+VI K KISSVR+A+  AP  +   P     Q Q  N   + 
Sbjct  143  TSDVPTNVSKGAPDYCTVYVIGKGKISSVRSAS--APPPTRPLPPRAHSQTQPANV--LE  198

Query  486  TKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
              +APS+  +++ +    ++ +  +   R   E    R    R  +  E    D D+SFV
Sbjct  199  PTDAPSAT-AYNPR----YRGDRPQHPPRNMPEDMEIRSPFTRGHIKYEPSIPDCDISFV  253

Query  666  SSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDF--------  821
            SSG RPS DRM   L + +E G TPRLS SSD    S   G     N   DF        
Sbjct  254  SSG-RPSTDRMFPSLYDNLEYG-TPRLSVSSDYDNRS--FGSSYSGNRSMDFSSSQYELS  309

Query  822  -----------------------SSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALT  932
                                   S+  +  D+ E EMRRL+ EL++TMD+YS ACKEALT
Sbjct  310  SSSLESGRTSWSSQNMIQDRKSCSTVQMPQDDVEAEMRRLRQELKQTMDMYSAACKEALT  369

Query  933  AKQKTSELQRW  965
            AKQ+  EL  W
Sbjct  370  AKQRAKELHSW  380



>ref|XP_008358252.1| PREDICTED: U-box domain-containing protein 34-like [Malus domestica]
Length=670

 Score =   265 bits (678),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             +YRRY+I+EIEEATEHF  SRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+E
Sbjct  324   KYRRYSIEEIEEATEHFLPSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQKE  383

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             ++ILSC+RHPNMV+LLGACPEYG LVYEYMA+GS+DD L  +GN P LSWQ+RF+IAAE+
Sbjct  384   IDILSCIRHPNMVLLLGACPEYGILVYEYMANGSLDDCLSRKGNTPALSWQLRFQIAAEV  443

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  444   ATGLLFLHQTKPEPLVHRDLKPGNILL  470


 Score =   115 bits (287),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 143/240 (60%), Gaps = 29/240 (12%)
 Frame = +3

Query  291  LKRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN  470
            L R K + IP+  SK APDFCTV+VISK KI S R+A+RPA ++SPL  Q++ + +Q+  
Sbjct  22   LCRFKSSSIPSSVSKGAPDFCTVYVISKGKIHSERHASRPAAYSSPLLAQIEALNQQSAK  81

Query  471  NPDIRTKNA--PSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEG  644
              +   +N    ++  SF  +++        +  SR +  R    G    R+ G  + E 
Sbjct  82   AAETPRQNMYLKAARPSFRPRNL-------PDEASRYAYTRGG--GFSNGRISGGFS-ES  131

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDF  821
            +S+ SF+SS  R S DR SS + E ++ GR   LS+SSD SFGS RLG K  +LN   DF
Sbjct  132  ESERSFISS-DRASTDRASSVMYEYMDRGR---LSTSSDQSFGSMRLGPKFAELNFPQDF  187

Query  822  SSSSLEND------------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            SS S E++            E E EMRRLKLEL++TMD+YSTAC+EALTAKQK  EL  W
Sbjct  188  SSISHESNQTSSSWSSENLEEVESEMRRLKLELKQTMDMYSTACREALTAKQKEMELHSW  247



>gb|KHN24375.1| U-box domain-containing protein 35 [Glycine soja]
Length=788

 Score =   268 bits (685),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE AT  F+ES+KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  468   VRYRKYTIEEIEAATNFFTESQKIGEGGYGPVYKCHLDHTPVAVKVLRPDAAQGRSQFQR  527

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM++GS+DDRL  RGN  P+ WQ+RFRIAAE
Sbjct  528   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMSNGSLDDRLFCRGNTHPIPWQLRFRIAAE  587

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  588   IGTGLLFLHQTKPEPLVHRDLKPANILL  615


 Score =   157 bits (398),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 129/366 (35%), Positives = 184/366 (50%), Gaps = 47/366 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQ---------------TSLQHKQ-------QL  119
            SQ A+KW  ++LL+KG +VVL+HV ++                  S+ H +         
Sbjct  28   SQNALKWAIDHLLNKGSNVVLLHVKHKPSSLSASASLTTPRAGANSIAHAEPSALVCHDP  87

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKR  299
            + Q K++F  +  FC RK+IHC D++++  D++KAL +Y S  AIE+LV+G+S      R
Sbjct  88   DEQTKEIFRPYRVFCARKDIHCKDVVLEDMDVSKALIEYSSQYAIEHLVIGTSNKGGFLR  147

Query  300  LKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQA-QNNP  476
             K+ DIP   SK APDFCTV++++K KI S+R+A+R AP  SPL  Q      ++  ++P
Sbjct  148  FKIADIPGSVSKGAPDFCTVYIVAKGKIQSMRSASRAAPAFSPLQNQFSHASARSDHSDP  207

Query  477  DIRTKNAPSS--LRSFDEKHMRSFKL-EESESVSRPSIERAATRGIPPRRMLGAETVEGD  647
             +   N       RSF+    RS     +S   +  S     TR     +  G  +V  D
Sbjct  208  RVPLANGAKGPQRRSFEAPPHRSQDAPRKSNDGTTDSFRSPFTRRGMTDKSYGEISVP-D  266

Query  648  SDLSFVSSGSRPSGDRMSSFLSETV----ESGRT-PRLssssdgsfgsgRLGKGNDLNSF  812
            SD+SFVSS    +     S  +       E+G + PRLS SSD    +      +     
Sbjct  267  SDISFVSSRRSSTDRSFLSLYNNNNNNNSETGMSNPRLSFSSDTDGNNYSFESMHFGRRS  326

Query  813  TDFS---------------SSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
             D S               S+S   D+ E EMRRLKLEL + M+ YS ACKEA  A+QK 
Sbjct  327  MDISSDFSSFSQESEGLSFSASQGMDDVEAEMRRLKLELNQIMEKYSNACKEAFKAQQKA  386

Query  948  SELQRW  965
             ELQRW
Sbjct  387  VELQRW  392



>ref|XP_004245436.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Solanum lycopersicum]
 ref|XP_010325201.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Solanum lycopersicum]
Length=767

 Score =   267 bits (683),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIE AT +F+ES KIGEGGYGPV+KC +DHT VAVKVLRPDAA GR+QFQQ
Sbjct  450   VRYRRYSIEEIESATNYFAESNKIGEGGYGPVYKCYMDHTHVAVKVLRPDAAHGRQQFQQ  509

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCL+YE+M++GS++DRL  +GN P LSWQ RFRIAAE
Sbjct  510   EVEVLSCIRHPNMVLLLGACPEYGCLIYEFMSNGSLEDRLFQKGNSPALSWQHRFRIAAE  569

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +G GLLFLHQ+KP+PIVHRDLKP NILL
Sbjct  570   IGAGLLFLHQSKPEPIVHRDLKPANILL  597


 Score =   186 bits (473),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 198/357 (55%), Gaps = 48/357 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQ------TQTSLQHKQ----------QLEAQNKD  137
            SQ A+KW  +NLL++GQ+++L+HV  +      +Q+  +  Q          +L+ Q K+
Sbjct  29   SQVALKWAVDNLLARGQTIILIHVKVKPSGTPFSQSGNRINQDGSNDGSGMTELDPQLKE  88

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDI  317
            LF+ F  FCTRK+I C D++++  D+ KA+ +Y++  AIE L+LG++    L R K+ DI
Sbjct  89   LFLPFRVFCTRKDIQCHDVVLEDADVVKAIVEYINRTAIEVLILGAAAKGGLLRFKLKDI  148

Query  318  PTLTSKAAPDFCTVFvisks-kissvRNATRPAPFASPLHPQLQEIQEQAQNN-------  473
            P    K APDFCTV+VISKS KISS R+A R APF  PL  Q  +      N+       
Sbjct  149  PGNVLKGAPDFCTVYVISKSGKISSTRSAARLAPFVHPLRHQFTQNGNVKSNSFEDFNVP  208

Query  474  PDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            P       P  +      ++ S    ++ ++  P   R    G P       E  + D+D
Sbjct  209  PRGSISGIPKPVSDMPMSNLHS----DTFNMKSPFTHRKGPNGKP------YEISQPDTD  258

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRT-PRLssssdgsfgsgR---LGKGNDLNSFTDF  821
            +SFVSSG RPS D M    +++ +SG T PRLS  SD    S     +G+ +     ++ 
Sbjct  259  ISFVSSG-RPSIDNMFPSFADSFDSGTTPPRLSGFSDYEGQSFEPMPMGRRSLDIMPSEM  317

Query  822  SSSSLEN---------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S  S+E          D+   EMRRLKLEL++TM++YSTACKEALTA+QK +ELQRW
Sbjct  318  SLLSMEGDRPSFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKATELQRW  374



>ref|XP_006850971.1| hypothetical protein AMTR_s00025p00206220 [Amborella trichopoda]
 gb|ERN12552.1| hypothetical protein AMTR_s00025p00206220 [Amborella trichopoda]
Length=807

 Score =   268 bits (685),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE AT+ F+E RKIGEGGYGPV+KC L+HT+VA+KVLRPDAAQGR QFQQ
Sbjct  464   VRYRKYTIEEIETATDFFAEDRKIGEGGYGPVYKCYLEHTSVAIKVLRPDAAQGRMQFQQ  523

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++D L  RGN P L+WQ RFRIAAE
Sbjct  524   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLFRRGNSPSLTWQQRFRIAAE  583

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GT LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  584   IGTALLFLHQTKPEPLVHRDLKPGNILL  611


 Score =   199 bits (505),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 139/366 (38%), Positives = 202/366 (55%), Gaps = 61/366 (17%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT------------------SLQHKQQLEAQN  131
            SQYA+KW  ++L++KGQ++ L+HV N+ QT                  +   ++Q+EAQ 
Sbjct  38   SQYALKWAVDHLVTKGQTITLIHVKNKIQTVPTPMGNHVSISEVSEEVASAFREQMEAQI  97

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKV  308
            ++L + F CFCTRK++HC D +++ +D+ KA+ DYV+  +I+NLVLG S+R SFL+R K 
Sbjct  98   RELLMPFRCFCTRKDVHCKDAILEDSDVTKAIIDYVALESIDNLVLGASTRSSFLRRFKS  157

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
             DIPT  SK  PDFCTV+VISK K++SVR+A RPAP   PL           +N+P I  
Sbjct  158  HDIPTSISKGTPDFCTVYVISKGKLASVRSAVRPAP-PPPLR------NSSPRNHP-ITA  209

Query  489  KNAPSSLRSFD--EKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
             N PS +        H +    + S+ +  P       RG  PR    +E    +SD+S+
Sbjct  210  SNIPSPIHPIKVGAGHEQKRLGDHSDPIMSPFAR--GGRGSNPRL---SENTMPESDISY  264

Query  663  VSSGSRPSGDRMSSFLSETVESGRTPRLssssdg-------sfgsgRLGKGN--------  797
            VS G + +     + L E  ES R PRLSS +         +     +  G+        
Sbjct  265  VSHGKKSADRFYPASLYEHFESSRPPRLSSGAHSIEEDFNHNHSFESIHSGDHKSIDSAS  324

Query  798  ----------DLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
                      ++ S T +SS ++E+ EA  EM+RL+LEL++TMD+YS+ACKEAL AK K 
Sbjct  325  TAPEFSTVSQEMESRTSWSSQTMEDVEA--EMKRLRLELKQTMDMYSSACKEALNAKNKA  382

Query  948  SELQRW  965
             EL  W
Sbjct  383  RELHLW  388



>ref|XP_006360651.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum]
Length=794

 Score =   268 bits (684),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE AT++F+ +RKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  458   RYRKYTIEEIETATDNFAATRKIGEGGYGPVYKCYLDHTQVAIKVLRPDAAQGRSQFQQE  517

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DDRL  RG+   L WQ+RFRIAAE+
Sbjct  518   VEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDRLFRRGSTQVLPWQLRFRIAAEV  577

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GT LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  578   GTSLLFLHQTKPEPLVHRDLKPGNILL  604


 Score =   167 bits (424),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 192/364 (53%), Gaps = 50/364 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ-----------HKQQLEAQNKDLFVTF  152
            SQYA+KW  + L+ KG++V L+HV  +   SL            ++   ++Q K+LF+ F
Sbjct  24   SQYALKWAVDTLIGKGKNVTLLHVKVRPSVSLPNADVSDGTPRVYRSDPDSQAKELFLPF  83

Query  153  HCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLT  329
             CFC RKNI   +++I+G DIA +++DYV+   IE LV+G+ SR+ F+ R K  D+PT  
Sbjct  84   RCFCNRKNIQVNEVVIEGIDIATSISDYVTANVIEILVVGAASRNGFVSRFKTMDVPTAV  143

Query  330  SKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAP-SS  506
            SK  P FCTV+VI+K K+ S +NA+ P P +     Q               T+ A  SS
Sbjct  144  SKVIPGFCTVYVIAKGKVQSTKNASSPVPSSPTPVQQNHSTSSLGAKLGFADTRYAQISS  203

Query  507  LRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPS  686
                    +RS     S +    SI+    RG    R  G  +V  +SDLSFVSSG RPS
Sbjct  204  DTKGSVTDIRSPYASRSSADDLDSIKSPFNRGKGINRSYGDLSV-AESDLSFVSSG-RPS  261

Query  687  GDRMSSF---LSETVESGRTPRLssss------------dgsfgsgRLGKGND-----LN  806
                S+F   +  + + G  PRLS+SS            + S    RL  G+      L+
Sbjct  262  ----STFPISMDSSHDLGLPPRLSNSSDTDVKYSAPRLSNSSETESRLSFGSSFSATRLS  317

Query  807  SFTDFSSSSLEN-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
                FSS+S ++           ++ E EMRRLK EL++TMD+YS+ACKEAL+AK K  E
Sbjct  318  EANGFSSNSFDSGNGSWSSPSNMEDIEAEMRRLKQELKQTMDMYSSACKEALSAKHKAME  377

Query  954  LQRW  965
            L RW
Sbjct  378  LHRW  381



>ref|XP_009353318.1| PREDICTED: U-box domain-containing protein 35-like [Pyrus x bretschneideri]
Length=776

 Score =   267 bits (682),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+ESRKIGEGGYGPV++C LDHT VA+KVLRPDAAQGR QF Q
Sbjct  451   VRYRKYSIEEIEAATEFFTESRKIGEGGYGPVYRCNLDHTPVAIKVLRPDAAQGRSQFNQ  510

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL+ RGN P LSW++RF+IAAE
Sbjct  511   EVEVLSSIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLLRRGNSPILSWKLRFKIAAE  570

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  571   IGTGLLFLHQAKPEPLVHRDLKPANILL  598


 Score =   191 bits (484),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 202/358 (56%), Gaps = 48/358 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------------DNQTQTSLQHKQQL-----EAQ  128
            SQ A+KW  ++L+  GQSV+L+HV              ++  +++    QQL     + Q
Sbjct  28   SQCALKWAIDSLIKPGQSVLLIHVKVKHSIISQSHSLSNSTPRSNPNWDQQLVCKDPDPQ  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKV  308
             ++LF+ F  FCTRKNI C D++++ +D+ KAL +YV+  AIE+LV+G+S  +   R K 
Sbjct  88   TRELFLPFRVFCTRKNIQCRDLVLEDSDVTKALVEYVTQTAIEHLVVGASAKTGFLRFKA  147

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            +DIP   SKAAPDFC V+V+SK K+ S R A+RPAP  SPL    +      ++ P +  
Sbjct  148  SDIPGNLSKAAPDFCNVYVVSKQKLQSRRAASRPAPAVSPLRNPARNHTPSPKSEPYV--  205

Query  489  KNAPSSLRSFDEKHMRSFKLEESE-SVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFV  665
               P S    +EK     +    E    R    R    G        A+    D+D+SFV
Sbjct  206  --FPHSGNKGNEKPPEPPRQSHDEMDYFRSPFTRKGPNG-----KSYADLPTPDTDISFV  258

Query  666  SSGSRPSGDRM-SSFLSETVESGRT--PRLssssd-----gsfgsgRLGKGN-DLNSF-T  815
            SSG RPS DR+  +F +E ++SGR   PR+S+S++             G+ + D++S   
Sbjct  259  SSG-RPSIDRIFPAFYNENLDSGRVTPPRMSNSTEIDLNHSFESMQYFGRRSVDVSSSPP  317

Query  816  DFSSSSLEND--------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             FSS S ++D        + E EMRRLKLEL++TM++YSTACKEAL+AKQK  ELQRW
Sbjct  318  TFSSVSQDSDRLSSASMEDMEAEMRRLKLELKQTMEMYSTACKEALSAKQKAVELQRW  375



>ref|XP_009128323.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Brassica rapa]
 ref|XP_009128324.1| PREDICTED: U-box domain-containing protein 52-like isoform X2 
[Brassica rapa]
Length=760

 Score =   267 bits (682),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  430   VRYRKYTVEEIEEATSNFDESKKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  489

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  +GN PP+SWQ+RFRIAAE
Sbjct  490   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMQGNTPPISWQLRFRIAAE  549

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKP N+LL
Sbjct  550   IATGLLFLHQTKPEPIVHRDLKPANVLL  577


 Score =   212 bits (540),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 211/347 (61%), Gaps = 43/347 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV---------DNQTQTSLQHKQQLEAQNKDLFVTFHC  158
            SQ+A+KWT ENL S+GQ++ L+HV          +  + + Q K++ E   +DLFV+FHC
Sbjct  29   SQHALKWTIENLASRGQTISLIHVLSKSHSSSSSDIAEATPQQKKESEKLAQDLFVSFHC  88

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSK  335
            +C+RK I+C DIL++  D  +A+T++VS +AIENLV+G +SR+ F++R K TD+PT  SK
Sbjct  89   YCSRKEINCQDILLEDIDKVRAITEFVSSSAIENLVVGAASRNGFMRRFK-TDLPTTLSK  147

Query  336  AAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRS  515
             APDFC V+VISK KI+SVRNA+RPAP+ S    QL E   Q    P+   K+   S +S
Sbjct  148  QAPDFCNVYVISKGKIASVRNASRPAPYKS--SKQLSEFDNQHPTTPEKAPKHHDHS-QS  204

Query  516  FDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS---------  668
                  R  +  E +S+  P + R   +          +  + DSDLSF+S         
Sbjct  205  AGSTPSRPRRSVEYDSIRSPLVRRQGKQ--------YGDLYDSDSDLSFISPSSHRDSHD  256

Query  669  ----SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSS---  827
                S  RPS DR SSF  +  ESGR+ R+S+SS+  F        N+ ++F++ S    
Sbjct  257  ISFISSGRPSVDR-SSFTHDFPESGRSSRMSTSSEFKFSDPSF--PNESSTFSEESGGTS  313

Query  828  --SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
              SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ S LQ+
Sbjct  314  SYSSQGVDDIEAEMKRLRLELKQTMDMYSTACKEALSARQQASALQK  360



>ref|XP_006580497.1| PREDICTED: U-box domain-containing protein 35-like isoform X1 
[Glycine max]
Length=808

 Score =   267 bits (682),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +3

Query  1074  PVRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQ  1253
             P RYR+YTI+EIEEAT+ FS S KIGEGGYGPV++  LDHT VA+KVL+PDAAQGR QFQ
Sbjct  460   PARYRKYTIEEIEEATKFFSNSLKIGEGGYGPVYRSELDHTPVAIKVLKPDAAQGRSQFQ  519

Query  1254  QEVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAA  1433
             QEVE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DD L  RGNKP L WQ+RFRIAA
Sbjct  520   QEVEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDCLFRRGNKPALPWQLRFRIAA  579

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+ TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  580   EIATGLLFLHQTKPEPLVHRDLKPGNILL  608


 Score =   139 bits (351),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 157/294 (53%), Gaps = 53/294 (18%)
 Frame = +3

Query  177  IHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCT  356
            I C +IL++  DI+K L + +S  ++E LVLG++  S L R + +D+P+L SK AP FCT
Sbjct  120  IQCKEILLEDMDISKGLIEGISKYSVELLVLGAASRSGLVRFRTSDVPSLVSKGAPPFCT  179

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN--NPDIRTKNAPSSLRSFDEKH  530
            V++I+K KISSV+ AT P     P      + Q+  Q     D +    P   R   EK 
Sbjct  180  VYIIAKGKISSVKTATAPLTAKPPARNNTMQPQQSLQTPERMDTQITRNPIPPRPSSEKP  239

Query  531  ---MRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMS  701
               +R    +E E +S     R+  RG      +  E+   DSD+SFVSSG RPS DRM 
Sbjct  240  SYIVRQLSSDEDEIIS--PFTRSG-RG----NYISYESSIPDSDISFVSSG-RPSVDRMF  291

Query  702  SFLSETVESGRTPRLssssdgsfgsgRLGKGNDLN------SFT--------DFSSSSLE  839
              + + ++SG              + RL  G+D +      SF+        D+S SS +
Sbjct  292  PSMYDDMDSG--------------TNRLSTGSDFDVRSFGSSFSGAKSIDHGDYSFSSQD  337

Query  840  ------------NDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                        +DE E EMRRLKLEL++TM+LYS+ACKEA+TAKQK  ELQRW
Sbjct  338  SGTSMSSSMFSASDEVEAEMRRLKLELKQTMELYSSACKEAMTAKQKALELQRW  391



>ref|XP_004172287.1| PREDICTED: U-box domain-containing protein 52-like [Cucumis sativus]
Length=772

 Score =   266 bits (681),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+E+E ATEHF++SRKIGEGGYGPVF+C LDHT+VAVKVLRPDA QGR QFQQ
Sbjct  453   IRYRRYSIEEVESATEHFAQSRKIGEGGYGPVFRCRLDHTSVAVKVLRPDATQGRTQFQQ  512

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E++ILSC+RHPNMV+LLGACPEYG LVYEYM++GS++DRL  +GN P + WQ+RFRIAAE
Sbjct  513   EIDILSCIRHPNMVLLLGACPEYGILVYEYMSNGSLEDRLFRKGNTPVIPWQLRFRIAAE  572

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  573   IATGLLFLHQTKPEPLVHRDLKPANILL  600


 Score =   226 bits (577),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 163/357 (46%), Positives = 214/357 (60%), Gaps = 51/357 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------------------DNQTQTSLQHKQQLEA  125
            SQ A++W  E+L+ KGQ+V+L+HV                    D  + +   H QQLE 
Sbjct  35   SQNALRWAAEHLIGKGQTVILIHVVHRPSSAAASLIGEAIICNTDGSSTSDSPHIQQLEM  94

Query  126  QNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRL  302
            Q +D+F+TFHC+CTRK+I CLDI+++ TDI KALT+YVS AAIE LVLG+ SRH F+ R 
Sbjct  95   QTRDIFLTFHCYCTRKDIQCLDIILEDTDIVKALTEYVSYAAIETLVLGAPSRHGFI-RF  153

Query  303  KVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI  482
            K + + +  SK APDFCTV+VISK K+SSV+NA+R APF SPL  +LQ++     + P +
Sbjct  154  KSSSMGSSVSKGAPDFCTVYVISKGKVSSVKNASRSAPFTSPLLDRLQKL-----SKPIV  208

Query  483  RTKNAPS---SLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            +    P    +LR       RSF+ E  +S      ER                 E +SD
Sbjct  209  KGSITPRHKFNLRDRTSFKPRSFQDETIKSPYSHGGERTCISK------FSGGFSESESD  262

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSS  830
            +SF+SSG RPS DR SS   +  +SG  PR S+SS+ SF S     K  DL++  DFSS 
Sbjct  263  ISFISSG-RPSTDRSSSVAFDYSDSG-PPRFSTSSEHSFTSLPFKPKWADLSNLNDFSSV  320

Query  831  SLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S E+            DE E+EMRRLKLEL++TM++YSTACKEALTAKQK  EL  W
Sbjct  321  SDESCRTSCSWSSQNLDEVELEMRRLKLELKQTMEMYSTACKEALTAKQKAMELNNW  377



>ref|XP_008448004.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis melo]
 ref|XP_008448005.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis melo]
Length=790

 Score =   266 bits (681),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+E+E ATEHF++SRKIGEGGYGPVF+C LDHT+VAVKVLRPDA QGR QFQQ
Sbjct  454   IRYRRYSIEEVESATEHFAQSRKIGEGGYGPVFRCRLDHTSVAVKVLRPDATQGRTQFQQ  513

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E++ILSC+RHPNMV+LLGACPEYG LVYEYM++GS++DRL  +GN P + WQ+RFRIAAE
Sbjct  514   EIDILSCIRHPNMVLLLGACPEYGILVYEYMSNGSLEDRLFRKGNTPVIPWQLRFRIAAE  573

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  574   IATGLLFLHQTKPEPLVHRDLKPANILL  601


 Score =   220 bits (561),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 159/356 (45%), Positives = 211/356 (59%), Gaps = 49/356 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------------------DNQTQTSLQHKQQLEA  125
            SQ A++W  E+L+ KGQ+V+L+HV                    D    +     QQLE 
Sbjct  36   SQNALRWAAEHLIGKGQTVILIHVVHRPSSAAASLIGEAIICNSDGNFTSDSPRIQQLEL  95

Query  126  QNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRL  302
            Q +D+F+TFHC+CTRK+I CLDI+++ TDI KALT+Y S AAIE LVLG+ S+H F+ R 
Sbjct  96   QTRDIFLTFHCYCTRKDIQCLDIILEDTDIVKALTEYASYAAIETLVLGAPSKHGFI-RF  154

Query  303  KVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI  482
            K + + +  SK APDFCTV+VISK K+SSV+NA+R APF+SPL   LQ+I     + P +
Sbjct  155  KSSSMGSSVSKGAPDFCTVYVISKGKVSSVKNASRSAPFSSPLLDHLQKI-----SKPIV  209

Query  483  RTKNAPSSLRSFDEKHMRSFKLE--ESESVSRPSIERAATRGIPPRRMLGAETVEGDSDL  656
            +    P     F+ +   SFK    + E+V  P         I           E +SD+
Sbjct  210  KGSITPR--HKFNSRDRTSFKPRSFQDETVKSPYSHGGERTSISK---FSGGFSESESDI  264

Query  657  SFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSS  833
            SF+SSG RPS DR SS   +  +SG  PR S+SS+ SF S     K  DL++  DFSS S
Sbjct  265  SFISSG-RPSTDRSSSVAFDYSDSG-PPRFSTSSEHSFASLPFKPKWTDLSNLNDFSSVS  322

Query  834  LEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             E+            D+ E+EMRRLKLEL++TM++YSTACKEALTAKQK  EL  W
Sbjct  323  DESCRTSCSWSSQNLDDVELEMRRLKLELKQTMEMYSTACKEALTAKQKAMELNNW  378



>ref|XP_009128322.1| PREDICTED: U-box domain-containing protein 52-like isoform X1 
[Brassica rapa]
Length=791

 Score =   266 bits (681),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F ES+K+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  461   VRYRKYTVEEIEEATSNFDESKKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  520

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  +GN PP+SWQ+RFRIAAE
Sbjct  521   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMQGNTPPISWQLRFRIAAE  580

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKP N+LL
Sbjct  581   IATGLLFLHQTKPEPIVHRDLKPANVLL  608


 Score =   212 bits (540),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 211/347 (61%), Gaps = 43/347 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV---------DNQTQTSLQHKQQLEAQNKDLFVTFHC  158
            SQ+A+KWT ENL S+GQ++ L+HV          +  + + Q K++ E   +DLFV+FHC
Sbjct  60   SQHALKWTIENLASRGQTISLIHVLSKSHSSSSSDIAEATPQQKKESEKLAQDLFVSFHC  119

Query  159  FCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSK  335
            +C+RK I+C DIL++  D  +A+T++VS +AIENLV+G +SR+ F++R K TD+PT  SK
Sbjct  120  YCSRKEINCQDILLEDIDKVRAITEFVSSSAIENLVVGAASRNGFMRRFK-TDLPTTLSK  178

Query  336  AAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRS  515
             APDFC V+VISK KI+SVRNA+RPAP+ S    QL E   Q    P+   K+   S +S
Sbjct  179  QAPDFCNVYVISKGKIASVRNASRPAPYKS--SKQLSEFDNQHPTTPEKAPKHHDHS-QS  235

Query  516  FDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS---------  668
                  R  +  E +S+  P + R   +          +  + DSDLSF+S         
Sbjct  236  AGSTPSRPRRSVEYDSIRSPLVRRQGKQ--------YGDLYDSDSDLSFISPSSHRDSHD  287

Query  669  ----SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSS---  827
                S  RPS DR SSF  +  ESGR+ R+S+SS+  F        N+ ++F++ S    
Sbjct  288  ISFISSGRPSVDR-SSFTHDFPESGRSSRMSTSSEFKFSDPSF--PNESSTFSEESGGTS  344

Query  828  --SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
              SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ S LQ+
Sbjct  345  SYSSQGVDDIEAEMKRLRLELKQTMDMYSTACKEALSARQQASALQK  391



>emb|CDX96806.1| BnaA08g23490D [Brassica napus]
Length=768

 Score =   266 bits (680),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y++ EIEE T +F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  432   VRYRKYSVQEIEEGTGNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  491

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN P +SWQ+RFRIAAE
Sbjct  492   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPAISWQLRFRIAAE  551

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  552   IATGLLFLHQTKPEPIVHRDLKPGNVLL  579


 Score =   217 bits (552),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 160/356 (45%), Positives = 223/356 (63%), Gaps = 59/356 (17%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TSQ A+KWT ENL S+GQ++ L+HV  ++Q+S      + HKQQ+E + K LFV+FHCFC
Sbjct  27   TSQNALKWTMENLTSRGQTLALIHVVPKSQSSSDIEEGITHKQQIEKETKHLFVSFHCFC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+CLD++++  D  KA+ +YV+ +AIENLVLG+ SR+SF++R K TD+PT  SKAA
Sbjct  87   SRKEINCLDVVLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQ-LQEI--QEQAQNNPDIRTKNAPS---  503
            PDFC V+VI+KSKISS+R+++RPAP+    HP  L E    E  +N    R    P+   
Sbjct  146  PDFCNVYVIAKSKISSLRSSSRPAPY----HPSVLSEFDNHETTENKHKTREATTPAYSR  201

Query  504  SLRSFDEKHMRS---------FKL--EESESVSRPSIERAATRGIPPRRMLGAETVEGDS  650
              RS D    RS          KL  + S+S S  S   A+ +G               S
Sbjct  202  GRRSVDSDGPRSGFVKPPQGHMKLMGDFSDSESEYSFINASQQG---------------S  246

Query  651  DLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS  827
            D+S++SSG RPS DR SSF  +  +S RT R+S+SS+ S GS RLG K  DL    + S+
Sbjct  247  DISYISSG-RPSVDR-SSFTYDLPDSARTSRMSTSSEQSIGSNRLGIKFTDLGFLNNAST  304

Query  828  SSLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
            +S E+             + E +MRRL+LEL++TMD+YS+AC+EALTA+ + +ELQ
Sbjct  305  ASEESGRTSCSYSSQSLGDVEAQMRRLRLELKQTMDMYSSACREALTARNEATELQ  360



>ref|XP_009110442.1| PREDICTED: U-box domain-containing protein 35-like [Brassica 
rapa]
Length=768

 Score =   266 bits (679),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y++ EIEE T +F+ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QF +
Sbjct  432   VRYRKYSVQEIEEGTGNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHK  491

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYG LVYEYMA GS+DDRL  RGN P +SWQ+RFRIAAE
Sbjct  492   EVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPAISWQLRFRIAAE  551

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  552   IATGLLFLHQTKPEPIVHRDLKPGNVLL  579


 Score =   216 bits (551),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 160/356 (45%), Positives = 223/356 (63%), Gaps = 59/356 (17%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTS------LQHKQQLEAQNKDLFVTFHCFC  164
            TSQ A+KWT ENL S+GQ++ L+HV  ++Q+S      + HKQQ+E + K LFV+FHCFC
Sbjct  27   TSQNALKWTMENLTSRGQTLALIHVVPKSQSSSDIEEGITHKQQIEKETKHLFVSFHCFC  86

Query  165  TRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAA  341
            +RK I+CLD++++  D  KA+ +YV+ +AIENLVLG+ SR+SF++R K TD+PT  SKAA
Sbjct  87   SRKEINCLDVVLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFK-TDLPTSVSKAA  145

Query  342  PDFCTVFviskskissvRNATRPAPFASPLHPQ-LQEI--QEQAQNNPDIRTKNAPS---  503
            PDFC V+VI+KSKISS+R+++RPAP+    HP  L E    E  +N    R    P+   
Sbjct  146  PDFCNVYVIAKSKISSLRSSSRPAPY----HPSVLSEFDNHETTENKHKTREATTPAYSR  201

Query  504  SLRSFDEKHMRS---------FKL--EESESVSRPSIERAATRGIPPRRMLGAETVEGDS  650
              RS D    RS          KL  + S+S S  S   A+ +G               S
Sbjct  202  GRRSVDSDGPRSGFVKPPQGHMKLMGDFSDSESEYSFINASQQG---------------S  246

Query  651  DLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSS  827
            D+S++SSG RPS DR SSF  +  +S RT R+S+SS+ S GS RLG K  DL    + S+
Sbjct  247  DISYISSG-RPSVDR-SSFTYDLPDSARTSRMSTSSEQSIGSNRLGIKFTDLGFLNNAST  304

Query  828  SSLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
            +S E+             + E +MRRL+LEL++TMD+YS+AC+EALTA+ + +ELQ
Sbjct  305  ASEESGRTSCSYSSQSLGDVEAQMRRLRLELKQTMDMYSSACREALTARNEATELQ  360



>gb|KGN43210.1| hypothetical protein Csa_7G009060 [Cucumis sativus]
Length=793

 Score =   266 bits (680),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+E+E ATEHF++SRKIGEGGYGPVF+C LDHT+VAVKVLRPDA QGR QFQQ
Sbjct  453   IRYRRYSIEEVESATEHFAQSRKIGEGGYGPVFRCRLDHTSVAVKVLRPDATQGRTQFQQ  512

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E++ILSC+RHPNMV+LLGACPEYG LVYEYM++GS++DRL  +GN P + WQ+RFRIAAE
Sbjct  513   EIDILSCIRHPNMVLLLGACPEYGILVYEYMSNGSLEDRLFRKGNTPVIPWQLRFRIAAE  572

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  573   IATGLLFLHQTKPEPLVHRDLKPANILL  600


 Score =   226 bits (577),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 163/357 (46%), Positives = 214/357 (60%), Gaps = 51/357 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------------------DNQTQTSLQHKQQLEA  125
            SQ A++W  E+L+ KGQ+V+L+HV                    D  + +   H QQLE 
Sbjct  35   SQNALRWAAEHLIGKGQTVILIHVVHRPSSAAASLIGEAIICNTDGSSTSDSPHIQQLEM  94

Query  126  QNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRL  302
            Q +D+F+TFHC+CTRK+I CLDI+++ TDI KALT+YVS AAIE LVLG+ SRH F+ R 
Sbjct  95   QTRDIFLTFHCYCTRKDIQCLDIILEDTDIVKALTEYVSYAAIETLVLGAPSRHGFI-RF  153

Query  303  KVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI  482
            K + + +  SK APDFCTV+VISK K+SSV+NA+R APF SPL  +LQ++     + P +
Sbjct  154  KSSSMGSSVSKGAPDFCTVYVISKGKVSSVKNASRSAPFTSPLLDRLQKL-----SKPIV  208

Query  483  RTKNAPS---SLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            +    P    +LR       RSF+ E  +S      ER                 E +SD
Sbjct  209  KGSITPRHKFNLRDRTSFKPRSFQDETIKSPYSHGGERTCISK------FSGGFSESESD  262

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSS  830
            +SF+SSG RPS DR SS   +  +SG  PR S+SS+ SF S     K  DL++  DFSS 
Sbjct  263  ISFISSG-RPSTDRSSSVAFDYSDSG-PPRFSTSSEHSFTSLPFKPKWADLSNLNDFSSV  320

Query  831  SLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S E+            DE E+EMRRLKLEL++TM++YSTACKEALTAKQK  EL  W
Sbjct  321  SDESCRTSCSWSSQNLDEVELEMRRLKLELKQTMEMYSTACKEALTAKQKAMELNNW  377



>ref|XP_006355246.1| PREDICTED: U-box domain-containing protein 35-like [Solanum tuberosum]
Length=767

 Score =   266 bits (679),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRY+I+EIE AT +F++S KIGEGGYGPV+KC +DHT VAVKVLRPDAA GR+QFQQE
Sbjct  451   RYRRYSIEEIESATNYFAQSNKIGEGGYGPVYKCYMDHTHVAVKVLRPDAAHGRQQFQQE  510

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPEYGCL+YE+M++GS++DRL  RGN P LSWQ RFRIAAE+
Sbjct  511   VEVLSCIRHPNMVLLLGACPEYGCLIYEFMSNGSLEDRLFQRGNSPALSWQHRFRIAAEI  570

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             G GLLFLHQ+KP+PIVHRDLKP NILL
Sbjct  571   GAGLLFLHQSKPEPIVHRDLKPANILL  597


 Score =   186 bits (473),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 197/357 (55%), Gaps = 48/357 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQ------TQTSLQHKQ----------QLEAQNKD  137
            SQ A+KW  +NLL++GQ+++L+HV  +      +Q+  +  Q          +L+ Q K+
Sbjct  29   SQIALKWAVDNLLARGQTIILIHVKVKASGTPFSQSGNRINQDGSNDGPGMSELDPQLKE  88

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDI  317
            LF+ F  FCTRK+I C D++++  D+ KA+ +Y++  AIE L+LG++    L R K+ DI
Sbjct  89   LFLPFRVFCTRKDIQCHDVVLEDADVVKAIIEYINRTAIEVLILGAAAKGGLLRFKIKDI  148

Query  318  PTLTSKAAPDFCTVFvisks-kissvRNATRPAPFASPLHPQLQEIQEQAQNN-------  473
            P    K  PDFCTV+VISKS KISS R+A R APF  PL  Q  +      N+       
Sbjct  149  PGNVLKGVPDFCTVYVISKSGKISSTRSAARLAPFIHPLRHQFTQNANVKSNSIEDSNVP  208

Query  474  PDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            P       P  +      ++ S    ++ ++  P   R    G P       E  + D+D
Sbjct  209  PRGSISGIPKPVSDIPMSNLHS----DTFNMKSPFTHRKGPNGKP------YEISQPDTD  258

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRT-PRLssssdgsfgsgR---LGKGNDLNSFTDF  821
            +SFVSSG RPS D M    ++T +SG T PRLS  SD    S     +G+ +     ++ 
Sbjct  259  ISFVSSG-RPSIDNMFPSFADTFDSGATPPRLSGFSDYEGQSFEPMPMGRRSLDIMPSEM  317

Query  822  SSSSLEN---------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S  S+E          D+   EMRRLKLEL++TM++YSTACKEALTA+QK +ELQRW
Sbjct  318  SFLSMEGDRPSFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKATELQRW  374



>emb|CDY55241.1| BnaC02g44910D [Brassica napus]
Length=740

 Score =   265 bits (678),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVK+LR DAAQG  QFQQ
Sbjct  415   VRYRKYSIEEIEHATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKILRADAAQGMSQFQQ  474

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E+E+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  475   EIEVLSCIRHPNMVLLLGACPEGGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  534

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  535   IGTGLLFLHQAKPEPLVHRDLKPGNILL  562


 Score =   178 bits (452),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 182/320 (57%), Gaps = 39/320 (12%)
 Frame = +3

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLK  296
            E  +K++F+ F CFCTRK+I C D+L++  D+AKAL +Y + AAIE LV+GSS +  FL+
Sbjct  21   EGASKEIFLPFRCFCTRKDIQCQDVLLEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLR  80

Query  297  RLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLH-----PQLQEIQEQ  461
              K  D+P   +K APDFCTV+VI K KIS++R+A+R AP  SPL      P L+  Q  
Sbjct  81   FNKPADVPGTITKTAPDFCTVYVIFKGKISTMRSASRSAPNISPLRTPIQPPSLRPPQPV  140

Query  462  AQNNPDIRT---------KNAPSSLRSFDEKHMRSFKLEES---ESVSRPSIERAATRGI  605
                 ++R          + +    RS +++  RS + ++    E + R S+E  +    
Sbjct  141  PSTATNMRADRRSFETQQRRSTEDRRSIEDQQRRSMEDQQRRSMEDLQRRSMEDQSDSFR  200

Query  606  PP--RRMLG---AETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsf  770
             P  RR  G    E    +SD+SFVSSG R S DR+   L +  +  RTP   S+     
Sbjct  201  SPFTRRGNGRSYGELSVPESDISFVSSG-RASIDRIFPNLYDNSDPNRTPPRLSNYSDMD  259

Query  771  gsgRLGKGN------DLNSFTDFSSSSLEN---------DEAEVEMRRLKLELQKTMDLY  905
                L   N      D++S TD S+ S E+         D+ E EMRRLKLEL++TM++Y
Sbjct  260  YGPSLESSNYGRRSLDVSSPTDLSNGSFESERFSSASAMDDVESEMRRLKLELKQTMEMY  319

Query  906  STACKEALTAKQKTSELQRW  965
            STACKEALTAKQK +ELQRW
Sbjct  320  STACKEALTAKQKATELQRW  339



>ref|XP_002310353.2| hypothetical protein POPTR_0007s15230g [Populus trichocarpa]
 gb|EEE90803.2| hypothetical protein POPTR_0007s15230g [Populus trichocarpa]
Length=758

 Score =   265 bits (678),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+EIEEAT++FSES+KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  421   IRYRRYSIEEIEEATQYFSESKKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQR  480

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+L+GACPEYG LVYE++A GS++D L  RGN P LSWQ+RFRIAAE
Sbjct  481   EVEVLSLIRHPNMVLLIGACPEYGILVYEHLAKGSLEDCLFKRGNTPALSWQIRFRIAAE  540

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  541   IATGLLFLHQTKPEPLVHRDLKPGNILL  568


 Score =   229 bits (583),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 155/337 (46%), Positives = 206/337 (61%), Gaps = 42/337 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV------DNQTQTSLQHKQQLEAQNKDLFVTFHCFCT  167
            SQ A+KWT ENLLSKGQ+VVL+HV       + + + +  KQQLE   KDLF+ F C+CT
Sbjct  29   SQNALKWTMENLLSKGQTVVLIHVFSKSSSSSSSSSFVTRKQQLEKMAKDLFLAFRCYCT  88

Query  168  RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAP  344
            RK++ CLD+ ++ TDIAKA+T+YV+ AAIE LVLG+ SR  F+++ K  D+P+  S+ AP
Sbjct  89   RKDVRCLDVALESTDIAKAITEYVAHAAIETLVLGTPSRSGFMRKFKA-DVPSTVSRGAP  147

Query  345  DFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDE  524
            DFCTV+ +SK K+SS+RNA+R APF SPL  Q+               KN  +   + D+
Sbjct  148  DFCTVYAVSKGKVSSMRNASRAAPFVSPLLDQI---------------KNQQNEKSAGDD  192

Query  525  KHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSS  704
             H   +K   S S+ R S       G   R       +  ++D+SFVSS SRPS DRMSS
Sbjct  193  SHEALYK--HSWSIKRLSPFGTGRYGHSVRSF---ADLMSETDISFVSS-SRPSTDRMSS  246

Query  705  FLSETVESGRTPRLssssdgsfgsgRLGKG----NDLNSF---------TDFSSSSLEND  845
               + ++SG  PRLS+SS  SF S   G      N    F         T FS S+   D
Sbjct  247  TTYDFMDSGLAPRLSTSSATSFASIHSGPKSIGPNSQQGFSSVSHDSGGTSFSGSTHSLD  306

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL  956
            + E EMRRLKLEL++TM++YS AC+EALTAKQK +EL
Sbjct  307  DMESEMRRLKLELKQTMEMYSEACREALTAKQKATEL  343



>ref|XP_002533177.1| kinase, putative [Ricinus communis]
 gb|EEF29214.1| kinase, putative [Ricinus communis]
Length=565

 Score =   261 bits (667),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE+ATE FS+S KIGEGGYGPV+K  LDHTAVA+KVLRPDAAQG++QFQQ
Sbjct  400   VRYRKYTIEEIEDATEKFSQSNKIGEGGYGPVYKGTLDHTAVAIKVLRPDAAQGKKQFQQ  459

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHP+MV+LLGACPEYGCLVYEYM +GS++DRL+ R N PP+SW+ RF+IAAE
Sbjct  460   EVEVLSCIRHPHMVLLLGACPEYGCLVYEYMDNGSLEDRLLRRDNTPPISWRRRFKIAAE  519

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + T LLFLHQ KP+P+VHRDLKP NILL
Sbjct  520   ISTALLFLHQAKPEPLVHRDLKPANILL  547


 Score = 87.0 bits (214),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 89/141 (63%), Gaps = 9/141 (6%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQ--LEAQNKD---LFVTFHCFCT  167
             SQ+A++W  ++L+     ++LVHV ++     QH     ++A + +   LFV F  +C 
Sbjct  25   NSQHAVRWAIDHLIINNPVIILVHVRHKNH---QHHTNNGIDADSDEVQQLFVPFRGYCA  81

Query  168  RKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAP  344
            RK +   +I+++  D+A+AL DY+S   + ++ +G S+R++F ++ K  D+P+   K+ P
Sbjct  82   RKGVQLKEIILEDNDVARALLDYISKNFLGSIAVGASTRNAFTRKFKNQDVPSSLIKSTP  141

Query  345  DFCTVFviskskissvRNATR  407
            DFC+V+VISK KI+SVR A R
Sbjct  142  DFCSVYVISKGKIASVRTAQR  162


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  801  LNSFTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            L S  D ++S    D  E EMRRL+LEL++T+D+YS AC+EALTAK+K +EL +W
Sbjct  271  LGSPKDLAASQAARD-IEAEMRRLRLELKQTIDMYSAACREALTAKKKANELHQW  324



>ref|XP_010247378.1| PREDICTED: U-box domain-containing protein 34-like [Nelumbo nucifera]
Length=564

 Score =   261 bits (666),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+Y+IDEIE ATE F+ES KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR+QFQQ
Sbjct  226   IRYRKYSIDEIEVATERFAESLKIGEGGYGPVYKAFLDHTPVAIKVLRPDAAQGRKQFQQ  285

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYM +GS++DRL  R N P + WQ+RF+IAAE
Sbjct  286   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMDNGSLEDRLFRRENTPAIPWQIRFKIAAE  345

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  346   IATGLLFLHQTKPEPLVHRDLKPANILL  373


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +3

Query  792  GNDLNSFTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            GN  +S T  S SS+++ EAE  M+RLKLEL++TM++YSTACKEA++AKQK  EL +W
Sbjct  95   GNSSDSPTHPSQSSVKDIEAE--MKRLKLELKQTMEMYSTACKEAISAKQKALELHQW  150



>ref|XP_009417522.1| PREDICTED: U-box domain-containing protein 52 [Musa acuminata 
subsp. malaccensis]
Length=638

 Score =   263 bits (671),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y I+EIE ATE+F++  KIGEGGYGPV+KC LDHTAVAVKVLRPDAAQ R QF Q
Sbjct  300   VRYRKYAIEEIETATEYFADHHKIGEGGYGPVYKCYLDHTAVAVKVLRPDAAQSRSQFHQ  359

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN P + WQ RF+IAAE
Sbjct  360   EVEILSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPVIPWQYRFQIAAE  419

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + T LLFLH  KP+P+VHRDLKPGNILL
Sbjct  420   IATCLLFLHHKKPEPLVHRDLKPGNILL  447


 Score =   110 bits (274),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 121/230 (53%), Gaps = 11/230 (5%)
 Frame = +3

Query  291  LKRLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN  470
            ++R K  DI    +K APDFCTV+VI+K K+S+++NATR AP  SPL  Q   IQ Q   
Sbjct  1    MRRFKHHDITANITKGAPDFCTVYVIAKGKVSAMKNATRLAPIVSPLRDQ---IQSQVSL  57

Query  471  NPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPS---IERAATRGIPPRRMLGAET--  635
             P+  + +      +  +    +  L   +S+  P    +  ++T+          +   
Sbjct  58   KPNAMSHHFLLGSEATSDVASDTHSLHHEDSIKSPYAKVLRGSSTKSYADTSFTDTDISF  117

Query  636  VEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFT  815
            V  D+D+SFVSSG RPS +R  +    +   G                     N+ ++ T
Sbjct  118  VSSDTDISFVSSG-RPSNERSLALRLSSGSEGIDNSFEMVRTSHKSVDPYLTRNEGSTGT  176

Query  816  DFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             +SS ++E+   E EM+RL+LEL+ TMD+Y+ ACKEALTAKQK  ELQRW
Sbjct  177  SWSSQTMED--VEEEMKRLRLELKHTMDMYNKACKEALTAKQKAMELQRW  224



>ref|XP_009140543.1| PREDICTED: U-box domain-containing protein 52 [Brassica rapa]
Length=762

 Score =   265 bits (677),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLR DAAQGR QFQQ
Sbjct  467   VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRADAAQGRSQFQQ  526

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  527   EVEVLSSIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  586

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  587   IGTGLLFLHQAKPEPLVHRDLKPGNILL  614


 Score =   216 bits (551),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 161/365 (44%), Positives = 215/365 (59%), Gaps = 46/365 (13%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV             + + + L  +  L     E  +
Sbjct  29   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLNNNSSLHASSSKLTQEPSLVCRDPEGAS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            KD+F+ F CFCTRK+I C D+LI+  D+AKAL +Y + AAIE LV+GSS +  FL+  K 
Sbjct  89   KDIFLPFRCFCTRKDIQCQDVLIEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
            TDIP   +K APDFCTV+VISK KIS++R+A+R AP  +PL   +Q    +        +
Sbjct  149  TDIPVAITKTAPDFCTVYVISKGKISTMRSASRSAPTNAPLRSPIQPPSLRPPQPVPSTS  208

Query  489  KNAPSSLRSFDEKHMRSFK----LEESESV-SRPSIERAATRGIPPRRMLGAETVEGD--  647
             N  +  +SF E   RS +    +E+  SV  R S+E  +     P    G     GD  
Sbjct  209  NNMRADRQSF-ESQRRSMEDRRSVEDRRSVEDRRSVEDQSDSFRSPFTRRGYGRSYGDLS  267

Query  648  ---SDLSFVSSGSRPSGDRMSSFLSETVESGRTP-RLssssdgsfgsgRLGKGN------  797
               SD+SFVSSG RPS DRM   +++  +  RTP RLS+ SD  +GS      N      
Sbjct  268  VPESDISFVSSG-RPSIDRMFPNINDMNDPNRTPPRLSNFSDMDYGSNFESSSNYGRRSV  326

Query  798  DLNSFTDFSSSSLEN---------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTS  950
            D+NS TD SS S EN         D+ E EMRRLKLEL++TM++YSTACKEALTAKQK +
Sbjct  327  DVNSPTDLSSGSFENERFSSASAMDDVENEMRRLKLELKQTMEMYSTACKEALTAKQKAT  386

Query  951  ELQRW  965
            ELQRW
Sbjct  387  ELQRW  391



>ref|XP_008381640.1| PREDICTED: U-box domain-containing protein 52-like [Malus domestica]
Length=833

 Score =   266 bits (680),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             +YRRY+I+EIEEATEHF  SRKIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+E
Sbjct  487   KYRRYSIEEIEEATEHFLPSRKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQKE  546

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             ++ILSC+RHPNMV+LLGACPEYG LVYEYMA+GS+DD L  +GN P LSWQ+RF+IAAE+
Sbjct  547   IDILSCIRHPNMVLLLGACPEYGILVYEYMANGSLDDCLSRKGNTPALSWQLRFQIAAEV  606

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  607   ATGLLFLHQTKPEPLVHRDLKPGNILL  633


 Score =   219 bits (558),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 159/355 (45%), Positives = 220/355 (62%), Gaps = 50/355 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ-------------------HKQQLEAQ  128
            SQ A++W  E+LL+KGQ+V+L+HV  +T +                       KQQLE  
Sbjct  71   SQNALRWAAEHLLTKGQTVILLHVVQKTSSVCSSIXGNNAIVCNINNLSQSPRKQQLEKM  130

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLK  305
             KDLF+TFHC+C RK+I+C+DI+++ +DIAKA+T+Y S AAIENLVLG+ ++H F+ R K
Sbjct  131  TKDLFLTFHCYCARKDINCIDIILEDSDIAKAVTEYASYAAIENLVLGAPTKHGFI-RFK  189

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
             + IP+  SK APDFCTV+VISK KI S R+A+RPA ++SPL  Q++ + +Q+    +  
Sbjct  190  SSSIPSSVSKGAPDFCTVYVISKGKIHSERHASRPAAYSSPLLAQIEALNQQSAKAAETP  249

Query  486  TKNA--PSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLS  659
             +N    ++  SF  +++        +  SR +  R    G    R+ G  + E +S+ S
Sbjct  250  RQNMYLKAARPSFRPRNL-------PDEASRYAYTRGG--GFSNGRISGGFS-ESESERS  299

Query  660  FVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSL  836
            F+SS  R S DR SS + E ++ G   RLS+SSD SFGS RLG K  +LN   DFSS S 
Sbjct  300  FISS-DRASTDRASSVMYEYMDRG---RLSTSSDQSFGSMRLGPKFAELNFPQDFSSISH  355

Query  837  END------------EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            E++            E E EMRRLKLEL++TMD+YSTAC+EALTAKQK  EL  W
Sbjct  356  ESNQTSSSWSSENLEEVESEMRRLKLELKQTMDMYSTACREALTAKQKEMELHSW  410



>emb|CDX87421.1| BnaA07g34520D [Brassica napus]
Length=1355

 Score =   270 bits (690),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  428   VRYRKYTVEEIEEATSNFDESRKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  487

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  488   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  547

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  548   IATGLLFLHQTKPEPIVHRDLKPGNVLL  575


 Score =   213 bits (543),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 214/352 (61%), Gaps = 55/352 (16%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS--LQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ+A++WT ENL S+GQ++ L+HV +++ +S  ++  QQ +   KDLFV+FHC+C+RK I
Sbjct  29   SQHALRWTIENLASRGQTISLIHVLSKSHSSSDIEDAQQGDKIAKDLFVSFHCYCSRKEI  88

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCT  356
            +C ++L++  D  +A+ ++VS + IENLV+G+ SR+SF+ R   TD+PT  SK+APDFC 
Sbjct  89   NCQNVLLEDADKVRAIIEHVSTSGIENLVVGAPSRNSFMSRRFKTDLPTTVSKSAPDFCN  148

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
            V+VISK KI+SVRNATRPAPF S +  +  E + Q    P   + +A S           
Sbjct  149  VYVISKGKIASVRNATRPAPFKSSM--KSSEYENQQPVTPSDHSHSAVS-----------  195

Query  537  SFKLEESESVSRP--SIERAATRGIPPRRMLG--AETVEGDSDLSFVS------------  668
                    + SRP  S E   TR    RR +    +  + DSDLSF+S            
Sbjct  196  --------TPSRPSKSAEADTTRSPLGRRQVKPYGDLYDSDSDLSFISPSSHRESHDISF  247

Query  669  -SGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-----KGNDLNSFTDFSS-  827
             S  RPS DR SSF  +  ESGR+ R+S+SS+ S GS RLG      G   +S T FS  
Sbjct  248  ISSGRPSVDR-SSFTLDFPESGRSSRISTSSEQSIGSHRLGIKFSDPGFPNDSSTTFSEE  306

Query  828  -------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                   SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ S LQ+
Sbjct  307  SGGTSSYSSQSVDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQASALQK  358



>gb|EPS61916.1| hypothetical protein M569_12876 [Genlisea aurea]
Length=786

 Score =   265 bits (677),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +3

Query  1083  YRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQEV  1262
             YR+YTI+EIE ATE+FS+SRKIGEGGYGPV+KC LDHTA AVKVLRPDA  GR QFQQEV
Sbjct  461   YRKYTIEEIEVATEYFSQSRKIGEGGYGPVYKCYLDHTAAAVKVLRPDATHGRSQFQQEV  520

Query  1263  EILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEMG  1442
             EILSC+RHP+MV+LLGACPEYGCLVYEYM+HGS++DRL  RG  PPL WQ RFRIAAE+ 
Sbjct  521   EILSCIRHPHMVLLLGACPEYGCLVYEYMSHGSLEDRLFRRGKTPPLPWQHRFRIAAEIA  580

Query  1443  TGLLFLHQNKPDPIVHRDLKPGNILL  1520
              GLLFLHQ KP+P+VHRDLKP NILL
Sbjct  581   RGLLFLHQTKPEPLVHRDLKPANILL  606


 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 183/362 (51%), Gaps = 51/362 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQ---------TQTSLQHKQQ-------LEAQNKD  137
            SQ A+KW  EN+L+KGQ+VVL HV  +         T  SL H++         + Q K+
Sbjct  32   SQSALKWAVENVLTKGQTVVLAHVRTKPPSSSSSSDTVASLPHQKHDGVDRIGEDPQVKE  91

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDI  317
            +F+ F  FCTRK+I C D+L+D  D+ KAL D+V+ + I+ L+LG++    + R K  DI
Sbjct  92   IFLPFRVFCTRKDIQCHDVLLDDPDVTKALIDFVTQSHIDFLILGAAARGSIFRFKAKDI  151

Query  318  PTLTSKAAPDFCTVFviskskissvRNATRPAP-FASPLHPQLQEIQEQAQNNPDIRTKN  494
            P    K  PDFCTVFVI K KISS R+A+RP P   SPL  Q+  +   A N+       
Sbjct  152  PGSVLKGVPDFCTVFVIHKGKISSTRSASRPPPSILSPLRVQIMSLATNATNS-------  204

Query  495  APSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPP----RRMLGAETV------EG  644
              S  R+      R     E   + RP+   A    I      RR    ++       E 
Sbjct  205  --SISRNAYFAQQRPGGGSEPTPIPRPNEPNAVKSVIQSPFTHRRAPNGKSFDVLSPPET  262

Query  645  DSDLSFVSSGSRPSGDRM-SSFLSETVESGRTPRLssssdgsfgsgRLG------KGNDL  803
            D      SS +R S DR  ++  SE+++ G TP   S                  K  D+
Sbjct  263  DISFVSSSSSARRSVDRYNTAAASESMDGGLTPPRLSGFSEMDYYQGFDSLPYGRKSMDI  322

Query  804  NSFTDFSSSSLEN--------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
                DFSSS   +        D+ E EMRRLK EL++TM++YSTACKEAL+A++K  ELQ
Sbjct  323  TGPLDFSSSDESDRIFTAQSMDDVEAEMRRLKQELRQTMEMYSTACKEALSAREKAKELQ  382

Query  960  RW  965
            RW
Sbjct  383  RW  384



>ref|XP_010321639.1| PREDICTED: U-box domain-containing protein 35-like [Solanum lycopersicum]
Length=826

 Score =   266 bits (679),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE AT++F+  RKIGEGGYGPV+KC LDHT VA+KVLRPDAAQGR QFQQE
Sbjct  507   RYRKYTIEEIETATDNFAAIRKIGEGGYGPVYKCYLDHTQVAIKVLRPDAAQGRSQFQQE  566

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LSC+RHPNMV+LLGACPE+GCLVYEYMA+GS+DDRL  RG+   L WQ+RFRIAAE+
Sbjct  567   VEVLSCIRHPNMVLLLGACPEFGCLVYEYMANGSLDDRLFRRGSTQVLPWQLRFRIAAEV  626

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             GT LLFLHQ KP+P+VHRDLKPGNILL
Sbjct  627   GTSLLFLHQTKPEPLVHRDLKPGNILL  653


 Score =   168 bits (425),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 146/415 (35%), Positives = 205/415 (49%), Gaps = 103/415 (25%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQ---------------------------  104
            SQYA+KW  + L+ +G++V L+HV  +   SL                            
Sbjct  24   SQYALKWAVDTLIGRGKNVTLLHVKVRPSVSLPNAGSFFSKLHIYYLNNVSFSDVSDGTP  83

Query  105  --HKQQLEAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-S  275
              ++   ++Q K+LF+ F CFCTRKNI   +++I+G DIA +++DYV+   IENLV+G +
Sbjct  84   RVYRSDPDSQAKELFLPFRCFCTRKNIQVNEVVIEGIDIATSISDYVTANVIENLVVGAA  143

Query  276  SRHSFLKRLKVTDIPTLTSKAAPDFCTVFviskskissvRNA------------------  401
            SR+ F+ R K+TD+PT  SK  PDFCTVFVI+K KI S +NA                  
Sbjct  144  SRNGFVSRFKMTDVPTAVSKIVPDFCTVFVIAKGKIQSTKNASSPVPSSPTPSQQNHSTS  203

Query  402  ----------TRPAPFASP-----LHPQLQEIQEQAQNNPDIRTK-NAPSSLRSFDEKHM  533
                      TR A  +S       H Q   +    ++   +RT    P S  S  +  +
Sbjct  204  SLGAKLGFADTRYAQISSDTKGLFFHLQHIALISVIKHLNTVRTGLTCPISPGSVTD--I  261

Query  534  RSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSF--  707
            RS     S +    SI+   TRG    R  G  +V  +SDLSFVSSG RPS    S+F  
Sbjct  262  RSPYASRSSADDLDSIKSPFTRGKAINRSYGDLSV-AESDLSFVSSG-RPS----STFPI  315

Query  708  -LSETVESGRTPRLsss------------sdgsfgsgRLGKGND-----LNSFTDFSSSS  833
             +  + + G  PRLS+S            S+ S    RL  G+      L+    FSS+S
Sbjct  316  SMDSSHDLGLPPRLSNSSDTDAKYSAPRLSNSSETESRLSFGSSFSATRLSEANGFSSNS  375

Query  834  LEN-----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
             ++           ++ E EMRRLK EL++TMD+YS+ACKEAL+AK K  EL RW
Sbjct  376  FDSGNGSWSSPSNMEDIEAEMRRLKQELKQTMDMYSSACKEALSAKHKAMELHRW  430



>emb|CDX88492.1| BnaC06g39360D [Brassica napus]
Length=1354

 Score =   270 bits (690),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YT++EIEEAT +F ESRK+GEGGYGPVF+  LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  428   VRYRKYTVEEIEEATSNFDESRKVGEGGYGPVFRGYLDHTSVAVKVLRPDAAQGRSQFQK  487

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+G LVYEYMA GS++DRL  RGN PP++WQ+RFRIAAE
Sbjct  488   EVEVLSCIRHPNMVLLLGACPEFGILVYEYMAKGSLEDRLFMRGNTPPITWQLRFRIAAE  547

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGN+LL
Sbjct  548   IATGLLFLHQTKPEPIVHRDLKPGNVLL  575


 Score =   219 bits (557),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 153/350 (44%), Positives = 214/350 (61%), Gaps = 51/350 (15%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS--LQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ+A++WT ENL S+GQ++ L+HV +++ +S  ++  QQ +   KDLFV+FHC+C+RK I
Sbjct  29   SQHALRWTIENLASRGQTISLIHVLSKSHSSSDIEDAQQGDKIAKDLFVSFHCYCSRKEI  88

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDFCT  356
            +C ++L++  D  +A+ ++VS + IENLV+G+ SR+SF+ R   TD+PT  SK+APDFC 
Sbjct  89   NCQNVLLEDADKVRAIIEHVSTSGIENLVVGAPSRNSFMSRRFKTDLPTTVSKSAPDFCN  148

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
            V+VISK KI+SVRNA+RPAPF S + P   E + Q    P   + +A S           
Sbjct  149  VYVISKGKIASVRNASRPAPFKSSMQP--SEYENQPPVTPSDHSHSAVS-----------  195

Query  537  SFKLEESESVSRPSIERAATRGIPPRRMLG--AETVEGDSDLSFVS-------------S  671
                  + S  R S E  ATR    RR +    +  + DSDLSF+S             S
Sbjct  196  ------TPSRPRKSAEADATRSPLGRRQVKPYGDLYDSDSDLSFISPSSHRDSHDISFIS  249

Query  672  GSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-----KGNDLNSFTDFSS---  827
              RPS DR SSF  +  ESGR+ R+S+SS+ S GS RLG      G   +S T FS    
Sbjct  250  SGRPSVDR-SSFTLDFPESGRSSRISTSSEQSIGSHRLGIKFSDPGFPNDSSTTFSEESG  308

Query  828  -----SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQR  962
                 SS   D+ E EM+RL+LEL++TMD+YSTACKEAL+A+Q+ S LQ+
Sbjct  309  GTSSYSSQSVDDVEAEMKRLRLELKQTMDMYSTACKEALSARQQASALQK  358



>ref|XP_009117133.1| PREDICTED: U-box domain-containing protein 52-like [Brassica 
rapa]
Length=797

 Score =   265 bits (677),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVK+LR DAAQG  QFQQ
Sbjct  472   VRYRKYSIEEIEHATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKILRADAAQGMSQFQQ  531

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PP+SWQ+RFRIAAE
Sbjct  532   EVEVLSCIRHPNMVLLLGACPEGGCLVYEFMANGSLEDRLFRLGNSPPISWQMRFRIAAE  591

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  592   IGTGLLFLHQAKPEPLVHRDLKPGNILL  619


 Score =   202 bits (514),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 146/368 (40%), Positives = 202/368 (55%), Gaps = 48/368 (13%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD-----------------NQTQTSLQHKQQLEAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV                    +Q S    +  E  +
Sbjct  30   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLNNASSLHASSAKMSQDSSLVCRDPEGAS  89

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K++F+ F CFCTRK+I C D+L++  D+AKAL +Y + AA+E LV+GSS +  FL+  K 
Sbjct  90   KEIFLPFRCFCTRKDIQCKDVLLEEYDVAKALVEYANQAAVEVLVVGSSNKGGFLRFNKP  149

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
             D+P   +K APDFCTV+VISK KIS++R+A+R AP  +PL   +Q    +         
Sbjct  150  ADVPGTITKTAPDFCTVYVISKGKISTMRSASRSAPNIAPLRTPIQPPSLRPPQPVPSTA  209

Query  489  KNAPSSLRSFDEKHMRSFKLEES---------ESVSRPSIERAATRGIPPRRMLGAETVE  641
             N  +  RSF+ +  RS +   S         E + R S+E  +     P    G     
Sbjct  210  TNMRADRRSFETQQRRSTEDRRSVEDQQRRSMEDLQRRSMEDQSDSFRSPFTRRGNGRSY  269

Query  642  GD-----SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN---  797
            GD     SD+SFVSSG R S DR+   L +  +  RTP   S+         L   N   
Sbjct  270  GDLSVPESDISFVSSG-RASIDRIFPNLYDNNDPNRTPPRLSNYSDMDYGPSLESSNYGR  328

Query  798  ---DLNSFTDFSSSSLEN---------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
               D++S TD S+ S E+         D+ E EMRRLKLEL++TM++YSTACKEALTAKQ
Sbjct  329  RSLDVSSPTDLSTGSFESERFSSASAMDDVESEMRRLKLELKQTMEMYSTACKEALTAKQ  388

Query  942  KTSELQRW  965
            K +ELQRW
Sbjct  389  KATELQRW  396



>emb|CDY34775.1| BnaA09g41420D [Brassica napus]
Length=797

 Score =   265 bits (677),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVK+LR DAAQG  QFQQ
Sbjct  472   VRYRKYSIEEIEHATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKILRADAAQGMSQFQQ  531

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PP+SWQ+RFRIAAE
Sbjct  532   EVEVLSCIRHPNMVLLLGACPEGGCLVYEFMANGSLEDRLFRLGNSPPISWQMRFRIAAE  591

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  592   IGTGLLFLHQAKPEPLVHRDLKPGNILL  619


 Score =   202 bits (515),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 205/369 (56%), Gaps = 50/369 (14%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD-----------------NQTQTSLQHKQQLEAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV                    +Q S    +  E  +
Sbjct  30   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLNNASSLHASSAKMSQDSSLICRDPEGAS  89

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            K++F+ F CFCTRK+I C D+L++  D+AKAL +Y + AA+E LV+GSS +  FL+  K 
Sbjct  90   KEIFLPFRCFCTRKDIQCKDVLLEEYDVAKALVEYANQAAVEVLVVGSSNKGGFLRFNKP  149

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQ-EQAQNNPDIR  485
             D+P   +K APDFCTV+VISK KIS++R+A+R AP  +PL   +Q    +  Q  P   
Sbjct  150  ADVPGTITKTAPDFCTVYVISKGKISTMRSASRSAPNIAPLRTPIQPPSLKPPQPVPSTA  209

Query  486  TKNAPSSLRSFDEKHMRSFKLEES---------ESVSRPSIERAATRGIPPRRMLGAETV  638
            T N  +  RSF+ +  RS +   S         E + R S+E  +     P    G    
Sbjct  210  T-NMRADRRSFETQQRRSTEDRRSMEDQQRRSMEDLQRRSMEDQSDSFRSPFTRRGNGRS  268

Query  639  EGD-----SDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGN--  797
             GD     SD+SFVSSG R S DR+   L +  +  RTP   S+         L   N  
Sbjct  269  YGDLSVPESDISFVSSG-RASIDRIFPNLYDNNDPNRTPPRLSNYSDMDYGPSLESSNYG  327

Query  798  ----DLNSFTDFSSSSLEN---------DEAEVEMRRLKLELQKTMDLYSTACKEALTAK  938
                D++S TD S+ S E+         D+ E EMRRLKLEL++TM++YSTACKEALTAK
Sbjct  328  RRSLDVSSPTDLSTGSFESERFSSASAMDDVESEMRRLKLELKQTMEMYSTACKEALTAK  387

Query  939  QKTSELQRW  965
            QK +ELQRW
Sbjct  388  QKATELQRW  396



>ref|XP_002870429.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46688.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score =   264 bits (674),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+Y+I+EIEEATE FS SRK+GEGGYGPV+K  LD+T VA+KVLRPDAAQGR QFQQ
Sbjct  403   LRYRKYSIEEIEEATEDFSPSRKVGEGGYGPVYKGTLDYTKVAIKVLRPDAAQGRSQFQQ  462

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L+CMRHPNMV+LLGACPEYGCLVYEYMA+GS++D +  RGN P LSWQ+RFRIAAE
Sbjct  463   EVEVLTCMRHPNMVLLLGACPEYGCLVYEYMANGSLEDCIFRRGNSPILSWQLRFRIAAE  522

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGL FLHQ KP+P+VHRDLKPGNILL
Sbjct  523   IATGLHFLHQMKPEPLVHRDLKPGNILL  550


 Score =   174 bits (440),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 133/344 (39%), Positives = 186/344 (54%), Gaps = 57/344 (17%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKD----LFVTFHCFCTRK  173
            SQ A+KW   NLLS+GQ++ L+HV  +  +SL +     ++  D    LF+ F C+C RK
Sbjct  22   SQNALKWAVSNLLSRGQTLTLLHVKLKQPSSLPYSGSNLSKPGDDPSELFLPFRCYCARK  81

Query  174  NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFC  353
            +I+C D++++    AK + DYV   AIE L+LGSS+ + L+R K  D+ +   K AP FC
Sbjct  82   DINCQDVVVEDVSAAKGIVDYVQQNAIETLILGSSKMTLLRRFKAADVSSTVMKKAPSFC  141

Query  354  TVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQN-NPDIRTKNAPSSLRSFDEKH  530
            TV+VISK KISS+R+AT   P  S + P  Q    Q  N N + R +      R+ DE  
Sbjct  142  TVYVISKGKISSLRSATSSPPH-SIMPPMRQHAHAQTSNLNVERRQQTMQ---RTHDE--  195

Query  531  MRSFKLE---ESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMS  701
                K+E     E V +PSI                     DSD+SFVSSG RPS D+M 
Sbjct  196  ---IKIEIKRGYEGVYQPSIT--------------------DSDISFVSSG-RPSVDQMF  231

Query  702  SFLSETVESGRTPRLssssdgsfgsgRLG-----KGNDLNS-FTDFSSSSLEN-------  842
              L + V+    PRLS SS+              +  DL S +    SSS E+       
Sbjct  232  PSLYDNVD---VPRLSVSSEYGENRSSFATSYSKQSIDLGSPYAPNYSSSFESGRQSFSL  288

Query  843  ---DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
               DE E EMRRLK+EL+ TM++Y++ACKEA++AK+  +EL +W
Sbjct  289  QSQDEIETEMRRLKMELKHTMEMYNSACKEAISAKKAANELHKW  332



>ref|XP_010925037.1| PREDICTED: U-box domain-containing protein 52 [Elaeis guineensis]
Length=783

 Score =   264 bits (675),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y I+EIE AT++FSE+ KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR+QFQQ
Sbjct  439   VRYRKYGIEEIEIATDYFSENLKIGEGGYGPVYKASLDHTPVAIKVLRPDAAQGRQQFQQ  498

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSCMRHPNMV+LLGACPEYGCLVYEYM +GS++DRL  RGN PP+ W VRF+IAAE
Sbjct  499   EVEVLSCMRHPNMVLLLGACPEYGCLVYEYMDNGSLEDRLFRRGNTPPIPWNVRFKIAAE  558

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ+KP+P+VHRDLKP NILL
Sbjct  559   IATGLLFLHQSKPEPLVHRDLKPANILL  586


 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 117/340 (34%), Positives = 177/340 (52%), Gaps = 33/340 (10%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQT---------QTSLQHKQQLEAQNKDLFVTFH  155
             SQ A+KWT ++LL K +++VLVHV  +           TS  +++Q+EA+ + LF+ F 
Sbjct  38   NSQQAVKWTVDHLLVKNETIVLVHVRCKNYGFGFATGEATSEANREQIEAEMQQLFIPFK  97

Query  156  CFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTS  332
             FC RK +   ++++D  D++KA+ DY++   I N+V+GSS R++  K+ +  D+PT   
Sbjct  98   GFCARKGVQMKEVVLDDIDVSKAIVDYLTANHIHNIVVGSSNRNALTKKFRNPDVPTSLI  157

Query  333  KAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPD----IRTKNAP  500
            K+AP+FC+V+VISK K  +VR+A   A  AS  H Q          +PD    ++T  A 
Sbjct  158  KSAPEFCSVYVISKGKPVTVRSAK--ASTASLQHRQPSSNLGSVHYHPDHDDAVKTPFAR  215

Query  501  SSLRSFDEKHMRSFKLEESESV-SRPSIERAAT-RGIPPRRMLGAETVEGDSDLSFVSSG  674
            ++ R        S       +V  R S E+ A     P R + GA T      L F  + 
Sbjct  216  ANYRG-------SLPPAGPSAVPERWSFEKNADFMKAPARPLSGARTAPVQMLLEFSEAS  268

Query  675  SRP---SGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEND  845
             RP   S     SF  +T   G T               +   ++L+     S S   + 
Sbjct  269  QRPPRPSSYSRDSFAEDTDSHGST-----GFQSIDFGDSIELSSNLSDSPRGSYSPNSSR  323

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            + E EMRRL+LEL++TMD+YS ACKEA++AKQK  EL +W
Sbjct  324  DLEAEMRRLRLELKQTMDMYSNACKEAISAKQKAKELHQW  363



>ref|XP_009380166.1| PREDICTED: U-box domain-containing protein 52-like [Musa acuminata 
subsp. malaccensis]
Length=736

 Score =   263 bits (673),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIE ATE+F+E RKIGEGGYGPV+KC LDHTAVAVKVLRPDAAQGR QF Q
Sbjct  430   LRYRKYTIEEIEAATEYFAEHRKIGEGGYGPVYKCHLDHTAVAVKVLRPDAAQGRSQFHQ  489

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYEYMA+GS++DRL  RGN P + WQ RFRIA E
Sbjct  490   EVEVLSCIRHPNMVLLLGACPEYGCLVYEYMANGSLEDRLFRRGNTPMIPWQHRFRIACE  549

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLH+ KP+P+VHRDLKP NILL
Sbjct  550   IVTGLLFLHRMKPEPLVHRDLKPANILL  577


 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/356 (37%), Positives = 187/356 (53%), Gaps = 57/356 (16%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHC  185
            SQ A+KW  +NL+++GQ++ L+ +  +  +   H +  +  +K+LF+ F CFCTRK++ C
Sbjct  20   SQNALKWAVDNLVTRGQTLTLILIHVKITS---HPKPTDHHSKELFLPFRCFCTRKDVRC  76

Query  186  LDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFCTVFv  365
             D+L++  D+AKA+ ++VS  AIE LV+G+S      R K  D+    +K  PDFCTV+V
Sbjct  77   KDVLLEDLDVAKAIIEFVSHTAIEKLVVGASSKGGFVRFKTRDVTASITKGVPDFCTVYV  136

Query  366  iskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRSFK  545
            I+K K+S++RNA RPAP  SPL  Q   IQ QA   PD+     P            S  
Sbjct  137  IAKGKVSAMRNAVRPAPHMSPLRAQ---IQSQASLKPDV---TPPRLFPGSRGSSSPSLS  190

Query  546  LEESESVSRPSIERAATRGI---------------PPRRMLGAETVE-------GDSDLS  659
                 S     + +   R I               P  R +G  T +        D+D+S
Sbjct  191  SSALSSRLNDQLLQGQARRILTDMDAYSVSLWKRSPFGRGMGGATTKSFADLSLSDTDIS  250

Query  660  FVSSGSRPSGDRM--------SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSF-  812
            FVSSG RPS D+         S  L  + E  RTP                 GN+ +S  
Sbjct  251  FVSSG-RPSTDQAFPPRLSNGSDGLDRSFEM-RTPH--------KSVDSYSTGNEFSSIS  300

Query  813  -----TDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                 T +SS ++E+   E EM+RL+LEL+ TMD+Y+ ACKEALTAKQKT+ELQRW
Sbjct  301  QGSTGTSWSSQAMED--VEEEMKRLRLELKHTMDMYNNACKEALTAKQKTTELQRW  354



>emb|CBI18425.3| unnamed protein product [Vitis vinifera]
Length=742

 Score =   263 bits (673),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 176/343 (51%), Positives = 226/343 (66%), Gaps = 35/343 (10%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQH---KQQLEAQN-KDLFVTFHCFCTRK  173
            SQ+A++W TE LL+KGQ+VVL+HV   + TS++H       E  N KDLFVTFHCFC RK
Sbjct  27   SQHALRWATERLLTKGQTVVLIHVLKISPTSIEHHPVSSHKEKMNVKDLFVTFHCFCRRK  86

Query  174  NIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAPDF  350
            +IHCLDIL++ TDI +AL ++ + AA++NL+LG SS++SF++R K++D+P   SK A DF
Sbjct  87   DIHCLDILLEDTDIPRALIEFTNHAAVDNLILGASSKYSFIRRFKISDVPGSVSKGAADF  146

Query  351  CTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKH  530
            CTV+VISK KISSVRNA+R AP  SPLH     IQ +  NN       APSS       H
Sbjct  147  CTVYVISKGKISSVRNASRTAPHVSPLH---SHIQNKVNNNAIANPVEAPSS-------H  196

Query  531  MRSFKLEESESV------SRPSIERAATR-GIPPRRMLGAETVEGDSDLSFVSSGSRPSG  689
              S + E+  S        R S +    R G      LG+E +E D+D+SF+SS  RPS 
Sbjct  197  SISIRAEKISSKPHSIQDDRESFKSPFLRGGRASNAKLGSEPLELDTDISFISS-ERPSS  255

Query  690  DRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-NDLNSFTDFSSSSLEND-------  845
            DRMS+ + E ++SG TPR+SSSSD SFGS R+G    D NS  +FSS S E+        
Sbjct  256  DRMSNVVYEYMDSGPTPRISSSSDHSFGSIRIGPAFGDPNSL-NFSSISQESGRTSCSST  314

Query  846  ---EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
               + E EMRRLKLEL++TMD+YSTACKEAL+AKQK  ELQRW
Sbjct  315  SMVKVEAEMRRLKLELKQTMDMYSTACKEALSAKQKAVELQRW  357


 Score =   248 bits (634),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIEEATE FSESRKIGEGGYG V+KC LDHT VAVKVLRPDA+QGR QFQ+
Sbjct  421   IRYRKYTIEEIEEATEFFSESRKIGEGGYGRVYKCYLDHTPVAVKVLRPDASQGRSQFQK  480

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYE MA GS+DDRL   GN PPLSWQ+RFRI+AE
Sbjct  481   EVEILSCIRHPNMVLLLGACPEYGCLVYECMAKGSLDDRLFQLGNTPPLSWQLRFRISAE  540

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  541   IATGLLFLHQTKPEPLVHRDLKPGNILL  568



>ref|XP_010655258.1| PREDICTED: U-box domain-containing protein 35-like isoform X3 
[Vitis vinifera]
Length=789

 Score =   264 bits (675),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 228/354 (64%), Gaps = 45/354 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQH-------------KQQLEAQNKDLFV  146
            SQ+A++W TE LL+KGQ+VVL+HV   + T  ++             +  L+   KDLFV
Sbjct  27   SQHALRWATERLLTKGQTVVLIHVLKISPTMGEYTPVHDVDSAIVSGQNNLDKNVKDLFV  86

Query  147  TFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPT  323
            TFHCFC RK+IHCLDIL++ TDI +AL ++ + AA++NL+LG SS++SF++R K++D+P 
Sbjct  87   TFHCFCRRKDIHCLDILLEDTDIPRALIEFTNHAAVDNLILGASSKYSFIRRFKISDVPG  146

Query  324  LTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPS  503
              SK A DFCTV+VISK KISSVRNA+R AP  SPLH     IQ +  NN       APS
Sbjct  147  SVSKGAADFCTVYVISKGKISSVRNASRTAPHVSPLH---SHIQNKVNNNAIANPVEAPS  203

Query  504  SLRSFDEKHMRSFKLEESESVSRPSIE--RAATR------GIPPRRMLGAETVEGDSDLS  659
            S       H  S ++ E  S    SI+  R + +      G      LG+E +E D+D+S
Sbjct  204  S-------HSISIRVAEKISSKPHSIQDDRESFKSPFLRGGRASNAKLGSEPLELDTDIS  256

Query  660  FVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKG-NDLNSF--------  812
            F+SS  RPS DRMS+ + E ++SG TPR+SSSSD SFGS R+G    D NS         
Sbjct  257  FISS-ERPSSDRMSNVVYEYMDSGPTPRISSSSDHSFGSIRIGPAFGDPNSLNFSSISQE  315

Query  813  ---TDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
               T  SS+S+ N+E E EMRRLKLEL++TMD+YSTACKEAL+AKQK  ELQRW
Sbjct  316  SGRTSCSSTSMINEEVEAEMRRLKLELKQTMDMYSTACKEALSAKQKAVELQRW  369


 Score =   249 bits (635),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI+EIEEATE FSESRKIGEGGYG V+KC LDHT VAVKVLRPDA+QGR QFQ+
Sbjct  445   IRYRKYTIEEIEEATEFFSESRKIGEGGYGRVYKCYLDHTPVAVKVLRPDASQGRSQFQK  504

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVEILSC+RHPNMV+LLGACPEYGCLVYE MA GS+DDRL   GN PPLSWQ+RFRI+AE
Sbjct  505   EVEILSCIRHPNMVLLLGACPEYGCLVYECMAKGSLDDRLFQLGNTPPLSWQLRFRISAE  564

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  565   IATGLLFLHQTKPEPLVHRDLKPGNILL  592



>emb|CDY20308.1| BnaC04g36480D [Brassica napus]
Length=800

 Score =   264 bits (675),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLR DAAQGR QFQQ
Sbjct  505   VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRADAAQGRSQFQQ  564

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  565   EVEVLSSIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  624

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  625   IGTGLLFLHQAKPEPLVHRDLKPGNILL  652


 Score =   203 bits (517),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 221/405 (55%), Gaps = 88/405 (22%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------NQTQTSLQHKQQL-----------EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV       N T +      +L           E  +
Sbjct  29   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLNNTSSLHASSAKLTQEPSLVCRDPEGAS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            KD+F+ F CFCTRK+I C D+LI+  D+AKAL +Y + AAIE LV+GSS +  FL+  K 
Sbjct  89   KDIFLPFRCFCTRKDIQCQDVLIEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLH-----PQLQEIQEQAQNN  473
            TDIP   +K APDFCTV+VISK KIS++R+A+R AP  +PL      P L+  Q     +
Sbjct  149  TDIPVAITKTAPDFCTVYVISKGKISTMRSASRSAPTNAPLRSPIQPPSLRPPQPVPSTS  208

Query  474  PDIRT--KNAPSSLRSFDEKH----MRSFKLEESESVSRPSIERAATRGIPPRRM-----  620
             ++R   ++  S  RS +++      RS + ++S+S S+  I      G  PRR+     
Sbjct  209  NNMRADRQSFESQRRSMEDRRSVEDRRSVE-DQSDSFSKNPI--FCDFGGKPRRLPFISC  265

Query  621  ----------------------------LGAETVEGD-----SDLSFVSSGSRPSGDRMS  701
                                         G     GD     SD+SFVSSG RPS DRM 
Sbjct  266  VFIYTFILITHRHETETPLDENRSPFTRRGYGRSYGDLSVPESDISFVSSG-RPSIDRMF  324

Query  702  SFLSETVESGRT-PRLssssdgsfgsgRLGKGN------DLNSFTDFSSSSLEN------  842
              +++  +  RT PRLS+ SD  +G       N      D+NS TD SS S EN      
Sbjct  325  PNINDMNDPNRTPPRLSNFSDMDYGPNFESSSNYGRRSVDVNSPTDLSSGSFENERFSSA  384

Query  843  ----DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                D+ E EMRRLKLEL++TM++YSTACKEALTAKQK +ELQRW
Sbjct  385  SAMQDDVESEMRRLKLELKQTMEMYSTACKEALTAKQKATELQRW  429



>ref|XP_011031475.1| PREDICTED: U-box domain-containing protein 35 [Populus euphratica]
Length=798

 Score =   264 bits (675),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+EIEEAT++FSES+KIGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  456   IRYRRYSIEEIEEATQYFSESKKIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQR  515

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+L+GACPEYG LVYE++A GS++D L  RGN P LSWQ+RFRIAAE
Sbjct  516   EVEVLSLIRHPNMVLLIGACPEYGILVYEHLAKGSLEDCLFKRGNTPALSWQIRFRIAAE  575

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  576   IATGLLFLHQTKPEPLVHRDLKPGNILL  603


 Score =   227 bits (579),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 159/360 (44%), Positives = 210/360 (58%), Gaps = 47/360 (13%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV----DNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRK  173
            SQ A+KWT ENLLSKGQ+VVL+HV     + + + +  KQQLE   KDLF+ F C+CTRK
Sbjct  29   SQNALKWTMENLLSKGQTVVLIHVFSKSSSSSSSFVTRKQQLEKMAKDLFLAFRCYCTRK  88

Query  174  NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPDF  350
            ++ CLD+ ++ TDIAKA+T+YV+ AAIE LVLG+ SR  F+++ K  D+P+  S+ APDF
Sbjct  89   DVRCLDVALESTDIAKAITEYVAHAAIETLVLGTPSRSGFMRKFKA-DVPSTVSRGAPDF  147

Query  351  CTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLR------  512
            CTV+ +SK K+SS+RNA+R APF SPL  Q++      Q N  I  +N    L       
Sbjct  148  CTVYAVSKGKVSSMRNASRAAPFVSPLLDQIKN-----QQNEKILIQNPIYGLLLTERTA  202

Query  513  ------SFDEKHMRSF---KLEESESVSRPSIERAATRGIPP-------RRMLGAETVEG  644
                  S DE     F    L      S+ ++         P         +     +  
Sbjct  203  SVNHHISVDENFSLGFWLLWLAYDSICSKANLNTIVGNNRSPFGTGRYGHSVRSFADLMS  262

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNS----  809
            ++D+SFVSS SRPS DRMSS   + ++SG  PRLS+SS  SF S   G K    NS    
Sbjct  263  ETDISFVSS-SRPSTDRMSSTTYDFMDSGLAPRLSTSSATSFASIHSGPKSVGHNSQQGL  321

Query  810  --------FTDFSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                     T FS S+   D  E EMRRLKLEL++TM++YS AC+EALTAKQK +EL RW
Sbjct  322  SSVSHDSGGTSFSGSTHSLDGMESEMRRLKLELKQTMEMYSEACREALTAKQKATELNRW  381



>ref|XP_004144908.1| PREDICTED: U-box domain-containing protein 35-like [Cucumis sativus]
Length=888

 Score =   265 bits (678),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+E+E ATEHF++SRKIGEGGYGPVF+C LDHT+VAVKVLRPDA QGR QFQQ
Sbjct  453   IRYRRYSIEEVESATEHFAQSRKIGEGGYGPVFRCRLDHTSVAVKVLRPDATQGRTQFQQ  512

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             E++ILSC+RHPNMV+LLGACPEYG LVYEYM++GS++DRL  +GN P + WQ+RFRIAAE
Sbjct  513   EIDILSCIRHPNMVLLLGACPEYGILVYEYMSNGSLEDRLFRKGNTPVIPWQLRFRIAAE  572

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  573   IATGLLFLHQTKPEPLVHRDLKPANILL  600


 Score =   226 bits (576),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 163/357 (46%), Positives = 214/357 (60%), Gaps = 51/357 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------------------DNQTQTSLQHKQQLEA  125
            SQ A++W  E+L+ KGQ+V+L+HV                    D  + +   H QQLE 
Sbjct  35   SQNALRWAAEHLIGKGQTVILIHVVHRPSSAAASLIGEAIICNTDGSSTSDSPHIQQLEM  94

Query  126  QNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRL  302
            Q +D+F+TFHC+CTRK+I CLDI+++ TDI KALT+YVS AAIE LVLG+ SRH F+ R 
Sbjct  95   QTRDIFLTFHCYCTRKDIQCLDIILEDTDIVKALTEYVSYAAIETLVLGAPSRHGFI-RF  153

Query  303  KVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDI  482
            K + + +  SK APDFCTV+VISK K+SSV+NA+R APF SPL  +LQ++     + P +
Sbjct  154  KSSSMGSSVSKGAPDFCTVYVISKGKVSSVKNASRSAPFTSPLLDRLQKL-----SKPIV  208

Query  483  RTKNAPS---SLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSD  653
            +    P    +LR       RSF+ E  +S      ER                 E +SD
Sbjct  209  KGSITPRHKFNLRDRTSFKPRSFQDETIKSPYSHGGERTCISK------FSGGFSESESD  262

Query  654  LSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSS  830
            +SF+SSG RPS DR SS   +  +SG  PR S+SS+ SF S     K  DL++  DFSS 
Sbjct  263  ISFISSG-RPSTDRSSSVAFDYSDSG-PPRFSTSSEHSFTSLPFKPKWADLSNLNDFSSV  320

Query  831  SLEN------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S E+            DE E+EMRRLKLEL++TM++YSTACKEALTAKQK  EL  W
Sbjct  321  SDESCRTSCSWSSQNLDEVELEMRRLKLELKQTMEMYSTACKEALTAKQKAMELNNW  377



>emb|CDY46145.1| BnaA04g14330D [Brassica napus]
Length=775

 Score =   263 bits (673),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE F+E  KIGEGGYGPV+KC LDHT VAVKVLR DAAQGR QFQQ
Sbjct  480   VRYRKYSIEEIESATEFFAEKYKIGEGGYGPVYKCYLDHTPVAVKVLRADAAQGRSQFQQ  539

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPE GCLVYE+MA+GS++DRL   GN PPLSWQ+RFRIAAE
Sbjct  540   EVEVLSSIRHPNMVLLLGACPECGCLVYEFMANGSLEDRLFRLGNSPPLSWQMRFRIAAE  599

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  600   IGTGLLFLHQAKPEPLVHRDLKPGNILL  627


 Score =   134 bits (336),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 18/166 (11%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVD------------NQTQTSLQHKQQL-----EAQN  131
            +SQ+A+KW  ++LL +GQSV+LVHV             + + + L  +  L     E  +
Sbjct  29   SSQHALKWAVDHLLQRGQSVILVHVKLRPSPLNNNSSLHASSSKLTQEPSLVCRDPEGAS  88

Query  132  KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKV  308
            KD+F+ F CFCTRK+I C D+LI+  D+AKAL +Y + AAIE LV+GSS +  FL+  K 
Sbjct  89   KDIFLPFRCFCTRKDIQCQDVLIEEYDVAKALVEYANQAAIEVLVVGSSNKGGFLRFNKP  148

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQ  446
            TDIP   +K APDFCTV+VISK KIS++R+A+R AP  +PL   L 
Sbjct  149  TDIPVAITKTAPDFCTVYVISKGKISTMRSASRSAPTNAPLRSHLN  194


 Score = 96.7 bits (239),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 82/124 (66%), Gaps = 18/124 (15%)
 Frame = +3

Query  645  DSDLSFVSSGSRPSGDRMSSFLSETVESGRTP-RLssssdgsfgsgRLGKGN------DL  803
            +SD+SFVSSG RPS DRM   +++  +  RTP RLS+ SD  +GS      N      D+
Sbjct  282  ESDISFVSSG-RPSIDRMFPNINDMNDPNRTPPRLSNFSDMDYGSNFESSSNYGRRSVDV  340

Query  804  NSFTDFSSSSLEN----------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSE  953
            NS TD SS S EN          D+ E EMRRLKLEL++TM++YSTACKEALTAKQK +E
Sbjct  341  NSPTDLSSGSFENERFSSASAMQDDVENEMRRLKLELKQTMEMYSTACKEALTAKQKATE  400

Query  954  LQRW  965
            LQRW
Sbjct  401  LQRW  404



>gb|KEH27279.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=806

 Score =   264 bits (674),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
              RYRRY+I+EIEEAT  FS+S KIGEGGYGPVFKC LDHT VA+KVL+ DAAQGR+QF Q
Sbjct  456   ARYRRYSIEEIEEATNRFSDSLKIGEGGYGPVFKCELDHTPVAIKVLKSDAAQGRQQFNQ  515

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPE+GC+VYEYMA+GS+DD L  RG +PPL WQ+RF+IAAE
Sbjct  516   EVEVLSCIRHPNMVLLLGACPEFGCIVYEYMANGSLDDCLFRRGKQPPLPWQLRFQIAAE  575

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+PIVHRDLKPGNILL
Sbjct  576   IATGLLFLHQTKPEPIVHRDLKPGNILL  603


 Score =   181 bits (459),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 202/368 (55%), Gaps = 58/368 (16%)
 Frame = +3

Query  3    TSQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQ----LEAQNKDLFVTFHCFCTR  170
            TSQ+A+KW  ENLL K Q + L+HV  ++ +S          ++++++DLF +F  FC R
Sbjct  26   TSQHAVKWAVENLLPKDQCLFLIHVKQKSNSSTSTPSNDEDVMDSESRDLFDSFRVFCNR  85

Query  171  KNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDIPTLTSKAAPD  347
            KNI C ++L++ TDI KALT+ +S  +IE LVLG+ S+   ++R + TD+PT  SK AP 
Sbjct  86   KNIQCNELLLEDTDIPKALTECISTHSIELLVLGACSKGGIVRRFRTTDVPTSVSKGAPP  145

Query  348  FCTVFviskskissvRNATRPAPFASPLH-PQLQEIQEQAQNNPDIRTKNAPSSLRSFDE  524
            FCT+++ISK KISSV++AT P P  + +  PQ    +      P      +P   RS D 
Sbjct  146  FCTIYIISKGKISSVKSATAPIPKPAVVATPQTIPQRGNQFQQPHAMPTRSPE--RS-DP  202

Query  525  KHMRSFKLEESESVSRPSIERAATRG-----------IPPRRMLGAETVE---GDSDLSF  662
            + +R++         RPS ER A  G           I P    G +  E    +SD+SF
Sbjct  203  QMLRNYP-------PRPSAERHAAYGMRQGLDDDQEMISPFNRRGNKAYESSINESDISF  255

Query  663  VSSGSRPSGDRMSSFL--------SETVESGR-TPRLssssdgsfgsgRLGKGN-----D  800
            VSSG RPS DR+   L        + ++ +G  T RLSS  D          G      D
Sbjct  256  VSSG-RPSIDRIFPSLYNNDDLDSNSSISNGHPTGRLSSEYDARNSFASSYSGGGPRSID  314

Query  801  LNSFTD---FSSS----------SLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQ  941
            L+S  D   FSS           S   DE E EMRRLKLEL++TM++YS+ACKEALTAKQ
Sbjct  315  LSSPLDNYSFSSQGSNGPSSIRLSDATDEVESEMRRLKLELKQTMEMYSSACKEALTAKQ  374

Query  942  KTSELQRW  965
            K  ELQRW
Sbjct  375  KAIELQRW  382



>ref|XP_002513301.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF48704.1| ATP binding protein, putative [Ricinus communis]
Length=786

 Score =   263 bits (673),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+EIE+ATE+F+ESR IGEGGYGPV+KC LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  437   LRYRRYSIEEIEQATEYFAESRMIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQR  496

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYG LVYEYMA GS+DD L  RGN P L WQ+RFRIAA+
Sbjct  497   EVEVLSLIRHPNMVLLLGACPEYGVLVYEYMAKGSLDDCLFRRGNTPVLPWQLRFRIAAQ  556

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  557   IATGLLFLHQTKPEPLVHRDLKPGNILL  584


 Score =   224 bits (571),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 216/347 (62%), Gaps = 43/347 (12%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT----------SLQHKQQLEAQNKDLFVTFH  155
            SQ A+KW  ENLLSKGQ+VVLVHV ++  +          +   K QL+   K+LF++F 
Sbjct  27   SQNALKWALENLLSKGQTVVLVHVLHRVASYTGPGYTCDFNSTTKHQLDKMTKELFLSFR  86

Query  156  CFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSK  335
            C+CTRK++ CLDI+++  D+ K L +YVS AAIENLV+G+SRH F+++ K  DIPT  SK
Sbjct  87   CYCTRKDVQCLDIVLEDQDVVKGLVEYVSYAAIENLVIGASRHGFIRKFKA-DIPTSVSK  145

Query  336  AAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRS  515
             APDFC V+VISK KISS+R A+R AP+ASPL   + +IQ Q+      R  +A S   S
Sbjct  146  GAPDFCNVYVISKGKISSMRQASRSAPYASPL---IDQIQSQSS-----RPSDASSDTLS  197

Query  516  FDEKHMRSF------KLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGS  677
                 MR+       ++   ES   P  ER   R    +    AE ++ ++D+SFVSSG 
Sbjct  198  MHSGSMRAECPVVKPRISLDESFKSP-FERGG-RAFNVKSF--AEFMDSETDISFVSSG-  252

Query  678  RPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSF------------TD  818
            RPS DR SS   + ++S  T RLS+SS+ SFGS R G K ND +S             T 
Sbjct  253  RPSTDRSSSVALDFIDSCLTSRLSTSSETSFGSIRSGPKFNDCSSLHEFSTFSHESGATS  312

Query  819  FSSSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQ  959
            FS SS   D+ E EMRRLKLEL++TMD+YSTACKEALTAKQK  EL 
Sbjct  313  FSGSSQSMDDMEAEMRRLKLELKQTMDMYSTACKEALTAKQKAVELH  359



>ref|XP_008380441.1| PREDICTED: U-box domain-containing protein 35-like [Malus domestica]
Length=805

 Score =   263 bits (673),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             +YRRY+I+EIEEATEHF  SRK+GEGGYGPV+KC L+HT VAVKVLRPDAAQGR QFQ+E
Sbjct  443   KYRRYSIEEIEEATEHFLPSRKVGEGGYGPVYKCYLNHTLVAVKVLRPDAAQGRSQFQKE  502

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             ++ILSC+RHPNMV+LLGACPEYG L YEYMA+GS+DD L  +GN P LSWQ+RFRIAAE+
Sbjct  503   IDILSCIRHPNMVLLLGACPEYGILAYEYMANGSLDDCLSRKGNTPALSWQLRFRIAAEI  562

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  563   ATGLLFLHQTKPEPLVHRDLKPGNILL  589


 Score =   218 bits (556),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 159/354 (45%), Positives = 221/354 (62%), Gaps = 51/354 (14%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV-------------------DNQTQTSLQHKQQLEAQ  128
            SQ A++W  E++L++GQ+V+L+HV                   +N +Q+    KQQLE  
Sbjct  30   SQNALRWAAEHVLTRGQTVILLHVQKTSSVCPLAGNNAVVCNINNPSQSP--RKQQLEKM  87

Query  129  NKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLK  305
             KDLFVTFHC+CTRK+I+CLDI+++ +DI KALT+Y S AAIE LVLG+ S+H F+ R K
Sbjct  88   AKDLFVTFHCYCTRKDINCLDIILEDSDIPKALTEYASYAAIETLVLGAPSKHGFI-RFK  146

Query  306  VTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIR  485
             + IP+  SK APDFCT++VISK KI+S R+A+RPAP +SPL  Q++ + +Q+    +  
Sbjct  147  SSSIPSSVSKGAPDFCTIYVISKGKINSERHASRPAPHSSPLLAQIEALNQQSAKAAETP  206

Query  486  TKNAPSSLR-SFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
             +N     R SF  ++++       +  +R +  R    G     M+G    E +SD+SF
Sbjct  207  KQNMYLKARPSFKPRNLQ-------DEAARYAYARG---GGFSNGMIGGGFSESESDISF  256

Query  663  VSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSFTDFSSSSLE  839
            +SS  R S DR SS + + ++ G   RLS+SSD SFGS RLG K  +LN   D SS S E
Sbjct  257  ISS-DRASTDRASSVMYDYMDRG---RLSTSSDQSFGSMRLGPKFAELNFQQDLSSVSHE  312

Query  840  N------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +            DE E EMRRLKLEL++TMD+YSTAC+EA+TAKQK  +L  W
Sbjct  313  SSRTSSSWSSQNLDEVESEMRRLKLELKQTMDMYSTACREAITAKQKEMKLHSW  366



>ref|XP_007216419.1| hypothetical protein PRUPE_ppa022892mg [Prunus persica]
 gb|EMJ17618.1| hypothetical protein PRUPE_ppa022892mg [Prunus persica]
Length=759

 Score =   263 bits (671),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+YTI++IE AT  FS +RKIGEGGYGPVF+  LDHT VA+KVLRPDAAQGR QFQ+
Sbjct  422   LRYRKYTIEDIEAATNEFSPARKIGEGGYGPVFRGELDHTPVAIKVLRPDAAQGRSQFQK  481

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+L+GACPEYGCLVYEYMA GS++DRL  RGN P + WQ+RFRIAAE
Sbjct  482   EVEVLSCIRHPNMVLLVGACPEYGCLVYEYMAKGSLEDRLFQRGNTPVIPWQLRFRIAAE  541

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  542   IGTGLLFLHQTKPEPVVHRDLKPGNILL  569


 Score =   169 bits (427),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 136/353 (39%), Positives = 185/353 (52%), Gaps = 58/353 (16%)
 Frame = +3

Query  6    SQYAIKWTTENLLSK-GQSVVLVHVDNQT----------------QTSLQHKQQLEAQNK  134
            S+YAIKW  E+LL++ GQS+ LVHV   T                + +   K Q++A+ K
Sbjct  24   SEYAIKWIAEHLLTRPGQSLTLVHVKQPTAAPALPNISKSGELPREVAKMIKYQVDAEAK  83

Query  135  DLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSF-LKRLKV  308
            DLF+ F CFCT+K IH  +++++  DI+KAL +YV+  +IE LVLG+ SR++F   R K 
Sbjct  84   DLFLPFRCFCTKKAIHWNEVILENADISKALINYVTANSIEILVLGAPSRNAFGFLRFKT  143

Query  309  TDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRT  488
             DIP+  SK APDFCTV+VI + KI+  R AT       PLH Q+Q+   Q        +
Sbjct  144  RDIPSAVSKGAPDFCTVYVIGRGKITHSRPATGRLTPKPPLHNQIQQQPSQV-----YES  198

Query  489  KNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVS  668
            +   SS RS     + + KL       +P +    TR IP R        E D       
Sbjct  199  EITQSSTRS----QLNNIKL-------KPPL----TRAIPIRDKSYEALPESD---GLSV  240

Query  669  SGSRPSGDRMSSFLS--------ETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFS  824
            S  RPS D MS+F S         ++ S    R S+SS        +  G   N F+  S
Sbjct  241  SSERPSTDLMSNFPSMASRMTYQSSISSELDNRSSTSSHSGIKFIDMSSGR--NEFSSSS  298

Query  825  S------SSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                   SS   DE E EMRRL+LEL++TM++YS ACKEA+TAK K  EL +W
Sbjct  299  IESGRSWSSTSRDEMENEMRRLRLELKQTMEMYSMACKEAVTAKHKEKELHQW  351



>ref|XP_008445579.1| PREDICTED: U-box domain-containing protein 51 [Cucumis melo]
Length=845

 Score =   264 bits (675),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE FSES KIGEGGYGPV+K  LDHTAVA+KVLRPDAAQGR QFQQ
Sbjct  510   VRYRKYSIEEIETATEFFSESLKIGEGGYGPVYKGYLDHTAVAIKVLRPDAAQGRSQFQQ  569

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRG-NKPPLSWQVRFRIAA  1433
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MAHGS+DD L  RG N  PLSWQ RF+IAA
Sbjct  570   EVEVLSCIRHPNMVLLLGACPEYGCLVYEFMAHGSLDDCLFRRGENSKPLSWQRRFKIAA  629

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  630   EIGTALLFLHQTKPEPLVHRDLKPANILL  658


 Score =   160 bits (406),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 119/309 (39%), Positives = 163/309 (53%), Gaps = 62/309 (20%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT----------------------SLQHKQQL  119
            SQ A+KW TENLL KGQ+ +L+HV  ++ T                      ++   + +
Sbjct  133  SQLALKWATENLLVKGQTAILIHVKLKSSTYSGSSMASPKVMSASDAGNVNGNVLVSKDI  192

Query  120  EAQNKDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLK  296
            +   +DLF+ F CFCTRK+I C DI+++  D+AKAL +YV+ A IENLV+GS S+ SFL+
Sbjct  193  DPSTRDLFLPFRCFCTRKDIFCKDIVVEDLDVAKALIEYVTQAGIENLVVGSTSKSSFLR  252

Query  297  RLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQE---IQEQAQ  467
            RLK TDIP    K APDFC V+VIS+SKI ++R+A+RPAP +SPL   L     I+ Q+ 
Sbjct  253  RLKTTDIPGSVVKGAPDFCNVYVISRSKIQTMRSASRPAPVSSPLRSLLLSQTVIKSQSA  312

Query  468  NN--PDIRTKNAPSSL----RSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGA  629
             +  P I+T+     L    RS D    RS           P   +     +P       
Sbjct  313  ESLVPQIQTRPEKPPLEAARRSQDNIEFRS-----------PFTRKGYNGKMP------G  355

Query  630  ETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNS  809
            E    D+D+SFVSSG RPS DR+   L +  ++GR P             RL  GND   
Sbjct  356  EVTLPDTDISFVSSG-RPSVDRLFPTLFDNADTGRVP------------PRLSSGNDAEL  402

Query  810  FTDFSSSSL  836
            +  F S  L
Sbjct  403  YNSFESQQL  411



>ref|XP_006374811.1| hypothetical protein POPTR_0014s01190g [Populus trichocarpa]
 gb|ERP52608.1| hypothetical protein POPTR_0014s01190g [Populus trichocarpa]
Length=705

 Score =   261 bits (668),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYRRY+I+EIE AT++FSES+KIG GGYGPV+ C LDHT VAVKVLRPDAAQGR QFQ+
Sbjct  411   IRYRRYSIEEIEVATQYFSESKKIGGGGYGPVYNCYLDHTPVAVKVLRPDAAQGRSQFQR  470

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYG LVYEYMA GS++D L  RGN P LSWQ+RFRIAAE
Sbjct  471   EVEVLSLIRHPNMVLLLGACPEYGILVYEYMAKGSLEDCLFKRGNTPALSWQIRFRIAAE  530

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKPGNILL
Sbjct  531   IATGLLFLHQTKPEPLVHRDLKPGNILL  558


 Score =   205 bits (521),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 196/341 (57%), Gaps = 60/341 (18%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT---------------SLQHKQQLEAQNKDL  140
            SQ A+KWT ENLL+KGQ+++L+HV N++ +               S   KQQLE   KDL
Sbjct  29   SQNALKWTVENLLTKGQNLILIHVFNKSSSSSSSFVTSHGSPGDYSSPGKQQLEKMAKDL  88

Query  141  FVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLKRLKVTDI  317
            F+TF C+CTRK++HCLD+ ++ TDIAKA+T+YVS AAIE LVLG+ SR  F++      +
Sbjct  89   FLTFRCYCTRKDVHCLDVALESTDIAKAITEYVSHAAIETLVLGTPSRSGFMRYF--CHV  146

Query  318  PTLTSKAAPDFCTVFviskskissvRNATRPAPFASPL----HPQLQEIQEQAQNNPDIR  485
            P+  S+ APDFC V+V+SK K+S++RNA+RPAPFASPL      Q  +   +A++N  + 
Sbjct  147  PSTVSRGAPDFCIVYVVSKGKVSTMRNASRPAPFASPLLDQIQNQQNQNSPRAEHNTIVG  206

Query  486  TKNAPSSLRSFDEKHMRSFKLEESES-VSRPSIERAATRGIPPRRMLGAETVEGDSDLSF  662
               +P   R      ++SF    SE+ +S  S  R +T  I P       +V   SD SF
Sbjct  207  NNRSPFG-REGQGHSVKSFADLMSETDISFVSSSRPSTDRINP-------SVSTSSDTSF  258

Query  663  VSSGSRP---SGDRMSSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSS  833
             S  S P   S +    F S + +SGR                          T F+ S+
Sbjct  259  ASIQSGPKFFSPNYHQGFSSISQDSGR--------------------------TSFTGST  292

Query  834  LENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSEL  956
               D+ E EMRR KLEL++TMDLY+ AC+EALTAK+K +EL
Sbjct  293  HSLDDMESEMRRRKLELKQTMDLYNAACREALTAKRKATEL  333



>ref|XP_004305624.1| PREDICTED: U-box domain-containing protein 51-like [Fragaria 
vesca subsp. vesca]
Length=734

 Score =   262 bits (669),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+YTI+EIE+ATE F++S KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR+QFQQ
Sbjct  401   VRYRKYTIEEIEQATEKFADSMKIGEGGYGPVYKGKLDHTPVAIKVLRPDAAQGRKQFQQ  460

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+R+PNMV+LLGACPEYGCLVYEYM +GS++DRL+ RGN PP+SW+ RF+IAAE
Sbjct  461   EVEVLSCIRYPNMVLLLGACPEYGCLVYEYMDNGSLEDRLLRRGNTPPISWRKRFKIAAE  520

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + T LLFLHQ KP+P+VHRDLKP NILL
Sbjct  521   ISTALLFLHQAKPEPLVHRDLKPANILL  548


 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 107/183 (58%), Gaps = 11/183 (6%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHKQQLEAQNKDLFVTFHCFCTRKNIHC  185
            S  A++W  ++L+     ++L+HV  + +++       E++N ++F+ F  +C RK I  
Sbjct  26   SNTAVRWAIDHLVISNPYLILIHV--RQKSNYNDGDGGESENYNVFLPFRGYCARKGIQL  83

Query  186  LDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAPDFCTVF  362
             ++++D  D+AKAL DY+S   I N+V+G S+R++  +RLK  D+P+  +K+AP+FC+V+
Sbjct  84   KEVVLDEQDVAKALLDYISTNYINNIVVGASTRNALTRRLKGLDVPSSLTKSAPEFCSVY  143

Query  363  viskskissvRNATRPA--PFASPLHPQLQEIQEQA----QNNPD--IRTKNAPSSLRSF  518
            V+ K K+ SVR A RP       P  P +Q +  Q+    QN  +   RT     +L+S 
Sbjct  144  VVHKGKMLSVRTARRPVVNSVTPPKQPPVQALPPQSPTTEQNGGENVARTPTRERTLKSG  203

Query  519  DEK  527
             EK
Sbjct  204  SEK  206



>gb|KGN62856.1| hypothetical protein Csa_2G377920 [Cucumis sativus]
Length=810

 Score =   263 bits (673),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYR+Y+I+EIE ATE FSES KIGEGGYGPV+K  LDHT VA+KVLRPDAAQGR QFQQ
Sbjct  475   VRYRKYSIEEIETATEFFSESLKIGEGGYGPVYKGYLDHTPVAIKVLRPDAAQGRSQFQQ  534

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRG-NKPPLSWQVRFRIAA  1433
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MAHGS+DD L  RG N  PLSWQ RF+IAA
Sbjct  535   EVEVLSCIRHPNMVLLLGACPEYGCLVYEFMAHGSLDDCLFRRGQNSKPLSWQRRFKIAA  594

Query  1434  EMGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             E+GT LLFLHQ KP+P+VHRDLKP NILL
Sbjct  595   EIGTALLFLHQTKPEPLVHRDLKPANILL  623


 Score =   201 bits (512),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 151/407 (37%), Positives = 200/407 (49%), Gaps = 126/407 (31%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQT----SLQHKQQLEAQN--------------  131
            SQ A+KW TENLL KGQ+ +L+HV  ++ T    S+   + + A +              
Sbjct  32   SQLALKWATENLLVKGQTAILIHVKLKSSTYPGSSMASPKVMSASDAGNVNGNVLVSKDI  91

Query  132  ----KDLFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGS-SRHSFLK  296
                +DLF+ F CFCTRK+I C DI+++  D+AKAL +YV+ A IENLV+GS S++SFL 
Sbjct  92   DPITRDLFLPFRCFCTRKDIFCKDIVVEDLDVAKALIEYVTQAGIENLVVGSTSKNSFL-  150

Query  297  RLKVTDIPTLTSKAAPDFCTVFviskskissvRNATRPAPF------------------A  422
            RLK TDIP    K APDFC V+VIS+SKI ++R+A+RPAP                   A
Sbjct  151  RLKTTDIPGSVVKGAPDFCNVYVISRSKIQTIRSASRPAPVSSPLRSLLLSQTVVKSHSA  210

Query  423  SPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRG  602
              L PQ+Q  + +    P +      ++ RS D    RS           P   +     
Sbjct  211  ESLVPQIQTTRPE---KPPLE-----AARRSQDNIEFRS-----------PFTRKGYNGK  251

Query  603  IPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSETVESGRTPRLssssdgsfgsgR  782
            +P       E    D+D+SFVSSG RPS DR+   L + V++GR P             R
Sbjct  252  MP------GEVSLPDTDISFVSSG-RPSVDRLFPTLFDNVDTGRVP------------PR  292

Query  783  LGKGNDLNSFTDF----------------------------------------------S  824
            L  GND   +  F                                              S
Sbjct  293  LSSGNDAELYNSFESQQFGRKSVDGRKSVDGRKSVDGRKSVDVNYPPEFLSVFSESDRLS  352

Query  825  SSSLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            +SS   +E E EMRRLKLEL++TM++YSTACKEALTAKQK  ELQRW
Sbjct  353  TSSQSMEEVEAEMRRLKLELKQTMEMYSTACKEALTAKQKAVELQRW  399



>ref|XP_010262238.1| PREDICTED: U-box domain-containing protein 52, partial [Nelumbo 
nucifera]
Length=668

 Score =   260 bits (664),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYR+YTI+EIE ATE F+ S KIGEGGYGPV+K  LDHT VA+KVLR DAAQGR+QF QE
Sbjct  379   RYRKYTIEEIEAATESFTPSMKIGEGGYGPVYKATLDHTPVAIKVLRQDAAQGRKQFHQE  438

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VEILSC+RHPNMV+LLGACPEYGCLVYEYM +GS++DRL  RGN PP+ WQ+RF+IAAE+
Sbjct  439   VEILSCIRHPNMVLLLGACPEYGCLVYEYMENGSLEDRLFRRGNTPPIPWQIRFKIAAEI  498

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  499   ATGLLFLHQTKPEPLVHRDLKPANILL  525


 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQT--QTSLQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            SQ A+KWT ++LL K  +VVL+HV N+    T+L   ++++ + + +F+ +  FC+RK +
Sbjct  27   SQSAVKWTIDHLLMKNPNVVLIHVKNRNLHHTALDSNREVDTETQQIFLPYRGFCSRKGV  86

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTDIPTLTSKAAPDFCT  356
               +++++  D++KA+TDY+++  I N+V+G SSR++  +R +  D+ +  +K+APDFCT
Sbjct  87   QVREVVLEDVDVSKAITDYINNNYISNIVVGASSRNAITRRFRNADVASCLTKSAPDFCT  146

Query  357  VFviskskissvRNATR  407
            V+VISK K+S+VR+A+R
Sbjct  147  VYVISKGKVSTVRSASR  163


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  846  EAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            E E EM+RLKLEL++TM+LYS ACKEA++AKQK  EL +W
Sbjct  263  EVEAEMKRLKLELRQTMELYSVACKEAISAKQKALELHQW  302



>gb|KCW70920.1| hypothetical protein EUGRSUZ_F04036 [Eucalyptus grandis]
Length=694

 Score =   260 bits (665),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRYTI+EIE AT  F++S K+GEGGYGPVFKC LDHT VAVKVLRPDA  GR QFQQE
Sbjct  372   RYRRYTIEEIEAATNFFAKSHKVGEGGYGPVFKCYLDHTPVAVKVLRPDAVHGRSQFQQE  431

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS+++RL  RG  P LSWQ+RFRIAAE+
Sbjct  432   VEVLSRIRHPNMVLLLGACPEYGCLVYEYMANGSLEERLFKRGKSPVLSWQLRFRIAAEI  491

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLF+HQ KP+P+VHRDLKPGNILL
Sbjct  492   ATGLLFIHQTKPEPLVHRDLKPGNILL  518


 Score =   233 bits (594),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 203/341 (60%), Gaps = 84/341 (25%)
 Frame = +3

Query  9    QYAIKWTTENLLSKGQSVVLVHVDNQTQT---SLQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            QYAI+W  +N+LSKGQ+V+L+HV   + +   S  HKQ+L+  NKDLF+TFHC+CTRK+I
Sbjct  17   QYAIRWAVDNILSKGQTVILIHVHQNSASAPISSPHKQELQKLNKDLFLTFHCYCTRKDI  76

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDFCT  356
            HCLD++++  D+A+A+T+YVS A IE LVLG+S RH F+ RLK  +IP+  SK APDFCT
Sbjct  77   HCLDVILEDMDVARAITEYVSYAGIELLVLGASHRHGFI-RLKHVNIPSSVSKGAPDFCT  135

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
            V+VISK K+SSVRNA+RP+P ASPL  Q+Q + EQ                         
Sbjct  136  VYVISKGKVSSVRNASRPSPHASPLLDQIQNLNEQ-------------------------  170

Query  537  SFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSE  716
                               T G+ P         E ++D+SF+SSG R S D+ SS L +
Sbjct  171  -------------------TAGMMP---------EVETDISFISSG-RSSTDQPSSSLYD  201

Query  717  TVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSS-----------------SLEN-  842
             ++S    RLS+S D S         + L  + DFSSS                 S +N 
Sbjct  202  RMDSFHPARLSASPDRSSI-------HSLQKYIDFSSSYELSPISQESARTSCSYSSQNL  254

Query  843  DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            D+ E+EMRRLKLEL++TM++YSTAC+EAL AKQK  ELQ W
Sbjct  255  DDVEIEMRRLKLELKQTMEMYSTACREALVAKQKAMELQHW  295



>gb|KDP25035.1| hypothetical protein JCGZ_22570 [Jatropha curcas]
Length=1031

 Score =   265 bits (677),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY+I+EIEEATE FSESRKIGEGGYGPV+KC LDHT+VAVKVLRPDAAQGR QFQ+
Sbjct  435   VRYRRYSIEEIEEATECFSESRKIGEGGYGPVYKCYLDHTSVAVKVLRPDAAQGRSQFQR  494

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LS +RHPNMV+LLGACPEYG LVYEYMA+GS++D L+ RGN P L WQ+RFRIAAE
Sbjct  495   EVEVLSLIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLLRRGNSPVLPWQLRFRIAAE  554

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  555   IATGLLFLHQTKPEPLVHRDLKPANILL  582


 Score =   248 bits (632),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 220/345 (64%), Gaps = 37/345 (11%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTS----------LQHKQQLEAQNKDLFVTFH  155
            SQ A+KW  ENLLS+GQ+V+L+HV ++  +              KQQL+    DLF++FH
Sbjct  27   SQNALKWALENLLSRGQTVILIHVLHRVSSHNSAHGHPYDFSNGKQQLDKTTNDLFISFH  86

Query  156  CFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSK  335
            C+CTRK++ CLDI+++  D+ + LT+YVS AAIENLV+G+SRH F+++ K  DIP+  SK
Sbjct  87   CYCTRKDVQCLDIVLEDHDVVRGLTEYVSYAAIENLVVGASRHGFIRKFKA-DIPSSVSK  145

Query  336  AAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLR-  512
             APDFC VFVISK K+SSVR+A+R APF SPL  Q+     QA N P I T +   S+  
Sbjct  146  GAPDFCNVFVISKGKVSSVRHASRAAPFTSPLQDQI-----QALNKP-IDTMSETQSMHS  199

Query  513  -SFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSG  689
             S  E+ +   ++   ES   P +ER   R    +    AE ++ +++LSFVSSG RPS 
Sbjct  200  GSMRERTLVKPRMSVDESCRSP-LERGG-RAFNVKSF--AEFMDTETELSFVSSG-RPST  254

Query  690  DRMSSFLSETVESGRTPRLssssdgsfgsgRLG-KGNDLNSF------------TDFSSS  830
            DR SS   +  +S    RLS+SSD SFGS R   K NDL+S             T FS S
Sbjct  255  DRTSSVALDFTDSCLPSRLSTSSDVSFGSIRSAPKFNDLSSLHEFSTFSHDSERTSFSGS  314

Query  831  SLENDEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            S   D+ E EMRRLKLEL++TMD+YSTACKEALTAKQK +EL RW
Sbjct  315  SQTMDDMEAEMRRLKLELKQTMDMYSTACKEALTAKQKATELHRW  359



>ref|XP_010065061.1| PREDICTED: U-box domain-containing protein 52-like [Eucalyptus 
grandis]
Length=753

 Score =   261 bits (667),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +3

Query  1080  RYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQE  1259
             RYRRYTI+EIE AT  F++S K+GEGGYGPVFKC LDHT VAVKVLRPDA  GR QFQQE
Sbjct  414   RYRRYTIEEIEAATNFFAKSHKVGEGGYGPVFKCYLDHTPVAVKVLRPDAVHGRSQFQQE  473

Query  1260  VEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAEM  1439
             VE+LS +RHPNMV+LLGACPEYGCLVYEYMA+GS+++RL  RG  P LSWQ+RFRIAAE+
Sbjct  474   VEVLSRIRHPNMVLLLGACPEYGCLVYEYMANGSLEERLFKRGKSPVLSWQLRFRIAAEI  533

Query  1440  GTGLLFLHQNKPDPIVHRDLKPGNILL  1520
              TGLLF+HQ KP+P+VHRDLKPGNILL
Sbjct  534   ATGLLFIHQTKPEPLVHRDLKPGNILL  560


 Score =   247 bits (630),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 218/341 (64%), Gaps = 42/341 (12%)
 Frame = +3

Query  9    QYAIKWTTENLLSKGQSVVLVHVDNQTQT---SLQHKQQLEAQNKDLFVTFHCFCTRKNI  179
            QYAI+W  +N+LSKGQ+V+L+HV   + +   S  HKQ+L+  NKDLF+TFHC+CTRK+I
Sbjct  17   QYAIRWAVDNILSKGQTVILIHVHQNSASAPISSPHKQELQKLNKDLFLTFHCYCTRKDI  76

Query  180  HCLDILIDGTDIAKALTDYVSDAAIENLVLGSS-RHSFLKRLKVTDIPTLTSKAAPDFCT  356
            HCLD++++  D+A+A+T+YVS A IE LVLG+S RH F+ RLK  +IP+  SK APDFCT
Sbjct  77   HCLDVILEDMDVARAITEYVSYAGIELLVLGASHRHGFI-RLKHVNIPSSVSKGAPDFCT  135

Query  357  VFviskskissvRNATRPAPFASPLHPQLQEIQEQAQNNPDIRTKNAPSSLRSFDEKHMR  536
            V+VISK K+SSVRNA+RP+P ASPL  Q+Q + EQ   +     K+  +SL+  D+  ++
Sbjct  136  VYVISKGKVSSVRNASRPSPHASPLLDQIQNLNEQTAGS----EKHLHNSLK--DQTSIK  189

Query  537  SFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSRPSGDRMSSFLSE  716
            S     +ES+     +R  +       M   ET     D+SF+SSG R S D+ SS L +
Sbjct  190  SSLAMHNESIRSALDKRRGSSAYAAGMMPEVET-----DISFISSG-RSSTDQPSSSLYD  243

Query  717  TVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSS-----------------SLEN-  842
             ++S    RLS+S D S         + L  + DFSSS                 S +N 
Sbjct  244  RMDSFHPARLSASPDRSSI-------HSLQKYIDFSSSYELSPISQESARTSCSYSSQNL  296

Query  843  DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
            D+ E+EMRRLKLEL++TM++YSTAC+EAL AKQK  ELQ W
Sbjct  297  DDVEIEMRRLKLELKQTMEMYSTACREALVAKQKAMELQHW  337



>ref|XP_006286064.1| hypothetical protein CARUB_v10007597mg [Capsella rubella]
 gb|EOA18962.1| hypothetical protein CARUB_v10007597mg [Capsella rubella]
Length=701

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             +RYR+Y+I+EIEEAT+ FS S KIGEGGYGPVFK  LD+T VA+KVLRPDAA GR QFQQ
Sbjct  407   LRYRKYSIEEIEEATKDFSPSHKIGEGGYGPVFKGTLDYTKVAIKVLRPDAAHGRSQFQQ  466

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+L+CMRHPNMV+LLGACPEYGCLVYEYMA+GS++D L  RGN P LSWQ+RFRI AE
Sbjct  467   EVEVLTCMRHPNMVLLLGACPEYGCLVYEYMANGSLEDCLFRRGNSPTLSWQLRFRITAE  526

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             + TGL FLHQ KP+P+VHRDLKPGNILL
Sbjct  527   IATGLHFLHQMKPEPLVHRDLKPGNILL  554


 Score =   167 bits (422),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 184/350 (53%), Gaps = 65/350 (19%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHVDNQTQTSLQHK-QQLEAQNKDL---FVTFHCFCTRK  173
            SQ  +KW   NLLS+GQ++ L+HV  +  +SL +    L   N D+   F+ F C+C RK
Sbjct  22   SQNVMKWAVNNLLSRGQTITLLHVKLKQSSSLPYSGSNLNKPNDDVSEFFLPFRCYCARK  81

Query  174  NIHCLDILIDGTDIAKALTDYVSDAAIENLVLGSSRHSFLKRLKVTDIPTLTSKAAPDFC  353
            +I+C D++++    AK + DYV    IE LVLGSS+ + L+R K  D+ +   K AP FC
Sbjct  82   DINCQDVVVEDVSAAKGILDYVEQHGIETLVLGSSKMNLLRRFKAADVSSTVMKKAPSFC  141

Query  354  TVFviskskissvRNATRPAPFAS---PLHPQL--------QEIQEQAQNNPDIRTKNAP  500
             V+VISK KISS+++AT   P ++    ++ Q+        QE  ++ Q+   I  K+  
Sbjct  142  KVYVISKGKISSLKSATTSPPSSTMRYHVNAQMGNLNVERRQETMQREQDEIKIEMKSP-  200

Query  501  SSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSSGSR  680
                         F   E ES+ +PSI                     +SD+SFVSSG R
Sbjct  201  -------------FSRREYESIYQPSIT--------------------ESDISFVSSG-R  226

Query  681  PSGDRMSSFLSETVES---GRTPRLssssdgsfgsgRLGKGN-DLNS-FTDFSSSSLEN-  842
            PS D+M   L E V+            +      S   GK + DL S + + SSSSLE+ 
Sbjct  227  PSMDQMFPSLYENVDITWLSVGSEYGKNRSSFATSYSSGKESIDLTSPYAEHSSSSLESG  286

Query  843  ---------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKTSELQRW  965
                     DE E EMRRLK+EL+ TM++Y++ACKEA++AK+  +EL +W
Sbjct  287  RQSFSLQCQDEMEAEMRRLKMELKYTMEMYNSACKEAISAKKAANELYKW  336



>gb|AES58877.2| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=771

 Score =   261 bits (667),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  1077  VRYRRYTIDEIEEATEHFSESRKIGEGGYGPVFKCILDHTAVAVKVLRPDAAQGREQFQQ  1256
             VRYRRY I+EIE AT  F++S KIGEGGYGPV+KC+LDHT VAVKVLRPDA QGR QFQ+
Sbjct  451   VRYRRYAIEEIEAATSFFTDSLKIGEGGYGPVYKCLLDHTPVAVKVLRPDAQQGRSQFQR  510

Query  1257  EVEILSCMRHPNMVMLLGACPEYGCLVYEYMAHGSVDDRLMNRGNKPPLSWQVRFRIAAE  1436
             EVE+LSC+RHPNMV+LLGACPEYGCLVYE+MA+GS+DD L  RGN  PL WQ+RF+IAAE
Sbjct  511   EVEVLSCIRHPNMVLLLGACPEYGCLVYEHMANGSLDDCLFCRGNTHPLPWQLRFKIAAE  570

Query  1437  MGTGLLFLHQNKPDPIVHRDLKPGNILL  1520
             +GTGLLFLHQ KP+P+VHRDLKP NILL
Sbjct  571   IGTGLLFLHQTKPEPLVHRDLKPANILL  598


 Score =   192 bits (488),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 141/366 (39%), Positives = 195/366 (53%), Gaps = 64/366 (17%)
 Frame = +3

Query  6    SQYAIKWTTENLLSKGQSVVLVHV--------DNQT--------QTSLQHKQQLEAQNKD  137
            SQ A+KW  ++L +KG ++VL+HV         N T        Q S+  K+  E Q K+
Sbjct  28   SQNALKWAVDHLTTKGSTIVLIHVKVKQAPPSSNSTPRMNSILEQGSVVGKEPDE-QTKE  86

Query  138  LFVTFHCFCTRKNIHCLDILIDGTDIAKALTDYVSDAAIENLVLG-SSRHSFLKRLKVTD  314
            +F  +  FC RK++HC D++++  D+ KAL +Y S +AIE+LVLG S+++ FLKR KV D
Sbjct  87   IFRPYRVFCARKDVHCKDVVVEHGDVCKALIEYTSQSAIEHLVLGCSNKNGFLKRFKVVD  146

Query  315  IPTLTSKAAPDFCTVFviskskissvRNATRPAPFASPLHPQLQEIQEQA-QNNPDIRTK  491
            IP   SK APDFCTV+V+ K KI S+R+A+R AP  SPL  QL     ++ Q  P +   
Sbjct  147  IPATISKGAPDFCTVYVVGKGKIQSMRSASRAAPSFSPLQSQLSHSSPKSEQPEPRVPVV  206

Query  492  NAPSSLRSFDEKHMRSFKLEESESVSRPSIERAATRGIPPRRMLGAETVEGDSDLSFVSS  671
                  +SF+ +  RS   +  ES   P      TR  P  R  G E    + D+SFVSS
Sbjct  207  TKAPERKSFEGQTRRS--QDGMESFRSP-----FTRRRPNDRSYG-ELSMPEGDISFVSS  258

Query  672  GSRPSGDRM-SSFLSETVESGRTPRLssssdgsfgsgRLGKGNDLNSFTDFSSSSLEN--  842
            G RPS DR+  S  +      ++         SF + RL   +D +    F S++     
Sbjct  259  GGRPSTDRLFPSVYNHNCNPDQS---------SFSNPRLSYSSDTDGNYSFESNNYGRRS  309

Query  843  -------------------------DEAEVEMRRLKLELQKTMDLYSTACKEALTAKQKT  947
                                     D+ E EMRRLKLEL++TM++YSTACKEALTA+QK 
Sbjct  310  IDIGTPDHSSFSFDSDGFSSSASNVDDVEAEMRRLKLELKQTMEMYSTACKEALTAQQKA  369

Query  948  SELQRW  965
             ELQRW
Sbjct  370  VELQRW  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4164492915968