BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3434_g1_i1 len=1242 path=[1:0-1241]

Length=1242
                                                                      Score     E

gb|AFY26879.1|  anionic peroxidase swpa9                                632   0.0      
ref|XP_009787653.1|  PREDICTED: peroxidase 27-like                      519   1e-180   
ref|XP_009598812.1|  PREDICTED: peroxidase 27-like                      514   5e-179   
ref|XP_006363505.1|  PREDICTED: peroxidase 27-like                      494   3e-171   
ref|XP_004251490.1|  PREDICTED: peroxidase 27                           489   5e-169   
ref|XP_002268360.1|  PREDICTED: peroxidase 27                           471   5e-162   Vitis vinifera
ref|XP_007213025.1|  hypothetical protein PRUPE_ppa023088mg             459   2e-157   
ref|XP_008224769.1|  PREDICTED: peroxidase 27                           459   2e-157   
ref|XP_010057739.1|  PREDICTED: peroxidase 27-like                      458   6e-157   
ref|XP_010057733.1|  PREDICTED: peroxidase 27-like                      455   8e-156   
gb|AHL39168.1|  class III peroxidase                                    454   2e-155   
ref|XP_010999629.1|  PREDICTED: peroxidase 27-like                      454   2e-155   
ref|XP_002316610.2|  hypothetical protein POPTR_0011s00280g             452   2e-154   Populus trichocarpa [western balsam poplar]
gb|KCW74965.1|  hypothetical protein EUGRSUZ_E03708                     452   2e-154   
ref|XP_010057976.1|  PREDICTED: peroxidase 27-like                      451   7e-154   
ref|XP_011007886.1|  PREDICTED: peroxidase 27-like                      449   3e-153   
gb|KCW75372.1|  hypothetical protein EUGRSUZ_E04120                     450   5e-153   
ref|XP_010088079.1|  Peroxidase 27                                      450   8e-153   
ref|XP_010057737.1|  PREDICTED: peroxidase 27-like                      446   3e-152   
ref|XP_006371331.1|  Peroxidase 27 precursor family protein             446   3e-152   
ref|XP_010048939.1|  PREDICTED: peroxidase 27-like                      439   2e-149   
gb|KCW81364.1|  hypothetical protein EUGRSUZ_C02744                     439   5e-149   
ref|XP_010048942.1|  PREDICTED: peroxidase 27-like                      438   6e-149   
ref|XP_002518541.1|  Peroxidase 27 precursor, putative                  434   2e-147   Ricinus communis
ref|XP_009604229.1|  PREDICTED: peroxidase 27-like                      431   4e-146   
emb|CDP20391.1|  unnamed protein product                                431   4e-146   
ref|XP_010267771.1|  PREDICTED: peroxidase 27-like                      427   1e-144   
ref|XP_009794257.1|  PREDICTED: peroxidase 27-like                      423   4e-143   
ref|XP_010240936.1|  PREDICTED: peroxidase 27-like                      422   1e-142   
ref|XP_004287926.1|  PREDICTED: peroxidase 27-like                      421   4e-142   
ref|XP_010240935.1|  PREDICTED: peroxidase 27-like                      420   6e-142   
ref|XP_004240143.1|  PREDICTED: peroxidase 27-like                      419   1e-141   
ref|XP_007045601.1|  Peroxidase superfamily protein                     419   2e-141   
ref|XP_011007637.1|  PREDICTED: peroxidase 27-like                      418   3e-141   
gb|EYU24791.1|  hypothetical protein MIMGU_mgv1a010031mg                418   3e-141   
ref|XP_006356926.1|  PREDICTED: peroxidase 56-like                      418   5e-141   
gb|EYU24792.1|  hypothetical protein MIMGU_mgv1a009974mg                417   6e-141   
ref|XP_010048945.1|  PREDICTED: peroxidase 27-like                      417   1e-140   
ref|XP_010035573.1|  PREDICTED: peroxidase 27-like                      416   2e-140   
ref|XP_004293253.1|  PREDICTED: peroxidase 27-like                      416   3e-140   
ref|XP_008230092.1|  PREDICTED: peroxidase 27-like                      414   9e-140   
gb|EYU33918.1|  hypothetical protein MIMGU_mgv1a010413mg                414   9e-140   
ref|XP_010048943.1|  PREDICTED: peroxidase 27-like                      414   2e-139   
ref|XP_002304934.1|  hypothetical protein POPTR_0004s02240g             414   2e-139   Populus trichocarpa [western balsam poplar]
ref|XP_006447517.1|  hypothetical protein CICLE_v10017908mg             414   2e-139   
ref|XP_007217744.1|  hypothetical protein PRUPE_ppa008516mg             414   2e-139   
ref|XP_002274157.2|  PREDICTED: peroxidase 27-like                      413   4e-139   Vitis vinifera
ref|XP_002304933.2|  hypothetical protein POPTR_0004s02230g             412   6e-139   Populus trichocarpa [western balsam poplar]
ref|NP_186768.1|  peroxidase 27                                         412   7e-139   Arabidopsis thaliana [mouse-ear cress]
gb|AHL39131.1|  class III peroxidase                                    411   1e-138   
emb|CBI28955.3|  unnamed protein product                                413   2e-138   
gb|EYU24798.1|  hypothetical protein MIMGU_mgv1a009213mg                412   2e-138   
ref|XP_002280216.1|  PREDICTED: peroxidase 27                           411   2e-138   Vitis vinifera
gb|EYU24797.1|  hypothetical protein MIMGU_mgv1a010025mg                411   2e-138   
gb|EYU24795.1|  hypothetical protein MIMGU_mgv1a021569mg                409   9e-138   
ref|XP_002882194.1|  peroxidase 27                                      409   1e-137   
ref|XP_009353257.1|  PREDICTED: peroxidase 27-like                      409   1e-137   
ref|XP_008379619.1|  PREDICTED: peroxidase 27-like                      408   4e-137   
ref|XP_010551859.1|  PREDICTED: peroxidase 27-like                      407   3e-136   
ref|XP_006380314.1|  hypothetical protein POPTR_0007s02560g             405   5e-136   
ref|XP_006387149.1|  hypothetical protein POPTR_1693s00200g             404   2e-135   
ref|XP_009631264.1|  PREDICTED: peroxidase 27-like                      403   2e-135   
ref|XP_011100419.1|  PREDICTED: peroxidase 27-like                      402   3e-135   
gb|AFQ36036.1|  peroxidase 27                                           403   4e-135   
gb|KHG20863.1|  Peroxidase 27 -like protein                             402   5e-135   
ref|XP_010267770.1|  PREDICTED: peroxidase 27-like                      402   7e-135   
ref|XP_002309830.2|  hypothetical protein POPTR_0007s02570g             402   7e-135   Populus trichocarpa [western balsam poplar]
ref|XP_011003205.1|  PREDICTED: peroxidase 56-like                      400   2e-134   
ref|XP_009800459.1|  PREDICTED: peroxidase 27-like                      400   4e-134   
ref|XP_010485528.1|  PREDICTED: peroxidase 27-like                      399   9e-134   
gb|EYU24796.1|  hypothetical protein MIMGU_mgv1a010112mg                399   1e-133   
ref|XP_009630374.1|  PREDICTED: peroxidase 27-like                      398   2e-133   
ref|XP_011003204.1|  PREDICTED: peroxidase 27-like                      397   4e-133   
ref|XP_010463561.1|  PREDICTED: peroxidase 27                           397   5e-133   
ref|XP_010413829.1|  PREDICTED: peroxidase 27-like                      396   1e-132   
ref|XP_006352038.1|  PREDICTED: peroxidase 27-like                      395   3e-132   
ref|XP_004245974.1|  PREDICTED: peroxidase 27-like                      395   4e-132   
ref|XP_009604225.1|  PREDICTED: peroxidase 27-like                      395   4e-132   
emb|CBI28956.3|  unnamed protein product                                407   4e-132   
ref|XP_004144487.1|  PREDICTED: peroxidase 56-like                      395   5e-132   
ref|XP_006299954.1|  hypothetical protein CARUB_v10016167mg             394   5e-132   
ref|XP_006400035.1|  hypothetical protein EUTSA_v10014085mg             394   7e-132   
ref|XP_004159200.1|  PREDICTED: peroxidase 56-like                      394   1e-131   
ref|XP_010059640.1|  PREDICTED: peroxidase 27-like                      392   2e-131   
ref|XP_002527239.1|  Peroxidase 27 precursor, putative                  393   2e-131   Ricinus communis
emb|CDY55811.1|  BnaCnng29190D                                          392   3e-131   
ref|XP_009604224.1|  PREDICTED: peroxidase 27-like                      392   4e-131   
ref|XP_009796690.1|  PREDICTED: peroxidase 27-like                      392   6e-131   
ref|XP_009121602.1|  PREDICTED: peroxidase 56                           392   7e-131   
ref|NP_197022.1|  peroxidase 56                                         391   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286841.1|  hypothetical protein CARUB_v10003841mg             391   2e-130   
ref|XP_008809845.1|  PREDICTED: peroxidase 1-like                       390   2e-130   
ref|XP_009117679.1|  PREDICTED: peroxidase 27-like                      390   2e-130   
ref|XP_006408471.1|  hypothetical protein EUTSA_v10021152mg             390   2e-130   
ref|XP_010453647.1|  PREDICTED: peroxidase 56-like                      390   3e-130   
emb|CDP20341.1|  unnamed protein product                                390   3e-130   
ref|XP_010908221.1|  PREDICTED: peroxidase 1-like                       390   4e-130   
emb|CDX85056.1|  BnaC05g19990D                                          390   5e-130   
ref|XP_002871653.1|  hypothetical protein ARALYDRAFT_909489             389   6e-130   
ref|XP_006352037.1|  PREDICTED: peroxidase 56-like                      400   6e-130   
gb|KFK28588.1|  hypothetical protein AALP_AA7G016800                    389   6e-130   
ref|XP_010267772.1|  PREDICTED: peroxidase 56-like                      389   1e-129   
ref|XP_011100418.1|  PREDICTED: peroxidase 27-like                      389   1e-129   
ref|XP_002871652.1|  hypothetical protein ARALYDRAFT_325975             388   2e-129   
emb|CDY37537.1|  BnaA05g34020D                                          388   2e-129   
ref|XP_010679746.1|  PREDICTED: peroxidase 27-like                      388   2e-129   
ref|XP_004251512.1|  PREDICTED: peroxidase 27-like                      388   3e-129   
emb|CDY43275.1|  BnaC05g48680D                                          387   3e-129   
ref|XP_009147405.1|  PREDICTED: peroxidase 27                           387   4e-129   
gb|KFK37581.1|  hypothetical protein AALP_AA3G001800                    385   1e-128   
ref|XP_010557013.1|  PREDICTED: peroxidase 2-like                       385   3e-128   
ref|XP_008801172.1|  PREDICTED: peroxidase 1-like                       385   3e-128   
ref|XP_009784557.1|  PREDICTED: peroxidase 27-like                      384   8e-128   
ref|XP_010543013.1|  PREDICTED: peroxidase 2-like                       384   2e-127   
ref|XP_010492345.1|  PREDICTED: peroxidase 56                           383   2e-127   
ref|XP_010420175.1|  PREDICTED: peroxidase 56-like                      383   2e-127   
ref|XP_002529736.1|  Peroxidase 27 precursor, putative                  382   7e-127   Ricinus communis
ref|XP_008455410.1|  PREDICTED: peroxidase 27-like                      382   8e-127   
gb|EYU24800.1|  hypothetical protein MIMGU_mgv1a010045mg                381   9e-127   
ref|XP_010923934.1|  PREDICTED: peroxidase 1-like                       380   2e-126   
gb|KDP41154.1|  hypothetical protein JCGZ_03648                         380   3e-126   
emb|CDY10038.1|  BnaC08g44130D                                          379   1e-125   
ref|XP_006288216.1|  hypothetical protein CARUB_v10001453mg             377   3e-125   
ref|XP_010931148.1|  PREDICTED: peroxidase 1                            376   1e-124   
ref|XP_009126036.1|  PREDICTED: peroxidase 56-like                      376   1e-124   
ref|XP_010271617.1|  PREDICTED: peroxidase 27-like                      375   2e-124   
gb|AHJ86268.1|  peroxidase                                              374   4e-124   
emb|CDP11799.1|  unnamed protein product                                374   1e-123   
emb|CDP11800.1|  unnamed protein product                                373   1e-123   
gb|EPS63360.1|  hypothetical protein M569_11425                         373   3e-123   
emb|CDX75919.1|  BnaC03g40020D                                          372   5e-123   
emb|CAA80502.1|  peroxidase                                             371   1e-122   Spirodela polyrhiza
emb|CDX91005.1|  BnaC02g05920D                                          371   1e-122   
ref|XP_006855827.1|  hypothetical protein AMTR_s00037p00025630          370   3e-122   
ref|XP_009405647.1|  PREDICTED: peroxidase 1-like                       369   4e-122   
ref|XP_010679747.1|  PREDICTED: peroxidase 27-like                      367   4e-121   
gb|ABK26805.1|  unknown                                                 366   9e-121   Picea sitchensis
ref|XP_006418048.1|  hypothetical protein EUTSA_v10008157mg             365   2e-120   
emb|CDY65912.1|  BnaAnng21310D                                          365   3e-120   
emb|CDY65910.1|  BnaAnng21290D                                          365   3e-120   
ref|XP_009118606.1|  PREDICTED: peroxidase 2-like                       364   4e-120   
emb|CDY59801.1|  BnaAnng16320D                                          365   4e-120   
ref|XP_009118605.1|  PREDICTED: peroxidase 2-like                       364   4e-120   
gb|KFK42858.1|  hypothetical protein AALP_AA1G048400                    362   2e-119   
ref|XP_009398185.1|  PREDICTED: peroxidase 27-like                      362   3e-119   
emb|CDY49516.1|  BnaC05g03280D                                          362   3e-119   
emb|CDY46843.1|  BnaA10g03270D                                          362   3e-119   
ref|XP_006418049.1|  hypothetical protein EUTSA_v10008202mg             362   4e-119   
gb|EYU24799.1|  hypothetical protein MIMGU_mgv1a019406mg                362   5e-119   
ref|XP_009119176.1|  PREDICTED: peroxidase 2-like                       360   2e-118   
ref|XP_006594891.1|  PREDICTED: peroxidase 39-like                      360   2e-118   
ref|XP_006306557.1|  hypothetical protein CARUB_v10012652mg             359   3e-118   
emb|CDY69305.1|  BnaAnng29930D                                          359   3e-118   
ref|XP_002889541.1|  predicted protein                                  359   5e-118   
ref|XP_010484836.1|  PREDICTED: peroxidase 2-like isoform X1            358   6e-118   
ref|XP_008777796.1|  PREDICTED: peroxidase 3-like                       358   1e-117   
gb|KHN36550.1|  Peroxidase 39                                           358   1e-117   
ref|XP_010457607.1|  PREDICTED: peroxidase 2-like                       358   1e-117   
gb|AAD11482.1|  peroxidase precursor                                    358   2e-117   Glycine max [soybeans]
ref|XP_003540317.1|  PREDICTED: peroxidase 39-like                      357   2e-117   
ref|XP_006304823.1|  hypothetical protein CARUB_v10012469mg             357   2e-117   
ref|XP_010484845.1|  PREDICTED: peroxidase 2-like                       357   3e-117   
ref|NP_001068411.1|  Os11g0661600                                       357   4e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003597023.1|  Peroxidase                                         357   5e-117   
gb|AES67274.2|  peroxidase family protein                               355   1e-116   
ref|XP_010540729.1|  PREDICTED: peroxidase 39                           357   2e-116   
ref|XP_003540316.1|  PREDICTED: peroxidase 3                            355   2e-116   
ref|XP_002892275.1|  hypothetical protein ARALYDRAFT_470522             353   2e-116   
ref|XP_009382695.1|  PREDICTED: peroxidase 1-like                       355   2e-116   
ref|XP_007149959.1|  hypothetical protein PHAVU_005G113800g             355   2e-116   
ref|XP_008804375.1|  PREDICTED: peroxidase 3-like                       354   3e-116   
emb|CDY55444.1|  BnaC08g46330D                                          355   3e-116   
ref|XP_004487389.1|  PREDICTED: peroxidase 3-like                       354   4e-116   
gb|AAD11481.1|  peroxidase precursor                                    354   8e-116   Glycine max [soybeans]
emb|CDY13252.1|  BnaC09g24040D                                          353   9e-116   
ref|XP_006594890.1|  PREDICTED: peroxidase 3                            353   1e-115   
gb|EAY81751.1|  hypothetical protein OsI_36925                          352   1e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_008379618.1|  PREDICTED: peroxidase 3                            352   2e-115   
ref|XP_009111057.1|  PREDICTED: peroxidase 2-like                       352   2e-115   
ref|XP_002892276.1|  hypothetical protein ARALYDRAFT_887707             352   3e-115   
ref|XP_010233139.1|  PREDICTED: peroxidase 1-like                       352   3e-115   
ref|XP_010227737.1|  PREDICTED: peroxidase 1-like                       352   4e-115   
gb|KFK31897.1|  hypothetical protein AALP_AA6G173300                    352   4e-115   
emb|CDY49517.1|  BnaC05g03290D                                          351   5e-115   
ref|XP_003580604.1|  PREDICTED: peroxidase 1-like                       352   5e-115   
ref|XP_002459202.1|  hypothetical protein SORBIDRAFT_02g000470          352   6e-115   Sorghum bicolor [broomcorn]
ref|XP_009108181.1|  PREDICTED: peroxidase 39                           351   7e-115   
ref|XP_006654599.1|  PREDICTED: peroxidase 1-like                       351   7e-115   
gb|ACU24335.1|  unknown                                                 351   7e-115   Glycine max [soybeans]
emb|CDY55446.1|  BnaC08g46340D                                          351   7e-115   
ref|NP_192868.1|  peroxidase 39                                         351   8e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855828.1|  hypothetical protein AMTR_s00037p00030970          350   9e-115   
emb|CAA67337.1|  peroxidase                                             350   1e-114   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK00543.1|  predicted protein                                      350   1e-114   
ref|XP_002872571.1|  peroxidase ATP19a                                  350   1e-114   
gb|ACI00841.1|  class III peroxidase                                    350   1e-114   Triticum aestivum [Canadian hard winter wheat]
gb|KDP25855.1|  hypothetical protein JCGZ_22885                         350   2e-114   
ref|XP_011100296.1|  PREDICTED: peroxidase 3-like                       350   2e-114   
ref|XP_010931180.1|  PREDICTED: peroxidase 3-like isoform X1            349   2e-114   
ref|XP_008341973.1|  PREDICTED: peroxidase 3-like                       349   2e-114   
ref|XP_004287925.1|  PREDICTED: peroxidase 3-like                       349   2e-114   
ref|XP_004978254.1|  PREDICTED: peroxidase 1-like                       350   3e-114   
ref|XP_010908222.1|  PREDICTED: peroxidase 3-like                       349   3e-114   
ref|XP_009119175.1|  PREDICTED: peroxidase 2-like                       349   4e-114   
gb|ACU19509.1|  unknown                                                 349   4e-114   Glycine max [soybeans]
ref|XP_010231205.1|  PREDICTED: peroxidase 1-like                       349   5e-114   
ref|XP_008455840.1|  PREDICTED: peroxidase 39-like                      349   5e-114   
ref|XP_009111058.1|  PREDICTED: peroxidase 2-like                       349   5e-114   
gb|ACI00835.1|  class III peroxidase                                    348   7e-114   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002436934.1|  hypothetical protein SORBIDRAFT_10g011530          348   7e-114   Sorghum bicolor [broomcorn]
emb|CDY46844.1|  BnaA10g03280D                                          348   7e-114   
ref|XP_004151878.1|  PREDICTED: peroxidase 39-like                      348   7e-114   
gb|KGN63270.1|  hypothetical protein Csa_2G421020                       348   8e-114   
emb|CDY15538.1|  BnaA08g28220D                                          348   8e-114   
ref|NP_563732.1|  peroxidase 1                                          348   8e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784560.1|  PREDICTED: peroxidase 3-like                       348   9e-114   
ref|XP_009342252.1|  PREDICTED: peroxidase 3                            348   1e-113   
emb|CDY10037.1|  BnaC08g44140D                                          348   1e-113   
gb|EMT00309.1|  Peroxidase 1                                            348   1e-113   
ref|XP_006657390.1|  PREDICTED: peroxidase 1-like                       348   2e-113   
ref|XP_010931166.1|  PREDICTED: peroxidase 56-like                      348   2e-113   
ref|XP_010422076.1|  PREDICTED: peroxidase 39-like                      347   3e-113   
ref|XP_009118603.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    347   3e-113   
gb|AHL39150.1|  class III peroxidase                                    347   3e-113   
ref|XP_006396925.1|  hypothetical protein EUTSA_v10028797mg             347   3e-113   
ref|XP_008341978.1|  PREDICTED: peroxidase 3-like                       347   4e-113   
ref|XP_006288205.1|  hypothetical protein CARUB_v10001445mg             346   4e-113   
ref|XP_008663625.1|  PREDICTED: peroxidase 1-like                       347   4e-113   
ref|XP_010522326.1|  PREDICTED: peroxidase 3                            347   4e-113   
ref|XP_004961613.1|  PREDICTED: peroxidase 1-like                       346   5e-113   
ref|XP_008230094.1|  PREDICTED: peroxidase 3                            346   5e-113   
gb|EMS60389.1|  Peroxidase 1                                            346   5e-113   
ref|XP_010455535.1|  PREDICTED: peroxidase 39-like                      346   5e-113   
ref|XP_010931832.1|  PREDICTED: peroxidase 3-like                       346   5e-113   
ref|XP_007215666.1|  hypothetical protein PRUPE_ppa008540mg             346   6e-113   
ref|XP_009353255.1|  PREDICTED: peroxidase 3                            346   6e-113   
ref|XP_004965313.1|  PREDICTED: peroxidase 1-like                       346   6e-113   
emb|CAJ86371.1|  OSIGBa0117N13.15                                       346   6e-113   Oryza sativa [red rice]
dbj|BAK02643.1|  predicted protein                                      346   6e-113   
gb|ACR61552.1|  peroxidase 2                                            345   8e-113   
ref|XP_002436932.1|  hypothetical protein SORBIDRAFT_10g011510          346   8e-113   Sorghum bicolor [broomcorn]
emb|CAE04245.3|  OSJNBa0089N06.6                                        345   9e-113   Oryza sativa [red rice]
ref|XP_002280274.1|  PREDICTED: peroxidase 3                            345   9e-113   Vitis vinifera
gb|ACI00836.1|  class III peroxidase                                    345   1e-112   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008804399.1|  PREDICTED: peroxidase 1-like                       345   1e-112   
ref|XP_006652863.1|  PREDICTED: peroxidase 1-like                       346   1e-112   
ref|XP_002309832.1|  peroxidase precursor family protein                345   1e-112   Populus trichocarpa [western balsam poplar]
ref|XP_006663651.1|  PREDICTED: peroxidase 1-like                       345   1e-112   
ref|XP_002447146.1|  hypothetical protein SORBIDRAFT_06g029370          345   1e-112   Sorghum bicolor [broomcorn]
ref|XP_004987268.1|  PREDICTED: peroxidase 1-like                       345   2e-112   
ref|XP_010435105.1|  PREDICTED: peroxidase 39                           345   2e-112   
ref|XP_009119172.1|  PREDICTED: peroxidase 3-like                       345   2e-112   
ref|XP_006357954.1|  PREDICTED: peroxidase 3-like                       345   2e-112   
dbj|BAK06872.1|  predicted protein                                      345   2e-112   
emb|CBI23165.3|  unnamed protein product                                341   3e-112   
ref|XP_004965312.1|  PREDICTED: peroxidase 1-like                       344   3e-112   
ref|XP_009342265.1|  PREDICTED: peroxidase 3-like                       344   3e-112   
emb|CDY46845.1|  BnaA10g03290D                                          344   3e-112   
ref|XP_009604384.1|  PREDICTED: peroxidase 3-like                       344   3e-112   
tpe|CAH69339.1|  TPA: class III peroxidase 97 precursor                 345   4e-112   
gb|AFW86434.1|  peroxidase 1                                            344   4e-112   
gb|EEC81377.1|  hypothetical protein OsI_24583                          344   4e-112   Oryza sativa Indica Group [Indian rice]
gb|EMS46833.1|  Peroxidase 1                                            344   4e-112   
ref|XP_006418047.1|  hypothetical protein EUTSA_v10008189mg             343   5e-112   
ref|XP_008804373.1|  PREDICTED: peroxidase 1-like                       343   5e-112   
ref|XP_002889542.1|  CBRCI35                                            343   6e-112   
ref|XP_004243525.1|  PREDICTED: peroxidase 3-like                       343   7e-112   
gb|EMT32567.1|  Peroxidase 1                                            343   7e-112   
gb|EMT33122.1|  hypothetical protein F775_52516                         343   8e-112   
ref|XP_010931155.1|  PREDICTED: peroxidase 1-like                       343   8e-112   
ref|XP_006305430.1|  hypothetical protein CARUB_v10009829mg             342   8e-112   
dbj|BAK07568.1|  predicted protein                                      343   9e-112   
ref|XP_008804400.1|  PREDICTED: peroxidase 56-like                      343   9e-112   
ref|XP_006357953.1|  PREDICTED: peroxidase 3-like                       343   1e-111   
ref|NP_001147671.1|  peroxidase 1 precursor                             343   1e-111   Zea mays [maize]
ref|XP_007035436.1|  Peroxidase superfamily protein                     344   1e-111   
ref|XP_006357003.1|  PREDICTED: peroxidase 39-like                      343   1e-111   
ref|XP_002440020.1|  hypothetical protein SORBIDRAFT_09g024580          343   1e-111   Sorghum bicolor [broomcorn]
ref|XP_011003206.1|  PREDICTED: peroxidase 3-like                       343   1e-111   
gb|AAT72298.1|  CBRCI35                                                 342   1e-111   
dbj|BAK01904.1|  predicted protein                                      342   2e-111   
emb|CDY10040.1|  BnaC08g44110D                                          342   2e-111   
ref|XP_010320977.1|  PREDICTED: peroxidase 39-like                      342   2e-111   
ref|XP_009630373.1|  PREDICTED: peroxidase 3                            342   2e-111   
ref|XP_003568173.1|  PREDICTED: peroxidase 1-like                       342   3e-111   
gb|KFK42859.1|  hypothetical protein AALP_AA1G048500                    342   3e-111   
ref|XP_002438300.1|  hypothetical protein SORBIDRAFT_10g011290          342   3e-111   
emb|CDY10039.1|  BnaC08g44120D                                          341   3e-111   
gb|ACF84679.1|  unknown                                                 342   4e-111   
gb|KFK42864.1|  hypothetical protein AALP_AA1G049000                    341   4e-111   
ref|NP_172018.1|  peroxidase 3                                          341   5e-111   
gb|AAM61240.1|  putative peroxidase                                     341   5e-111   
ref|XP_008659484.1|  PREDICTED: peroxidase 1-like                       341   5e-111   
gb|KFK42863.1|  hypothetical protein AALP_AA1G048900                    341   6e-111   
ref|XP_004965311.1|  PREDICTED: peroxidase 1-like                       341   6e-111   
ref|XP_006582342.1|  PREDICTED: peroxidase 3-like                       341   6e-111   
gb|EMT04116.1|  Peroxidase 1                                            340   8e-111   
gb|ACG38470.1|  peroxidase 1 precursor                                  341   9e-111   
ref|XP_010484852.1|  PREDICTED: peroxidase 3-like                       340   1e-110   
ref|XP_010243339.1|  PREDICTED: peroxidase 3-like                       340   1e-110   
ref|XP_003568172.1|  PREDICTED: peroxidase 1                            340   1e-110   
gb|EMT32565.1|  Peroxidase 1                                            340   1e-110   
ref|XP_002488879.1|  hypothetical protein SORBIDRAFT_2674s002010        340   1e-110   
gb|KDP20805.1|  hypothetical protein JCGZ_21276                         337   2e-110   
gb|KFK42862.1|  hypothetical protein AALP_AA1G048800                    339   2e-110   
gb|EMS55662.1|  Peroxidase 1                                            340   2e-110   
gb|ACL52390.1|  unknown                                                 340   3e-110   
emb|CAA76374.2|  peroxidase                                             339   3e-110   
gb|AFA25668.1|  class III peroxidase                                    338   4e-110   
ref|XP_009796691.1|  PREDICTED: peroxidase 3-like                       339   4e-110   
ref|XP_009768247.1|  PREDICTED: peroxidase 3                            338   6e-110   
gb|EMT32591.1|  Peroxidase 1                                            338   8e-110   
gb|EYU24801.1|  hypothetical protein MIMGU_mgv1a009942mg                338   8e-110   
ref|XP_010457608.1|  PREDICTED: peroxidase 3-like                       338   8e-110   
gb|EMT01883.1|  Peroxidase 1                                            337   1e-109   
gb|EMS60388.1|  Peroxidase 1                                            338   1e-109   
ref|XP_010475209.1|  PREDICTED: peroxidase 3                            337   2e-109   
ref|XP_010696607.1|  PREDICTED: peroxidase 3                            337   2e-109   
ref|XP_006372960.1|  hypothetical protein POPTR_0017s06570g             337   2e-109   
gb|EMT32568.1|  Peroxidase 1                                            337   3e-109   
ref|XP_010240937.1|  PREDICTED: peroxidase 3-like                       337   3e-109   
gb|EAZ00663.1|  hypothetical protein OsI_22684                          337   3e-109   
dbj|BAD62399.1|  putative peroxidase 1 precursor                        337   3e-109   
ref|XP_006372959.1|  hypothetical protein POPTR_0017s06570g             336   4e-109   
ref|XP_009802836.1|  PREDICTED: peroxidase 3-like                       336   4e-109   
ref|XP_010689572.1|  PREDICTED: peroxidase 27-like                      336   5e-109   
ref|XP_009589067.1|  PREDICTED: peroxidase 3-like                       336   5e-109   
gb|EMS50723.1|  Peroxidase 1                                            336   7e-109   
gb|KFK42860.1|  hypothetical protein AALP_AA1G048600                    335   7e-109   
ref|NP_001057675.2|  Os06g0490400                                       335   8e-109   
ref|XP_011037007.1|  PREDICTED: peroxidase 3-like                       335   9e-109   
emb|CDY49518.1|  BnaC05g03300D                                          335   1e-108   
ref|XP_009603962.1|  PREDICTED: peroxidase 3-like                       335   1e-108   
ref|XP_002317707.1|  hypothetical protein POPTR_0012s03980g             334   2e-108   
gb|AHZ89831.1|  peroxidase                                              335   2e-108   
gb|KHN28247.1|  Peroxidase 3                                            334   2e-108   
gb|KDP25852.1|  hypothetical protein JCGZ_22882                         333   2e-108   
gb|EAZ01004.1|  hypothetical protein OsI_23038                          334   2e-108   
ref|NP_001146942.1|  peroxidase 1 precursor                             335   2e-108   
ref|XP_010267773.1|  PREDICTED: peroxidase 3                            334   2e-108   
emb|CDP20342.1|  unnamed protein product                                334   3e-108   
ref|XP_011079026.1|  PREDICTED: peroxidase 3-like                       334   3e-108   
ref|XP_008234970.1|  PREDICTED: peroxidase 3-like                       333   4e-108   
ref|XP_006372957.1|  hypothetical protein POPTR_0017s06550g             334   4e-108   
ref|XP_002515748.1|  Peroxidase 39 precursor, putative                  333   4e-108   
ref|NP_001234644.1|  peroxidase precursor                               333   4e-108   
ref|XP_006367274.1|  PREDICTED: peroxidase 3-like                       333   5e-108   
ref|XP_006367289.1|  PREDICTED: peroxidase 3-like                       336   5e-108   
ref|XP_010524488.1|  PREDICTED: peroxidase 30                           333   5e-108   
ref|XP_009624293.1|  PREDICTED: peroxidase 3-like                       333   6e-108   
gb|ABK93918.1|  unknown                                                 333   6e-108   
ref|XP_002437459.1|  hypothetical protein SORBIDRAFT_10g027490          333   6e-108   
ref|NP_001055955.1|  Os05g0499300                                       333   7e-108   
ref|XP_002270603.1|  PREDICTED: peroxidase 3                            333   8e-108   
ref|XP_004243458.1|  PREDICTED: peroxidase 3-like                       333   8e-108   
ref|XP_010227808.1|  PREDICTED: peroxidase 1-like                       332   8e-108   
ref|XP_007200009.1|  hypothetical protein PRUPE_ppa024711mg             332   1e-107   
gb|AIY26418.1|  peroxidase 1b                                           333   1e-107   
gb|AIY26417.1|  peroxidase 1a                                           332   1e-107   
dbj|BAA03644.1|  peroxidase                                             332   1e-107   
ref|XP_009419593.1|  PREDICTED: peroxidase 39-like                      332   2e-107   
gb|AIY26420.1|  peroxidase 1b                                           332   2e-107   
ref|NP_001289850.1|  peroxidase 3 precursor                             332   2e-107   
gb|AIV42034.1|  peroxidase                                              332   2e-107   
gb|KEH29649.1|  peroxidase family protein                               332   3e-107   
ref|XP_003564026.1|  PREDICTED: peroxidase 1-like                       331   3e-107   
ref|XP_011037006.1|  PREDICTED: peroxidase 3-like                       331   3e-107   
ref|XP_004243459.1|  PREDICTED: peroxidase 3-like                       331   3e-107   
gb|ABQ18321.1|  putative peroxidase                                     331   4e-107   
gb|KHG05441.1|  Peroxidase 3 -like protein                              331   4e-107   
ref|XP_006356923.1|  PREDICTED: peroxidase 3-like                       331   4e-107   
ref|XP_009620797.1|  PREDICTED: peroxidase 3-like                       331   4e-107   
ref|XP_007132569.1|  hypothetical protein PHAVU_011G105900g             330   6e-107   
ref|XP_011003762.1|  PREDICTED: peroxidase 3-like                       330   6e-107   
gb|AIV42033.1|  peroxidase                                              331   6e-107   
ref|XP_002515749.1|  Peroxidase 3 precursor, putative                   330   7e-107   
gb|ABQ23446.1|  putative peroxidase                                     330   9e-107   
ref|XP_007050753.1|  Peroxidase superfamily protein                     331   9e-107   
ref|XP_006367288.1|  PREDICTED: peroxidase 3-like                       330   1e-106   
ref|XP_009786925.1|  PREDICTED: peroxidase 3-like                       330   1e-106   
gb|KDP25860.1|  hypothetical protein JCGZ_22890                         330   1e-106   
ref|XP_003521524.1|  PREDICTED: peroxidase 3-like                       329   1e-106   
gb|EMT05880.1|  Peroxidase 3                                            330   2e-106   
ref|XP_008801212.1|  PREDICTED: peroxidase 1-like                       333   2e-106   
ref|XP_010109530.1|  Peroxidase 3                                       338   2e-106   
gb|EMS62297.1|  Peroxidase 1                                            333   2e-106   
gb|EYU43875.1|  hypothetical protein MIMGU_mgv1a017718mg                328   2e-106   
gb|AIY26419.1|  peroxidase 1a                                           329   3e-106   
tpe|CAH69322.1|  TPA: class III peroxidase 80 precursor                 329   3e-106   
ref|XP_008652821.1|  PREDICTED: peroxidase 1-like                       327   3e-106   
ref|XP_009382683.1|  PREDICTED: peroxidase 3-like                       328   3e-106   
ref|XP_006406236.1|  hypothetical protein EUTSA_v10021123mg             328   4e-106   
gb|KDP40039.1|  hypothetical protein JCGZ_02037                         328   4e-106   
gb|EMT32569.1|  Peroxidase 1                                            331   4e-106   
ref|XP_006356924.1|  PREDICTED: peroxidase 3-like                       328   5e-106   
ref|XP_006656020.1|  PREDICTED: peroxidase 1-like                       328   5e-106   
ref|XP_010091374.1|  Peroxidase 3                                       328   6e-106   
ref|XP_003536895.1|  PREDICTED: peroxidase 3-like                       328   6e-106   
ref|XP_010242563.1|  PREDICTED: peroxidase 3-like                       330   6e-106   
ref|XP_006489185.1|  PREDICTED: peroxidase 24-like                      328   6e-106   
ref|XP_006419701.1|  hypothetical protein CICLE_v10005432mg             328   6e-106   
gb|ABM66586.1|  putative peroxidase                                     328   6e-106   
ref|XP_009145451.1|  PREDICTED: peroxidase 30                           328   9e-106   
ref|XP_008657600.1|  PREDICTED: peroxidase 1-like                       327   1e-105   
gb|AFY26878.1|  basic peroxidase swpb7                                  327   1e-105   
gb|AIY26421.1|  peroxidase 1a                                           327   1e-105   
ref|XP_003638079.1|  Peroxidase                                         327   1e-105   
ref|XP_009624291.1|  PREDICTED: peroxidase 3-like                       327   1e-105   
gb|AIY26422.1|  peroxidase 1b                                           327   1e-105   
gb|AAU04879.1|  peroxidase a                                            327   1e-105   
gb|KFK42861.1|  hypothetical protein AALP_AA1G048700                    327   1e-105   
ref|XP_004243835.1|  PREDICTED: peroxidase 3-like                       327   1e-105   
ref|XP_010484840.1|  PREDICTED: peroxidase 2-like isoform X2            325   2e-105   
ref|NP_001149755.1|  peroxidase 39 precursor                            327   2e-105   
ref|XP_008657599.1|  PREDICTED: peroxidase 1-like                       327   2e-105   
emb|CAA66965.1|  peroxidase                                             326   4e-105   
ref|NP_001058379.1|  Os06g0681600                                       326   4e-105   
gb|AHC69832.1|  peroxidase                                              326   4e-105   
gb|AFK41025.1|  unknown                                                 325   5e-105   
emb|CAA67360.1|  peroxidase ATP7a                                       325   5e-105   
ref|XP_009615423.1|  PREDICTED: peroxidase 3-like                       327   5e-105   
gb|ACJ11761.1|  class III peroxidase                                    325   6e-105   
ref|XP_004292686.1|  PREDICTED: peroxidase 3-like                       325   6e-105   
tpe|CAH69331.1|  TPA: class III peroxidase 89 precursor                 326   7e-105   
emb|CAN71671.1|  hypothetical protein VITISV_044355                     327   7e-105   
ref|XP_010261100.1|  PREDICTED: peroxidase 3-like                       325   8e-105   
emb|CDP11801.1|  unnamed protein product                                325   9e-105   
ref|XP_009787132.1|  PREDICTED: peroxidase 3-like                       325   9e-105   
ref|XP_008345186.1|  PREDICTED: peroxidase 3-like                       325   1e-104   
ref|XP_009405648.1|  PREDICTED: peroxidase 27-like                      325   1e-104   
ref|XP_006656386.1|  PREDICTED: peroxidase 3-like                       325   1e-104   
gb|EMS63657.1|  Peroxidase 1                                            323   1e-104   
ref|XP_007045599.1|  Peroxidase superfamily protein isoform 1           325   1e-104   
ref|NP_188814.1|  peroxidase 30                                         325   1e-104   
gb|KCW75373.1|  hypothetical protein EUGRSUZ_E041212                    323   1e-104   
ref|XP_010488198.1|  PREDICTED: peroxidase 30-like                      324   2e-104   
ref|XP_010242552.1|  PREDICTED: uncharacterized protein LOC104586872    337   2e-104   
ref|XP_010510594.1|  PREDICTED: peroxidase 30                           323   3e-104   
gb|AAM61382.1|  putative peroxidase                                     323   3e-104   
gb|AFW81710.1|  hypothetical protein ZEAMMB73_539966                    322   4e-104   
gb|KDP40041.1|  hypothetical protein JCGZ_02039                         323   4e-104   
emb|CDY33143.1|  BnaCnng07140D                                          325   4e-104   
ref|XP_002516845.1|  Peroxidase 27 precursor, putative                  323   4e-104   
ref|XP_003518944.1|  PREDICTED: peroxidase 3-like                       323   4e-104   
gb|AIV42032.1|  peroxidase                                              323   4e-104   
ref|XP_004987267.1|  PREDICTED: peroxidase 1-like                       323   5e-104   
ref|XP_004515086.1|  PREDICTED: peroxidase 3-like                       323   5e-104   
ref|XP_004240140.1|  PREDICTED: peroxidase 3                            323   6e-104   
ref|XP_009392735.1|  PREDICTED: peroxidase 56-like                      323   1e-103   
ref|XP_009800216.1|  PREDICTED: peroxidase 3-like                       322   1e-103   
gb|AFK41517.1|  unknown                                                 322   2e-103   
emb|CDY19299.1|  BnaC01g31810D                                          322   2e-103   
ref|XP_002883319.1|  peroxidase 30                                      322   2e-103   
ref|XP_010480350.1|  PREDICTED: peroxidase 2-like                       320   2e-103   
ref|XP_007163044.1|  hypothetical protein PHAVU_001G201300g             321   2e-103   
ref|XP_010098323.1|  Peroxidase 24                                      323   2e-103   
ref|XP_002277879.1|  PREDICTED: peroxidase 24                           321   3e-103   
emb|CCJ34832.1|  horseradish peroxidase isoenzyme HRP_2021              321   3e-103   
emb|CDY55649.1|  BnaA01g36520D                                          321   3e-103   
ref|XP_010070010.1|  PREDICTED: peroxidase 3-like                       321   3e-103   
ref|XP_004240141.1|  PREDICTED: peroxidase 3-like                       321   3e-103   
ref|XP_009417254.1|  PREDICTED: peroxidase 1-like                       319   4e-103   
ref|XP_006479844.1|  PREDICTED: peroxidase 3-like                       321   4e-103   
ref|XP_004966236.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    321   4e-103   
ref|XP_006298132.1|  hypothetical protein CARUB_v10014176mg             321   4e-103   
ref|XP_004982558.1|  PREDICTED: peroxidase 56-like                      321   4e-103   
gb|KDP21543.1|  hypothetical protein JCGZ_22014                         320   5e-103   
ref|XP_004494311.1|  PREDICTED: peroxidase 3-like                       320   5e-103   
ref|XP_009109348.1|  PREDICTED: peroxidase 30                           320   1e-102   
gb|ACT35472.1|  peroxidase 30                                           320   2e-102   
ref|XP_008366006.1|  PREDICTED: peroxidase 39-like                      319   2e-102   
gb|KHN25776.1|  Peroxidase 39                                           316   3e-102   
ref|XP_004240142.1|  PREDICTED: peroxidase 3-like                       318   3e-102   
gb|EEE52524.1|  hypothetical protein OsJ_34737                          317   5e-102   
ref|XP_003561523.1|  PREDICTED: peroxidase 1-like                       319   6e-102   
ref|XP_010261101.1|  PREDICTED: peroxidase 3-like                       318   6e-102   
ref|XP_010272777.1|  PREDICTED: peroxidase 3-like                       317   7e-102   
gb|KFK39497.1|  hypothetical protein AALP_AA3G251500                    317   1e-101   
ref|XP_006581060.1|  PREDICTED: peroxidase isoform X1                   316   2e-101   
ref|XP_006447516.1|  hypothetical protein CICLE_v10015924mg             316   3e-101   
gb|KHN25777.1|  Peroxidase 3                                            314   3e-101   
gb|KHN41200.1|  Peroxidase 3                                            316   3e-101   
gb|KDO59839.1|  hypothetical protein CISIN_1g048664mg                   315   5e-101   
ref|XP_010024493.1|  PREDICTED: peroxidase 24-like                      315   5e-101   
ref|XP_002459203.1|  hypothetical protein SORBIDRAFT_02g000490          316   6e-101   
ref|XP_006489267.1|  PREDICTED: peroxidase 3-like                       315   6e-101   
ref|XP_006356922.1|  PREDICTED: peroxidase 3-like                       315   9e-101   
ref|XP_006357991.1|  PREDICTED: peroxidase 3-like                       314   9e-101   
ref|XP_006419700.1|  hypothetical protein CICLE_v10007121mg             315   1e-100   
gb|KDO74974.1|  hypothetical protein CISIN_1g020619mg                   314   1e-100   
ref|XP_002520704.1|  peroxidase, putative                               326   2e-100   
ref|XP_010244668.1|  PREDICTED: uncharacterized protein LOC104588433    326   3e-100   
gb|KHN22848.1|  Peroxidase 3                                            313   3e-100   
emb|CDY65911.1|  BnaAnng21300D                                          313   4e-100   
ref|XP_002466914.1|  hypothetical protein SORBIDRAFT_01g016600          313   9e-100   
gb|KDP40042.1|  hypothetical protein JCGZ_02040                         312   1e-99    
emb|CDO98926.1|  unnamed protein product                                311   4e-99    
ref|XP_010024491.1|  PREDICTED: peroxidase 24-like                      310   4e-99    
ref|XP_009609714.1|  PREDICTED: peroxidase 24-like                      310   4e-99    
gb|EAZ04149.1|  hypothetical protein OsI_26291                          311   5e-99    



>gb|AFY26879.1| anionic peroxidase swpa9 [Ipomoea batatas]
Length=351

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/329 (93%), Positives = 313/329 (95%), Gaps = 1/329 (0%)
 Frame = +1

Query  133   MAKFSRYLSLEI-LIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             MA FSRYLSL+I LIFLAFACCNHHA GYGGLRVGFYEQTCPHLE IVKEI+DQV+AVAP
Sbjct  1     MANFSRYLSLQIILIFLAFACCNHHAAGYGGLRVGFYEQTCPHLEHIVKEISDQVMAVAP  60

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ EKDA PN SLRGFQIIDKVKTAVEEACP
Sbjct  61    SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQAEKDAIPNLSLRGFQIIDKVKTAVEEACP  120

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADILA VARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANIT LKQGF
Sbjct  121   GVVSCADILATVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITTLKQGF  180

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEES  849
              D+GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKL+MKCPE S
Sbjct  181   LDRGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLRMKCPEAS  240

Query  850   PTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFK  1029
             PTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFK
Sbjct  241   PTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFK  300

Query  1030  DFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             DFGESMVNMG+     GDQGEIRKVCTAV
Sbjct  301   DFGESMVNMGKDRSPPGDQGEIRKVCTAV  329



>ref|XP_009787653.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=327

 Score =   519 bits (1336),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 253/330 (77%), Positives = 284/330 (86%), Gaps = 8/330 (2%)
 Frame = +1

Query  136   AKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSL  315
             +KF+    L  LIF AFA  ++HA G   L+VGFY + CPHLE IVKE+ D VI+  PSL
Sbjct  4     SKFANCCFLISLIFFAFA--SNHANG-KELKVGFYHKNCPHLELIVKEVIDDVISRVPSL  60

Query  316   AGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             A PLLRMHFHDCFVRGC+GSVLL+SPTKQ EK+A PN SLRGFQIIDKVKTAVE+ CPG+
Sbjct  61    AAPLLRMHFHDCFVRGCDGSVLLNSPTKQAEKNAIPNLSLRGFQIIDKVKTAVEKYCPGI  120

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCADI+A+VARDVT A+KGP+WEVETGRRDGRVSN+TEALFNL+PPFANIT LKQGF  
Sbjct  121   VSCADIVALVARDVTVAVKGPFWEVETGRRDGRVSNITEALFNLIPPFANITSLKQGFLQ  180

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
             +GLSVKDLVVLSG HTIGISHCSSF +RLYNFTGKGD DPSLDPNY ++LKMKC   SPT
Sbjct  181   RGLSVKDLVVLSGSHTIGISHCSSFNNRLYNFTGKGDTDPSLDPNYIKRLKMKC---SPT  237

Query  856   D--NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFK  1029
             D  ++VEMDPGSVRTFDTSY+ L+AKRRGLFTSD+ALLDD+ETK YL +QAL HGSTFFK
Sbjct  238   DQNSIVEMDPGSVRTFDTSYYNLVAKRRGLFTSDSALLDDKETKGYLKEQALNHGSTFFK  297

Query  1030  DFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             DFGESMV MGRI VLTG QGEIRKVCT +N
Sbjct  298   DFGESMVKMGRIQVLTGTQGEIRKVCTKIN  327



>ref|XP_009598812.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=327

 Score =   514 bits (1324),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 250/330 (76%), Positives = 284/330 (86%), Gaps = 8/330 (2%)
 Frame = +1

Query  136   AKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSL  315
             ++F+    L  L F AFA  ++HA G   L+VGFY + CPHLE IVKE+ D VI+  PSL
Sbjct  4     SQFANCCFLISLFFFAFA--SNHANG-KELKVGFYHKKCPHLELIVKEVIDDVISRVPSL  60

Query  316   AGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             A PLLRMHFHDCFVRGC+GSVLL+SPTKQ EKDA PN SLRG+QIIDKVKTAVE++CPG+
Sbjct  61    AAPLLRMHFHDCFVRGCDGSVLLNSPTKQAEKDAIPNLSLRGYQIIDKVKTAVEKSCPGM  120

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCADI+A+VARDVT A+KGP+WEVETGRRDGRVSN+TEALFNL+PPFANIT LKQGF  
Sbjct  121   VSCADIVALVARDVTVAVKGPFWEVETGRRDGRVSNITEALFNLIPPFANITSLKQGFLQ  180

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
             KGLSVKDLVVLSG HTIG+SHCSSF +RLYNFTGKGDADPSLDPNY ++LKMKC   SPT
Sbjct  181   KGLSVKDLVVLSGSHTIGMSHCSSFNNRLYNFTGKGDADPSLDPNYIKRLKMKC---SPT  237

Query  856   D--NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFK  1029
             D  ++VEMDPGSVRTFDTSY+ ++AKRRGLFTSD+ALLDD+ETK YL +QAL HGSTFFK
Sbjct  238   DQNSIVEMDPGSVRTFDTSYYNIVAKRRGLFTSDSALLDDKETKGYLKEQALNHGSTFFK  297

Query  1030  DFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             DFGESMV MGRI VLTG QGEIR VCT +N
Sbjct  298   DFGESMVKMGRIQVLTGTQGEIRNVCTKIN  327



>ref|XP_006363505.1| PREDICTED: peroxidase 27-like [Solanum tuberosum]
Length=328

 Score =   494 bits (1273),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/326 (73%), Positives = 273/326 (84%), Gaps = 4/326 (1%)
 Frame = +1

Query  145   SRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             S YL + +  FL  A  ++HA G   L+VGFY +TCPH+E I KEI D VI+  PSLA P
Sbjct  6     SNYLLISLTFFL-IAFSSNHANGEV-LKVGFYHKTCPHVELISKEIVDDVISRVPSLAAP  63

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRMH+HDCFVRGC+GSVLLDSPTKQ EKD+ PN SLRG+QIIDKVKTA+E++CPG+VSC
Sbjct  64    LLRMHYHDCFVRGCDGSVLLDSPTKQAEKDSIPNLSLRGYQIIDKVKTALEKSCPGIVSC  123

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             ADI+A+VARDVT A+KGP WEVETGRRDG VSN+TEALFNL+PPFANIT LKQGF  +GL
Sbjct  124   ADIVALVARDVTVAVKGPSWEVETGRRDGSVSNITEALFNLIPPFANITSLKQGFLQRGL  183

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
             SVKDLVVLSG HTIGISHCSSF +RLYNFTGKGD DPSLDPNY + LK KCP     + L
Sbjct  184   SVKDLVVLSGSHTIGISHCSSFNNRLYNFTGKGDTDPSLDPNYIKNLKKKCPPND-QNTL  242

Query  865   VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALT-HGSTFFKDFGE  1041
             VEMDPGSVRTFD SY+ L+AKRRGLFTSD+ALLDD ETK YL +Q +  +GSTFFKDFGE
Sbjct  243   VEMDPGSVRTFDNSYYKLVAKRRGLFTSDSALLDDSETKDYLKKQGINQYGSTFFKDFGE  302

Query  1042  SMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             SMV MGR+ VLTG+QGEIRKVC+ +N
Sbjct  303   SMVKMGRVQVLTGNQGEIRKVCSRIN  328



>ref|XP_004251490.1| PREDICTED: peroxidase 27 [Solanum lycopersicum]
Length=328

 Score =   489 bits (1259),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 238/319 (75%), Positives = 270/319 (85%), Gaps = 5/319 (2%)
 Frame = +1

Query  169   LIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHD  348
             L F   A  ++HA G   L+VGFY +TCPH+E IVK I D VI+  PSLA PLLRMH+HD
Sbjct  13    LTFFLIAFGSNHANGEV-LKVGFYHKTCPHVELIVKGIIDDVISRVPSLAAPLLRMHYHD  71

Query  349   CFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVA  528
             CFVRGC+GSVLLDSPTKQ EKD+ PN SLRG+QIIDKVKTA+E++CPGVVSCADI+A+VA
Sbjct  72    CFVRGCDGSVLLDSPTKQAEKDSIPNLSLRGYQIIDKVKTALEKSCPGVVSCADIVALVA  131

Query  529   RDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVL  708
             RDVT A+KGP WEVETGRRDG VSN+TEALFNL+PPFANIT LKQGF  +GLSVKDLVVL
Sbjct  132   RDVTVAVKGPSWEVETGRRDGSVSNITEALFNLIPPFANITSLKQGFLQRGLSVKDLVVL  191

Query  709   SGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKC-PEESPTDNLVEMDPGS  885
             SG HTIGISHCSSF +R+YNFTGKGD DPSLDPNY + LK KC P +  T  LVEMDPGS
Sbjct  192   SGSHTIGISHCSSFNNRIYNFTGKGDTDPSLDPNYIKNLKKKCLPNDQNT--LVEMDPGS  249

Query  886   VRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALT-HGSTFFKDFGESMVNMGR  1062
             VRTFDTSY+ L+AKRRGLFTSD+ALLDD ETK YL +Q +  +GSTFFKDFGESMV MGR
Sbjct  250   VRTFDTSYYKLVAKRRGLFTSDSALLDDSETKDYLKKQGINQYGSTFFKDFGESMVKMGR  309

Query  1063  IGVLTGDQGEIRKVCTAVN  1119
             + VLTG+QGEIRKVC+ VN
Sbjct  310   VQVLTGNQGEIRKVCSRVN  328



>ref|XP_002268360.1| PREDICTED: peroxidase 27 [Vitis vinifera]
Length=326

 Score =   471 bits (1212),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 255/300 (85%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCP+ E IVK++ DQ ++VAPSL+GPLLRMHFHDCFVRGCEGSVLL+S T+
Sbjct  28    GLKVGFYRKTCPNAEAIVKKVVDQAMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSSTQ  87

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDA PN SLRG+Q+ID+VK+A+E+ACPGVVSC+DILA+VARDV  AMKGP W+VETG
Sbjct  88    QAEKDAFPNLSLRGYQVIDRVKSALEKACPGVVSCSDILALVARDVVVAMKGPSWKVETG  147

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVSN+TEAL NL+PP ANIT LK GF  +GLSVKDLVVLSGGHT+G SHCSSF+ R
Sbjct  148   RRDGRVSNITEALTNLIPPTANITQLKSGFQQRGLSVKDLVVLSGGHTLGTSHCSSFSSR  207

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LDP Y  KLK KC ++   ++LVEMDPGS +TFD SY+TL+ KRRGL
Sbjct  208   LYNFTGKGDTDPDLDPKYIAKLKNKC-KQGDANSLVEMDPGSFKTFDESYYTLVGKRRGL  266

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F SDAALLDD ETKAY+  QA THGSTFF+DFG SM+ MGRIGVLTG  GEIRK C  VN
Sbjct  267   FVSDAALLDDSETKAYVKLQATTHGSTFFEDFGVSMIKMGRIGVLTGSSGEIRKECALVN  326



>ref|XP_007213025.1| hypothetical protein PRUPE_ppa023088mg [Prunus persica]
 gb|EMJ14224.1| hypothetical protein PRUPE_ppa023088mg [Prunus persica]
Length=328

 Score =   459 bits (1182),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 260/330 (79%), Gaps = 7/330 (2%)
 Frame = +1

Query  136   AKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSL  315
             +K   YL L+ L F+ F      A   GGL VGFY ++CP  E IVK++  Q I+  PSL
Sbjct  4     SKLFSYLFLQ-LTFILFVL--DLANAQGGLNVGFYAKSCPKAEDIVKKVIFQTISTTPSL  60

Query  316   AGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             A PLLRMHFHDCFVRGCEGS+LL+S T Q EKDA PN SLRGFQIIDK K+A+E+ACPGV
Sbjct  61    AAPLLRMHFHDCFVRGCEGSILLNSSTNQAEKDAIPNLSLRGFQIIDKAKSALEKACPGV  120

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCAD+LAI ARDV +A+ G +W VETGRRDGRVSN+TEA  NLLPP ANIT+LK GF  
Sbjct  121   VSCADVLAITARDVVSALNGAHWNVETGRRDGRVSNITEAFMNLLPPTANITILKAGFAR  180

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKC-PEESP  852
             KGLS KDLVVLSGGHTIG SHC++F++RLYNFTGKGD DP+LDPNY  +LK+KC P +  
Sbjct  181   KGLSAKDLVVLSGGHTIGTSHCTAFSNRLYNFTGKGDTDPTLDPNYIARLKLKCKPNDQK  240

Query  853   TDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHG-STFFK  1029
             T  LVEMDPGS +TFD +YFTL++KRRGLF SDAALLDD ETKAY+       G S+FFK
Sbjct  241   T--LVEMDPGSFKTFDQTYFTLVSKRRGLFQSDAALLDDSETKAYVQSHVAAVGKSSFFK  298

Query  1030  DFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             DFG SMVNMGRIGVLTG+ GEIRKVC+ +N
Sbjct  299   DFGVSMVNMGRIGVLTGNAGEIRKVCSKIN  328



>ref|XP_008224769.1| PREDICTED: peroxidase 27 [Prunus mume]
Length=328

 Score =   459 bits (1182),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 251/307 (82%), Gaps = 4/307 (1%)
 Frame = +1

Query  205   ATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLL  384
             A   GGL VGFY ++CP  E IVK++  Q I+  PSLA PLLRMHFHDCFVRGCEGS+LL
Sbjct  24    ANAQGGLNVGFYAKSCPKAEDIVKKVIFQTISTTPSLAAPLLRMHFHDCFVRGCEGSILL  83

Query  385   DSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYW  564
             +S T Q EKDA PN SLRGFQIIDK K+A+E+ACPGVVSCAD+LAI ARDV +A+ G +W
Sbjct  84    NSSTNQAEKDAVPNLSLRGFQIIDKAKSALEKACPGVVSCADVLAITARDVVSALNGAHW  143

Query  565   EVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCS  744
              VETGRRDGRVSN+TEA  NLLPP ANIT+LK GF  KGLS KDLVVLSGGHTIG SHC+
Sbjct  144   NVETGRRDGRVSNITEAFMNLLPPTANITILKAGFARKGLSAKDLVVLSGGHTIGTSHCT  203

Query  745   SFTDRLYNFTGKGDADPSLDPNYAEKLKMKC-PEESPTDNLVEMDPGSVRTFDTSYFTLI  921
             +F++RLYNFTGKGD DP+LDPNY  +LK+KC P +  T  LVEMDPGS +TFD +YFTL+
Sbjct  204   AFSNRLYNFTGKGDTDPTLDPNYIARLKLKCKPNDQKT--LVEMDPGSFKTFDQTYFTLV  261

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHG-STFFKDFGESMVNMGRIGVLTGDQGEIR  1098
             +KRRGLF SDAALLDD ETKAY+   A   G S+FFKDFG SMVNMGRIGVLTG+ GEIR
Sbjct  262   SKRRGLFQSDAALLDDSETKAYVQSHAAAVGKSSFFKDFGVSMVNMGRIGVLTGNAGEIR  321

Query  1099  KVCTAVN  1119
             KVC+ +N
Sbjct  322   KVCSKIN  328



>ref|XP_010057739.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
 gb|KCW74971.1| hypothetical protein EUGRSUZ_E03716 [Eucalyptus grandis]
Length=327

 Score =   458 bits (1179),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 249/300 (83%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++TCP+ E IVK++ DQV++VAPSL+GPLLRMHFHDCFVRGCEGS+LL+S T 
Sbjct  29    GLKVGFYQKTCPNAEAIVKKVMDQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAPPNFSLRG+Q+ID+VKTA+E+ACPG VSCAD+LAIVARDV  A     ++VETG
Sbjct  89    QAEKDAPPNFSLRGYQVIDRVKTALEKACPGTVSCADVLAIVARDVVVATGALSYDVETG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS++ EAL NL+PP ANIT LK  F  KGLSVKDLVVLSGGHT+G SHCSSF+DR
Sbjct  149   RRDGNVSSLNEALNNLVPPNANITTLKADFAMKGLSVKDLVVLSGGHTLGTSHCSSFSDR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LD NY  +LK+KC     T  LVEMDPGSVRTFD  YF LI KRRGL
Sbjct  209   LYNFTGKGDTDPKLDSNYIARLKLKCKPNDQT-TLVEMDPGSVRTFDIKYFDLIPKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSDAALLDD ETKAY+  Q  T GSTFFKDFG SMVNMGRIGVLTG  GE+RKVC  VN
Sbjct  268   FTSDAALLDDSETKAYIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN  327



>ref|XP_010057733.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
Length=327

 Score =   455 bits (1171),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 218/300 (73%), Positives = 251/300 (84%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++TCP+ E IVK++  QV++VAPSL+GPLLRMHFHDCFVRGCEGS+LL+S T 
Sbjct  29    GLKVGFYQKTCPNAEAIVKKVIGQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAPPNFSLRG+Q+ID+VKTA+E+ACPG+VSCAD+LAIVARDV  A +G  ++VETG
Sbjct  89    QAEKDAPPNFSLRGYQVIDRVKTALEKACPGIVSCADVLAIVARDVIVATRGLSYDVETG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS++ EAL NL+PP ANIT LK  F  +GLSVKDLVVLSGGHT+G SHCSSF+DR
Sbjct  149   RRDGNVSSLNEALNNLVPPNANITTLKADFAMRGLSVKDLVVLSGGHTLGTSHCSSFSDR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LD NY  +LK+KC     T  LVEMDPGSVRTFD  YF LI KRRGL
Sbjct  209   LYNFTGKGDTDPKLDSNYIARLKLKCKPNDQT-TLVEMDPGSVRTFDIKYFDLIPKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSDAALLDD +TKA++  Q  T GSTFFKDFG SMVNMGRIGVLTG  GE+RKVC  VN
Sbjct  268   FTSDAALLDDSQTKAFIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN  327



>gb|AHL39168.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   454 bits (1168),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 229/329 (70%), Positives = 257/329 (78%), Gaps = 6/329 (2%)
 Frame = +1

Query  136   AKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSL  315
             +K S  L    +IFL F   + +A     L+VGFY+ TCP  E IVKE+ DQV+ VAPSL
Sbjct  4     SKLSPCLIFLQIIFLVFVFNSANAQ----LKVGFYKDTCPKAEAIVKEVMDQVMKVAPSL  59

Query  316   AGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             +GPLLRMHFHDCFVRGCEGSVLL+S T Q EKD+PPN SLRG+Q+ID+VKTA+E+ CPGV
Sbjct  60    SGPLLRMHFHDCFVRGCEGSVLLNSSTGQAEKDSPPNLSLRGYQVIDRVKTALEKECPGV  119

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCADILAIVARDVT A  GP+WEVETGRRDGRVSN +E L NL P FANI+ L   F  
Sbjct  120   VSCADILAIVARDVTVATMGPFWEVETGRRDGRVSNFSEPLTNLPPFFANISQLISMFRS  179

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
             KGLSVKDLVVLSGGHTIG SHCSSF+ RLYN TGK   DP LD  Y EKLK KC     T
Sbjct  180   KGLSVKDLVVLSGGHTIGTSHCSSFSSRLYNSTGKDGTDPKLDSEYIEKLKNKCKVGDQT  239

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKD  1032
               LVEMDPGSVRTFD SY+TL+AKRRGLF SDAALLD+ ETKAY+ +Q A TH STFFKD
Sbjct  240   -TLVEMDPGSVRTFDNSYYTLVAKRRGLFQSDAALLDNSETKAYVKLQSAATHRSTFFKD  298

Query  1033  FGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FG SM+NMGR+ VLTG  GEIRKVC+ VN
Sbjct  299   FGVSMINMGRVEVLTGKAGEIRKVCSKVN  327



>ref|XP_010999629.1| PREDICTED: peroxidase 27-like [Populus euphratica]
Length=325

 Score =   454 bits (1168),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 257/329 (78%), Gaps = 8/329 (2%)
 Frame = +1

Query  136   AKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSL  315
             +K S  L    +IFL F   N        LRVGFY+ TCP  E IVK++ DQV+ VAPSL
Sbjct  4     SKLSPSLIFLQIIFLVFNSANAQ------LRVGFYKDTCPKAEAIVKKVMDQVMKVAPSL  57

Query  316   AGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             +GPLLRMHFHDCFVRGC+GSVLL+S T Q EKD+PPN SLRG+Q+ID+VKTA+E+ CPGV
Sbjct  58    SGPLLRMHFHDCFVRGCDGSVLLNSSTGQAEKDSPPNLSLRGYQVIDRVKTALEKECPGV  117

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCADI+AIVARDVT A  GP+WEVETGRRDGRVSN +E L NL P FANI+ L   F  
Sbjct  118   VSCADIMAIVARDVTVATMGPFWEVETGRRDGRVSNFSEPLTNLPPFFANISQLISMFRS  177

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
             KGLSVKDLVVLSGGHTIG SHCSSF+ RLYN TGK   DP+LD  Y EKLK KC     T
Sbjct  178   KGLSVKDLVVLSGGHTIGTSHCSSFSSRLYNSTGKDGTDPTLDSEYIEKLKNKCKVGDQT  237

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKD  1032
               LVEMDPGSVRTFD SY+TL+AKRRGLF SDAALLD+EETKAY+ +Q A T+ STFFKD
Sbjct  238   -TLVEMDPGSVRTFDNSYYTLVAKRRGLFQSDAALLDNEETKAYVKLQSASTYRSTFFKD  296

Query  1033  FGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FG SM+NMGR+ VLTG  GEIRKVC+ VN
Sbjct  297   FGVSMINMGRVEVLTGKAGEIRKVCSKVN  325



>ref|XP_002316610.2| hypothetical protein POPTR_0011s00280g [Populus trichocarpa]
 gb|EEE97222.2| hypothetical protein POPTR_0011s00280g [Populus trichocarpa]
Length=327

 Score =   452 bits (1163),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 257/329 (78%), Gaps = 6/329 (2%)
 Frame = +1

Query  136   AKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSL  315
             +K S  L    +IFL F   + +A     L+VGFY+ TCP  E IVKE+ DQV+ VAPSL
Sbjct  4     SKLSPCLIFLQIIFLVFVFNSANAQ----LKVGFYKDTCPKAEAIVKEVMDQVMKVAPSL  59

Query  316   AGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             +GPLLRMHFHDCFVRGCEGSVLL+S T Q EKD+PPN SLRG+Q+ID+VKTA+E+ CPGV
Sbjct  60    SGPLLRMHFHDCFVRGCEGSVLLNSSTGQAEKDSPPNLSLRGYQVIDRVKTALEKECPGV  119

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCADILAIVARDVT A  GP+WEVETGRRDGRVS  +E L NL P FANI+ L   F  
Sbjct  120   VSCADILAIVARDVTVATIGPFWEVETGRRDGRVSTFSEPLTNLPPFFANISQLISMFRS  179

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
             KGLSVKDLVVLSGGHTIG SHCSSF+ RLYN TGK   DP+LD  Y EKLK KC     T
Sbjct  180   KGLSVKDLVVLSGGHTIGTSHCSSFSSRLYNSTGKDGTDPTLDSEYIEKLKNKCKVGDQT  239

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKD  1032
               LVEMDPGSVRTFD SY+TL+AKRRGLF SDAALLD+ ETKAY+ +Q A TH STFFKD
Sbjct  240   -TLVEMDPGSVRTFDNSYYTLVAKRRGLFQSDAALLDNSETKAYVKLQSAATHRSTFFKD  298

Query  1033  FGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FG SM+NMGR+ VLTG  GEIRKVC+ VN
Sbjct  299   FGVSMINMGRVEVLTGKAGEIRKVCSKVN  327



>gb|KCW74965.1| hypothetical protein EUGRSUZ_E03708, partial [Eucalyptus grandis]
Length=325

 Score =   452 bits (1162),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 216/296 (73%), Positives = 249/296 (84%), Gaps = 1/296 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++TCP+ E IVK++  QV++VAPSL+GPLLRMHFHDCFVRGCEGS+LL+S T 
Sbjct  29    GLKVGFYQKTCPNAEAIVKKVIGQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAPPNFSLRG+Q+ID+VKTA+E+ACPG+VSCAD+LAIVARDV  A +G  ++VETG
Sbjct  89    QAEKDAPPNFSLRGYQVIDRVKTALEKACPGIVSCADVLAIVARDVIVATRGLSYDVETG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS++ EAL NL+PP ANIT LK  F  +GLSVKDLVVLSGGHT+G SHCSSF+DR
Sbjct  149   RRDGNVSSLNEALNNLVPPNANITTLKADFAMRGLSVKDLVVLSGGHTLGTSHCSSFSDR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LD NY  +LK+KC     T  LVEMDPGSVRTFD  YF LI KRRGL
Sbjct  209   LYNFTGKGDTDPKLDSNYIARLKLKCKPNDQT-TLVEMDPGSVRTFDIKYFDLIPKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             FTSDAALLDD +TKA++  Q  T GSTFFKDFG SMVNMGRIGVLTG  GE+RKVC
Sbjct  268   FTSDAALLDDSQTKAFIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVC  323



>ref|XP_010057976.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
Length=327

 Score =   451 bits (1159),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 218/300 (73%), Positives = 248/300 (83%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++ CP+ E IVK +  +V++VAPSL+GPLLRMHFHDCFVRGCEGSVLL+SPT 
Sbjct  29    GLKVGFYQKACPNAEAIVKGVIHEVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGFQ ID+VKTA+E+ACPG+VSCADILA+VARDV  A     ++VETG
Sbjct  89    QSEKNAGPNLSLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGALSYDVETG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS +T+AL NL+PP ANIT LK  F  KGLSVKDLV LSGGHTIG SHCSSF+DR
Sbjct  149   RRDGNVSILTDALNNLIPPTANITTLKADFAKKGLSVKDLVALSGGHTIGTSHCSSFSDR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             +YNFTGKGDADP+LD NY  +LK++C     T  LVEMDPGSVRTFD  YF LI KRRGL
Sbjct  209   VYNFTGKGDADPTLDSNYIARLKLRCKPNDQT-TLVEMDPGSVRTFDVKYFDLIPKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSD+ALLDD ETKAY+  Q  T GSTFFKDFGESMVNMGRIGVLTG  GE+RKVCT VN
Sbjct  268   FTSDSALLDDSETKAYIDLQIKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCTKVN  327



>ref|XP_011007886.1| PREDICTED: peroxidase 27-like [Populus euphratica]
Length=327

 Score =   449 bits (1154),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 226/329 (69%), Positives = 257/329 (78%), Gaps = 6/329 (2%)
 Frame = +1

Query  136   AKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSL  315
             +K S  L    +IFL F   + +A     L+VGFY+ TCP  E IVK++ DQV+ VAPSL
Sbjct  4     SKLSPCLIFIQIIFLVFVFNSANAQ----LKVGFYKDTCPKAEAIVKKVMDQVMKVAPSL  59

Query  316   AGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             +GPLLRMHFHDCFVRGCE SVLL+S T Q EKD+PPN SLRG+Q+ID+VKTA+E+ CPGV
Sbjct  60    SGPLLRMHFHDCFVRGCEASVLLNSSTGQAEKDSPPNLSLRGYQVIDRVKTALEKECPGV  119

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCADILAIVARDVT A  GP+WEVETGRRDGRVSN +E L NL P FANI+ L   F  
Sbjct  120   VSCADILAIVARDVTVATMGPFWEVETGRRDGRVSNFSEPLTNLPPFFANISQLISMFRS  179

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
             KGLSVKDLVVLSGGHTIG SHCSSF+ RLYN TGK   DP+LD  Y EKLK KC     T
Sbjct  180   KGLSVKDLVVLSGGHTIGTSHCSSFSSRLYNSTGKDGTDPTLDSEYIEKLKNKCKVGDQT  239

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKD  1032
               LVEMDPGSVRTFD SY+TL+AKRRGLF SDAALLD+ ETKAY+ +Q A T+ STFFKD
Sbjct  240   -TLVEMDPGSVRTFDNSYYTLVAKRRGLFQSDAALLDNSETKAYVKLQSASTYRSTFFKD  298

Query  1033  FGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FG SM+NMGR+ VLTG  GEIRKVC+ VN
Sbjct  299   FGVSMINMGRVEVLTGKAGEIRKVCSRVN  327



>gb|KCW75372.1| hypothetical protein EUGRSUZ_E04120 [Eucalyptus grandis]
Length=367

 Score =   450 bits (1157),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 218/300 (73%), Positives = 248/300 (83%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++ CP+ E IVK +  +V++VAPSL+GPLLRMHFHDCFVRGCEGSVLL+SPT 
Sbjct  69    GLKVGFYQKACPNAEAIVKGVIHEVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTN  128

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGFQ ID+VKTA+E+ACPG+VSCADILA+VARDV  A     ++VETG
Sbjct  129   QSEKNAGPNLSLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGALSYDVETG  188

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS +T+AL NL+PP ANIT LK  F  KGLSVKDLV LSGGHTIG SHCSSF+DR
Sbjct  189   RRDGNVSILTDALNNLIPPTANITTLKADFAKKGLSVKDLVALSGGHTIGTSHCSSFSDR  248

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             +YNFTGKGDADP+LD NY  +LK++C     T  LVEMDPGSVRTFD  YF LI KRRGL
Sbjct  249   VYNFTGKGDADPTLDSNYIARLKLRCKPNDQT-TLVEMDPGSVRTFDVKYFDLIPKRRGL  307

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSD+ALLDD ETKAY+  Q  T GSTFFKDFGESMVNMGRIGVLTG  GE+RKVCT VN
Sbjct  308   FTSDSALLDDSETKAYIDLQIKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCTKVN  367



>ref|XP_010088079.1| Peroxidase 27 [Morus notabilis]
 gb|EXB31398.1| Peroxidase 27 [Morus notabilis]
Length=388

 Score =   450 bits (1158),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 250/305 (82%), Gaps = 2/305 (1%)
 Frame = +1

Query  199   HHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSV  378
             HH     GL+VGFY +TCP  E +VKEI  + + VAPSLAGPL R+HFHDCFVRGCEGSV
Sbjct  22    HHGASAHGLKVGFYAKTCPRAEAVVKEIMVETLKVAPSLAGPLNRLHFHDCFVRGCEGSV  81

Query  379   LLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGP  558
             LL+SPT Q EK+A PN  LRGFQIIDKVKTA+E+ CPGVVSCADILAIVARD   AM GP
Sbjct  82    LLNSPTGQAEKNAAPNSGLRGFQIIDKVKTALEKECPGVVSCADILAIVARDSVVAMSGP  141

Query  559   YWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISH  738
             YWEVETGRRDGRVSN+TEAL NLL P +NITVLK GF  +GLSVKDLVVLSGGHTIG S 
Sbjct  142   YWEVETGRRDGRVSNITEALQNLLSPLSNITVLKAGFARRGLSVKDLVVLSGGHTIGTSR  201

Query  739   CSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTL  918
             CS+F +RLYNFTGKGD DP+LDP Y E+LK+KC +    ++ VEMDPGS + FD +Y+TL
Sbjct  202   CSAFGNRLYNFTGKGDTDPTLDPEYIEQLKLKC-KTGDQNSHVEMDPGSFKIFDVNYYTL  260

Query  919   IAKRRGLFTSDAALLDDEETKAYLVQQALTHG-STFFKDFGESMVNMGRIGVLTGDQGEI  1095
             I+KRRGLF SDAALLDD ET+AY++  A T+G S+FFKDF  SMVNMG+IG LTG +GE+
Sbjct  261   ISKRRGLFQSDAALLDDAETRAYVLSHANTYGTSSFFKDFRVSMVNMGKIGALTGTEGEV  320

Query  1096  RKVCT  1110
             RKVCT
Sbjct  321   RKVCT  325



>ref|XP_010057737.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
 gb|KCW74970.1| hypothetical protein EUGRSUZ_E03715 [Eucalyptus grandis]
Length=327

 Score =   446 bits (1148),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 216/300 (72%), Positives = 249/300 (83%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++ CP+ E IVK +  +V++VAPSL+GPLLRMHFHDCFVRGCEGSVLL+SPT 
Sbjct  29    GLKVGFYQKACPNAEAIVKGVIHEVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGFQ ID+VKTA+E+ACPG+VSCADILA+VARD+  A  G  ++VETG
Sbjct  89    QAEKNAIPNQSLRGFQTIDRVKTALEKACPGIVSCADILALVARDMVVATGGFSYDVETG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS M EAL +L+PP ANIT LK  F  +GLSVKDLVVLSGGHTIG SHCSSF++R
Sbjct  149   RRDGNVSIMNEALNDLIPPTANITTLKADFAKRGLSVKDLVVLSGGHTIGTSHCSSFSNR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             +YNFTGKGDADP+LD NY  +LK++C     T  LVEMDPGSVRTFD  YF LI KRRGL
Sbjct  209   VYNFTGKGDADPTLDSNYIARLKLRCKPNDQT-TLVEMDPGSVRTFDVKYFDLIPKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSD+ALLDD ETKAY+  Q  T GSTFFKDFGESMVNMGRIGVLTG  GE+RKVC+ VN
Sbjct  268   FTSDSALLDDSETKAYIDLQIKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCSKVN  327



>ref|XP_006371331.1| Peroxidase 27 precursor family protein [Populus trichocarpa]
 gb|ERP49128.1| Peroxidase 27 precursor family protein [Populus trichocarpa]
 gb|AHL39197.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   446 bits (1148),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 250/319 (78%), Gaps = 8/319 (3%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             + + L F   N        LRVGFY+ TCP  E IV+E+  QV+ VAPSL+GPLLRMHFH
Sbjct  16    VFLVLVFNSANAQ------LRVGFYKDTCPKAEAIVEEVMHQVMKVAPSLSGPLLRMHFH  69

Query  346   DCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIV  525
             DCFVRGC+GSVLL+S T Q EKD+PPN SLRG+QIID+VKTA+E+ CPGVVSCADI+AIV
Sbjct  70    DCFVRGCDGSVLLNSSTGQAEKDSPPNLSLRGYQIIDRVKTALEKECPGVVSCADIMAIV  129

Query  526   ARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVV  705
             ARDVT A  GP+WEVETGRRDGRVSN+ E L NL P FANI+ L   F  KGLSVKDLVV
Sbjct  130   ARDVTVATMGPFWEVETGRRDGRVSNILEPLTNLPPFFANISQLISMFRSKGLSVKDLVV  189

Query  706   LSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGS  885
             LSGGHTIG SHCSSF+ RLYN TGK   DP+LD  Y EKLK +C     T  LVEMDPGS
Sbjct  190   LSGGHTIGTSHCSSFSSRLYNSTGKDGTDPTLDSEYIEKLKSRCKVGDQT-TLVEMDPGS  248

Query  886   VRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKDFGESMVNMGR  1062
             VRTFD SY+TL+AKRRGLF SDAALLD+ ETKAY+ +Q A TH  TFFKDFG SM+NMGR
Sbjct  249   VRTFDNSYYTLVAKRRGLFQSDAALLDNSETKAYVKLQSAATHRPTFFKDFGVSMINMGR  308

Query  1063  IGVLTGDQGEIRKVCTAVN  1119
             +GVLTG  GEIRKVC+ VN
Sbjct  309   VGVLTGKAGEIRKVCSKVN  327



>ref|XP_010048939.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
Length=312

 Score =   439 bits (1128),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/300 (71%), Positives = 245/300 (82%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL VGFY++ CP+ E IVKE+  QV++VAPSL+GPLLR+HFHDCFVRGCEGSVLL+SPT 
Sbjct  14    GLEVGFYQKACPNAEAIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTN  73

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAP N +LRGFQ ID+VKTA+E+ACPG+VSCADILA+VARDV  A  G +++VETG
Sbjct  74    QSEKDAPQNHNLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGGLFYDVETG  133

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS + EA  +L+P  ANIT LK  F  +GLSVKDLVVLSGGHTIG SHC++F++R
Sbjct  134   RRDGCVSILGEASNDLIPSTANITTLKADFAKRGLSVKDLVVLSGGHTIGTSHCTAFSNR  193

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP+LD NY  +LK+ C     T  LVEMDPGSVRTFD  YF LIAKRRGL
Sbjct  194   LYNFTGKGDTDPTLDSNYVARLKLSCKPNDQT-TLVEMDPGSVRTFDIKYFDLIAKRRGL  252

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSDAALLDD +TKAYL  Q  T GSTFFKDFGESMV MGRIGVLT   GE+RKVC+ VN
Sbjct  253   FTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGRIGVLTETSGEVRKVCSKVN  312



>gb|KCW81364.1| hypothetical protein EUGRSUZ_C02744 [Eucalyptus grandis]
Length=351

 Score =   439 bits (1129),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 213/300 (71%), Positives = 245/300 (82%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL VGFY++ CP+ E IVKE+  QV++VAPSL+GPLLR+HFHDCFVRGCEGSVLL+SPT 
Sbjct  53    GLEVGFYQKACPNAEAIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTN  112

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAP N +LRGFQ ID+VKTA+E+ACPG+VSCADILA+VARDV  A  G +++VETG
Sbjct  113   QSEKDAPQNHNLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGGLFYDVETG  172

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS + EA  +L+P  ANIT LK  F  +GLSVKDLVVLSGGHTIG SHC++F++R
Sbjct  173   RRDGCVSILGEASNDLIPSTANITTLKADFAKRGLSVKDLVVLSGGHTIGTSHCTAFSNR  232

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP+LD NY  +LK+ C     T  LVEMDPGSVRTFD  YF LIAKRRGL
Sbjct  233   LYNFTGKGDTDPTLDSNYVARLKLSCKPNDQT-TLVEMDPGSVRTFDIKYFDLIAKRRGL  291

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSDAALLDD +TKAYL  Q  T GSTFFKDFGESMV MGRIGVLT   GE+RKVC+ VN
Sbjct  292   FTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGRIGVLTETSGEVRKVCSKVN  351



>ref|XP_010048942.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
 gb|KCW81366.1| hypothetical protein EUGRSUZ_C02747 [Eucalyptus grandis]
Length=327

 Score =   438 bits (1126),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 215/300 (72%), Positives = 244/300 (81%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY + CP+ E IVKE+  QV++VAPSL+GPLLR+HFHDCFVRGCEGSVLL+SPT 
Sbjct  29    GLKVGFYRKACPNAEIIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTY  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDA PN SLRGFQ ID+VKTA+E+ACPG+VSCADILA+VARDV  A  G ++ VETG
Sbjct  89    QAEKDAHPNHSLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGGLFYYVETG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             R+DG VS   EAL +L+P  ANIT LK  F  +GLSVKDLVVLSGGHTIG SHC SF++R
Sbjct  149   RKDGNVSTSKEALNDLIPSKANITTLKIDFAKRGLSVKDLVVLSGGHTIGTSHCPSFSNR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP+LD NY  +LK+ C  +  T  LVEMDPGSVRTFD  YF LIAKRRGL
Sbjct  209   LYNFTGKGDTDPTLDSNYLARLKLSCKPDDQT-TLVEMDPGSVRTFDIKYFNLIAKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSDAALLDD +TKAYL  Q  T GSTFFKDFGESMV MGRIGVLT   GE+RKVC+ VN
Sbjct  268   FTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGRIGVLTETAGEVRKVCSKVN  327



>ref|XP_002518541.1| Peroxidase 27 precursor, putative [Ricinus communis]
 gb|EEF43928.1| Peroxidase 27 precursor, putative [Ricinus communis]
Length=330

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 251/331 (76%), Gaps = 12/331 (4%)
 Frame = +1

Query  142   FSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
             FS  L   IL+   F   N        L+VGFY +TCP  E IVKE+ +QV++VAPSLAG
Sbjct  7     FSALLIQLILVLFVFNPANAQ------LKVGFYSKTCPRAEAIVKEVINQVMSVAPSLAG  60

Query  322   PLLRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             PLLRMHFHDCFVRGC+GSVLL+  S T+Q EKDA PN SLRG+QIID+VKTA+E+ CPGV
Sbjct  61    PLLRMHFHDCFVRGCDGSVLLNATSSTQQVEKDALPNLSLRGYQIIDRVKTALEKECPGV  120

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCAD++AIVARDVT A KGPYWEVETGRRDGRVS   E L NL+ P ANIT L   F  
Sbjct  121   VSCADVVAIVARDVTVASKGPYWEVETGRRDGRVSIGAETLTNLVAPNANITTLITRFQA  180

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKG---DADPSLDPNYAEKLKMKCPEE  846
             KGL++KDLVVLSGGHTIG SHCSSF +RLYNFTG G   D DP+LD  Y  KLK+KC   
Sbjct  181   KGLNLKDLVVLSGGHTIGTSHCSSFNNRLYNFTGMGINNDFDPTLDSEYVRKLKIKC-RP  239

Query  847   SPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFF  1026
                ++LVEMDPGS +TFD SYFTL++KRRGLF SDAALLD+  TK Y+  QA T  STFF
Sbjct  240   GDQNSLVEMDPGSFKTFDESYFTLVSKRRGLFQSDAALLDNRVTKNYIKLQAATKSSTFF  299

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             KDFG SMV MGR+ VLTG  GEIRKVC+ VN
Sbjct  300   KDFGVSMVKMGRVDVLTGSAGEIRKVCSMVN  330



>ref|XP_009604229.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=327

 Score =   431 bits (1107),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 216/334 (65%), Positives = 257/334 (77%), Gaps = 17/334 (5%)
 Frame = +1

Query  142   FSRYLSLEIL----IFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             FSR++ + IL    + LAF  CN       GL+ GFY +TCP +E IV+E   Q I+ AP
Sbjct  3     FSRHIVVLILQLMLVPLAFNLCNAQ-----GLKYGFYRKTCPRVESIVRETTAQYISKAP  57

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEAC  486
             +LA PLLRM FHDCFVRGC+GSV+L+S  T Q E+DA PN SLRGFQ+I+ VK+A+E  C
Sbjct  58    TLAAPLLRMQFHDCFVRGCDGSVMLNSTKTNQAERDAIPNQSLRGFQVINGVKSALENKC  117

Query  487   PGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLP-PFANITVLKQ  663
             PGVVSCADI+A+VARD  + +KGPYW+V  GRRDG VSNM EAL NLLP PFANI+ LK 
Sbjct  118   PGVVSCADIIALVARDAVSMIKGPYWKVPLGRRDGSVSNMLEAL-NLLPAPFANISSLKA  176

Query  664   GFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPE  843
              F   GL+ KDLVVLSGGHTIG SHC +FT+R+YNFTG GDADP++DPNY  +LK+KC  
Sbjct  177   QFVSLGLNAKDLVVLSGGHTIGTSHCFAFTNRMYNFTGNGDADPTMDPNYIARLKLKC--  234

Query  844   ESPTD--NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGS  1017
              SPTD   LVEMDPGS +TFD  Y+T++A RRGLF SD+ALLDD ETKAY+ +QALTHG 
Sbjct  235   -SPTDVTTLVEMDPGSFKTFDEKYYTIVANRRGLFQSDSALLDDIETKAYVKRQALTHGK  293

Query  1018  TFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             TFFKDFG+SMV MG+IGVLTG  GEIRK C  VN
Sbjct  294   TFFKDFGKSMVKMGKIGVLTGQAGEIRKHCDFVN  327



>emb|CDP20391.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   431 bits (1107),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 216/320 (68%), Positives = 251/320 (78%), Gaps = 7/320 (2%)
 Frame = +1

Query  169   LIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHD  348
             LIFLA    N  A G G L   FY+ TCP+L   ++ + D+V++VAP+L GPL+RMHFHD
Sbjct  14    LIFLALIAFNR-ANGQG-LTPDFYKHTCPNLVYTIRTVVDEVMSVAPTLGGPLMRMHFHD  71

Query  349   CFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVA  528
             CFVRGC+GSVLLD+P K  EK A PN S+RGFQIID+VKTAVE+ CPG+VSCAD+LA VA
Sbjct  72    CFVRGCDGSVLLDTPNKT-EKYAIPNLSIRGFQIIDRVKTAVEKVCPGIVSCADVLAAVA  130

Query  529   RDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVL  708
             RDVT A+ GP WEVE GRRDGRVS + EAL NLL PFANI+ LKQGF  KGLSVKDLVVL
Sbjct  131   RDVTVALNGPSWEVEFGRRDGRVSTVNEALANLLSPFANISTLKQGFQAKGLSVKDLVVL  190

Query  709   SGGHTIGISHCSSFTDRLYNFTGKG---DADPSLDPNYAEKLKMKCPEESPTDNLVEMDP  879
             SGGHT+G SHCS+F +RLYNFTGKG   DADP+LD  Y  KLK KC +    + LVEMDP
Sbjct  191   SGGHTVGTSHCSAFNNRLYNFTGKGIQNDADPTLDSEYVPKLKSKC-KFGDRNTLVEMDP  249

Query  880   GSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMG  1059
             GS +TFD SYF+L+AKRRGLF SDAALLDD ET+AY+   AL   + FFKDF +SM+ MG
Sbjct  250   GSFKTFDLSYFSLVAKRRGLFQSDAALLDDSETRAYVKLHALKDKAGFFKDFADSMIRMG  309

Query  1060  RIGVLTGDQGEIRKVCTAVN  1119
             RIGVLTG +GEIRKVCT VN
Sbjct  310   RIGVLTGIRGEIRKVCTKVN  329



>ref|XP_010267771.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=329

 Score =   427 bits (1097),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 213/306 (70%), Positives = 239/306 (78%), Gaps = 3/306 (1%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL+VGFYE+TCP +E IVK+  D  ++ APSLA PLLRMHFHDCFVRGC+GSVLL+
Sbjct  25    TSAQGLKVGFYEKTCPSVEAIVKQTTDSFLSRAPSLAAPLLRMHFHDCFVRGCDGSVLLN  84

Query  388   SPTK--QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPY  561
             S +   Q EK A PN SLRGFQ+ID  K+AVE+ CPGVVSCADI+A+VARD  +  KGP+
Sbjct  85    SSSANPQPEKTAFPNQSLRGFQVIDAAKSAVEKTCPGVVSCADIIALVARDAVSFDKGPF  144

Query  562   WEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHC  741
             WEV TGRRDGRVSN +EAL  L PP ANI+ LK  F  KGLSVKDLVVLS GHTIG SHC
Sbjct  145   WEVPTGRRDGRVSNSSEALQFLPPPTANISDLKSRFSAKGLSVKDLVVLSAGHTIGTSHC  204

Query  742   SSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLI  921
              +F +RLYNFTGKGD DPSLDPNY  KLK KC     T  LVEMDPGS RTFD+ Y+TL+
Sbjct  205   FNFNNRLYNFTGKGDTDPSLDPNYIAKLKNKC-RSGDTTTLVEMDPGSFRTFDSDYYTLV  263

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             +KRRGLF SDAALL D ETKAY+  QA THGSTFFKDFG SMVNMG IGVLTG  GEIRK
Sbjct  264   SKRRGLFQSDAALLTDSETKAYVNLQASTHGSTFFKDFGVSMVNMGNIGVLTGAAGEIRK  323

Query  1102  VCTAVN  1119
              C  +N
Sbjct  324   HCAFIN  329



>ref|XP_009794257.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=327

 Score =   423 bits (1087),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 211/333 (63%), Positives = 252/333 (76%), Gaps = 15/333 (5%)
 Frame = +1

Query  142   FSRYLSLEIL----IFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             FSR++ + IL    + LAF  CN       GL+ GFY +TCP +E IV++   Q I+ AP
Sbjct  3     FSRHIVVLILQLMLVPLAFNLCNAQ-----GLKYGFYSKTCPGVESIVRKTTAQFISKAP  57

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEAC  486
             +LA PLLRM FHDCFVRGC+GSV+L+S    Q E+DA PN SLRGFQ+I+ VK+A+E  C
Sbjct  58    TLAAPLLRMQFHDCFVRGCDGSVMLNSTKNNQAERDAIPNQSLRGFQVINGVKSALENKC  117

Query  487   PGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQG  666
             PGVVSCADI+A+VARD  + + GPYW+V  GRRDGRVS M EAL  L PPFANI+ LK  
Sbjct  118   PGVVSCADIVALVARDAVSMINGPYWKVPLGRRDGRVSIMLEALTLLPPPFANISTLKSQ  177

Query  667   FFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEE  846
             F   GL+ KDLVVLSGGHTIG SHC +FT+R+YNFTG GDADP++DPNY   LK+KC   
Sbjct  178   FASVGLNAKDLVVLSGGHTIGTSHCFAFTNRMYNFTGNGDADPTMDPNYIAGLKLKC---  234

Query  847   SPTD--NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST  1020
             SPTD   LVEMDPGS +TFD  Y+TL+AKRRGLF SD+ALLDD ET+AY+ +QALTHG T
Sbjct  235   SPTDVTTLVEMDPGSFKTFDEKYYTLVAKRRGLFQSDSALLDDIETRAYVKRQALTHGKT  294

Query  1021  FFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FFKDF +SMV MG+IGVLTG  GEIRK C  VN
Sbjct  295   FFKDFAKSMVKMGKIGVLTGQAGEIRKHCDFVN  327



>ref|XP_010240936.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=329

 Score =   422 bits (1085),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/327 (65%), Positives = 246/327 (75%), Gaps = 13/327 (4%)
 Frame = +1

Query  151   YLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLL  330
             +L L +++F++        T   GL+VGFY+  CP +E IV++     ++ APSLA PLL
Sbjct  12    FLHLTVVLFVS------EPTNAQGLKVGFYKNACPSVEAIVEQTTAHFLSRAPSLAAPLL  65

Query  331   RMHFHDCFVRGCEGSVLLDS--PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             RMHFHDCFVRGC+GSVLL++    KQ EK A PN SLRGFQ+ID VK+AVE+ CPGVVSC
Sbjct  66    RMHFHDCFVRGCDGSVLLNATAANKQTEKTAVPNQSLRGFQVIDAVKSAVEKVCPGVVSC  125

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             ADI+A+VARD     KGP+WEV TGRRDGRVSN +EAL  L PPFANI+ LK  F  KGL
Sbjct  126   ADIIALVARDAVVFDKGPFWEVPTGRRDGRVSNASEALQFLPPPFANISDLKSRFQAKGL  185

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN-  861
             SVKDLVVLS  HTIG SHC +F +RLYNFTGKGD DPS+DPNY  +LK KC    P DN 
Sbjct  186   SVKDLVVLSAAHTIGTSHCFNFNNRLYNFTGKGDTDPSMDPNYIARLKNKC---KPGDNT  242

Query  862   -LVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
              LVEMDPGS +TFD  Y+TL+AKRRGLF SDAALL D ET+AY+  QA THGSTFFKDFG
Sbjct  243   TLVEMDPGSRKTFDADYYTLVAKRRGLFQSDAALLTDSETRAYVKLQASTHGSTFFKDFG  302

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMVNMG IGVLTG  GEIRK C  VN
Sbjct  303   VSMVNMGNIGVLTGFAGEIRKHCAFVN  329



>ref|XP_004287926.1| PREDICTED: peroxidase 27-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   421 bits (1081),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 233/301 (77%), Gaps = 2/301 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
              L+VGFY+ TCPHLE IV       ++  P+LA PLLRMHFHDCFVRGC+GSVLL S  K
Sbjct  28    ALQVGFYKYTCPHLEDIVHYTTYYYVSRTPTLAAPLLRMHFHDCFVRGCDGSVLLKSTAK  87

Query  400   -QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q E+DA PN SLRGFQ+ID VK AVE+ACPGVVSCADILA+VARD    + GPYWEV T
Sbjct  88    NQAERDAIPNQSLRGFQVIDAVKYAVEKACPGVVSCADILALVARDAVLMLHGPYWEVPT  147

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS  +EAL  L PPFANI  LK  F  KGL+VKDLVVLSGGHTIG SHCSSF++
Sbjct  148   GRRDGRVSIASEALTGLPPPFANIAQLKGMFASKGLTVKDLVVLSGGHTIGTSHCSSFSN  207

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RLYNFTGKGD DP+LD NY  +LK+KC +    + LVEMDPGS +TFD  Y+TL+AKRRG
Sbjct  208   RLYNFTGKGDTDPTLDRNYIAQLKIKC-KPGDANTLVEMDPGSFKTFDEDYYTLVAKRRG  266

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAALLDD ETK Y+  QA+THG+TF KDF  SMV MG IGVLTG  GEIRK C  V
Sbjct  267   LFQSDAALLDDIETKTYVTTQAITHGATFAKDFAASMVKMGNIGVLTGKNGEIRKQCAFV  326

Query  1117  N  1119
             N
Sbjct  327   N  327



>ref|XP_010240935.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=328

 Score =   420 bits (1080),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 210/301 (70%), Positives = 236/301 (78%), Gaps = 2/301 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             GL+VGFY++TCP +E IVK+     I+ AP+LA PLLRMHFHDCFVRGC+GSVLL+S  T
Sbjct  29    GLKVGFYKKTCPSVEAIVKKTTAHFISRAPTLASPLLRMHFHDCFVRGCDGSVLLNSTAT  88

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EK A PN SLRGFQ++D  K AVE+ACPGVVSCADILA+VARDV + ++GP WEV T
Sbjct  89    NQAEKSAIPNQSLRGFQVVDAAKAAVEKACPGVVSCADILALVARDVVSLIEGPRWEVPT  148

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS  +EAL NL PPF NIT LK  F  KGLSVKDLVVLSGGHTIG SHC SFT+
Sbjct  149   GRRDGRVSLASEALTNLPPPFFNITQLKASFTRKGLSVKDLVVLSGGHTIGNSHCPSFTN  208

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RLYNFTGKGD D SLD NY  KLK KC     T  +VEM PGS +TFD  Y+TL+AKRRG
Sbjct  209   RLYNFTGKGDTDTSLDSNYIPKLKSKCKPGDVT-TIVEMVPGSFKTFDADYYTLVAKRRG  267

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAALL D +T+AY+  QA THGSTFF+DFG SMVNMG IGVLTG  GEIRK C  V
Sbjct  268   LFQSDAALLTDSDTRAYVKLQASTHGSTFFQDFGVSMVNMGNIGVLTGSAGEIRKHCAFV  327

Query  1117  N  1119
             N
Sbjct  328   N  328



>ref|XP_004240143.1| PREDICTED: peroxidase 27-like [Solanum lycopersicum]
Length=322

 Score =   419 bits (1077),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 204/327 (62%), Positives = 244/327 (75%), Gaps = 8/327 (2%)
 Frame = +1

Query  142   FSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
             F R + L +L  +    CN       GL++G+Y++TCP  E IV++I    I+ AP+LA 
Sbjct  3     FPRLIFLLVLAIIPL--CNAQ-----GLKLGYYQKTCPGAEAIVQKITSHYISRAPTLAA  55

Query  322   PLLRMHFHDCFVRGCEGSVLLDSPTKQ-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             PLLRMHFHDCFVRGC+GSVLL+S      E DA PN SLRGFQ+I+  K+ +E+ CP VV
Sbjct  56    PLLRMHFHDCFVRGCDGSVLLNSTKNNPAEIDAFPNQSLRGFQVIEAAKSELEQKCPDVV  115

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILA+VARD  + +KGPYW V  GRRDG+VS M EALFNL PPFANIT LK  F   
Sbjct  116   SCADILALVARDAISLIKGPYWNVPLGRRDGKVSIMLEALFNLPPPFANITTLKAQFSSV  175

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
             GL+ KDLVVLSGGHTIG SHCSSFT R+YNFTGKGD+DP++D NY  +LK KC   +   
Sbjct  176   GLNAKDLVVLSGGHTIGNSHCSSFTSRIYNFTGKGDSDPTMDANYVARLKSKCTSNNDVK  235

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
              +VEMDPGS +TFD SY++L+AKRRGLF SDAALLDD ETKAY+  QA++HGSTFFKDF 
Sbjct  236   TIVEMDPGSFKTFDGSYYSLVAKRRGLFQSDAALLDDNETKAYVKLQAMSHGSTFFKDFA  295

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             ESM  MGRI VLTG  GEIRK C+ +N
Sbjct  296   ESMEKMGRISVLTGKAGEIRKHCSFIN  322



>ref|XP_007045601.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY01433.1| Peroxidase superfamily protein [Theobroma cacao]
Length=328

 Score =   419 bits (1077),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/301 (67%), Positives = 238/301 (79%), Gaps = 2/301 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             GL++G+Y +TCP  E I+++   + I+ AP+LA PLLRMHFHDCFVRGC+GSVLL+S   
Sbjct  29    GLKLGYYYKTCPKAESIIRKTTYRFISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKN  88

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EK A PN SL+GF +ID VK+AVEEACPGVVSCAD LA+VARD  + + GP+WEV  
Sbjct  89    SQSEKAAVPNLSLQGFHVIDAVKSAVEEACPGVVSCADTLALVARDSVSMIYGPFWEVPL  148

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS + E   NL  PFANIT LKQ F  KGLS+KDL VLSGGHTIG SHC++FT+
Sbjct  149   GRRDGRVSLLNEVFANLPSPFANITTLKQMFAVKGLSLKDLAVLSGGHTIGTSHCNAFTN  208

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RLYNFTGKGD DPS+DPNY  KLK KC + + T  LVEMDPGS + F+  YFTL+AKRRG
Sbjct  209   RLYNFTGKGDTDPSMDPNYIVKLKKKC-KPADTTTLVEMDPGSFKNFEEDYFTLVAKRRG  267

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAALL+D+ETKAY++ Q+ THGSTF KDF ESMV MG++GVLTG QGEIRK C  V
Sbjct  268   LFQSDAALLNDKETKAYVILQSSTHGSTFGKDFAESMVKMGKVGVLTGHQGEIRKHCAVV  327

Query  1117  N  1119
             N
Sbjct  328   N  328



>ref|XP_011007637.1| PREDICTED: peroxidase 27-like [Populus euphratica]
Length=327

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 242/328 (74%), Gaps = 6/328 (2%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             K S  L    L+ LAF   + +A     L+VGFY+ TCP  E IVK + DQV+ VAPSL+
Sbjct  5     KLSSGLIFIHLVLLAFVFNSANAQ----LKVGFYKDTCPKAEAIVKRVMDQVLKVAPSLS  60

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             GPLLR+HFHDCFVRGC+ S+LL+S T Q EKD+PPN SLRG+Q+ID+VK A+E+ CPGVV
Sbjct  61    GPLLRLHFHDCFVRGCDASILLNSSTGQAEKDSPPNLSLRGYQVIDRVKAALEKNCPGVV  120

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILAIVARDVTAA  GP W VETGRRDGRVSN +E L NL P FANI+ L   F  K
Sbjct  121   SCADILAIVARDVTAATLGPSWRVETGRRDGRVSNFSEPLTNLPPFFANISQLLTQFRSK  180

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
              LS KDLVVLSG HT+G SHCSSF  RLYNFTGKGD DP+LD  Y  +LK  C +     
Sbjct  181   NLSKKDLVVLSGAHTLGTSHCSSFDSRLYNFTGKGDTDPTLDSEYITRLKKIC-KAGDQI  239

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKDF  1035
              LVEMDPG VRTFD SY+ L+A RR LF SDAALLD+  TKAY+ +Q   T GSTFFKDF
Sbjct  240   TLVEMDPGGVRTFDNSYYKLVANRRALFQSDAALLDNNYTKAYVKLQSVATDGSTFFKDF  299

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             G SM  MGR+ VLTG  GEIRKVC+ VN
Sbjct  300   GVSMRKMGRVEVLTGKAGEIRKVCSKVN  327



>gb|EYU24791.1| hypothetical protein MIMGU_mgv1a010031mg [Erythranthe guttata]
Length=324

 Score =   418 bits (1074),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 244/328 (74%), Gaps = 12/328 (4%)
 Frame = +1

Query  154   LSLEILIFLA----FACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
              S +IL+FL     F  CN       GL++GFY++TCP  E IVK+    ++AVAP+LA 
Sbjct  3     FSKQILVFLVLVGIFNLCNAQ-----GLKLGFYKKTCPTAEAIVKKETASIMAVAPTLAA  57

Query  322   PLLRMHFHDCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             P+LRMHFHDCFVRGC+ S+LL+S T  Q EKD+ PN SLRG+  ID+VK+AVE+ CPGVV
Sbjct  58    PILRMHFHDCFVRGCDASILLNSTTNNQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVV  117

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILA+VARD  + + G  W V  GRRDG VSN TEALFNL PPF NIT LK  F  K
Sbjct  118   SCADILALVARDAVSFLNGASWPVPLGRRDGNVSNSTEALFNLPPPFFNITQLKASFASK  177

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
             GL+ KDLVVLSGGHTIG SHCSSFT+RLYNFTG GD+DPSLD NY  +LK +C   + T 
Sbjct  178   GLNAKDLVVLSGGHTIGTSHCSSFTNRLYNFTGVGDSDPSLDSNYVARLKTRC-SATDTT  236

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST-FFKDF  1035
              LVEMDPGS +TFDT Y+TL+AKRRGLFTSDAALL D ET+AY+   A   GS  F KDF
Sbjct  237   TLVEMDPGSFKTFDTEYYTLVAKRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDF  296

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              +SMV MG+IGVLTG QGEIRK C  +N
Sbjct  297   AKSMVKMGKIGVLTGSQGEIRKTCGFIN  324



>ref|XP_006356926.1| PREDICTED: peroxidase 56-like [Solanum tuberosum]
Length=337

 Score =   418 bits (1074),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 201/327 (61%), Positives = 241/327 (74%), Gaps = 6/327 (2%)
 Frame = +1

Query  142   FSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
             +S   +  +L+      CN       GL++G+YE+TCP  E IV++     I+ AP+LA 
Sbjct  16    YSLIFTQLVLMLAIIPICNAQ-----GLKLGYYEKTCPGAEAIVEKTTSHYISRAPTLAA  70

Query  322   PLLRMHFHDCFVRGCEGSVLLDSPTKQ-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             PLLRMHFHDCF+RGC+GSVLL+S      E DA PN SLRGFQ+I+  K+ +E+ CPGVV
Sbjct  71    PLLRMHFHDCFIRGCDGSVLLNSTKNNLAEIDAIPNQSLRGFQVIEAAKSELEQKCPGVV  130

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILA+VARD  + +KGPYW V  GRRDG+VS M EALFNL PPFANIT LK  F   
Sbjct  131   SCADILALVARDAISLIKGPYWNVPLGRRDGKVSIMLEALFNLPPPFANITTLKAQFASV  190

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
             GL+ KDLVVLSGGHTIG SHCSSFT R+YNFTGKGD DP++D NY  +LK KC   +   
Sbjct  191   GLNAKDLVVLSGGHTIGNSHCSSFTSRIYNFTGKGDTDPTMDANYVARLKSKCTSINDVK  250

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
              +VEMDPGS + FD SY++L+ KRRGLF SDAALLDD ETKAY+  QA++HGSTFFKDF 
Sbjct  251   TIVEMDPGSFKIFDGSYYSLVEKRRGLFQSDAALLDDNETKAYVKLQAMSHGSTFFKDFA  310

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             ESM  MGRIGVLTG  GEIRK C+ +N
Sbjct  311   ESMEKMGRIGVLTGKAGEIRKRCSFIN  337



>gb|EYU24792.1| hypothetical protein MIMGU_mgv1a009974mg [Erythranthe guttata]
Length=325

 Score =   417 bits (1073),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 242/324 (75%), Gaps = 3/324 (1%)
 Frame = +1

Query  154   LSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLR  333
              S +IL+FL      + +    GL++GFY++TCP  E IVK+    ++AVAP+LA P+LR
Sbjct  3     FSKQILVFLVLVGIFNISCNAQGLKLGFYKKTCPSAEAIVKKETASIMAVAPTLAAPILR  62

Query  334   MHFHDCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCAD  510
             MHFHDCFVRGC+ S+LL+S T  Q EKD+ PN SLRG+  ID+VK+AVE+ CPGVVSCAD
Sbjct  63    MHFHDCFVRGCDASILLNSTTNNQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCAD  122

Query  511   ILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSV  690
             ILA+VARD  + + G  W V  GRRDG VSN TE LFNL PPF NIT LK  F  KGL+ 
Sbjct  123   ILALVARDAVSLLNGASWPVPLGRRDGNVSNSTEVLFNLPPPFFNITQLKANFASKGLNA  182

Query  691   KDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVE  870
             KDLVVLSGGHTIG SHCSSFT+RLYNFTG GD+DPSLD NY  +LK +C   + T  LVE
Sbjct  183   KDLVVLSGGHTIGTSHCSSFTNRLYNFTGVGDSDPSLDSNYVARLKTRC-SATDTTTLVE  241

Query  871   MDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST-FFKDFGESM  1047
             MDPGS +TFDT Y+TL+AKRRGLFTSDAALL D ET+AY+   A   GS  F KDF +SM
Sbjct  242   MDPGSFKTFDTEYYTLVAKRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSM  301

Query  1048  VNMGRIGVLTGDQGEIRKVCTAVN  1119
             V MG+IGVLTG QGEIRK C  +N
Sbjct  302   VKMGKIGVLTGSQGEIRKTCGFIN  325



>ref|XP_010048945.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
Length=327

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 238/300 (79%), Gaps = 1/300 (0%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++ CP+ E IVKE+  QV+++ PSL+GP+LR+HFHDCFVRGCEGSVLL+SPT 
Sbjct  29    GLKVGFYQKACPNAEAIVKEVIGQVLSIDPSLSGPILRLHFHDCFVRGCEGSVLLESPTY  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK A     LRG+Q ID+VKTA+E+ACPG+VSCADILA+V RD+  A  G +++VETG
Sbjct  89    QSEKYAIRKLGLRGYQEIDRVKTALEKACPGIVSCADILALVTRDIVVATGGLFYDVETG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS + EA  +L+PP  NIT LK  F  +GLS KDLVVLSGGHTIG SHC++F++R
Sbjct  149   RRDGYVSILEEARRDLIPPSTNITTLKADFAKRGLSAKDLVVLSGGHTIGNSHCAAFSNR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGDADP+LD NY  +LK+ C     T  LVEMDPGS RTFD  YF LI KRRGL
Sbjct  209   LYNFTGKGDADPTLDSNYIARLKLSCKPNDQT-TLVEMDPGSARTFDIKYFDLILKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSDAALLDD++TKAYL  Q  T GSTFFKDFG SMV MGRIGVLT   GE+RKVCT VN
Sbjct  268   FTSDAALLDDKQTKAYLDFQIKTGGSTFFKDFGVSMVKMGRIGVLTKTAGEVRKVCTKVN  327



>ref|XP_010035573.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
Length=326

 Score =   416 bits (1070),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/323 (64%), Positives = 243/323 (75%), Gaps = 6/323 (2%)
 Frame = +1

Query  160   LEILIF-LAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRM  336
             L +L+F LA            GL++GFY+ TCP  E IVK+ A   I+ APSLA PLLRM
Sbjct  7     LSLLVFQLALVAFILDVANAQGLKIGFYKNTCPQAEEIVKKAAASFISRAPSLAAPLLRM  66

Query  337   HFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADI  513
             HFHDCFVRGC+GSVLL+S  + Q EKDA PN SLRG+Q+I+  K A+E+ CPGVVSCADI
Sbjct  67    HFHDCFVRGCDGSVLLNSTSSNQAEKDAFPNLSLRGYQVIEAAKDALEKKCPGVVSCADI  126

Query  514   LAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVK  693
             LA+VARD  + M GPYW+V TGRRDGRVS + +AL NL  P  +I+ LK  F  KGLSVK
Sbjct  127   LALVARDAVSMMNGPYWQVPTGRRDGRVSKLQDALNNLPAPTFSISALKSSFAAKGLSVK  186

Query  694   DLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKC-PEESPTDNLVE  870
             DL VLSGGHT+G+SHCSSFT+RLYNFTGK DADPS+DPNY  +LK KC P ++ T  +VE
Sbjct  187   DLAVLSGGHTLGMSHCSSFTNRLYNFTGKNDADPSMDPNYVAQLKTKCKPNDATT--IVE  244

Query  871   MDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMV  1050
             MDPGS +TFD  Y+TL++KRRGLF SDAALL D  TK+Y VQ  LT  STF KDFG SMV
Sbjct  245   MDPGSAKTFDVDYYTLVSKRRGLFQSDAALLTDSTTKSY-VQLQLTSKSTFAKDFGVSMV  303

Query  1051  NMGRIGVLTGDQGEIRKVCTAVN  1119
             NMG +GVLTG+ GEIRK C  VN
Sbjct  304   NMGNVGVLTGNSGEIRKKCYLVN  326



>ref|XP_004293253.1| PREDICTED: peroxidase 27-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   416 bits (1068),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/321 (66%), Positives = 247/321 (77%), Gaps = 9/321 (3%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             I++     C N       GL+VGFY ++CP  E IVK++  Q ++VAPSL GPLLRMHFH
Sbjct  15    IVLLSVLDCANAQ-----GLKVGFYAKSCPEAEAIVKKVIAQTLSVAPSLGGPLLRMHFH  69

Query  346   DCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIV  525
             DCFVRGC+GSVLL+S + Q EKDA PN SLRG+ IID+VK+A+E+ACPGVVSC+DILA+V
Sbjct  70    DCFVRGCDGSVLLNSSSNQAEKDAIPNLSLRGYGIIDRVKSALEKACPGVVSCSDILAVV  129

Query  526   ARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVV  705
             ARDV  A  G +W+VETGRRDG VSNM +AL NL  P +NI+ LK  F  KGLS KDLVV
Sbjct  130   ARDVVVADMGVHWDVETGRRDGNVSNMIDALRNLPAPTSNISSLKSSFASKGLSAKDLVV  189

Query  706   LSGGHTIGISHCSSFTDRLYNFTGK--GDADPSLDPNYAEKLKMKCPEESPTDNLVEMDP  879
             LSG HTIG SHCSSFT+RLYNFTGK   D DP+LD NY  KLKMKC     T  LVEMDP
Sbjct  190   LSGSHTIGTSHCSSFTNRLYNFTGKNVNDTDPTLDSNYIAKLKMKCKPNDQT-TLVEMDP  248

Query  880   GSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHG-STFFKDFGESMVNM  1056
             GS +TFD SY+TL+AKRRGLF SDAALLDD ETKAY+   A+  G ++F KDFG SMVNM
Sbjct  249   GSFKTFDGSYYTLVAKRRGLFQSDAALLDDSETKAYVTSHAVPKGEASFLKDFGVSMVNM  308

Query  1057  GRIGVLTGDQGEIRKVCTAVN  1119
             GRIGVLTG+ GEIRKVC+ +N
Sbjct  309   GRIGVLTGNAGEIRKVCSKIN  329



>ref|XP_008230092.1| PREDICTED: peroxidase 27-like [Prunus mume]
Length=327

 Score =   414 bits (1065),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 233/300 (78%), Gaps = 2/300 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L+VGFY +TCP++E IV +   Q I+ AP+LA PLLRMHFHDCFVRGC+GSVLL+S  + 
Sbjct  29    LKVGFYHKTCPNIEAIVAKTTQQYISRAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTSSN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDA PN SLRGF +ID VK+AVE+ CPGVVSCADILA+VARD    + G +WEV TG
Sbjct  89    SAEKDAFPNQSLRGFHVIDAVKSAVEKKCPGVVSCADILALVARDAVRMLHGSFWEVPTG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS  +EAL  L  P ANIT LK  F  KGLSVKDLVVLSGGHTIG SHC  F+ R
Sbjct  149   RRDGRVSVNSEALRGLPAPSANITQLKATFASKGLSVKDLVVLSGGHTIGTSHCGPFSSR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LD NY  +LK+KC +   T  LVEMDPGS ++FD  Y+TL+ KRRGL
Sbjct  209   LYNFTGKGDTDPKLDKNYLAQLKIKC-KPGDTKTLVEMDPGSFKSFDEDYYTLVTKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F SD+ALLDD ET+AY++QQA +HG+TF KDFG SMVNMG IGVLTG+ GEIRK C  VN
Sbjct  268   FQSDSALLDDPETRAYVIQQATSHGATFLKDFGASMVNMGNIGVLTGNSGEIRKQCAFVN  327



>gb|EYU33918.1| hypothetical protein MIMGU_mgv1a010413mg [Erythranthe guttata]
Length=313

 Score =   414 bits (1064),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 206/313 (66%), Positives = 244/313 (78%), Gaps = 14/313 (4%)
 Frame = +1

Query  181   AFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVR  360
             +FA     A G G L+VGFY    P+LEP++K++  +VI+   +LA PL RMHFHDCF+R
Sbjct  15    SFAILIFQANGQG-LKVGFYPYKWPNLEPVIKDVIYKVISEDRTLAPPLQRMHFHDCFIR  73

Query  361   GCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVT  540
             GCEGS LL+SPTKQ EKDA PN +LRGFQI+DKVK AVE+AC G VS ADI+        
Sbjct  74    GCEGSFLLESPTKQAEKDAFPNLTLRGFQILDKVKLAVEKACSGDVSSADIM--------  125

Query  541   AAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGH  720
                 GP+WEVETGR+DG+VS + EAL  L+PP ANI+ LK+GF D+GL++KDLVVLSG H
Sbjct  126   ----GPFWEVETGRKDGKVSILNEALTGLIPPSANISTLKKGFADRGLNMKDLVVLSGSH  181

Query  721   TIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFD  900
             TIGISHCSSF++RLYNFTGK DADP+LD  YA KLK KC +    +++VEMDPGS +TFD
Sbjct  182   TIGISHCSSFSNRLYNFTGKNDADPTLDSEYAAKLKQKC-KPGDQNSIVEMDPGSFKTFD  240

Query  901   TSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTG  1080
              SYFTL+AKRRGLF SDAALL+D ETKAYL  QAL  G TFFKDFGESMV MGRIGV+TG
Sbjct  241   VSYFTLVAKRRGLFESDAALLNDGETKAYLKFQALNKGPTFFKDFGESMVKMGRIGVITG  300

Query  1081  DQGEIRKVCTAVN  1119
             + GEIRKVCT VN
Sbjct  301   EGGEIRKVCTKVN  313



>ref|XP_010048943.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
 gb|KCW81368.1| hypothetical protein EUGRSUZ_C02751 [Eucalyptus grandis]
Length=327

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/299 (69%), Positives = 235/299 (79%), Gaps = 1/299 (0%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L+VGFY + CP+ E IVKE+  Q+++VAPSL+GPLLR+HFHDCFVRGCEGSVLLDSPT Q
Sbjct  30    LKVGFYGKACPNAEAIVKEVIGQILSVAPSLSGPLLRLHFHDCFVRGCEGSVLLDSPTYQ  89

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EK A     LRG+Q ID+VKTA+E+ACPG+VSCADILA+VARDV  A  G +++VETGR
Sbjct  90    SEKYAFRKHGLRGYQEIDRVKTALEKACPGIVSCADILALVARDVVVATGGLFYDVETGR  149

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDG VS   EA  +L+PP ANIT LK  F  +GLS KDLV+LSGGHTIG SHCS F++RL
Sbjct  150   RDGYVSISEEARRDLIPPTANITTLKADFAKRGLSAKDLVILSGGHTIGNSHCSPFSNRL  209

Query  763   YNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLF  942
             YNFTGKGDADP+LD NY  +LK+ C     T  LVEMDPGS RTFD  YF LI KRRGLF
Sbjct  210   YNFTGKGDADPTLDSNYIARLKLSCKPNDQT-TLVEMDPGSARTFDIKYFDLILKRRGLF  268

Query  943   TSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             TSDAALLDD +TKAYL  Q  T GSTFFKDFG SMV MGRIGVL    GE+RKVCT VN
Sbjct  269   TSDAALLDDNQTKAYLDFQIKTGGSTFFKDFGVSMVKMGRIGVLPKMAGEVRKVCTKVN  327



>ref|XP_002304934.1| hypothetical protein POPTR_0004s02240g [Populus trichocarpa]
 gb|EEE85445.1| hypothetical protein POPTR_0004s02240g [Populus trichocarpa]
Length=327

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 240/328 (73%), Gaps = 6/328 (2%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             K S  L    L+ LAF   + +A     L+VGFY+ TCP  E IVK + DQV+ VAPSL+
Sbjct  5     KLSSGLIFIQLVLLAFVFNSANAQ----LKVGFYKDTCPQAEAIVKGVMDQVLKVAPSLS  60

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             GPLLR+HFHDCFVRGC+ S+LL+S T Q EKD+PPN SLRG+Q+ID+VK A+E+ CPGVV
Sbjct  61    GPLLRLHFHDCFVRGCDASILLNSSTGQAEKDSPPNLSLRGYQVIDRVKAALEKKCPGVV  120

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILAIVARDVT A  GP W VETGRRDGRVSN++E L NL P FANI+ L   F  K
Sbjct  121   SCADILAIVARDVTVATLGPSWRVETGRRDGRVSNVSEPLTNLPPFFANISQLLTQFRSK  180

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
              LS KDLVVLSG HTIG SHCSSF  RLYNFTGKGD DP+LD  Y  +LK  C +     
Sbjct  181   NLSKKDLVVLSGAHTIGTSHCSSFDSRLYNFTGKGDTDPTLDSEYITRLKKIC-KAGDQI  239

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKDF  1035
              LVEMDPG  RTFD  Y+ L+A RR LF SDAALLD+  TKAY+ +Q   + GSTFFKDF
Sbjct  240   TLVEMDPGGARTFDNRYYKLVANRRALFQSDAALLDNNYTKAYVKLQSVASDGSTFFKDF  299

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             G SM  MGR+ VLTG  GEIRKVC+ VN
Sbjct  300   GVSMRKMGRVEVLTGKAGEIRKVCSKVN  327



>ref|XP_006447517.1| hypothetical protein CICLE_v10017908mg [Citrus clementina]
 ref|XP_006469708.1| PREDICTED: peroxidase 27-like [Citrus sinensis]
 gb|ESR60757.1| hypothetical protein CICLE_v10017908mg [Citrus clementina]
Length=328

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/321 (64%), Positives = 242/321 (75%), Gaps = 9/321 (3%)
 Frame = +1

Query  160   LEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMH  339
             + +L  L  A  +H      GL++GFY++TCP  E I ++I  Q I+ AP+LA PLLRMH
Sbjct  16    IHVLFILHLANADH------GLKLGFYQKTCPDAEAITRKITHQHISRAPTLAAPLLRMH  69

Query  340   FHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADIL  516
             FHDCF+RGC+GSVLL+S    Q EKDA  N SLRG+Q+ID VK+A+E  CPGVVSCADIL
Sbjct  70    FHDCFIRGCDGSVLLNSTKNNQAEKDAFANLSLRGYQVIDAVKSALENKCPGVVSCADIL  129

Query  517   AIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKD  696
             A+V RD  + +KGP+W+V TGRRDGR S  +E   +L PPF NIT+LKQ F  KGLSVKD
Sbjct  130   ALVTRDAVSMIKGPFWDVPTGRRDGRESVASETR-DLPPPFGNITLLKQKFAAKGLSVKD  188

Query  697   LVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMD  876
             LVVLSG HTIG SHCSSF  RLYNFTGKGD DP+LDPNY   LK KC +   T  LV+MD
Sbjct  189   LVVLSGAHTIGTSHCSSFETRLYNFTGKGDTDPTLDPNYVVHLKRKC-QPGDTTTLVKMD  247

Query  877   PGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNM  1056
             PGS RTFD  Y+TL+AKRRGLF SDAALL+D ETK+Y+  QA T+GSTF KDF ESMVNM
Sbjct  248   PGSFRTFDGDYYTLVAKRRGLFQSDAALLEDTETKSYVKLQANTYGSTFAKDFAESMVNM  307

Query  1057  GRIGVLTGDQGEIRKVCTAVN  1119
             G+IGVLTG  GEIRK C  VN
Sbjct  308   GKIGVLTGKAGEIRKHCAFVN  328



>ref|XP_007217744.1| hypothetical protein PRUPE_ppa008516mg [Prunus persica]
 gb|EMJ18943.1| hypothetical protein PRUPE_ppa008516mg [Prunus persica]
Length=328

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 202/301 (67%), Positives = 233/301 (77%), Gaps = 3/301 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L+VGFY +TCP+LE IV +     I+ AP+LA PLLR+HFHDCFVRGC+GSVLL+S  + 
Sbjct  29    LKVGFYHKTCPNLEAIVAKTTQHYISRAPTLAAPLLRLHFHDCFVRGCDGSVLLNSTASN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDA PN SLRGF +ID  K+AVE+ CPGVVSCADILA+VARD    + G +WEV TG
Sbjct  89    SAEKDAIPNLSLRGFHVIDAAKSAVEKKCPGVVSCADILALVARDAVRMLPGSFWEVPTG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS  +EAL  L  PFANIT LK  F  KGLSVKDLVVLSGGHTIG SHC SF+ R
Sbjct  149   RRDGRVSVNSEALRGLPSPFANITQLKAKFASKGLSVKDLVVLSGGHTIGTSHCDSFSSR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LD NY  +LK KC +   T  LVEMDPGS ++FD  Y+TL+AKRRGL
Sbjct  209   LYNFTGKGDTDPKLDKNYIARLKKKC-KPGDTKTLVEMDPGSFKSFDEDYYTLVAKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTH-GSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             F SD+ALLDD ET+AY++QQA +H G+TF KDFG SMVNMG IGVLTG+ GEIRK C  V
Sbjct  268   FHSDSALLDDPETRAYVIQQATSHGGATFLKDFGASMVNMGNIGVLTGNSGEIRKQCALV  327

Query  1117  N  1119
             N
Sbjct  328   N  328



>ref|XP_002274157.2| PREDICTED: peroxidase 27-like [Vitis vinifera]
Length=328

 Score =   413 bits (1061),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 241/333 (72%), Gaps = 7/333 (2%)
 Frame = +1

Query  124   ISKMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAV  303
             +S    FS +    IL  L     N        L++GFY++TCP  E IV++   Q I+ 
Sbjct  1     MSSQKLFSAFFLQVILATLVLGVANVQC-----LKLGFYKKTCPAAEDIVRKTTAQYISK  55

Query  304   APSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEE  480
             AP+LA PLLRMHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRG+ +ID  K+AVE+
Sbjct  56    APTLAAPLLRMHFHDCFVRGCDGSVLLNSTKNNQAEKDAIPNLSLRGYHVIDAAKSAVEK  115

Query  481   ACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLK  660
              CPGVVSCADILA+VARD  + + GPYW+V TGRRDG+VS   EAL NL PPFANIT LK
Sbjct  116   KCPGVVSCADILALVARDAVSMINGPYWKVPTGRRDGKVSVALEALINLPPPFANITQLK  175

Query  661   QGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCP  840
               F  KGLSVKDLVVLSGGHTIGISHCSSFT+RLYNFTGKGD DPS+DPNY  +LK KC 
Sbjct  176   SMFHSKGLSVKDLVVLSGGHTIGISHCSSFTNRLYNFTGKGDTDPSMDPNYVIQLKKKCR  235

Query  841   EESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST  1020
                 T  +VEMDPGS +TFD  Y+T++AKRRGLF SD ALLDD +T+ Y+   + +HG +
Sbjct  236   PGDVT-TIVEMDPGSFKTFDGDYYTMVAKRRGLFQSDVALLDDVQTRKYVKLHSFSHGKS  294

Query  1021  FFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F KDF  SMV MG++GVLTG  G IRK C  VN
Sbjct  295   FGKDFAASMVKMGKVGVLTGKAGGIRKYCAFVN  327



>ref|XP_002304933.2| hypothetical protein POPTR_0004s02230g [Populus trichocarpa]
 gb|EEE85444.2| hypothetical protein POPTR_0004s02230g [Populus trichocarpa]
 gb|AHL39130.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   412 bits (1060),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 243/328 (74%), Gaps = 6/328 (2%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             K S  L    L+ LAF   + +A     L+VGFY+ TCP  E IVK + DQV+ VAPSL+
Sbjct  5     KLSSGLIFIQLVLLAFVFNSANAQ----LKVGFYKDTCPQAEAIVKGVMDQVLKVAPSLS  60

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             GPLLR+HFHDCFVRGC+ S+LL+S   Q EKD+PPN SLRG+Q+ID+VK A+E+ CPGVV
Sbjct  61    GPLLRLHFHDCFVRGCDASILLNSCAGQAEKDSPPNLSLRGYQVIDRVKAALEKKCPGVV  120

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILAIVARDVTAA  GP W VETGRRDGRVSN++E + NL P FANI+ L   F  K
Sbjct  121   SCADILAIVARDVTAATLGPSWRVETGRRDGRVSNISEPITNLPPFFANISQLLTQFRSK  180

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
              LS KDLVVLSG HT+G SHCSSF  RLYNFTGKGD DP+LD  Y  +LK  C +     
Sbjct  181   NLSKKDLVVLSGAHTLGTSHCSSFDSRLYNFTGKGDTDPTLDSEYIARLKKIC-KAGDQI  239

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDF  1035
              LVEMDPG VRTFD SY+ L+A RR LF SDAALLD+  TKAY+  Q++ + GSTFFKDF
Sbjct  240   TLVEMDPGGVRTFDNSYYKLVANRRALFHSDAALLDNNYTKAYVKLQSVESDGSTFFKDF  299

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             G SM  MGR+ VLTG  GEIRKVC+ VN
Sbjct  300   GVSMRKMGRVEVLTGKAGEIRKVCSKVN  327



>ref|NP_186768.1| peroxidase 27 [Arabidopsis thaliana]
 sp|Q43735.1|PER27_ARATH RecName: Full=Peroxidase 27; Short=Atperox P27; AltName: Full=ATP12a; 
AltName: Full=PRXR7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF26155.1|AC008261_12 putative peroxidase [Arabidopsis thaliana]
 emb|CAA66963.1| peroxidase [Arabidopsis thaliana]
 emb|CAA67311.1| peroxidase ATP12a [Arabidopsis thaliana]
 gb|AAL32888.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAM10135.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAM65216.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEE73623.1| peroxidase 27 [Arabidopsis thaliana]
Length=321

 Score =   412 bits (1059),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/331 (62%), Positives = 239/331 (72%), Gaps = 12/331 (4%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MA   R +   + + L FA  N       GL+VGFY +TCP LE IVK++    +  AP+
Sbjct  1     MAASKRLVVSCLFLVLLFAQANSQ-----GLKVGFYSKTCPQLEGIVKKVVFDAMNKAPT  55

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPG  492
             L  PLLRM FHDCFVRGC+GSVLLD P  QGEK A PN SLRGF IID  K A+E+ CPG
Sbjct  56    LGAPLLRMFFHDCFVRGCDGSVLLDKPNNQGEKSAVPNLSLRGFGIIDDSKAALEKVCPG  115

Query  493   VVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFF  672
             +VSC+DILA+VARD   A++GP WEVETGRRDGRVSN+ E   NL  PF NIT L   F 
Sbjct  116   IVSCSDILALVARDAMVALEGPSWEVETGRRDGRVSNINEV--NLPSPFDNITKLISDFR  173

Query  673   DKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESP  852
              KGL+ KDLV+LSGGHTIG+ HC   T+RLYNFTGKGD+DPSLD  YA KL+ KC    P
Sbjct  174   SKGLNEKDLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDSEYAAKLRKKC---KP  230

Query  853   TDNL--VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFF  1026
             TD    +EMDPGS +TFD SYFTL+AKRRGLF SDAALLD+ +T+AY++QQ  THGS FF
Sbjct  231   TDTTTALEMDPGSFKTFDLSYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQIRTHGSMFF  290

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              DFG SMV MGR GVLTG  GEIRK C + N
Sbjct  291   NDFGVSMVKMGRTGVLTGKAGEIRKTCRSAN  321



>gb|AHL39131.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/328 (63%), Positives = 240/328 (73%), Gaps = 6/328 (2%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             K S  L    L+ LAF   + +A     L+VGFY+ TCP  E IVK + DQV+ VAPSL+
Sbjct  5     KLSSGLIFIQLVLLAFVFNSANAQ----LKVGFYKDTCPQAEAIVKGVMDQVLKVAPSLS  60

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             GPLLR+HFHDCFVRGC+ S+LL+S T Q EKD+PPN SLRG+Q+ID+VK A+E+ CPGVV
Sbjct  61    GPLLRLHFHDCFVRGCDASILLNSSTGQAEKDSPPNLSLRGYQVIDRVKAALEKKCPGVV  120

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILAIVARDVT A  GP W VETGRRDGRVSN++E L NL P FANI+ L   F  K
Sbjct  121   SCADILAIVARDVTVATLGPSWRVETGRRDGRVSNVSEPLTNLPPFFANISQLLTQFRSK  180

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
              LS KDLVVLSG HTIG SHCSSF  RLY+FTGKGD DP+LD  Y  +LK  C +     
Sbjct  181   NLSKKDLVVLSGAHTIGTSHCSSFDSRLYDFTGKGDTDPTLDSEYITRLKKIC-KAGDQI  239

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYL-VQQALTHGSTFFKDF  1035
              LVEMDPG  RTFD  Y+ L+A RR LF SDAALLD+  TKAY+ +Q   + GSTFFKDF
Sbjct  240   TLVEMDPGGARTFDNRYYKLVANRRALFQSDAALLDNNYTKAYVKLQSVASDGSTFFKDF  299

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             G SM  MGR+ VLTG  GEIRKVC+ VN
Sbjct  300   GVSMRKMGRVEVLTGKAGEIRKVCSKVN  327



>emb|CBI28955.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 241/333 (72%), Gaps = 7/333 (2%)
 Frame = +1

Query  124   ISKMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAV  303
             +S    FS +    IL  L     N        L++GFY++TCP  E IV++   Q I+ 
Sbjct  1     MSSQKLFSAFFLQVILATLVLGVANVQC-----LKLGFYKKTCPAAEDIVRKTTAQYISK  55

Query  304   APSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEE  480
             AP+LA PLLRMHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRG+ +ID  K+AVE+
Sbjct  56    APTLAAPLLRMHFHDCFVRGCDGSVLLNSTKNNQAEKDAIPNLSLRGYHVIDAAKSAVEK  115

Query  481   ACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLK  660
              CPGVVSCADILA+VARD  + + GPYW+V TGRRDG+VS   EAL NL PPFANIT LK
Sbjct  116   KCPGVVSCADILALVARDAVSMINGPYWKVPTGRRDGKVSVALEALINLPPPFANITQLK  175

Query  661   QGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCP  840
               F  KGLSVKDLVVLSGGHTIGISHCSSFT+RLYNFTGKGD DPS+DPNY  +LK KC 
Sbjct  176   SMFHSKGLSVKDLVVLSGGHTIGISHCSSFTNRLYNFTGKGDTDPSMDPNYVIQLKKKCR  235

Query  841   EESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST  1020
                 T  +VEMDPGS +TFD  Y+T++AKRRGLF SD ALLDD +T+ Y+   + +HG +
Sbjct  236   PGDVT-TIVEMDPGSFKTFDGDYYTMVAKRRGLFQSDVALLDDVQTRKYVKLHSFSHGKS  294

Query  1021  FFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F KDF  SMV MG++GVLTG  G IRK C A N
Sbjct  295   FGKDFAASMVKMGKVGVLTGKAGGIRKYCGARN  327



>gb|EYU24798.1| hypothetical protein MIMGU_mgv1a009213mg [Erythranthe guttata]
Length=349

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 240/324 (74%), Gaps = 3/324 (1%)
 Frame = +1

Query  154   LSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLR  333
              S +IL+FL      + +    GL++GFY++TCP  E IVK+    ++AVAP+LA P+LR
Sbjct  27    FSKQILVFLVLVGIFNISCNAQGLKLGFYKKTCPSAEAIVKKETASIMAVAPTLAAPILR  86

Query  334   MHFHDCFVRGCEGSVLLDSPTKQ-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCAD  510
             MHFHDCFVRGC+ S+LL+S T    EKD+ PN SLRG+  ID+VK+AVE+ CPGVVSCAD
Sbjct  87    MHFHDCFVRGCDASILLNSTTNNPAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCAD  146

Query  511   ILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSV  690
             ILA+VARD  + + G  W V  GRRDG VSN TE LFNL PPF NIT LK  F  KGL+ 
Sbjct  147   ILALVARDAVSLLNGASWPVPLGRRDGNVSNSTEVLFNLPPPFFNITQLKANFASKGLNA  206

Query  691   KDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVE  870
             KDLVVLSGGHTIG SHCSSFT+RLYNFTG GD+DPSLD NY  +LK +C   + T  LVE
Sbjct  207   KDLVVLSGGHTIGTSHCSSFTNRLYNFTGVGDSDPSLDSNYVARLKTRC-SATDTTTLVE  265

Query  871   MDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST-FFKDFGESM  1047
             MDPGS +TFD  Y+TL+AKRRGLFTSDAALL D ET+AY+   A   GS  F KDF +SM
Sbjct  266   MDPGSFKTFDIEYYTLVAKRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSM  325

Query  1048  VNMGRIGVLTGDQGEIRKVCTAVN  1119
             V MG+IGVLTG QGEIRK C  +N
Sbjct  326   VKMGKIGVLTGSQGEIRKTCAFIN  349



>ref|XP_002280216.1| PREDICTED: peroxidase 27 [Vitis vinifera]
Length=327

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/300 (65%), Positives = 233/300 (78%), Gaps = 2/300 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT-K  399
             L++GFY+ TCP  E IV+E   Q I+ AP+LA  LLR+HFHDCFVRGC+GSVLL+S    
Sbjct  29    LKLGFYKNTCPAAEDIVRETTAQYISKAPTLAASLLRIHFHDCFVRGCDGSVLLNSTKHN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDA PN SLRG+Q+ID  K+AVE+ CPGVVSCADILA+VARD  + + GPYW+V TG
Sbjct  89    QAEKDAIPNLSLRGYQVIDAAKSAVEKKCPGVVSCADILALVARDAVSMINGPYWQVPTG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG++S   EAL NL PPFANIT LK  F  KGLS+KDL VLSGGHTIGISHCSSFT+R
Sbjct  149   RRDGKLSVALEALTNLPPPFANITQLKAMFQSKGLSIKDLAVLSGGHTIGISHCSSFTNR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DPS+DPNY  +LK KC +      +VEMDPGS ++FD  Y++++AKRRGL
Sbjct  209   LYNFTGKGDTDPSMDPNYVIQLKKKC-KPGDVSTVVEMDPGSFKSFDEDYYSVVAKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F SDAALLDD ET  Y+  Q+ +HG +F +DF  SMV MGRIGVLTG+ GEIRK C  VN
Sbjct  268   FQSDAALLDDVETSKYVRLQSFSHGKSFGRDFAASMVKMGRIGVLTGNAGEIRKYCAFVN  327



>gb|EYU24797.1| hypothetical protein MIMGU_mgv1a010025mg [Erythranthe guttata]
Length=324

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/302 (66%), Positives = 234/302 (77%), Gaps = 3/302 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL++GFY++TCP +E IVK+    ++AVAP+LA P+LRMHFHDCFVRGCE S+LL+S T 
Sbjct  24    GLKLGFYKKTCPSVEAIVKKETASIMAVAPTLAAPILRMHFHDCFVRGCEASILLNSTTN  83

Query  400   -QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EKD+ PN SLRG+  ID+VK+AVE+ CPGVVSCADILA+VARD  + + G  W V  
Sbjct  84    NQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCADILALVARDAVSFLNGASWPVPL  143

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDG VSN TEALFNL PPF NIT LK  F  KGL+ KDLVVLSGGHTIG SHCSSFT+
Sbjct  144   GRRDGNVSNSTEALFNLPPPFFNITQLKASFASKGLNTKDLVVLSGGHTIGTSHCSSFTN  203

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RLYNFTG GD+DPSLD NY  +LK +C   + T  LVEMDPGS +TFD  Y++++AKRRG
Sbjct  204   RLYNFTGVGDSDPSLDSNYVARLKRRC-SATDTTTLVEMDPGSFKTFDIEYYSVVAKRRG  262

Query  937   LFTSDAALLDDEETKAYLVQQALTHGST-FFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             LFTSDAALL D ET+AY+   A   GS  F KDF +SMV MG+IGVLTG QGEIRK C  
Sbjct  263   LFTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSMVKMGKIGVLTGSQGEIRKTCGF  322

Query  1114  VN  1119
             VN
Sbjct  323   VN  324



>gb|EYU24795.1| hypothetical protein MIMGU_mgv1a021569mg [Erythranthe guttata]
Length=304

 Score =   409 bits (1050),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 233/301 (77%), Gaps = 3/301 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK-  399
             L++GFY++TCP +E IVK+    +++VAP+LA P+LRMHFHDCFVRGC+ S+LL+S T  
Sbjct  5     LKLGFYKKTCPSVEAIVKKETANIMSVAPTLAAPILRMHFHDCFVRGCDASILLNSTTNN  64

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKD+ PN SLRG+  ID+VK+AVE+ CPGVVSCADILA+VARD  + + G  W V  G
Sbjct  65    QAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVSCADILALVARDAVSFLNGASWPVPLG  124

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VSN TE LFNL PPF NIT LK  F  KGL+ KDLVVLSGGHTIG SHCSSFT+R
Sbjct  125   RRDGNVSNSTETLFNLPPPFFNITQLKASFASKGLNAKDLVVLSGGHTIGTSHCSSFTNR  184

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTG GD+DPSLD NY  +LK +C   + T  LVEMDPGS +TFDT Y+TL+AKRRGL
Sbjct  185   LYNFTGVGDSDPSLDSNYVARLKTRC-SATDTTTLVEMDPGSFKTFDTEYYTLVAKRRGL  243

Query  940   FTSDAALLDDEETKAYLVQQALTHGST-FFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             FTSDAALL D ET+AY+   A   GS  F KDF +SMV MG+IGVLTG QGEIRK C  +
Sbjct  244   FTSDAALLADSETRAYVTSHATPQGSKDFLKDFAKSMVKMGKIGVLTGSQGEIRKTCGFI  303

Query  1117  N  1119
             N
Sbjct  304   N  304



>ref|XP_002882194.1| peroxidase 27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58453.1| peroxidase 27 [Arabidopsis lyrata subsp. lyrata]
Length=321

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/331 (61%), Positives = 240/331 (73%), Gaps = 12/331 (4%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MA   R +   + + L FA          GL+VGFY +TCP +E IV+++    +  AP+
Sbjct  1     MAASKRLVVSCLFLVLLFAQAKSQ-----GLKVGFYSKTCPQVEGIVRKVVFDAMKKAPT  55

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPG  492
             +  PLLRM FHDCFVRGC+GS+LLD P  QGEK A PN SLRGF IID  K A+E+ CPG
Sbjct  56    VGAPLLRMFFHDCFVRGCDGSILLDKPNNQGEKSAVPNLSLRGFGIIDDSKAALEKVCPG  115

Query  493   VVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFF  672
             +VSC+D+LA++ARD   A++GP WEVETGRRDGRVSN+ E   NL  PF NIT L   F 
Sbjct  116   IVSCSDVLALIARDAMVALEGPSWEVETGRRDGRVSNINEV--NLPSPFDNITKLINDFR  173

Query  673   DKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESP  852
              KGL+ KDLVVLSGGHTIG+ HC   T+RLYNFTGKGD+DPSLD  YA KL+ KC    P
Sbjct  174   AKGLNEKDLVVLSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDTEYAAKLRQKC---KP  230

Query  853   TDNL--VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFF  1026
             TD    +EMDPGS +TFD SYFTL+AKRRGLF SDAALLD+ +T+AY++QQA THGS FF
Sbjct  231   TDTTTALEMDPGSFKTFDVSYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQARTHGSMFF  290

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              DFG SMV MGRIGVLTG  GEIRK C + N
Sbjct  291   SDFGVSMVKMGRIGVLTGQAGEIRKTCRSAN  321



>ref|XP_009353257.1| PREDICTED: peroxidase 27-like [Pyrus x bretschneideri]
Length=327

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 209/327 (64%), Positives = 237/327 (72%), Gaps = 7/327 (2%)
 Frame = +1

Query  142   FSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
              S +L   +L+ LA    N        L+VGFY +TCP LE IV     Q I+ AP+LA 
Sbjct  7     ISVFLLQVLLVSLALDSSNAQK-----LKVGFYCKTCPDLEAIVSRTTHQYISRAPTLAA  61

Query  322   PLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
             P+LRMHFHDCFVRGC+GSVLL+S P  Q EK A PN SLRGF +ID VK+AVE+ CPGVV
Sbjct  62    PILRMHFHDCFVRGCDGSVLLNSTPNSQAEKGAVPNQSLRGFDVIDAVKSAVEKKCPGVV  121

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCADILA+V RD    + G +WEV TGRRDGRVS  +EA   L PPFANIT LK  F  K
Sbjct  122   SCADILALVTRDAVRMVHGSFWEVPTGRRDGRVSLASEANRGLPPPFANITQLKALFAAK  181

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
             GLS KDL VLSGGHTIG SHC SFT+RLYNFTGKGD DP LD NY  +LK KC +   T 
Sbjct  182   GLSAKDLAVLSGGHTIGTSHCPSFTNRLYNFTGKGDTDPKLDKNYIAQLKTKC-KPGDTT  240

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
             + VEMDPGS +TFD  Y+TL+AKRRGLF SD+ALLDD ETKAY+ +QA T GSTF  DFG
Sbjct  241   SRVEMDPGSFKTFDEDYYTLVAKRRGLFQSDSALLDDTETKAYVTKQATTRGSTFLTDFG  300

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMVNMG IGVLTG+ GEIRK C  VN
Sbjct  301   VSMVNMGNIGVLTGNNGEIRKHCAFVN  327



>ref|XP_008379619.1| PREDICTED: peroxidase 27-like [Malus domestica]
Length=327

 Score =   408 bits (1048),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 228/300 (76%), Gaps = 2/300 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L+VGFY +TCP LE IV     Q I+ A +LA P+LRMHFHDCFVRGC+GSVLL+S P  
Sbjct  29    LKVGFYYKTCPDLEAIVARTTYQYISRASTLAAPILRMHFHDCFVRGCDGSVLLNSTPNS  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGF +ID VK+AVE+ CPGVVSCADILA+VARD    + G +WEV TG
Sbjct  89    QAEKEAIPNQSLRGFHVIDAVKSAVEKKCPGVVSCADILALVARDAVRMVHGSFWEVPTG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS  +EA   L PPFA+IT LK  F  KGLS KDL VLSGGHTIG SHC SFT+R
Sbjct  149   RRDGRVSLASEANRGLPPPFADITQLKAIFAAKGLSAKDLAVLSGGHTIGTSHCPSFTNR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LD NY  +LK KC +   T NLVEMDPGS +TFD  Y+TL+ +RRGL
Sbjct  209   LYNFTGKGDTDPKLDKNYIARLKTKC-KPGDTTNLVEMDPGSFKTFDEDYYTLVTQRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F SD+ALLDD ETKAY+ +QA T GSTF  DFG SMVNMG IGVLTG  GEIRK C  VN
Sbjct  268   FQSDSALLDDTETKAYVTKQATTRGSTFLTDFGVSMVNMGNIGVLTGKNGEIRKQCAFVN  327



>ref|XP_010551859.1| PREDICTED: peroxidase 27-like [Tarenaya hassleriana]
Length=368

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 241/325 (74%), Gaps = 3/325 (1%)
 Frame = +1

Query  145   SRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             S+ +SL   + L    C    T   GL++ FY++TCP  E IV++I    I  AP+LA P
Sbjct  47    SKIVSLLFFLQLISLLCFSVQTDAKGLKLRFYDKTCPKAELIVRKIVSDAIKKAPTLAAP  106

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRM FHDCFVRGC+GSVLLD P  +GEK A PN SLRGF IIDK K A+E+ CPG+VSC
Sbjct  107   LLRMFFHDCFVRGCDGSVLLDRP--KGEKSAIPNLSLRGFHIIDKAKKALEKECPGIVSC  164

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +DILA+V+RD  AA+ GP+WEVETGRRDGRV++  EAL NL  PF +++ L   F  KGL
Sbjct  165   SDILALVSRDAVAAIHGPFWEVETGRRDGRVTSAAEALLNLPSPFDDVSSLISQFHSKGL  224

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
              + DLVVLSGGHTIG  HC   T+RLYNFTGKGD+DPSLD  YA++L+ KC E +     
Sbjct  225   DLIDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPSLDSEYADRLRQKC-EPADLTTA  283

Query  865   VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGES  1044
             +EMDPGS RTFD SY+TL++KRRGLF SDAALLD  E +AY+++QA  HGSTFFKDFG S
Sbjct  284   LEMDPGSFRTFDKSYYTLVSKRRGLFQSDAALLDHPEARAYVLRQARPHGSTFFKDFGVS  343

Query  1045  MVNMGRIGVLTGDQGEIRKVCTAVN  1119
             MV MGR+GVLTG  GE+RK+C  VN
Sbjct  344   MVRMGRVGVLTGRAGEVRKMCRMVN  368



>ref|XP_006380314.1| hypothetical protein POPTR_0007s02560g [Populus trichocarpa]
 gb|ERP58111.1| hypothetical protein POPTR_0007s02560g [Populus trichocarpa]
 gb|AHL39148.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   405 bits (1040),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 198/305 (65%), Positives = 233/305 (76%), Gaps = 2/305 (1%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T  GGL++GFY+  CP  E IV +   + I+  P+LA PLLRMHFHDCF+RGCEGSVLL 
Sbjct  24    TNAGGLQLGFYQGACPDAELIVHQTLYRYISRDPTLAAPLLRMHFHDCFIRGCEGSVLLS  83

Query  388   S-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYW  564
             S    Q EKDA PN +LRGF +ID VK+A+E+ CPGVVSCADILA+VARD    + GP W
Sbjct  84    STKNNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCADILALVARDAVLMIGGPRW  143

Query  565   EVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCS  744
             +V TGRRDGRVS   EALFNL  PFANITVLKQ F   GLSVKDL VLSGGHTIGI HC+
Sbjct  144   DVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCT  203

Query  745   SFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIA  924
               ++RLYNFTGKGD DPSLDP YA +LK KC +   ++ +VEMDPGS ++FD  Y+ ++A
Sbjct  204   IISNRLYNFTGKGDTDPSLDPRYAAQLKNKC-KPGNSNTVVEMDPGSFKSFDEDYYNIVA  262

Query  925   KRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             KRRGLF SDAALLDD ET+ Y+  Q++T GSTF +DF ESMV MG IGVLTG+QGEIRK 
Sbjct  263   KRRGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFAESMVKMGYIGVLTGEQGEIRKH  322

Query  1105  CTAVN  1119
             C  VN
Sbjct  323   CAVVN  327



>ref|XP_006387149.1| hypothetical protein POPTR_1693s00200g [Populus trichocarpa]
 gb|ERP46063.1| hypothetical protein POPTR_1693s00200g [Populus trichocarpa]
Length=327

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/315 (63%), Positives = 236/315 (75%), Gaps = 2/315 (1%)
 Frame = +1

Query  178   LAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFV  357
             L FA      T  GGL++GFY++ CP  E IV +   + ++   +LA PLLRMHFHDCF+
Sbjct  14    LVFAFLLAGLTNAGGLQLGFYQRACPDAELIVHQTLYRYVSRDRTLAAPLLRMHFHDCFI  73

Query  358   RGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARD  534
             RGCEGSVLL S    Q EKDA PN +LRGF +ID VK+A+E+ CPGVVSCADILA+VARD
Sbjct  74    RGCEGSVLLSSTKNNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCADILALVARD  133

Query  535   VTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSG  714
                 + GP W+V TGRRDGRVS   EALFNL  PFANITVLKQ F   GLSVKDL VLSG
Sbjct  134   AVLMIGGPRWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSG  193

Query  715   GHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRT  894
             GHTIGI HC+  ++RLYNFTGKGD DPSLDP YA +LK KC +   ++ +VEMDPGS ++
Sbjct  194   GHTIGIGHCTIISNRLYNFTGKGDTDPSLDPRYAAQLKNKC-KPGNSNTVVEMDPGSFKS  252

Query  895   FDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVL  1074
             FD  Y+ ++AKRRGLF SDAALLDD ET+ Y+  Q++T GSTF +DF ESMV MG IGVL
Sbjct  253   FDEDYYNIVAKRRGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFAESMVKMGYIGVL  312

Query  1075  TGDQGEIRKVCTAVN  1119
             TG+QGEIRK C  VN
Sbjct  313   TGEQGEIRKHCAVVN  327



>ref|XP_009631264.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/328 (61%), Positives = 242/328 (74%), Gaps = 9/328 (3%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             KF  +L L+I   L  A C        G+ VGFY++TCP++E IVK+     I+ AP+LA
Sbjct  5     KFLSFLILQIFCILEVANCQ-------GVEVGFYKKTCPNVEAIVKQTTAHYISRAPTLA  57

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
              PLLRMHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRGFQ+ID  K+A+E+ CPG+
Sbjct  58    APLLRMHFHDCFVRGCDGSVLLNSTKGNQAEKDAIPNQSLRGFQVIDAAKSALEKECPGI  117

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSC+DILA+ ARD    + GP W V  GRRDGRVS +++AL NL  PF N T LK  F  
Sbjct  118   VSCSDILALAARDAVELINGPTWAVPLGRRDGRVSILSDALKNLPTPFDNFTTLKTTFGS  177

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
              GL+VKDLVVLSGGHTIG+SHC SF+ RLYNFTGKGD DP++D NY  +LK+KC     T
Sbjct  178   LGLNVKDLVVLSGGHTIGMSHCFSFSSRLYNFTGKGDMDPNMDQNYIGRLKIKCKPGDVT  237

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDF  1035
               +VEMDPGS ++FDT Y+T+++KRRGLFTSDAALL D +TKAY++ Q   +GSTFFKDF
Sbjct  238   -TIVEMDPGSFKSFDTDYYTMVSKRRGLFTSDAALLTDSQTKAYVLSQVNPYGSTFFKDF  296

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             GESM+ MG+IGVLTG  GEIRK C   N
Sbjct  297   GESMIKMGKIGVLTGKAGEIRKHCAFRN  324



>ref|XP_011100419.1| PREDICTED: peroxidase 27-like [Sesamum indicum]
Length=324

 Score =   402 bits (1034),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/328 (62%), Positives = 244/328 (74%), Gaps = 8/328 (2%)
 Frame = +1

Query  142   FSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
             F++++ + +++   F  CN       GL++GFY++TCP  E IVK    ++I+VAP+LA 
Sbjct  3     FTKHILVILVLLGIFNICNAQ-----GLKLGFYKKTCPPAEAIVKRETARIISVAPTLAA  57

Query  322   PLLRMHFHDCFVRG-CEGSVLLDSP-TKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
             PLLRMH     +RG C+GSVLL+S    Q EKDA PN SLRGF  ID+VK+AVE+ CPGV
Sbjct  58    PLLRMHLLPRILRGGCDGSVLLNSTGNNQAEKDAFPNLSLRGFGSIDRVKSAVEKKCPGV  117

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCADILA+VARD  + + GP+W V  GRRDGRVSN +EAL NL PP  NIT LK  F  
Sbjct  118   VSCADILALVARDAVSLLNGPFWPVPLGRRDGRVSNSSEALANLPPPSFNITQLKSSFAS  177

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
             KGLS KDLVVLSG HTIG SHCSSFT RLYNFTG+GD+DPSLD NY  +LK KC   + T
Sbjct  178   KGLSTKDLVVLSGSHTIGTSHCSSFTSRLYNFTGRGDSDPSLDSNYVAQLKRKC-SATDT  236

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDF  1035
               LVEMDPGS +TFD  Y+TL+ KRRGLFTSD+ALLDD ET+AY+ +QA   GSTF KDF
Sbjct  237   TTLVEMDPGSFKTFDEGYYTLVTKRRGLFTSDSALLDDGETRAYVRRQATFKGSTFLKDF  296

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              +SMV MG+IGVLTG+QGEIR+ C  VN
Sbjct  297   AKSMVKMGKIGVLTGNQGEIRRRCAFVN  324



>gb|AFQ36036.1| peroxidase 27 [Fragaria x ananassa]
Length=329

 Score =   403 bits (1035),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 210/321 (65%), Positives = 247/321 (77%), Gaps = 9/321 (3%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             I++     C N       GL+VGFY ++CP  E IVK++  Q ++VAPSL GPLLRMHFH
Sbjct  15    IVLLSVLDCANAQ-----GLKVGFYAKSCPEAEAIVKKVIAQTLSVAPSLGGPLLRMHFH  69

Query  346   DCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIV  525
             DCFVRGC+GSVLL+S + Q EKDA PN SLRG+ +ID+VK+A+E+ACPGVVSC+DILA+V
Sbjct  70    DCFVRGCDGSVLLNSSSNQAEKDAIPNLSLRGYGVIDRVKSALEKACPGVVSCSDILAVV  129

Query  526   ARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVV  705
             ARDV  A  G +W+VETGRRDG VSNM +AL NL  P +NI+ LK  F  KGLS KDLVV
Sbjct  130   ARDVVVADMGVHWDVETGRRDGNVSNMIDALRNLPAPSSNISSLKSSFASKGLSAKDLVV  189

Query  706   LSGGHTIGISHCSSFTDRLYNFTGK--GDADPSLDPNYAEKLKMKCPEESPTDNLVEMDP  879
             LSG HTIG SHCSSFT+RLYNFTGK   D DP+LD NY  KLKMKC     T  LVEMDP
Sbjct  190   LSGSHTIGTSHCSSFTNRLYNFTGKNVNDTDPTLDSNYIAKLKMKCKPNDQT-TLVEMDP  248

Query  880   GSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHG-STFFKDFGESMVNM  1056
             GS +TFD SY+TL+AKRRGLF SDAALLDD ETKAY+   A+  G ++F KDFG SMVNM
Sbjct  249   GSFKTFDGSYYTLVAKRRGLFQSDAALLDDSETKAYVTSHAVPKGEASFLKDFGVSMVNM  308

Query  1057  GRIGVLTGDQGEIRKVCTAVN  1119
             GRIGVLTG+ GEIRKVC+ +N
Sbjct  309   GRIGVLTGNAGEIRKVCSKIN  329



>gb|KHG20863.1| Peroxidase 27 -like protein [Gossypium arboreum]
Length=326

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 241/322 (75%), Gaps = 4/322 (1%)
 Frame = +1

Query  154   LSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLR  333
             L L I + +     NH  +   GL++GFY +TCP+ E I+++     I+ AP+LA PLLR
Sbjct  9     LCLHIQLIIVVMVLNH--SNAQGLKLGFYSETCPNAESIIRKTTYGFISRAPTLAAPLLR  66

Query  334   MHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADI  513
             +HFHDCFVRGC+GSVLL+S   Q EKDA PN SLRG+ +ID VK+AVE+ACPGVVSCADI
Sbjct  67    LHFHDCFVRGCDGSVLLNSTKNQAEKDAIPNLSLRGYHVIDAVKSAVEQACPGVVSCADI  126

Query  514   LAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVK  693
             LA+VARD  + + GP W+V  GRRDGRVS ++EAL NL  PF N+T LKQ F  KGL++K
Sbjct  127   LALVARDSVSMINGPSWKVPLGRRDGRVSKLSEALANLPSPFFNVTQLKQNFASKGLNMK  186

Query  694   DLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEM  873
             DL VLSGGHTIG SHC +F  RLYNF+GKGDADPS+D  Y  +LK KC     T +LVEM
Sbjct  187   DLAVLSGGHTIGTSHCVAFGLRLYNFSGKGDADPSMDLTYVTQLKQKCKPGDIT-SLVEM  245

Query  874   DPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVN  1053
             DPGS +TFD +Y+TL++KRRGLF SDAALL++ ETKAY V QA  HGSTF +DF  SM  
Sbjct  246   DPGSFKTFDEAYYTLVSKRRGLFGSDAALLNNAETKAY-VLQASRHGSTFARDFAVSMEK  304

Query  1054  MGRIGVLTGDQGEIRKVCTAVN  1119
             MG++ VLTG+QGEIRK C  VN
Sbjct  305   MGKVEVLTGNQGEIRKHCAMVN  326



>ref|XP_010267770.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=330

 Score =   402 bits (1033),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 208/331 (63%), Positives = 241/331 (73%), Gaps = 3/331 (1%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MA    + S+   I LA    +   T   GLRVGFY+ TCP +E IV++     +   PS
Sbjct  1     MAALKLFSSVVFFIQLAIVVFHLDPTSAQGLRVGFYKNTCPAVEDIVRKTTAHYVLPVPS  60

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             LA PLLRMHFHDCFVRGC+GSVLL+S    Q EK A PN SL GF IID VK+AVE+ACP
Sbjct  61    LAAPLLRMHFHDCFVRGCDGSVLLNSTANNQAEKSAIPNQSLNGFGIIDAVKSAVEKACP  120

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADILA+VARD  + +KGPYWEV TGRRDGRVS  +EAL NL PPFA I+ L+  F
Sbjct  121   GVVSCADILALVARDAVSLVKGPYWEVPTGRRDGRVSLASEALTNLPPPFATISDLQTRF  180

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEES  849
               KGLSVKDLVVLSG HTIG SHC SFT+RLYNFTG+ D+DPSLD  Y ++LK KC    
Sbjct  181   MAKGLSVKDLVVLSGAHTIGQSHCPSFTNRLYNFTGRADSDPSLDSIYIQRLKSKCKAGD  240

Query  850   PTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQ-ALTHGSTFF  1026
                + VEMDPGS +TFDT Y+  +AKRRGLF SDAALL+D +TKAY++QQ   + GS+FF
Sbjct  241   VVTS-VEMDPGSYKTFDTGYYKNVAKRRGLFQSDAALLNDADTKAYVIQQSTSSSGSSFF  299

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             KDFG SMVNMG IGVLT   GEIRK C  VN
Sbjct  300   KDFGVSMVNMGNIGVLTASAGEIRKQCAFVN  330



>ref|XP_002309830.2| hypothetical protein POPTR_0007s02570g [Populus trichocarpa]
 gb|EEE90280.2| hypothetical protein POPTR_0007s02570g [Populus trichocarpa]
 gb|AHL39149.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   402 bits (1033),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 198/315 (63%), Positives = 237/315 (75%), Gaps = 2/315 (1%)
 Frame = +1

Query  178   LAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFV  357
             L FA      T  GGL++GFY++ CP  E IV +   + ++   +LA PLLRMHFHDCF+
Sbjct  14    LVFAFLLAGLTNAGGLQLGFYQRACPDAELIVHQTLYRYVSRDRTLAAPLLRMHFHDCFI  73

Query  358   RGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARD  534
             RGC+GSVLL S  K Q EKDA PN +LRGF +ID VK+A+E+ CPGVVSC+D+LA+VARD
Sbjct  74    RGCDGSVLLSSTEKNQAEKDAIPNKTLRGFNVIDAVKSALEKNCPGVVSCSDVLALVARD  133

Query  535   VTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSG  714
                 + GP+W+V TGRRDGRVS   EALFNL  PFANITVLKQ F   GLSVKDL VLSG
Sbjct  134   AVLMIGGPHWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSG  193

Query  715   GHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRT  894
             GHTIGI HC+  ++RLYNFTGKGD DPSLDP YA +LK KC +   ++ +VEMDPGS +T
Sbjct  194   GHTIGIGHCTIISNRLYNFTGKGDTDPSLDPRYAAQLKKKC-KPGNSNTVVEMDPGSFKT  252

Query  895   FDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVL  1074
             FD  Y+ ++AKRRGLF SDAALLDD ET+ Y+  Q+ T GSTF +DF ESMV MG IGVL
Sbjct  253   FDEDYYNIVAKRRGLFRSDAALLDDAETRDYVKFQSRTQGSTFAQDFAESMVKMGYIGVL  312

Query  1075  TGDQGEIRKVCTAVN  1119
             TG+QGEIRK C  VN
Sbjct  313   TGEQGEIRKRCAVVN  327



>ref|XP_011003205.1| PREDICTED: peroxidase 56-like [Populus euphratica]
Length=327

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/323 (63%), Positives = 237/323 (73%), Gaps = 2/323 (1%)
 Frame = +1

Query  154   LSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLR  333
             L L   + L FA      T  GGL++GFY+  CP  E IV +   + I+   +LA PLLR
Sbjct  6     LFLVCFLQLVFAFLLAGLTNAGGLQLGFYQGACPDAELIVHQTLHRYISRDRTLAAPLLR  65

Query  334   MHFHDCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCAD  510
             MHFHDCF+RGC+GSVLL S  K Q EKDA PN +LRGF +ID VK+A+E+ CPGVVSCAD
Sbjct  66    MHFHDCFIRGCDGSVLLSSTKKNQAEKDAIPNKTLRGFNVIDAVKSALEKRCPGVVSCAD  125

Query  511   ILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSV  690
             ILA+VARD    + GP+W+V TGRRDGRVS   EALFNL  PFANITVLKQ F   GLSV
Sbjct  126   ILALVARDAVLMIGGPHWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSV  185

Query  691   KDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVE  870
             KDL VLSGGHTIGI HC+  + RLYNFTGKGD DPSLD  YA +LK KC +   ++ +VE
Sbjct  186   KDLAVLSGGHTIGIGHCTIISIRLYNFTGKGDTDPSLDRRYAAQLKKKC-KPGNSNTVVE  244

Query  871   MDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMV  1050
             MDPGS +TFD  Y+T++AKRRGLF SDAALLDD ET+ Y+  Q+ T GSTF +DF ESMV
Sbjct  245   MDPGSFKTFDEDYYTIVAKRRGLFRSDAALLDDAETRDYVRFQSRTQGSTFAQDFAESMV  304

Query  1051  NMGRIGVLTGDQGEIRKVCTAVN  1119
              MG IGVLTG QGEIRK C  VN
Sbjct  305   KMGYIGVLTGKQGEIRKRCAVVN  327



>ref|XP_009800459.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=324

 Score =   400 bits (1027),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 238/330 (72%), Gaps = 7/330 (2%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MA     L   + +  AF   N  +     L+VGFY++TCP++E IVK+     ++  P+
Sbjct  1     MATLKFLLVFILSLAFAFGLANSQS-----LQVGFYKKTCPNVEAIVKKATTDFVSRTPT  55

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             LA PLLRMHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRGFQ+ID  K+A+E+ CP
Sbjct  56    LAAPLLRMHFHDCFVRGCDGSVLLNSTKGNQTEKDAIPNQSLRGFQVIDAAKSALEKQCP  115

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             G+VSCADILA+VARD  + + GP W+VE GRRDGRVS + EA+ NL  PF N   LK  F
Sbjct  116   GIVSCADILALVARDAVSLINGPTWQVELGRRDGRVSILLEAIRNLPNPFDNFATLKSSF  175

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEES  849
                GLSVKD+VVLSGGHT+G+SHC SF  RLYNFTGKGD DP++D NY  +LK KC    
Sbjct  176   GALGLSVKDIVVLSGGHTLGVSHCFSFGSRLYNFTGKGDTDPNMDQNYIGQLKTKCKPND  235

Query  850   PTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFK  1029
              T   VEMDPGS ++FDT Y+T+++KRRGLF SDAALL D +TKAY++ Q  + GSTFFK
Sbjct  236   VTTT-VEMDPGSAKSFDTDYYTMVSKRRGLFVSDAALLTDSQTKAYVLSQLNSRGSTFFK  294

Query  1030  DFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             DFG SMVNMG+IGVLTG  GEIRK C   N
Sbjct  295   DFGVSMVNMGKIGVLTGKSGEIRKHCAITN  324



>ref|XP_010485528.1| PREDICTED: peroxidase 27-like [Camelina sativa]
Length=321

 Score =   399 bits (1025),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 228/302 (75%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCP +E IVK++  + +  AP+L  PLLRM FHDCFVRGC+GS+LLD    
Sbjct  25    GLKVGFYSKTCPQVEGIVKKVVFEAMKKAPTLGAPLLRMFFHDCFVRGCDGSILLDKSNN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             QGEK A PN SLRGF IID  K A+E+ CPG+VSC+D+LA+VARD   A++GP WEVETG
Sbjct  85    QGEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDVLALVARDAMVALEGPSWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVSN+ E   NL  PF NIT L   F   GL+ KDLV+LSGGHTIGI HC   T+R
Sbjct  145   RRDGRVSNINEV--NLPSPFDNITKLITDFRLNGLNEKDLVILSGGHTIGIGHCPLVTNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTG+GD+DPSLD  YA KL+ KC    PTD    +EMDPGS +TFD SYFTL+AKRR
Sbjct  203   LYNFTGRGDSDPSLDSEYAAKLRQKC---KPTDTTTALEMDPGSFKTFDVSYFTLVAKRR  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAALLD+ +TKAY++QQ  THGS FF DFG SMV MGR GVLTG  GEIRK+C  
Sbjct  260   GLFQSDAALLDNSKTKAYVLQQLRTHGSMFFHDFGVSMVKMGRSGVLTGRAGEIRKMCRV  319

Query  1114  VN  1119
              N
Sbjct  320   PN  321



>gb|EYU24796.1| hypothetical protein MIMGU_mgv1a010112mg [Erythranthe guttata]
Length=322

 Score =   399 bits (1024),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/327 (61%), Positives = 235/327 (72%), Gaps = 12/327 (4%)
 Frame = +1

Query  154   LSLEILIFLAFA----CCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
              S +IL+FL F      CN       GL++GFY++TCP  E IVK+    +++VAP+LA 
Sbjct  3     FSKQILVFLVFVGIFNTCNAQ-----GLKLGFYKKTCPSAEAIVKKETANIMSVAPTLAA  57

Query  322   PLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVS  501
             PLLRMHFHDCFVR      L    + Q EKD+ PN SLRG+  ID+VK+AVE+ CPGVVS
Sbjct  58    PLLRMHFHDCFVR-WHFRALHKQYSNQAEKDSFPNLSLRGYGSIDRVKSAVEKKCPGVVS  116

Query  502   CADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKG  681
             CADILA+VARD  + + G  W V  GRRDG VSN TE LFNL PPF NIT LK  F  KG
Sbjct  117   CADILALVARDAVSLLNGASWPVPLGRRDGNVSNSTETLFNLPPPFFNITQLKASFASKG  176

Query  682   LSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN  861
             L+ KDLVVLSGGHTIG SHCSSFT+RLYNFTG GD+DPSLD NY  +LK +C   + T  
Sbjct  177   LNAKDLVVLSGGHTIGTSHCSSFTNRLYNFTGVGDSDPSLDSNYVARLKTRC-SATDTTT  235

Query  862   LVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST-FFKDFG  1038
             LVEMDPGS +TFDT Y+TL+AKRRGLFTSDAALL D ET+AY+   A   GS  F KDF 
Sbjct  236   LVEMDPGSFKTFDTEYYTLVAKRRGLFTSDAALLADSETRAYVTSHATPQGSKDFLKDFA  295

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             +SMV MG+IGVLTG QGEIRK C  +N
Sbjct  296   KSMVKMGKIGVLTGSQGEIRKTCGFIN  322



>ref|XP_009630374.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/328 (60%), Positives = 240/328 (73%), Gaps = 9/328 (3%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             KF  +L L++   L  A C        G+ +GFY++TCP++E IVK+     I+ AP+LA
Sbjct  5     KFLSFLILQLFCILEVANCQ-------GVELGFYKKTCPNVEAIVKQTTAHYISRAPTLA  57

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
              PLLRMHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRGFQ+ID  K+A+E+ CPG+
Sbjct  58    APLLRMHFHDCFVRGCDGSVLLNSTKGNQAEKDAIPNQSLRGFQVIDAAKSALEKECPGI  117

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSC+DILA+ ARD    + GP W V  GRRDGRVS + +AL NL  PF N T LK  F  
Sbjct  118   VSCSDILALAARDAVELINGPTWAVPLGRRDGRVSILLDALKNLPTPFDNFTTLKTTFGS  177

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
              GL+VKDLVVLSGGHTIG+SHC SF+ RLYNFTGKGD DP++D NY  +LK+KC     T
Sbjct  178   LGLNVKDLVVLSGGHTIGMSHCFSFSSRLYNFTGKGDMDPNMDQNYVGRLKIKCKPGDVT  237

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDF  1035
               +VEMDPGS ++FDT Y+T+++KRRGLF SDAALL D +TKAY++ Q   +GSTFFKDF
Sbjct  238   -TIVEMDPGSFKSFDTDYYTMVSKRRGLFASDAALLTDSQTKAYVLSQVNPYGSTFFKDF  296

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             GESM+ MG+IGVLTG  GEIRK C   N
Sbjct  297   GESMIKMGKIGVLTGKAGEIRKHCAFRN  324



>ref|XP_011003204.1| PREDICTED: peroxidase 27-like [Populus euphratica]
Length=327

 Score =   397 bits (1021),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 237/319 (74%), Gaps = 2/319 (1%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             + + L  A      T   GL++GFY +TCP  E IV +   + I+  P+LA PLLRM+FH
Sbjct  10    LFLHLVLAFLLVELTNARGLQLGFYRRTCPDAELIVHKTLHRYISRDPTLAAPLLRMYFH  69

Query  346   DCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAI  522
             DCF+RGC+GSVLL S  K Q EKDA PN +LRGF +ID VK+A+E+ CPGVVSC+D+LA+
Sbjct  70    DCFIRGCDGSVLLSSTKKNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCSDVLAL  129

Query  523   VARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLV  702
             VARD    + GP+W+V TGRRDGR+S   EALFNL  PFANI+VLKQ F   GLSVKDL 
Sbjct  130   VARDAVLMIGGPHWDVPTGRRDGRLSIANEALFNLPSPFANISVLKQQFAATGLSVKDLA  189

Query  703   VLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPG  882
             VLSGGHTIGI HC+  ++RLYNFTGKGD DPSLD  YA +LK KC +   ++ +VEMDPG
Sbjct  190   VLSGGHTIGIGHCTIISNRLYNFTGKGDTDPSLDRRYAAQLKKKC-KPGNSNTVVEMDPG  248

Query  883   SVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGR  1062
             S +TFD  Y+T++AKRRGLF SDAALLDD ET+ Y+  Q+ T GSTF +DF ESMV MG 
Sbjct  249   SFKTFDEDYYTIVAKRRGLFRSDAALLDDAETRDYVKFQSRTQGSTFAQDFAESMVKMGY  308

Query  1063  IGVLTGDQGEIRKVCTAVN  1119
             IGVLTG QGEIRK C  VN
Sbjct  309   IGVLTGKQGEIRKRCAVVN  327



>ref|XP_010463561.1| PREDICTED: peroxidase 27 [Camelina sativa]
Length=321

 Score =   397 bits (1020),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 227/302 (75%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCP +E IVK++  + +  AP+L  PLLRM FHDCFVRGC+GS+LLD    
Sbjct  25    GLKVGFYSKTCPQVEGIVKKVVFEAMKKAPTLGAPLLRMFFHDCFVRGCDGSILLDKSNN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             QGEK A PN SLRGF IID  K A+E+ CPG+VSC+D+LA+VARD   A++GP WEVETG
Sbjct  85    QGEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDVLALVARDAMVALEGPSWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVSN+ E   NL  PF NIT L   F   GL+ KDLV+LSGGHTIG+ HC   T+R
Sbjct  145   RRDGRVSNINEV--NLPSPFDNITKLITDFRSNGLNEKDLVILSGGHTIGMGHCPLVTNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTG+GD+DP LD  YA KL+ KC    PTD    +EMDPGS +TFD SYFTL+AKRR
Sbjct  203   LYNFTGRGDSDPKLDSEYAVKLRQKC---KPTDTTTALEMDPGSFKTFDVSYFTLVAKRR  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAALLD+ +TKAY++QQ  THGS FF DFG SMV MGR GVLTG  GEIRK+C  
Sbjct  260   GLFQSDAALLDNSKTKAYVLQQLRTHGSMFFHDFGVSMVKMGRSGVLTGRAGEIRKMCRV  319

Query  1114  VN  1119
              N
Sbjct  320   PN  321



>ref|XP_010413829.1| PREDICTED: peroxidase 27-like [Camelina sativa]
Length=321

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 231/320 (72%), Gaps = 12/320 (4%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             + + L FA  N       GL+VGFY +TCP +E IVK++    +  AP+L  PLLRM FH
Sbjct  12    LFLVLLFAQANSQ-----GLKVGFYSKTCPQVEGIVKKVVFAAMKKAPTLGAPLLRMFFH  66

Query  346   DCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIV  525
             DCFVRGC+GS+LLD    Q EK A PN SLRGF IID  K A+E+ CPG+VSC+D+LA+V
Sbjct  67    DCFVRGCDGSILLDKSNNQAEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDVLALV  126

Query  526   ARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVV  705
             ARD   A++GP WEVETGRRDGRVSN+ E   NL  PF NIT L   F   GL+ KDLV+
Sbjct  127   ARDAMVALEGPSWEVETGRRDGRVSNINEV--NLPSPFDNITKLITDFRSNGLNEKDLVI  184

Query  706   LSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDP  879
             LSGGHTIG+ HC   T+RLYNFTG+GD+DPSLD  YA KL+ KC    PTD    +EMDP
Sbjct  185   LSGGHTIGMGHCPLMTNRLYNFTGRGDSDPSLDSEYAAKLRQKC---KPTDTTTALEMDP  241

Query  880   GSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMG  1059
             GS +TFD SYF L+AKRRGLF SDAALLD+ +TKAY++QQ  THGS FF DFG SMV MG
Sbjct  242   GSFKTFDVSYFKLVAKRRGLFQSDAALLDNSKTKAYVLQQLRTHGSMFFHDFGVSMVKMG  301

Query  1060  RIGVLTGDQGEIRKVCTAVN  1119
             R GVLTG  GEIRK+C   N
Sbjct  302   RSGVLTGRAGEIRKMCRVPN  321



>ref|XP_006352038.1| PREDICTED: peroxidase 27-like, partial [Solanum tuberosum]
Length=311

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 230/301 (76%), Gaps = 2/301 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             G+ VGFY++TCP++E IVK+     +++AP+LA PLLRMHFHDCFVRGC+GSVLL+S  +
Sbjct  12    GVEVGFYKKTCPNVEKIVKKAVVDYVSIAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKS  71

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EKDA  N SLRGFQ+ID  K+A+E+ CPGVVSCADILA+VARD  + + GP W+V  
Sbjct  72    NQAEKDAIANLSLRGFQVIDAAKSALEKQCPGVVSCADILALVARDAVSLINGPTWQVPL  131

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS ++EA  NL  PF N T LK  F   GLSVKDLVVLSGGHT+G+SHC SF  
Sbjct  132   GRRDGRVSILSEATTNLPTPFDNFTTLKTRFGSLGLSVKDLVVLSGGHTLGVSHCFSFGS  191

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             R+YNFTGKGD DP++D  Y  +LK KC     T   VEMDPGS +TFDT Y+TL++KRRG
Sbjct  192   RMYNFTGKGDMDPNMDQKYIAQLKTKCKPNDVTTT-VEMDPGSFKTFDTDYYTLVSKRRG  250

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDA LL D++TKAY++ Q  + GSTFF+DFG SMVNMG+IGVLT   GEIRK C  +
Sbjct  251   LFVSDATLLTDKQTKAYVLAQLSSSGSTFFEDFGVSMVNMGKIGVLTEKSGEIRKKCAFI  310

Query  1117  N  1119
             N
Sbjct  311   N  311



>ref|XP_004245974.1| PREDICTED: peroxidase 27-like [Solanum lycopersicum]
Length=322

 Score =   395 bits (1014),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 239/325 (74%), Gaps = 10/325 (3%)
 Frame = +1

Query  151   YLSLEIL-IFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPL  327
             +LS  IL +FL    C        G+ VGFY++TCP++E IVKE     I++AP+LA PL
Sbjct  6     FLSFLILQLFLITNNCE-------GVEVGFYKKTCPNVEAIVKETTKHYISIAPTLAAPL  58

Query  328   LRMHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LRMHFHDCFVRGC+GSVLL+S    + EKDA PN SLRGFQ+ID  K+A+E+ CPG+VSC
Sbjct  59    LRMHFHDCFVRGCDGSVLLNSTKGNKAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSC  118

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +DILA+ ARD  + + GP W V  GRRDGRVS ++EA  NL  PF N T LK  F   GL
Sbjct  119   SDILALAARDAVSLINGPTWSVPLGRRDGRVSILSEASKNLPTPFDNFTTLKTTFGALGL  178

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
             +VKDLVVLSGGHTIG+SHC SF+ RLYNFTGKGD DP++D NY   LK+KC     T  +
Sbjct  179   NVKDLVVLSGGHTIGMSHCFSFSSRLYNFTGKGDMDPNMDQNYINHLKIKCKPGDVT-TI  237

Query  865   VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGES  1044
             VEMDPGS ++FD  Y+T+IAKRRGLF SDAALL + +TK Y++ Q   HGSTFF+DFGES
Sbjct  238   VEMDPGSFKSFDADYYTMIAKRRGLFASDAALLSNTQTKEYVLSQLNRHGSTFFEDFGES  297

Query  1045  MVNMGRIGVLTGDQGEIRKVCTAVN  1119
             MV MG+IGVLTG+ GEIRK C   N
Sbjct  298   MVKMGQIGVLTGNAGEIRKHCAFRN  322



>ref|XP_009604225.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   395 bits (1015),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/321 (61%), Positives = 237/321 (74%), Gaps = 5/321 (2%)
 Frame = +1

Query  160   LEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMH  339
             L +++ LAFA          GL+VGFY++TCP++E IVK+     ++ AP+LA PLLRMH
Sbjct  8     LVVILCLAFA---FELANSQGLQVGFYKKTCPNVEAIVKKATTDFVSRAPTLAAPLLRMH  64

Query  340   FHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADIL  516
             FHDCFVRGC+GSVLL+S    Q EKDA PN SLRGFQ+ID  K+A+E+ CPG+VSC DIL
Sbjct  65    FHDCFVRGCDGSVLLNSTKGNQTEKDAIPNQSLRGFQVIDAAKSALEKQCPGIVSCTDIL  124

Query  517   AIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKD  696
             A+VARD  + + GP W+VE GRRDGRVS + EA+ NL  PF N T LK  F   GLSVKD
Sbjct  125   ALVARDAVSLINGPTWQVELGRRDGRVSILLEAIRNLPTPFDNFTTLKSSFGALGLSVKD  184

Query  697   LVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMD  876
             LVVLSGGHT+G+SHC SF  RLYNFTGKGD DP++D +Y  +LK KC     T   VEMD
Sbjct  185   LVVLSGGHTLGVSHCFSFGSRLYNFTGKGDTDPNMDQSYIGQLKTKCKPNDVTTT-VEMD  243

Query  877   PGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNM  1056
             PGS + FDT Y+T+++KRRGLF SDAALL + +TKAY++ Q  T GSTFF+DFG SMVNM
Sbjct  244   PGSAKNFDTDYYTMVSKRRGLFASDAALLTNTQTKAYVLSQLNTPGSTFFEDFGVSMVNM  303

Query  1057  GRIGVLTGDQGEIRKVCTAVN  1119
              +IGVLTG  GEIRK C   N
Sbjct  304   SKIGVLTGKAGEIRKHCAIRN  324



>emb|CBI28956.3| unnamed protein product [Vitis vinifera]
Length=671

 Score =   407 bits (1046),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/296 (66%), Positives = 231/296 (78%), Gaps = 2/296 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT-K  399
             L++GFY+ TCP  E IV+E   Q I+ AP+LA  LLR+HFHDCFVRGC+GSVLL+S    
Sbjct  29    LKLGFYKNTCPAAEDIVRETTAQYISKAPTLAASLLRIHFHDCFVRGCDGSVLLNSTKHN  88

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDA PN SLRG+Q+ID  K+AVE+ CPGVVSCADILA+VARD  + + GPYW+V TG
Sbjct  89    QAEKDAIPNLSLRGYQVIDAAKSAVEKKCPGVVSCADILALVARDAVSMINGPYWQVPTG  148

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG++S   EAL NL PPFANIT LK  F  KGLS+KDL VLSGGHTIGISHCSSFT+R
Sbjct  149   RRDGKLSVALEALTNLPPPFANITQLKAMFQSKGLSIKDLAVLSGGHTIGISHCSSFTNR  208

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DPS+DPNY  +LK KC +      +VEMDPGS ++FD  Y++++AKRRGL
Sbjct  209   LYNFTGKGDTDPSMDPNYVIQLKKKC-KPGDVSTVVEMDPGSFKSFDEDYYSVVAKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             F SDAALLDD ET  Y+  Q+ +HG +F +DF  SMV MGRIGVLTG+ GEIRK C
Sbjct  268   FQSDAALLDDVETSKYVRLQSFSHGKSFGRDFAASMVKMGRIGVLTGNAGEIRKYC  323


 Score =   271 bits (693),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 182/299 (61%), Gaps = 41/299 (14%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L++GFY ++CP  E IV +   + I  APSLA  L+RMHFHDCFVRGC+GSVL++S  + 
Sbjct  366   LKLGFYGESCPKAEKIVLDYVKKHIPNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSSN  425

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKD  PN +LRGF  I++VK+ VE  CPG+VSCADILA+VARD      GP+W V TG
Sbjct  426   QAEKDGTPNLTLRGFDFIERVKSVVEAECPGIVSCADILALVARDSIVVTGGPFWNVPTG  485

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +SN +EA+ ++  P  N T L+  F +KGL + DLV+LSG HTIG+SHCSSF++R
Sbjct  486   RRDGLISNSSEAVSDIPRPVNNFTTLQTLFANKGLDLNDLVLLSGAHTIGVSHCSSFSNR  545

Query  760   LYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             LYNFTG GD DP+LD  YA  LK  KC  +  TDN                         
Sbjct  546   LYNFTGVGDEDPALDSEYAANLKARKC--KVATDN-------------------------  578

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
                          T A++ Q      S+F  +F +SM  MGRI V TG  GE+RK C +
Sbjct  579   ------------TTIAFITQILQGPLSSFLAEFAKSMEKMGRIEVKTGTAGEVRKQCAS  625



>ref|XP_004144487.1| PREDICTED: peroxidase 56-like [Cucumis sativus]
 gb|KGN43538.1| hypothetical protein Csa_7G044780 [Cucumis sativus]
Length=329

 Score =   395 bits (1014),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 227/302 (75%), Gaps = 6/302 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L VGFY+  CP +E IV +   Q +   P++A  LLR+HFHDCFVRGC+GSVLL+S P  
Sbjct  31    LAVGFYKNCCPGVEYIVAKTVAQYVKKQPAIAASLLRIHFHDCFVRGCDGSVLLNSGPNN  90

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDA PN SLRG+ ++D VK AVE+ CPGVVSCADILA++ARD      GP WEV TG
Sbjct  91    QAEKDAIPNLSLRGYNVVDAVKAAVEKQCPGVVSCADILALIARDAVRMSGGPAWEVPTG  150

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS   EAL NL PPFANI+ LK  F  KGLS+KDLVVLSG HTIG+SHC+SF++R
Sbjct  151   RRDGTVSISREALINLPPPFANISSLKSSFQSKGLSLKDLVVLSGAHTIGVSHCTSFSNR  210

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTGKGDADP LD  YA  LK+KC    P D   +VEMDPGS +TFD SY+TL++KRR
Sbjct  211   LYNFTGKGDADPKLDKYYAAALKIKC---KPNDQKKIVEMDPGSFKTFDQSYYTLVSKRR  267

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SD+ALLDD +TKAY+  Q+ T GSTF  DF +SM+NMG IGVLTG  GEIR+ C  
Sbjct  268   GLFQSDSALLDDPDTKAYVQFQSSTRGSTFAADFAKSMINMGNIGVLTGTDGEIRRRCGF  327

Query  1114  VN  1119
             VN
Sbjct  328   VN  329



>ref|XP_006299954.1| hypothetical protein CARUB_v10016167mg, partial [Capsella rubella]
 gb|EOA32852.1| hypothetical protein CARUB_v10016167mg, partial [Capsella rubella]
Length=318

 Score =   394 bits (1013),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 224/296 (76%), Gaps = 3/296 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GLRVGFY +TCP +E IVK++    +  AP+L  PLLRM FHDCFVRGC+GSVLLD    
Sbjct  25    GLRVGFYSKTCPQVEGIVKKVVFDAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDKSNN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK A PN SLRGF IID  K A+E+ CPG+VSC+D+LA+VARD   A++GP WEVETG
Sbjct  85    QAEKSAIPNLSLRGFGIIDDSKAALEKVCPGIVSCSDVLALVARDAMVALEGPSWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVSN+ E   NL  PF NIT L   F  KGL+ KDLV+LSGGHTIG+ HC   T+R
Sbjct  145   RRDGRVSNINEV--NLPSPFDNITKLITDFRSKGLNEKDLVILSGGHTIGMGHCPLLTNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTG+GD+DPSLD  YA  L+ KC + + T   +EMDPGS +TFD SYFTL+AKRRGL
Sbjct  203   LYNFTGRGDSDPSLDSEYAAHLRKKC-KPTDTTTALEMDPGSFKTFDVSYFTLVAKRRGL  261

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             F SDAALLD+ +T+ Y++Q A THGS FF DFG SMV MGR GVLTG  GEIRK+C
Sbjct  262   FQSDAALLDNSKTRGYVLQLARTHGSMFFHDFGVSMVKMGRAGVLTGQSGEIRKMC  317



>ref|XP_006400035.1| hypothetical protein EUTSA_v10014085mg [Eutrema salsugineum]
 gb|ESQ41488.1| hypothetical protein EUTSA_v10014085mg [Eutrema salsugineum]
Length=329

 Score =   394 bits (1013),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 236/328 (72%), Gaps = 8/328 (2%)
 Frame = +1

Query  142   FSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
              S +  L+I +FL F+      T   GL+VGFY+ TCP  E IV +    V+   P++  
Sbjct  8     LSCFFLLQISLFLLFS---FDPTNAHGLKVGFYDNTCPKAELIVMKSVSDVMKKDPTIGA  64

Query  322   PLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVS  501
             PLLRM FHDCFVRGCEGSVLL+   K+ EK+A PN S+RGF++ID +K ++E+ CPGVVS
Sbjct  65    PLLRMFFHDCFVRGCEGSVLLELKNKKDEKNAAPNLSIRGFEVIDNIKASLEKECPGVVS  124

Query  502   CADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKG  681
             C+D+LA+VARD   AM G  W VETGRRDGRV+N+ EA  NL  PF NIT L   F  KG
Sbjct  125   CSDVLALVARDAVVAMNGRSWGVETGRRDGRVTNINEANSNLPSPFDNITSLITQFHSKG  184

Query  682   LSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN  861
             L  KDL VLSGGHT+GI HC    +RLYNFTGKGD+DP+LD  YA +LK KC    PTD 
Sbjct  185   LDKKDLAVLSGGHTVGIGHCPLIANRLYNFTGKGDSDPNLDSEYAARLKQKC---KPTDT  241

Query  862   L--VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDF  1035
                +EMDPGS +TFD S+F L++KRRG F SDAALLD++ETK+Y+++Q   HGSTFF+DF
Sbjct  242   TTALEMDPGSFKTFDDSFFKLVSKRRGFFQSDAALLDNQETKSYVLKQTKNHGSTFFEDF  301

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             G SMV MGRIGVLTG  GEIRK CT VN
Sbjct  302   GVSMVKMGRIGVLTGRVGEIRKKCTMVN  329



>ref|XP_004159200.1| PREDICTED: peroxidase 56-like [Cucumis sativus]
Length=329

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 227/302 (75%), Gaps = 6/302 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L VGFY+  CP +E IV +   Q +   P++A  LLR+HFHDCFVRGC+GSVLL+S P  
Sbjct  31    LAVGFYKNCCPGVEYIVAKTVAQYVKKQPAIAASLLRIHFHDCFVRGCDGSVLLNSGPNN  90

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDA PN SLRG+ ++D VK AVE+ CPGVVSCADILA++ARD      GP WEV TG
Sbjct  91    QAEKDAIPNLSLRGYNVVDAVKAAVEKQCPGVVSCADILALIARDAVRMSGGPAWEVPTG  150

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS   EAL NL PPFANI+ LK  F  KGLS+KDLVVLSG HTIG+SHC+SF++R
Sbjct  151   RRDGTVSISREALINLPPPFANISSLKSSFQSKGLSLKDLVVLSGAHTIGVSHCTSFSNR  210

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTGKGDADP LD  YA  LK+KC    P D   +VEMDPGS +TFD SY+TL++KRR
Sbjct  211   LYNFTGKGDADPKLDKYYAAALKIKC---KPNDQKKIVEMDPGSFKTFDQSYYTLVSKRR  267

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SD+ALLDD +TKAY+  Q+ T GSTF  DF +SM+NMG IGVLTG  GEIR+ C  
Sbjct  268   GLFQSDSALLDDPDTKAYVQFQSSTRGSTFPADFAKSMINMGNIGVLTGTDGEIRRRCGF  327

Query  1114  VN  1119
             VN
Sbjct  328   VN  329



>ref|XP_010059640.1| PREDICTED: peroxidase 27-like [Eucalyptus grandis]
Length=298

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/300 (66%), Positives = 223/300 (74%), Gaps = 30/300 (10%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY++TCP+ E IVK++ DQV++VAPSL+GPLLRMHFHDCFVR             
Sbjct  29    GLKVGFYQKTCPNAEAIVKKVMDQVMSVAPSLSGPLLRMHFHDCFVR-------------  75

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
                             +ID+VKTA+E+ACPG VSCAD+LAIVARDV  A     ++VETG
Sbjct  76    ----------------VIDRVKTALEKACPGTVSCADVLAIVARDVVVATGALSYDVETG  119

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG VS++ EAL NL+PP ANIT LK  F  KGLSVKDLVVLSGGHT+G SHCSSF+DR
Sbjct  120   RRDGNVSSLNEALNNLVPPNANITTLKADFAMKGLSVKDLVVLSGGHTLGTSHCSSFSDR  179

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTGKGD DP LD NY  +LK+KC     T  LVEMDPGSVRTFD  YF LI KRRGL
Sbjct  180   LYNFTGKGDTDPKLDSNYIARLKLKCKPNDQT-TLVEMDPGSVRTFDIKYFDLIPKRRGL  238

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FTSDAALLDD ETKAY+  Q  T GSTFFKDFG SMVNMGRIGVLTG  GE+RKVC  VN
Sbjct  239   FTSDAALLDDSETKAYIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN  298



>ref|XP_002527239.1| Peroxidase 27 precursor, putative [Ricinus communis]
 gb|EEF35165.1| Peroxidase 27 precursor, putative [Ricinus communis]
Length=328

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 228/301 (76%), Gaps = 2/301 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL++GFY +TCP+ E IV +IA + I+  P+LA PLLRMHFHDCFVRGC+GSVLLDS  K
Sbjct  28    GLQLGFYRKTCPNAEYIVHDIAYKYISRDPTLAAPLLRMHFHDCFVRGCDGSVLLDSTKK  87

Query  400   -QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EK A PN +LRGF +ID +K  +E  CPG+VSCADILA+ ARD    + GP W V T
Sbjct  88    NQAEKAAIPNQTLRGFNVIDAIKFELERRCPGIVSCADILALAARDSVLMIGGPSWSVPT  147

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS  +EAL  L  PFANI  LKQ F  KGLSVKDLVVLSGGHTIGI HC   ++
Sbjct  148   GRRDGRVSISSEALNQLPSPFANINQLKQNFASKGLSVKDLVVLSGGHTIGIGHCFIISN  207

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RLYNFTGKGD DPSLDP YA +LK KC +   ++ +VEMDPGS +TFD  Y+T++AKRRG
Sbjct  208   RLYNFTGKGDTDPSLDPLYAAQLKKKC-KPGNSNTIVEMDPGSFKTFDEDYYTVVAKRRG  266

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAALL+D ET  Y+  QALT+G TF +DF  SMV MG IGVLTG+QGEIRK C  V
Sbjct  267   LFQSDAALLNDIETSTYVKLQALTNGITFAQDFANSMVKMGHIGVLTGNQGEIRKQCAFV  326

Query  1117  N  1119
             N
Sbjct  327   N  327



>emb|CDY55811.1| BnaCnng29190D [Brassica napus]
Length=319

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 227/302 (75%), Gaps = 9/302 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCPH E IV+++    +  AP+L  PLLRM FHDCFVRGC+GSVLLDS   
Sbjct  25    GLKVGFYSKTCPHAEGIVRKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSSNN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGF IID  K A+E+ CPG+VSC+DILA++ARD   A++GP WEVETG
Sbjct  85    QAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALIARDAMVALEGPSWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVSN+ E   NL  PF NI  L   F  KGL+ KDLV+LSGGHTIG+ HC   T+R
Sbjct  145   RRDGRVSNINEV--NLPSPFDNIAKLITDFRTKGLNEKDLVILSGGHTIGMGHCPLMTNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTG+GD+DPSLD  YA  L+ KC    PTD    +EMDPGS +TFD SYF L+AKRR
Sbjct  203   LYNFTGRGDSDPSLDSEYAANLRKKC---KPTDTTTALEMDPGSFKTFDVSYFKLVAKRR  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAALLD+ +T+AY++QQA   GSTFF DFG SMV MGRIGVLTG  GEIRK+C  
Sbjct  260   GLFQSDAALLDNSKTRAYVLQQA--RGSTFFHDFGVSMVKMGRIGVLTGRTGEIRKMCRV  317

Query  1114  VN  1119
              N
Sbjct  318   PN  319



>ref|XP_009604224.1| PREDICTED: peroxidase 27-like [Nicotiana tomentosiformis]
Length=324

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 237/323 (73%), Gaps = 3/323 (1%)
 Frame = +1

Query  157   SLEILIFLAFAC-CNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLR  333
             +L++L FL     C        G+ +GFY++TCP++E IVK+     I+ AP+LA PLLR
Sbjct  3     TLKLLSFLILQIFCILEVANSQGVELGFYKKTCPNVEAIVKQTTAHYISHAPTLAAPLLR  62

Query  334   MHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCAD  510
             MHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRGFQ+ID  K+A+E+ CPG+VSC+D
Sbjct  63    MHFHDCFVRGCDGSVLLNSTKGNQAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSD  122

Query  511   ILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSV  690
             ILA+ ARD    + GP W V  GRRDGRVS + +AL NL  PF N T LK  F   GL+V
Sbjct  123   ILALAARDAVELINGPTWAVPLGRRDGRVSILLDALKNLPTPFDNFTTLKTTFGSLGLNV  182

Query  691   KDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVE  870
             KDLVVLSGGHTIG+SHC SF+ RLYNFTGKGD DP++D NY  +LK+KC     T  +VE
Sbjct  183   KDLVVLSGGHTIGMSHCFSFSSRLYNFTGKGDMDPNMDQNYIGRLKIKCKPGDVT-TIVE  241

Query  871   MDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMV  1050
             MDPGS ++FDT Y+T+++KRR LF SDAALL D +TKAY++ Q   +GSTFFKDFGESM+
Sbjct  242   MDPGSFKSFDTDYYTMVSKRRRLFASDAALLTDSQTKAYILSQVNPYGSTFFKDFGESMI  301

Query  1051  NMGRIGVLTGDQGEIRKVCTAVN  1119
              MG+IGVLTG  GEIRK C   N
Sbjct  302   KMGKIGVLTGKAGEIRKHCAFRN  324



>ref|XP_009796690.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=324

 Score =   392 bits (1007),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 236/328 (72%), Gaps = 9/328 (3%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             KF  +L L+I   L  A          G+ VGFY++TCP++E IVK+     I+ AP+LA
Sbjct  5     KFLTFLILQIFCILKGANSQ-------GVEVGFYKKTCPNVEAIVKQTTAHYISRAPTLA  57

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
              PLLRMHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRGFQ+ID  K+A+E+ CPG+
Sbjct  58    APLLRMHFHDCFVRGCDGSVLLNSTKGNQAEKDAIPNQSLRGFQVIDAAKSALEQECPGI  117

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSC+DILA+ ARD    + GP W V  GRRDGRVS + +AL NL  PF N T LK  F  
Sbjct  118   VSCSDILALAARDAVELINGPTWAVPLGRRDGRVSILLDALKNLPTPFDNFTTLKTTFGS  177

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPT  855
              GL+VKDL VLSGGHTIG+SHC SF+ R+YNFTGKGD DP +D NY  +LK+KC     T
Sbjct  178   LGLNVKDLAVLSGGHTIGMSHCFSFSSRMYNFTGKGDTDPKMDQNYIGRLKIKCKPGDVT  237

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDF  1035
               +VEMDPGS ++FDT Y+T+++KRRGLF SDAALL D +TKAY++ Q   + STFFKDF
Sbjct  238   -TIVEMDPGSFKSFDTDYYTMVSKRRGLFASDAALLTDSQTKAYVLSQLNPYASTFFKDF  296

Query  1036  GESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             GESM+ MG+IGVLTG  GEIRK C   N
Sbjct  297   GESMIKMGKIGVLTGKAGEIRKHCAFRN  324



>ref|XP_009121602.1| PREDICTED: peroxidase 56 [Brassica rapa]
Length=329

 Score =   392 bits (1006),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 227/306 (74%), Gaps = 5/306 (2%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL+VGFY+ TCP  E IVK+     I    ++  PLLRM FHDCFVRGCEGSVLL+
Sbjct  27    TNAQGLKVGFYDNTCPKAEGIVKKSVLDAIKKDRTIGAPLLRMFFHDCFVRGCEGSVLLE  86

Query  388   SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWE  567
                K+ EK+APPN SLRGF+IID VK AVE+ CPGVVSC+D+LA+VARD   A+ GP W 
Sbjct  87    LKNKKDEKNAPPNLSLRGFEIIDNVKEAVEKECPGVVSCSDVLALVARDAVVALNGPSWG  146

Query  568   VETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSS  747
             VETGRRDGRV+N+ EA  NL  PF NIT L   F  KGL  KDLVVLSGGHT+G  HC  
Sbjct  147   VETGRRDGRVTNINEARANLPSPFDNITSLITQFRSKGLDKKDLVVLSGGHTVGNGHCPL  206

Query  748   FTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLI  921
              T+RLYNFTGKGD+DP+LD  YA  L+ +C    PTD    +EMDPGS +TFD SYF L+
Sbjct  207   ITNRLYNFTGKGDSDPNLDTEYAANLRGRC---KPTDTTTALEMDPGSFKTFDESYFKLV  263

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             ++RRG F SDAALLD++ETK+Y+++Q  ++GSTFFKDFG SMV MGRIGVLTG  GE+RK
Sbjct  264   SQRRGFFQSDAALLDNQETKSYVLKQTKSYGSTFFKDFGVSMVKMGRIGVLTGRAGEVRK  323

Query  1102  VCTAVN  1119
              C  VN
Sbjct  324   KCRMVN  329



>ref|NP_197022.1| peroxidase 56 [Arabidopsis thaliana]
 sp|Q9LXG3.1|PER56_ARATH RecName: Full=Peroxidase 56; Short=Atperox P56; AltName: Full=ATP33; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB89328.1| prx10 peroxidase-like protein [Arabidopsis thaliana]
 gb|AAL59994.1| putative prx10 peroxidase [Arabidopsis thaliana]
 gb|AAN13160.1| putative prx10 peroxidase [Arabidopsis thaliana]
 dbj|BAF00358.1| prx10 peroxidase - like protein [Arabidopsis thaliana]
 gb|AED92125.1| peroxidase 56 [Arabidopsis thaliana]
Length=329

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 238/327 (73%), Gaps = 8/327 (2%)
 Frame = +1

Query  154   LSLEILIFLAFACC---NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             +++   +FL    C   +   T   GL+VGFY++ CP  E IVK+   + +    ++A P
Sbjct  6     MTISCFLFLQVIYCLLSSFAPTNVQGLKVGFYDKACPKAELIVKKSVFEAVKNDRTIAAP  65

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRM FHDCFVRGCEGSVLL+   K+ EK++ PN +LRGF+IID VK A+E+ CPG+VSC
Sbjct  66    LLRMFFHDCFVRGCEGSVLLELKNKKDEKNSIPNLTLRGFEIIDNVKAALEKECPGIVSC  125

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +D+LA+VARD   A+ GP WEVETGRRDG V+N+TEAL NL  PF NI+ L   F  KGL
Sbjct  126   SDVLALVARDAMVALNGPSWEVETGRRDGLVTNITEALLNLPSPFNNISSLITQFQSKGL  185

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
               KDLVVLSGGHTIG  HC   T+RLYNFTGKGD+DP+LD  YA KL+ KC    PTD  
Sbjct  186   DKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYAVKLRGKC---KPTDTT  242

Query  865   --VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
               +EMDPGS +TFD SYF L+++RRGLF SDAALLD++ETK+Y+++   + GSTFFKDFG
Sbjct  243   TALEMDPGSFKTFDESYFKLVSQRRGLFQSDAALLDNQETKSYVLKSLNSDGSTFFKDFG  302

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMV MGRIGVLTG  GE+RK C  VN
Sbjct  303   VSMVKMGRIGVLTGQVGEVRKKCRMVN  329



>ref|XP_006286841.1| hypothetical protein CARUB_v10003841mg [Capsella rubella]
 gb|EOA19739.1| hypothetical protein CARUB_v10003841mg [Capsella rubella]
Length=330

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/307 (62%), Positives = 232/307 (76%), Gaps = 6/307 (2%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL+VGFY++ CP  E IVK++  + +   P+L  PLLRM FHDCFVRGCEGSVLL+
Sbjct  27    TNVQGLKVGFYDKACPKAELIVKKVVFEAMKKDPTLGAPLLRMFFHDCFVRGCEGSVLLE  86

Query  388   SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWE  567
                KQ EK++ PN +LRGF+IID  K A+E+ CPG+VSC+D+LAIVARD   A+ GP WE
Sbjct  87    LKNKQDEKNSIPNLTLRGFEIIDNAKAALEKECPGIVSCSDVLAIVARDAMVALNGPSWE  146

Query  568   VETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSS  747
             VETGRRDG V+N++EAL NL  PFANI+ L   F  KGL  KDLVVLSGGHTIG  HC  
Sbjct  147   VETGRRDGIVTNISEALLNLPSPFANISSLITQFQSKGLDKKDLVVLSGGHTIGNGHCPQ  206

Query  748   FTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLI  921
              T+RLYNFTGKGD+DP+LD  YA  L+ KC    PTD    +EMDPGS +TFD SYF L+
Sbjct  207   ITNRLYNFTGKGDSDPNLDTKYAAALRKKC---KPTDTTTALEMDPGSFKTFDGSYFKLV  263

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHG-STFFKDFGESMVNMGRIGVLTGDQGEIR  1098
             ++RRGLF SDAALLD++ETK+YL++Q  + G STFF+DFG SMV MGRIGVLTG+ G++R
Sbjct  264   SQRRGLFQSDAALLDNQETKSYLLKQMNSDGYSTFFEDFGVSMVKMGRIGVLTGEVGQVR  323

Query  1099  KVCTAVN  1119
             K C  VN
Sbjct  324   KKCRMVN  330



>ref|XP_008809845.1| PREDICTED: peroxidase 1-like [Phoenix dactylifera]
Length=326

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 235/304 (77%), Gaps = 8/304 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCP +E IV++   +VI+VAPSLAGPLLRMHFHDCFVRGC+GSVLL+S   
Sbjct  27    GLQVGFYSKTCPDIELIVRQEMTRVISVAPSLAGPLLRMHFHDCFVRGCDGSVLLNSTQN  86

Query  400   Q-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EKDAPPN SLRGF +ID+VK  +E+ACP  VSCADI+A+VARD     KGP+W V T
Sbjct  87    NVAEKDAPPNQSLRGFGVIDRVKARLEKACPMTVSCADIVALVARDAVFLTKGPFWPVPT  146

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS + +    L P  + I+ L   F  KGLSVKDLVVLSGGHT+G SHC++F++
Sbjct  147   GRRDGRVS-IAQETRQLPPSNSTISSLISSFASKGLSVKDLVVLSGGHTLGTSHCTAFSN  205

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKR  930
             R+YN+TG+GD DP+LD NY  KLK KC   +P DN  LVEMDPGS RTFDTSY+T ++KR
Sbjct  206   RIYNYTGRGDTDPNLDGNYIPKLKAKC---APNDNTTLVEMDPGSFRTFDTSYYTDVSKR  262

Query  931   RGLFTSDAALLDDEETKAYLVQQA-LTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             RGLF SDAALL + +T+AY+++QA    GS FFKDFG+SM+NMG I VLTG QGEIRK C
Sbjct  263   RGLFESDAALLQNSQTRAYVLRQAGGAFGSEFFKDFGDSMINMGNIQVLTGTQGEIRKTC  322

Query  1108  TAVN  1119
               VN
Sbjct  323   AFVN  326



>ref|XP_009117679.1| PREDICTED: peroxidase 27-like [Brassica rapa]
Length=319

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 226/302 (75%), Gaps = 9/302 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCPH E IV+++    +  AP+L  PLLRM FHDCFVRGC+GSVLLDS   
Sbjct  25    GLKVGFYSKTCPHAEGIVRKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSSNN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGF IID  K A+E+ CPG+VSC+DILA++ARD   A++GP WEVETG
Sbjct  85    QAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALIARDAMVALEGPSWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR SN+ E   NL  PF NI  L   F  KGLS KDLV+LSGGHTIG+ HC   T+R
Sbjct  145   RRDGRGSNINEV--NLPSPFDNIAKLIIDFRTKGLSEKDLVILSGGHTIGMGHCPLMTNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTG+GD+DPSLD  YA  L+ KC    PTD    +EMDPGS +TFD SYF L+AKRR
Sbjct  203   LYNFTGRGDSDPSLDSEYAANLRKKC---KPTDTTTALEMDPGSFKTFDVSYFKLVAKRR  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAALLD+ +T+AY++QQA   GSTFF DFG SMV MGRIGVLTG  GEIRK+C  
Sbjct  260   GLFQSDAALLDNSKTRAYVLQQA--RGSTFFHDFGVSMVKMGRIGVLTGRTGEIRKMCRV  317

Query  1114  VN  1119
              N
Sbjct  318   PN  319



>ref|XP_006408471.1| hypothetical protein EUTSA_v10021152mg [Eutrema salsugineum]
 gb|ESQ49924.1| hypothetical protein EUTSA_v10021152mg [Eutrema salsugineum]
Length=321

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/331 (60%), Positives = 235/331 (71%), Gaps = 12/331 (4%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MA   R +   + + L  A  N       GL+VGFY +TCP  E IV++I    +  AP+
Sbjct  1     MAACKRLVVSCLFLVLLLAEANAQ-----GLKVGFYGKTCPEAEGIVRKIVFAAMKKAPT  55

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPG  492
             L  PLLRM FHDCFVRGC+GSVLL+   KQ EK+A PN SLRGF IID  K A+E+ CPG
Sbjct  56    LGAPLLRMFFHDCFVRGCDGSVLLELSNKQDEKNAVPNLSLRGFGIIDDSKAALEKVCPG  115

Query  493   VVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFF  672
             +VSC+DILA+VARD   A++GP WEVETGRRDGRVSN+ E +  L  PF NI  L   F 
Sbjct  116   IVSCSDILALVARDAMVALEGPSWEVETGRRDGRVSNINEVI--LPSPFDNIAKLITDFR  173

Query  673   DKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESP  852
              KGL  KDLVVLSGGHTIG+ HC   ++RLYNFTG+GD+DPSLD  YA  L+ KC    P
Sbjct  174   SKGLDEKDLVVLSGGHTIGMGHCPLMSNRLYNFTGRGDSDPSLDSEYAANLRKKC---KP  230

Query  853   TDNL--VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFF  1026
             TD    +EMDPGS +TFD SYFTL+AKRRGLF SDAALLD+ +T+AY+ QQA THGSTFF
Sbjct  231   TDTTTALEMDPGSFKTFDESYFTLVAKRRGLFQSDAALLDNSKTRAYVFQQARTHGSTFF  290

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              DFG SMV MGRI VLTG  GEIRK+C   N
Sbjct  291   HDFGVSMVKMGRIEVLTGRAGEIRKMCRVPN  321



>ref|XP_010453647.1| PREDICTED: peroxidase 56-like [Camelina sativa]
Length=330

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/327 (59%), Positives = 235/327 (72%), Gaps = 8/327 (2%)
 Frame = +1

Query  154   LSLEILIFLAFACC---NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             +++   +FL    C   +   T   GL+VGFYE++CP  E IVK+   + +    +L  P
Sbjct  6     MTISCFVFLQVLSCVLSSFAPTSAQGLKVGFYEKSCPKAELIVKKSVFEAMKKDLTLGAP  65

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRM FHDCFVRGCEGS+LLD   K+ EK+A PN  LRGF+IID  K A+E+ CPG+VSC
Sbjct  66    LLRMFFHDCFVRGCEGSLLLDLKNKKDEKNAIPNLFLRGFEIIDDAKAALEKECPGIVSC  125

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +D+LA+VARD   A+ GP WEVETGRRDG VSN++EAL NL  PF NI+ L   F  KGL
Sbjct  126   SDVLALVARDAMVALNGPSWEVETGRRDGLVSNISEALSNLPSPFNNISSLITQFHSKGL  185

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
             + KDLVVLSGGHTIG  HC   T+RLYNFTGKGD+DP+LD  YA  L+ KC    PTD  
Sbjct  186   NKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYATSLRKKC---KPTDTT  242

Query  865   --VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
               +EMDPGS +TFD SYF L+++RRGLF SDAALLD++ETK+YL+ Q  +  STFFKDFG
Sbjct  243   TALEMDPGSFKTFDKSYFKLVSQRRGLFQSDAALLDNQETKSYLLNQMKSDRSTFFKDFG  302

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMV MGRIGVLTG  G+IRK C  VN
Sbjct  303   VSMVKMGRIGVLTGKAGQIRKNCRMVN  329



>emb|CDP20341.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/319 (61%), Positives = 233/319 (73%), Gaps = 7/319 (2%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             +L+ +AF  CN       GL++ FY++TCP  E  VK +    ++ AP+LA   LRMHFH
Sbjct  15    VLLPIAFQHCNAK-----GLKLDFYKKTCPGAEATVKHMMTGFMSRAPTLAASFLRMHFH  69

Query  346   DCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAI  522
             DCFVRGC+GSVLL+S  K + EKDA PN +LRG Q+ID +K+A+E+ CPGVVSCADILA+
Sbjct  70    DCFVRGCDGSVLLNSTRKSKSEKDAIPNQTLRGLQVIDTIKSALEKKCPGVVSCADILAL  129

Query  523   VARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLV  702
             VARD  + + GP+W V  GRRDGRVS M EAL NL PPFANIT LK  F  KGL+ KDL 
Sbjct  130   VARDAVSLLNGPFWIVPLGRRDGRVSLMNEALANLPPPFANITELKASFAAKGLNTKDLA  189

Query  703   VLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPG  882
             VLSGGHTIG +HC  F+ RLYNFTGKGD DPSLDP Y   LK KC  E  T  LVEM PG
Sbjct  190   VLSGGHTIGNAHCFVFSSRLYNFTGKGDTDPSLDPKYIPFLKKKCKPEDVT-TLVEMTPG  248

Query  883   SVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGR  1062
             + ++FD  Y+TLI K RGLF SDAALLDD +T+AY+  QA THGSTFF+DF  SMV +G+
Sbjct  249   NFKSFDEDYYTLITKGRGLFQSDAALLDDRQTRAYVKLQATTHGSTFFRDFAASMVKLGK  308

Query  1063  IGVLTGDQGEIRKVCTAVN  1119
             +GVLTG  GEIR+ C  VN
Sbjct  309   VGVLTGKAGEIRRHCALVN  327



>ref|XP_010908221.1| PREDICTED: peroxidase 1-like [Elaeis guineensis]
Length=329

 Score =   390 bits (1001),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 232/304 (76%), Gaps = 7/304 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L+VGFY+++CP  E I+++    ++++APSLAGPLLRMHFHDCFVRGC+ S+LL+  T  
Sbjct  28    LQVGFYQRSCPKAEEIIRKEMTAIMSLAPSLAGPLLRMHFHDCFVRGCDASILLNGTTNN  87

Query  403   -GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKD  PN SLRG+ +ID+VK  +E ACPG+VSCADILAIVARD     KGP+W+V TG
Sbjct  88    PAEKDGLPNLSLRGYGVIDRVKAQLEAACPGIVSCADILAIVARDAVFLTKGPFWDVPTG  147

Query  580   RRDGRVSNMTEALFNLLPPFANITV-LKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             RRDG++S  +E L NL PPF N T  L   F  KGL+ KDLVVLSGGHTIG SHCSSF+ 
Sbjct  148   RRDGKISIASETLTNLPPPFFNATQNLNLFFIPKGLNAKDLVVLSGGHTIGTSHCSSFSS  207

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKC-PEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             RLYNFTG GDADP LD +Y  KLK KC P ++ T  LVEMDPGS +TFDTSY+ L+AKRR
Sbjct  208   RLYNFTGNGDADPMLDKDYLPKLKSKCRPNDATT--LVEMDPGSFKTFDTSYYKLVAKRR  265

Query  934   GLFTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             GLFTSDA L+ D +TKAY+ +QA   G  S FFKDFGESMV MG IGVLTG+QGEIRK C
Sbjct  266   GLFTSDATLILDGQTKAYIERQAQASGFPSEFFKDFGESMVKMGNIGVLTGNQGEIRKRC  325

Query  1108  TAVN  1119
               VN
Sbjct  326   AFVN  329



>emb|CDX85056.1| BnaC05g19990D [Brassica napus]
Length=329

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 226/306 (74%), Gaps = 5/306 (2%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL+VGFY+ TCP  E IVK+     I    ++  PLLRM FHDCFVRGCEGSVLL+
Sbjct  27    TNAQGLKVGFYDNTCPKAEGIVKKSVLDAIKKDRTIGAPLLRMFFHDCFVRGCEGSVLLE  86

Query  388   SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWE  567
                K+ EK+APPN SLRGF+IID VK AVE+ CPGVVSC+D+LA+VARD   A+ GP W 
Sbjct  87    LKNKKDEKNAPPNLSLRGFEIIDNVKAAVEKECPGVVSCSDVLALVARDAVVALNGPSWG  146

Query  568   VETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSS  747
             VETGRRDGRV+N+ EA  NL  PF NI  L   F  KGL  KDLVVLSGGHT+G  HC  
Sbjct  147   VETGRRDGRVTNINEARANLPSPFDNIISLIAQFRSKGLDKKDLVVLSGGHTVGNGHCPL  206

Query  748   FTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLI  921
              T+RLYNFTGKGD+DP+LD  YA  L+ +C    PTD    +EMDPGS +TFD SYF L+
Sbjct  207   ITNRLYNFTGKGDSDPNLDTEYAANLRGRC---KPTDTTTALEMDPGSFKTFDKSYFKLV  263

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             ++RRG F SDAALLD++ETK+Y+++Q  ++GSTFFKDFG SMV MGRIGVLTG  GE+RK
Sbjct  264   SQRRGFFQSDAALLDNQETKSYVLKQTKSYGSTFFKDFGVSMVKMGRIGVLTGRAGEVRK  323

Query  1102  VCTAVN  1119
              C  VN
Sbjct  324   KCRMVN  329



>ref|XP_002871653.1| hypothetical protein ARALYDRAFT_909489 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47912.1| hypothetical protein ARALYDRAFT_909489 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 186/307 (61%), Positives = 230/307 (75%), Gaps = 3/307 (1%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL+VGFY + CP  E +VK+    ++   PSL  PLLR+ FHDCFVRGCEGSVLL+
Sbjct  27    TNAQGLKVGFYNKACPKAELVVKKSIFDMVKKDPSLGPPLLRLFFHDCFVRGCEGSVLLE  86

Query  388   SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWE  567
                K+ EK+APPN SL GF  ID +K A+E+ CPG+VSC+D+LA+VARDV  A+ GP WE
Sbjct  87    LKNKKAEKNAPPNLSLEGFDFIDNIKAALEKECPGIVSCSDVLALVARDVVVALNGPSWE  146

Query  568   VETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSS  747
             VETGRRDGRV+N+ EA  N+  PF+NIT L   F  KGL+ KDLVVLSG HT+G +HC  
Sbjct  147   VETGRRDGRVTNINEATSNMPSPFSNITTLITQFQSKGLNKKDLVVLSGAHTVGDAHCPI  206

Query  748   FTDRLYNFTGKGDADPSLDPNYAEKLKMKC-PEESPTDNLVEMDPGSVRTFDTSYFTLIA  924
               +RLYNFTGKGD+DPSLD  YA +L+ KC P ++ TD  +EMDPGS  TFD SYF L++
Sbjct  207   VRNRLYNFTGKGDSDPSLDKEYAARLRRKCKPTDTTTD--LEMDPGSFTTFDKSYFKLVS  264

Query  925   KRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             K+RGLF SDAALL+++ETK+Y++ Q   +GSTFFKDFG SMV +GRIGVLTG  GE+RK 
Sbjct  265   KQRGLFQSDAALLNNQETKSYVLMQTKRYGSTFFKDFGVSMVKLGRIGVLTGRVGEVRKN  324

Query  1105  CTAVNNY  1125
             C  VN Y
Sbjct  325   CRMVNKY  331



>ref|XP_006352037.1| PREDICTED: peroxidase 56-like, partial [Solanum tuberosum]
Length=641

 Score =   400 bits (1028),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 198/326 (61%), Positives = 242/326 (74%), Gaps = 10/326 (3%)
 Frame = +1

Query  148   RYLSLEIL-IFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             ++LS  IL +FL    C        G+ VGFY+QTCP++E IVKE     I++AP+LA P
Sbjct  324   KFLSFLILQLFLVANNCE-------GVEVGFYKQTCPNVEAIVKETTKHYISIAPTLAAP  376

Query  325   LLRMHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVS  501
             LLRMHFHDCFVRGC+GSVLL+S    + EKDA PN SLRGFQ+ID  K+A+E+ CPG+VS
Sbjct  377   LLRMHFHDCFVRGCDGSVLLNSTKGNKAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVS  436

Query  502   CADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKG  681
             C+DILA+ ARD  + + GP W V  GRRDGRVS ++EA  NL  PF N T LK  F   G
Sbjct  437   CSDILALAARDAVSLINGPTWSVPLGRRDGRVSILSEASKNLPTPFDNFTTLKTTFGALG  496

Query  682   LSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN  861
             L+VKDLVVLSGGHTIG+SHC SF+ RLYNFTGKGD DP++D NY  +LK+KC     T  
Sbjct  497   LNVKDLVVLSGGHTIGMSHCFSFSSRLYNFTGKGDMDPNMDQNYINRLKIKCKPGDVT-T  555

Query  862   LVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGE  1041
             +VEMDPGS ++FDT Y+++++KRRGLF SDAALL D +TK Y++ Q   HGSTFFKDFGE
Sbjct  556   IVEMDPGSFKSFDTDYYSMVSKRRGLFVSDAALLTDTQTKHYVLSQLNQHGSTFFKDFGE  615

Query  1042  SMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             SMV MG+IGVLTG+ GEIRK C   N
Sbjct  616   SMVKMGQIGVLTGNAGEIRKHCAFRN  641


 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 236/313 (75%), Gaps = 2/313 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT-  396
             G+ VGFY++TCP++E IVKE     I++AP+LA PLLRMHFHDCFVRGC+GSVLL+S   
Sbjct  15    GVEVGFYKKTCPNVEAIVKETTKHYISIAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKG  74

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              + EKDA PN SLRGFQ+ID  K+A+E+ CPG+VSC+DILA+ ARD  + + GP W V  
Sbjct  75    NKAEKDAIPNQSLRGFQVIDAAKSALEKECPGIVSCSDILALAARDAVSLINGPTWSVPL  134

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS ++EA  NL  PF N T LK  F   GL+VKDLVVLSGGHTIG+SHC SF+ 
Sbjct  135   GRRDGRVSILSEASKNLPTPFDNFTTLKTTFGALGLNVKDLVVLSGGHTIGMSHCFSFSS  194

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RLYNFTGKGD DP++D NY  +LK+KC     T  +VEMDPGS ++FDT Y+T+++KRRG
Sbjct  195   RLYNFTGKGDMDPNMDQNYINRLKIKCRPADVT-TIVEMDPGSFKSFDTDYYTMVSKRRG  253

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAALL D +TK Y++ Q   HGSTFFKDFGESMV MG+IG+LTG  GEIRK C  V
Sbjct  254   LFASDAALLTDTQTKHYVLSQLNPHGSTFFKDFGESMVKMGQIGILTGRAGEIRKHCDLV  313

Query  1117  NNYY*MLP*WKVL  1155
                + ++   K L
Sbjct  314   KRKHNIMATLKFL  326



>gb|KFK28588.1| hypothetical protein AALP_AA7G016800 [Arabis alpina]
Length=321

 Score =   389 bits (999),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 228/300 (76%), Gaps = 3/300 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCP  E IV+++    +  AP+L  PLLRM FHDCFVRGC+GSVLL+   K
Sbjct  25    GLKVGFYGKTCPKAEGIVRKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLELKNK  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGF IID  K A+E+ CPG+VSC+D+LA++ARD   A++GP WEVETG
Sbjct  85    QDEKNATPNLSLRGFGIIDDSKAALEKVCPGIVSCSDVLALIARDAMVALEGPSWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRV+N++E   NL  PF NIT L   F   GL  KDLVVLSGGHTIG+ HC   T+R
Sbjct  145   RRDGRVTNISEV--NLPSPFDNITKLITDFGTLGLDEKDLVVLSGGHTIGMGHCPLMTNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTG+GD+DPSLD  YA KL++KC + + T   +EMDPGS RTFD SYF+L+AKRRGL
Sbjct  203   LYNFTGRGDSDPSLDSEYAAKLRLKC-KPTDTTTALEMDPGSFRTFDVSYFSLVAKRRGL  261

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F SDAALLD+ +T+A++ + A THGSTFF DFG SMV MGRIGVLTG  GEIRK C   N
Sbjct  262   FQSDAALLDNSKTRAHVFKLARTHGSTFFTDFGVSMVKMGRIGVLTGRAGEIRKSCRVPN  321



>ref|XP_010267772.1| PREDICTED: peroxidase 56-like [Nelumbo nucifera]
Length=327

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 224/302 (74%), Gaps = 4/302 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SP  393
             GL+VGFY+ TCP  E IV+    Q +   PSLA PLLR+HFHDCFVRGC+GSVLL+  S 
Sbjct  28    GLKVGFYKDTCPRAEEIVRRTTAQYVTHLPSLAAPLLRLHFHDCFVRGCDGSVLLNATSA  87

Query  394   TKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVE  573
                 EK A PN SL GF ++D  K+ +E+ CPGVVSCADILA+VARD    + GP+W+V 
Sbjct  88    NPNPEKTAIPNQSLDGFFVVDVAKSRLEKECPGVVSCADILALVARDAVKLVNGPFWDVP  147

Query  574   TGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             TGRRDG VS   E+L NL PPF NIT LK  F  KGLSVKDLVVLSGGHTIG SHC SFT
Sbjct  148   TGRRDGTVSLALESLANLPPPFFNITSLKLSFLSKGLSVKDLVVLSGGHTIGQSHCPSFT  207

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             +RLYNFTGKGD+DPSLD NY  +LK  C +   T   VEMDPGS RTFD SY+ L+AKRR
Sbjct  208   NRLYNFTGKGDSDPSLDSNYVPRLKSAC-QPGDTTTQVEMDPGSYRTFDASYYKLVAKRR  266

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SD+ALL+D ETKAY+ + A   GSTFFKDFG SMVNMG IGVLTG  GEIRK C  
Sbjct  267   GLFQSDSALLNDAETKAYVFEAA-GSGSTFFKDFGVSMVNMGNIGVLTGTAGEIRKHCAF  325

Query  1114  VN  1119
             VN
Sbjct  326   VN  327



>ref|XP_011100418.1| PREDICTED: peroxidase 27-like [Sesamum indicum]
Length=328

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 226/302 (75%), Gaps = 3/302 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
              LR  FY +TCP LE +VK+   Q I+ APSLA  LLRMHFHDCFVRGC+GSVLL+S T 
Sbjct  28    NLRTNFYNKTCPSLESVVKKTTAQFISRAPSLAAALLRMHFHDCFVRGCDGSVLLNSTTS  87

Query  400   Q-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EKDA PN SLRGFQ+ID VK AVE+ CPG VSCADILA+VARD  + + GP W V  
Sbjct  88    NSAEKDAFPNQSLRGFQVIDAVKAAVEKTCPGRVSCADILALVARDAVSQINGPSWAVPL  147

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDG VS   EAL NL PP  NIT L   F  KGL+VKDLVVLSGGHTIG+SHCSSFT+
Sbjct  148   GRRDGNVSTANEALANLPPPNFNITQLIASFAAKGLTVKDLVVLSGGHTIGVSHCSSFTN  207

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RLYNFTG+ D DPS+DPNY   L+ +CP  + T  +V+MDPGS + FDT Y+TL+ KRRG
Sbjct  208   RLYNFTGRNDTDPSMDPNYVAALRRRCP-PADTTTIVQMDPGSFKNFDTDYYTLVRKRRG  266

Query  937   LFTSDAALLDDEETKAYL-VQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             L  +DAALL++  T AY+ +  + +  S+FFKDF ESMV MG+IGVLTG  G+IR++C+A
Sbjct  267   LLQTDAALLNNNVTSAYVQLHSSSSGDSSFFKDFAESMVKMGQIGVLTGSAGQIRRICSA  326

Query  1114  VN  1119
             +N
Sbjct  327   IN  328



>ref|XP_002871652.1| hypothetical protein ARALYDRAFT_325975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47911.1| hypothetical protein ARALYDRAFT_325975 [Arabidopsis lyrata subsp. 
lyrata]
Length=329

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 233/327 (71%), Gaps = 8/327 (2%)
 Frame = +1

Query  154   LSLEILIFLAFACC---NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             +++    FL    C   +   T   GL+VGFY++ CP  E IVK+   + I   P+L  P
Sbjct  6     MTISCFFFLQVISCLLSSFAPTNVQGLQVGFYDKACPKAELIVKKSVFEAINKDPTLGAP  65

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRM FHDCFVRGCEGS+LL+   K+ EK+A PN +LRGF+IID  K A+E+ CPG+VSC
Sbjct  66    LLRMFFHDCFVRGCEGSLLLELKNKKDEKNAIPNLTLRGFEIIDNAKAALEKECPGIVSC  125

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +D+LA+VARD   A+ GP WEVETGRRDG V+N+TE L NL  PF NI+ L   F  KGL
Sbjct  126   SDVLALVARDAMLALNGPSWEVETGRRDGLVTNITEVLLNLPSPFNNISSLITQFQSKGL  185

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
               KDLVVLSGGHTIG  HC   T+RLYNFTGKGD+DP+LD  YA  L+ KC    PTD  
Sbjct  186   DKKDLVVLSGGHTIGHGHCPQITNRLYNFTGKGDSDPNLDTKYAANLRRKC---KPTDTT  242

Query  865   --VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
               +EMDPGS +TFD SYF L+++RRGLF SDAALLD++ETK+YL++   +  STFFKDFG
Sbjct  243   TALEMDPGSFKTFDESYFKLVSQRRGLFQSDAALLDNQETKSYLLKHMNSDKSTFFKDFG  302

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMV MGRIGVLTG  GE+RK C  VN
Sbjct  303   VSMVKMGRIGVLTGQAGEVRKKCRMVN  329



>emb|CDY37537.1| BnaA05g34020D [Brassica napus]
Length=319

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 231/317 (73%), Gaps = 12/317 (4%)
 Frame = +1

Query  175   FLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCF  354
             FL F     +A G   L+VGFY +TCPH E IVK++    +  AP+L  PLLRM FHDCF
Sbjct  13    FLVFLLAEANAQG---LKVGFYSKTCPHAEGIVKKVVFAAMKKAPTLGAPLLRMFFHDCF  69

Query  355   VRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARD  534
             VRGC+GSVLLDS   Q EK+A PN SLRGF IID  K A+E+ CPG+VSC+DILA+VARD
Sbjct  70    VRGCDGSVLLDSSNNQAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARD  129

Query  535   VTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSG  714
                A++GP WEVETGRRDGRVSN+ E   NL  PF NI  L   F  KGL+ KDLVVLSG
Sbjct  130   AMVALEGPTWEVETGRRDGRVSNINEV--NLPSPFDNIAKLITDFRTKGLNEKDLVVLSG  187

Query  715   GHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSV  888
             GHTIG+ HC   ++RLYNFTG+GD+DPSLD  YA  L+ KC    PTD    +EMDPGS 
Sbjct  188   GHTIGMGHCPLMSNRLYNFTGRGDSDPSLDSEYATNLRKKC---KPTDTTTALEMDPGSF  244

Query  889   RTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIG  1068
             +TFD SYF L+AKRRGLF SDAALLD+ +T+A++++QA   GSTFF DFG SMV MGR G
Sbjct  245   KTFDVSYFKLVAKRRGLFQSDAALLDNSKTRAHVLEQA--RGSTFFHDFGVSMVKMGRTG  302

Query  1069  VLTGDQGEIRKVCTAVN  1119
             VLTG  GEIRK+C   N
Sbjct  303   VLTGRAGEIRKMCRVPN  319



>ref|XP_010679746.1| PREDICTED: peroxidase 27-like [Beta vulgaris subsp. vulgaris]
Length=330

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 228/304 (75%), Gaps = 5/304 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL VGFY  +CP +E I   +    ++VAPSL+GPLLRM FHDCFVRGC+ SVLLDSPT 
Sbjct  28    GLNVGFYANSCPLVESITSNVVKHTLSVAPSLSGPLLRMFFHDCFVRGCDASVLLDSPTN  87

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKD+ PN +LRG++IID+VK+A+E  CPGVVSCADI+A+V+RDV     G  W+VETG
Sbjct  88    QAEKDSIPNQTLRGYEIIDRVKSALEMHCPGVVSCADIIALVSRDVVVQTGGVSWKVETG  147

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS + EAL  L PPF NIT LK  F  KGLSVKDLVVLSG HTIGIS C++FT+R
Sbjct  148   RRDGRVSVLNEALSELPPPFFNITSLKSLFQRKGLSVKDLVVLSGAHTIGISQCAAFTNR  207

Query  760   LYNFTGKGDA---DPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKR  930
             LYNF+G GD    DP++DPNY   L+ KC    P +  VEMDPGS + FD  Y+ L++KR
Sbjct  208   LYNFSGTGDINSFDPTMDPNYVAALRKKCIRNGP-NVFVEMDPGSSKVFDGHYYELVSKR  266

Query  931   RGLFTSDAALLDDEETKAYLVQQALT-HGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             RGLF SDAALLD+ ET+ Y+    ++ +   FFKDF  SMVNMGRIGVLTG+ GEIRKVC
Sbjct  267   RGLFQSDAALLDNAETRNYVETHKISGNQGNFFKDFAVSMVNMGRIGVLTGNAGEIRKVC  326

Query  1108  TAVN  1119
             + +N
Sbjct  327   SRIN  330



>ref|XP_004251512.1| PREDICTED: peroxidase 27-like [Solanum lycopersicum]
Length=324

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 227/301 (75%), Gaps = 2/301 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             GL VGFY++TCP++E IVK+     +++AP+LA PLLRMHFHDCFVRGC+GSVLL+S  +
Sbjct  25    GLEVGFYKKTCPNVEKIVKKAVVDYVSIAPTLAAPLLRMHFHDCFVRGCDGSVLLNSTKS  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EKDA  N SLRGFQ+ID  K+A+E+ C GVVSCADILA+VARD  + + GP W+V  
Sbjct  85    NQAEKDAIANLSLRGFQVIDAAKSALEKQCLGVVSCADILALVARDAVSLINGPTWQVPL  144

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS ++EA  NL  PF N T LK  F   GLSVKDLVVLSGGHT+G+SHC SF  
Sbjct  145   GRRDGRVSILSEATTNLPTPFDNFTTLKTRFGSLGLSVKDLVVLSGGHTLGVSHCFSFGS  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             R+YNFTGKGD DP++D  Y  +LK KC     T   VEMDPGS +TFDT Y+ L++KRRG
Sbjct  205   RMYNFTGKGDMDPNMDQKYIAQLKTKCKPNDVTTT-VEMDPGSFKTFDTDYYNLVSKRRG  263

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDA LL +++TK Y++ Q  + GSTFF+DFG SMVNMG+IGVLT   GEIRK C  +
Sbjct  264   LFVSDATLLTNKQTKDYVLAQLSSRGSTFFEDFGVSMVNMGKIGVLTDKSGEIRKKCAFI  323

Query  1117  N  1119
             N
Sbjct  324   N  324



>emb|CDY43275.1| BnaC05g48680D [Brassica napus]
Length=319

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 227/302 (75%), Gaps = 9/302 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCPH E IVK++    +  AP+L  PLLRM FHDCFVRGC+GSVLLDS   
Sbjct  25    GLKVGFYSKTCPHAEGIVKKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSSNN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGF IID  K A+E+ CPG+VSC+DILA+VARD   A++GP WEVETG
Sbjct  85    QAEKNAVPNLSLRGFDIIDDSKAALEKVCPGIVSCSDILALVARDAMVALEGPTWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVSN+ E   NL  PF NI+ L   F  KGL+ KDLV+LSGGHTIG+ HC   ++R
Sbjct  145   RRDGRVSNINEV--NLPSPFDNISKLITDFRTKGLNEKDLVILSGGHTIGMGHCPLMSNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTG+GD+DPSLD  YA  L+ KC    PTD    +EMDPGS +TFD SYF L+AKRR
Sbjct  203   LYNFTGRGDSDPSLDSEYATSLRKKC---KPTDTTTALEMDPGSFKTFDVSYFKLVAKRR  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAALLD+ +T+A++++QA   GSTFF DFG SMV MGR GVLTG  GEIRK+C  
Sbjct  260   GLFQSDAALLDNSKTRAHVLEQA--RGSTFFHDFGVSMVKMGRTGVLTGRAGEIRKMCRI  317

Query  1114  VN  1119
              N
Sbjct  318   PN  319



>ref|XP_009147405.1| PREDICTED: peroxidase 27 [Brassica rapa]
Length=319

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/302 (64%), Positives = 226/302 (75%), Gaps = 9/302 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCPH E IVK++    +  AP+L  PLLRM FHDCFVRGC+GSVLLDS   
Sbjct  25    GLKVGFYSKTCPHAEGIVKKVVFAAMKKAPTLGAPLLRMFFHDCFVRGCDGSVLLDSSNN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK+A PN SLRGF IID  K A+E+ CPG+VSC+DILA+VARD   A++GP WEVETG
Sbjct  85    QAEKNAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARDAMVALEGPTWEVETG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVSN+ E   NL  PF NI  L   F  KGL+ KDLVVLSGGHTIG+ HC   ++R
Sbjct  145   RRDGRVSNINEV--NLPSPFDNIAKLITDFRTKGLNEKDLVVLSGGHTIGMGHCPLMSNR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTG+GD+DPSLD  YA  L+ KC    PTD    +EMDPGS +TFD SYF L+AKRR
Sbjct  203   LYNFTGRGDSDPSLDSEYATNLRKKC---KPTDTTTALEMDPGSFKTFDVSYFKLVAKRR  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAALLD+ +T+A++++QA   GSTFF DFG SMV MGR GVLTG  GEIRK+C  
Sbjct  260   GLFQSDAALLDNSKTRAHVLEQA--RGSTFFHDFGVSMVKMGRTGVLTGRAGEIRKMCRV  317

Query  1114  VN  1119
              N
Sbjct  318   PN  319



>gb|KFK37581.1| hypothetical protein AALP_AA3G001800 [Arabis alpina]
Length=320

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 234/325 (72%), Gaps = 8/325 (2%)
 Frame = +1

Query  145   SRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             S+ L +  L  +  A  N       GL+VGFY +TCP  E IVK++    +   P+L  P
Sbjct  4     SKLLVVSCLFLVLLAQVNAQ-----GLKVGFYGKTCPQAEGIVKKVVFAAMKKDPTLGAP  58

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRM FHDCFVRGC+GSVLL+   KQ EK+A PN SLRGF IID  K A+E+ACPG+VSC
Sbjct  59    LLRMFFHDCFVRGCDGSVLLELKNKQDEKNAAPNLSLRGFGIIDDSKAALEKACPGIVSC  118

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +D+LA+VARD   A++GP WEVETGRRDGRV+N++E   NL  PF NIT L   F   GL
Sbjct  119   SDVLALVARDAMVALEGPSWEVETGRRDGRVTNISEV--NLPSPFDNITKLINDFGTLGL  176

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
             + KDLVVLSGGHTIG+ HC   T+RLYNFTG+GD+DPSLD  YA KL+MKC + + T   
Sbjct  177   NEKDLVVLSGGHTIGMGHCPLMTNRLYNFTGRGDSDPSLDSEYAAKLRMKC-KPTDTTTA  235

Query  865   VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGES  1044
             +EMDPGS +TFD SYF+L+AKRRGLF SDAALLD+ +T+ +++  A  HGSTFF DFG S
Sbjct  236   LEMDPGSFKTFDVSYFSLVAKRRGLFQSDAALLDNSKTRGHVLTLARPHGSTFFTDFGVS  295

Query  1045  MVNMGRIGVLTGDQGEIRKVCTAVN  1119
             MV MGRIGVLTG  G IRK C   N
Sbjct  296   MVKMGRIGVLTGRTGGIRKTCRVPN  320



>ref|XP_010557013.1| PREDICTED: peroxidase 2-like [Tarenaya hassleriana]
Length=323

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 225/302 (75%), Gaps = 5/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GLR+ +Y   CP  E IV+ +  Q ++  PSLA  LLRMHFHDCFVRGC+GSVLL SP K
Sbjct  25    GLRLDYYRSKCPDAEAIVQRVTYQYVSRQPSLAASLLRMHFHDCFVRGCDGSVLLKSPNK  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN SLRG++++D  K+A+++ CPG+VSCAD+LA+VARD  + ++GP+W V  G
Sbjct  85    DAERDAIPNLSLRGYEVVDAAKSALDKKCPGLVSCADVLALVARDAVSVIRGPFWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS+ +E   NL  PFANI VLKQ F  KGL+ KDL VLSGGHTIGISHCS   +R
Sbjct  145   RRDGRVSSASEVFLNLPSPFANIAVLKQNFLAKGLNAKDLAVLSGGHTIGISHCSIIHNR  204

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD+DP+++P+Y   LK +C   +P D   +V+MDPGS +TFD+ YF ++A+++
Sbjct  205   IYNFTGKGDSDPTMNPSYVRTLKKRC---NPNDFTTIVDMDPGSGKTFDSHYFNVVAQKK  261

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSDA LLDD ETK Y+  Q  T GS+F KDF ESMV +G  GVLTG  GEIRK C  
Sbjct  262   GLFTSDATLLDDPETKTYVQTQVSTGGSSFAKDFAESMVKLGSTGVLTGKAGEIRKKCAF  321

Query  1114  VN  1119
             VN
Sbjct  322   VN  323



>ref|XP_008801172.1| PREDICTED: peroxidase 1-like [Phoenix dactylifera]
Length=328

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/310 (62%), Positives = 233/310 (75%), Gaps = 9/310 (3%)
 Frame = +1

Query  205   ATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLL  384
             A    GL+VGFY +TCP  E IV+E   ++++VAPSLAGPLLRMHFHDCFVRGC+GSVLL
Sbjct  23    AAAAQGLQVGFYSKTCPRAELIVREETTRIMSVAPSLAGPLLRMHFHDCFVRGCDGSVLL  82

Query  385   DSPTKQ--GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGP  558
             +S       EKDAPPN SLRGF +ID+VK  +E+ACP  VSCADILA+VARDV   +KGP
Sbjct  83    NSTGNNNVAEKDAPPNQSLRGFGVIDRVKARLEKACPQTVSCADILALVARDVVFLIKGP  142

Query  559   YWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISH  738
             YW+V TGRRDGRVS + +    L P  + I+ L   F  KGLSVKDLVVLSGGHT+G SH
Sbjct  143   YWQVPTGRRDGRVS-IAQETRQLPPSNSTISSLISSFQSKGLSVKDLVVLSGGHTLGTSH  201

Query  739   CSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYF  912
             C+ F++R+YN+TGKGD DP+LD NY  KL+ KC   +P DN  LVEMDPGS RTFD  Y+
Sbjct  202   CTQFSNRIYNYTGKGDTDPNLDRNYIPKLRAKC---APNDNTTLVEMDPGSFRTFDAGYY  258

Query  913   TLIAKRRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQG  1089
             T ++KRRGLF SDAALL + +T+AY+++ A       FFKDFG+SM++MG IGVLTG +G
Sbjct  259   THVSKRRGLFESDAALLQNSQTRAYVLRHARGAFAPEFFKDFGDSMISMGNIGVLTGTKG  318

Query  1090  EIRKVCTAVN  1119
             EIRK C  VN
Sbjct  319   EIRKTCAFVN  328



>ref|XP_009784557.1| PREDICTED: peroxidase 27-like [Nicotiana sylvestris]
Length=328

 Score =   384 bits (986),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 236/332 (71%), Gaps = 13/332 (4%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             KF  +L L+I   +  A          G+ VGFY++TCP++E IVK+     I+ AP+LA
Sbjct  5     KFLSFLILQIFCIIEVA-------NSQGVEVGFYKKTCPNVEAIVKQTTAHYISRAPTLA  57

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPT-KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
              PLLRMHFHDCFVRGC+GSVLL+S    Q EKDA PN SLRGFQ+ID  K+A+E+ CPG+
Sbjct  58    APLLRMHFHDCFVRGCDGSVLLNSTKGNQAEKDAIPNQSLRGFQVIDAAKSALEQECPGI  117

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSC+DILA+ ARD    + GP W V  GRRDGRVS + +AL NL  PF N T LK  F  
Sbjct  118   VSCSDILALAARDAVELINGPTWAVPLGRRDGRVSILLDALKNLPTPFDNFTTLKTTFGS  177

Query  676   KGLSVKDLVVLSGGHTIGIS----HCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPE  843
              GL+VKDL VLSGGHTIG+S    HC SF  RLYNFTGKGD DP++D NY  +LK+KC  
Sbjct  178   LGLNVKDLAVLSGGHTIGMSHCFXHCLSFGSRLYNFTGKGDTDPNMDQNYIGRLKIKCKP  237

Query  844   ESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
                T  +VEMDPGS ++FDT Y+T+++KRRGLF SDAALL D +TK+Y++ Q   + STF
Sbjct  238   GDVT-TIVEMDPGSFKSFDTDYYTMVSKRRGLFASDAALLTDSQTKSYVLSQLNPYTSTF  296

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             FKDFGESM+ MG+IGVLTG  GEIRK C   N
Sbjct  297   FKDFGESMIKMGKIGVLTGKAGEIRKHCALRN  328



>ref|XP_010543013.1| PREDICTED: peroxidase 2-like [Tarenaya hassleriana]
Length=330

 Score =   384 bits (985),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 235/337 (70%), Gaps = 10/337 (3%)
 Frame = +1

Query  115   FACISKMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQV  294
             F    KMA  S   +L +L  L  +     A    GL++ +Y   CP  E +V+ +  Q 
Sbjct  2     FRTAEKMATKSILAALVLLSILGTS-----AAKPWGLKLDYYRSKCPDAEAVVQRVTYQY  56

Query  295   IAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAV  474
             ++  PSLA  LLRMHFHDCFVRGC+GSVLL SP K  E+DA PN SLRG++++D  K+A+
Sbjct  57    VSRQPSLAAGLLRMHFHDCFVRGCDGSVLLKSPNKDAERDAIPNLSLRGYEVVDAAKSAL  116

Query  475   EEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITV  654
             E+ CPGVVSCAD++A+VARD  + ++GPYW V  GRRDGRVS   E   NL  PFANI V
Sbjct  117   EKKCPGVVSCADVIALVARDAVSVIRGPYWPVPLGRRDGRVSKALEVFTNLPSPFANIAV  176

Query  655   LKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMK  834
             LKQ F  KGL+VKDLVVLSGGHTIGISHCS   +RLYNFTGKGD DPS++P+Y   LK +
Sbjct  177   LKQNFLAKGLNVKDLVVLSGGHTIGISHCSIIHNRLYNFTGKGDFDPSMNPSYVRTLKKR  236

Query  835   CPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALT  1008
             C   +P D   +V+MDPGSV+ FD+ YF ++A+++GLFTSDA LLDD ETK Y+  Q  T
Sbjct  237   C---NPNDFATIVDMDPGSVKNFDSHYFNVVAQKKGLFTSDATLLDDPETKTYVETQVST  293

Query  1009  HGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              GS+F +DF +SM+ +G   VLTG  GEIRK C  VN
Sbjct  294   GGSSFARDFSDSMIKLGFTQVLTGKAGEIRKKCAFVN  330



>ref|XP_010492345.1| PREDICTED: peroxidase 56 [Camelina sativa]
Length=330

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 232/327 (71%), Gaps = 8/327 (2%)
 Frame = +1

Query  154   LSLEILIFLAFACC---NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             +++   +FL    C   +   T   GL+VGFY++ CP  E IVK+   + +    +L  P
Sbjct  6     MTISCFVFLQVLSCLLSSFAPTNAQGLKVGFYDKLCPKAELIVKKSIFEAMKKDLTLGAP  65

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRM FHDCFVRGCEGSVLLD   K+ EK+A PN  LRGF+IID  K A+E+ CPG+VSC
Sbjct  66    LLRMFFHDCFVRGCEGSVLLDLKNKKDEKNAIPNLFLRGFEIIDDAKAALEKECPGIVSC  125

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +D+LA+VARD   A+ GP WEVETGRRDG V+N+ EAL NL  PF NI+ L   F  KGL
Sbjct  126   SDVLALVARDAMVALNGPSWEVETGRRDGLVTNINEALSNLPSPFNNISSLITQFNSKGL  185

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
             + KDLVVLSGGHTIG  HC   T+RLYNFTGKGD+DPSLD  YA  L+  C    PTD  
Sbjct  186   NKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPSLDTEYAASLRKIC---KPTDTT  242

Query  865   --VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
               +EMDPGS +TFD SYF L+++RRGLF SDAALLD+++TK+YL+ Q  +  STFFKDFG
Sbjct  243   TALEMDPGSFKTFDESYFKLVSQRRGLFQSDAALLDNQKTKSYLLNQMKSDRSTFFKDFG  302

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMV MGRIGVLTG  G+IRK C  VN
Sbjct  303   VSMVKMGRIGVLTGKAGQIRKNCRMVN  329



>ref|XP_010420175.1| PREDICTED: peroxidase 56-like [Camelina sativa]
Length=330

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 231/327 (71%), Gaps = 8/327 (2%)
 Frame = +1

Query  154   LSLEILIFLAFACCNHHATGYG---GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             +++   +FL    C   +       GL+VGFY+ +CP  E IVK+   + +    +L  P
Sbjct  6     MTISCFVFLQVLSCLLSSFALSKALGLKVGFYDMSCPKAELIVKKSVFEAMKKDLTLGAP  65

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLRM FHDCFVRGCEGSVLLD   K+ EK+A PN  LRGF+IID  K A+E+ CPG+VSC
Sbjct  66    LLRMFFHDCFVRGCEGSVLLDLKNKKDEKNAIPNLFLRGFEIIDDAKAALEKECPGIVSC  125

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +D+LA+VARD    + GP WEVETGRRDG VSN++EAL NL  PF NI+ L   F  KGL
Sbjct  126   SDVLALVARDAMVVLNGPSWEVETGRRDGLVSNISEALSNLPSPFNNISSLITQFHSKGL  185

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
             + KDLVVLSGGHTIG  HC   T+RLYNFTGKGD+DP+LD  YA  L+  C    PTD  
Sbjct  186   NKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTGYATSLRKIC---KPTDTT  242

Query  865   --VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
               +EMDPGS +TFD SYF L++KRRGLF SDAALLD++ETK+YL+ Q  +  STFFKDFG
Sbjct  243   TALEMDPGSFKTFDESYFKLVSKRRGLFQSDAALLDNQETKSYLLNQMKSDRSTFFKDFG  302

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMV MGRIGVLTG  G+IRK C  VN
Sbjct  303   VSMVKMGRIGVLTGKAGQIRKNCRMVN  329



>ref|XP_002529736.1| Peroxidase 27 precursor, putative [Ricinus communis]
 gb|EEF32643.1| Peroxidase 27 precursor, putative [Ricinus communis]
Length=330

 Score =   382 bits (980),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 220/307 (72%), Gaps = 1/307 (0%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL + FY +TCP  E IV     Q ++   +LA PLLRMHFHDCFVRGC+GSVLL 
Sbjct  24    TNAWGLYMRFYRRTCPRAEFIVHRTVYQYVSRDATLAAPLLRMHFHDCFVRGCDGSVLLQ  83

Query  388   S-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYW  564
             S    Q EKDA PN +LRGF +ID +K+A+E  CPGVVSCADILA+ ARD    + GP+W
Sbjct  84    STKNNQAEKDAIPNQTLRGFNVIDAIKSAIERECPGVVSCADILALAARDAVLMIGGPFW  143

Query  565   EVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCS  744
              V TGRRDGRVS  +EAL  L  PFANIT LKQ F  KGL+VKDL VLSGGHTIGI HC 
Sbjct  144   AVPTGRRDGRVSIASEALTQLPSPFANITELKQNFAAKGLNVKDLAVLSGGHTIGIGHCF  203

Query  745   SFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIA  924
               ++RLYNFTG+GD DPSLDP YA +LK KC     T  +VEMDPGS  +FD +Y+T +A
Sbjct  204   IISNRLYNFTGRGDTDPSLDPIYAAQLKKKCKPGGSTKTIVEMDPGSFVSFDENYYTTVA  263

Query  925   KRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             KRRGLF SDAALLDD ET  Y+  Q+LT G TF +DF  SMV +G +G+LTG QGEIRK 
Sbjct  264   KRRGLFQSDAALLDDFETSTYVRLQSLTGGLTFARDFSASMVKLGYVGILTGKQGEIRKH  323

Query  1105  CTAVNNY  1125
             C  VN +
Sbjct  324   CGCVNKW  330



>ref|XP_008455410.1| PREDICTED: peroxidase 27-like [Cucumis melo]
Length=328

 Score =   382 bits (980),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 227/302 (75%), Gaps = 6/302 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L VGFY+  CP +E IV +   Q +   PS+A  LLRMHFHDCFVRGC+GSVLL+S P  
Sbjct  30    LAVGFYQDCCPGVEYIVAKTVAQYVKKQPSIAASLLRMHFHDCFVRGCDGSVLLNSLPNN  89

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDA PN SL+G+ ++D VK AVE+ CPGVVSCADILA++ARD      GP W+V TG
Sbjct  90    PAEKDAFPNLSLKGYNVVDAVKAAVEKQCPGVVSCADILALIARDAVRMSGGPVWKVPTG  149

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS   EAL NL PPFANI+ LK  FF KGLS+KDLVVLSG HTIG+SHC+SF++R
Sbjct  150   RRDGRVSISREALINLPPPFANISSLKSSFFSKGLSLKDLVVLSGSHTIGVSHCTSFSNR  209

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTGKGDADP LD  YA  LK KC    P D   +VEMDPGS +TFD SY+TL++KRR
Sbjct  210   LYNFTGKGDADPKLDKYYAIALKKKC---KPNDQKKIVEMDPGSFKTFDHSYYTLVSKRR  266

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SD+ALLDD +TKAY+  QA T G+TF  DF ESM+NMG IGVLTG  GEIR+ C  
Sbjct  267   GLFQSDSALLDDPDTKAYVQLQARTRGATFAADFAESMINMGNIGVLTGTDGEIRRRCGF  326

Query  1114  VN  1119
             VN
Sbjct  327   VN  328



>gb|EYU24800.1| hypothetical protein MIMGU_mgv1a010045mg [Erythranthe guttata]
Length=324

 Score =   381 bits (979),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 224/311 (72%), Gaps = 8/311 (3%)
 Frame = +1

Query  199   HHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSV  378
             HHA     L + FY +TCP +E IV       I+ APSLA  LLRMHFHDCFVRGC+GSV
Sbjct  18    HHANAQN-LALNFYRRTCPSVESIVNRTTASFISRAPSLAAALLRMHFHDCFVRGCDGSV  76

Query  379   LLDSPTKQ-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKG  555
             LL+S      E+D+ PN SLRGFQ+ID VKTAVE +CP  VSCADILA+VARD  + +KG
Sbjct  77    LLNSTANNTAERDSIPNLSLRGFQVIDAVKTAVERSCPRTVSCADILALVARDAVSQIKG  136

Query  556   PYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGIS  735
             P+W+V  GRRDG VS   EAL NL PPF N T L   F  KGL VKDLVVLSGGHTIG+S
Sbjct  137   PFWQVPLGRRDGNVSISNEALTNLPPPFFNATQLVASFAAKGLDVKDLVVLSGGHTIGVS  196

Query  736   HCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSY  909
             HCSSFT R+YNFTG+ DADP++DPNY   LK +CP   PTD   +V+MDPGS   FDT Y
Sbjct  197   HCSSFTTRIYNFTGRNDADPTMDPNYVAALKARCP---PTDTTTIVQMDPGSFDRFDTDY  253

Query  910   FTLIAKRRGLFTSDAALLDDEETKAYLVQQ-ALTHGSTFFKDFGESMVNMGRIGVLTGDQ  1086
             +T++ KRRGLF SDAALL +  T AY+ Q  + +  S+FF+DF  SMV MGRIGVLTG  
Sbjct  254   YTIVRKRRGLFESDAALLRNNVTNAYVQQHSSSSGSSSFFQDFAASMVKMGRIGVLTGTA  313

Query  1087  GEIRKVCTAVN  1119
             GEIR++C+  N
Sbjct  314   GEIRRICSVAN  324



>ref|XP_010923934.1| PREDICTED: peroxidase 1-like [Elaeis guineensis]
Length=326

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 231/304 (76%), Gaps = 8/304 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL++GFY +TCP++E IV++   +VI+VAPSLAGPLLRMHFHDCFVRGC+GSVLL+S   
Sbjct  27    GLQLGFYSKTCPNVELIVRQEMARVISVAPSLAGPLLRMHFHDCFVRGCDGSVLLNSTQN  86

Query  400   Q-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EKDAPPN SLRGF +ID++K  +E+ACP  VSCADI+A+VARD     KGP+W V T
Sbjct  87    NVAEKDAPPNQSLRGFGVIDRIKARLEKACPNTVSCADIIALVARDAVLLTKGPFWPVPT  146

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDG VS + +    L    + I+ L   F  KGLSVKDLVVLSGGHT+G SHC++F  
Sbjct  147   GRRDGSVS-IAQETRQLPTANSTISSLISSFASKGLSVKDLVVLSGGHTLGTSHCTAFQK  205

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKR  930
             R+ N+TG+GD DP+LD NY  KL+ KC   +P DN  LVEMDPGS RTFDTSY++L++KR
Sbjct  206   RISNYTGRGDTDPNLDSNYIPKLRAKC---APNDNTTLVEMDPGSFRTFDTSYYSLVSKR  262

Query  931   RGLFTSDAALLDDEETKAYLVQQA-LTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             RGLF SDAALL + +T+AY+++QA     S FFKDFG+SM+NMG I VLTG QGEIRK C
Sbjct  263   RGLFESDAALLQNSQTRAYVLRQAGGAFASEFFKDFGDSMINMGNIQVLTGAQGEIRKTC  322

Query  1108  TAVN  1119
               VN
Sbjct  323   AFVN  326



>gb|KDP41154.1| hypothetical protein JCGZ_03648 [Jatropha curcas]
Length=343

 Score =   380 bits (977),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 228/306 (75%), Gaps = 4/306 (1%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL++GFY+QTCP+ E IV  +  + I+  P+LA PLLRMHFHDCFVRGC+GSVLL+
Sbjct  40    TNSKGLQLGFYKQTCPNAELIVHNVVQKFISSDPTLAAPLLRMHFHDCFVRGCDGSVLLN  99

Query  388   S-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYW  564
             S  T Q EKDA PN +LRGF +ID +K+ +E  C GVVSCADILA+ ARD    + GP W
Sbjct  100   STSTNQAEKDAIPNQTLRGFNVIDAIKSEIENNCTGVVSCADILALAARDSVQMIGGPSW  159

Query  565   EVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCS  744
             +V TGRRDG VSN +EA   L  PFANIT LK+ F  KGLSV+DLVVLSG HTIGI  C 
Sbjct  160   DVPTGRRDGSVSNASEASAQLPSPFANITQLKKNFAAKGLSVEDLVVLSGAHTIGIGQCF  219

Query  745   SFTDRLYNFTGKGDADPSLDPNYAEKLKMKC-PEESPTDNLVEMDPGSVRTFDTSYFTLI  921
               +DRLYNF+G+GD DPSL+  YA +LK KC P +S T  +VEMDPGS RTFD+ Y+ ++
Sbjct  220   VISDRLYNFSGRGDTDPSLNATYAAELKTKCKPGDSTT--VVEMDPGSSRTFDSDYYNVV  277

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
               RRG+F SDAALL+D +T+ Y++ Q+  +G+TF +DFG SMV +GRIGVLTG QGEIRK
Sbjct  278   NTRRGIFQSDAALLNDIQTRTYVLLQSSPNGTTFKQDFGSSMVKLGRIGVLTGSQGEIRK  337

Query  1102  VCTAVN  1119
              C  VN
Sbjct  338   QCALVN  343



>emb|CDY10038.1| BnaC08g44130D [Brassica napus]
Length=332

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 227/303 (75%), Gaps = 7/303 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             GGL +G+Y   CP +E IV+ +  Q ++  P+LA  LLRMHFHDCFV+GC+GS+L+ SP 
Sbjct  35    GGLYLGYYRSKCPQVEYIVRRVTYQYVSANPTLAAALLRMHFHDCFVKGCDGSILITSPN  94

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             K  E+DAPPN SL+GF++++ VK+A+E  CPGVVSCAD+LA+VARD    ++GP+W V  
Sbjct  95    KDAERDAPPNLSLKGFEVVNAVKSAIESECPGVVSCADVLALVARDAVLVIRGPWWPVPL  154

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+S ++EA  NL  PFAN+  LK+ F DKGL+ KDLVVLSG HTIG+S C   + 
Sbjct  155   GRRDGRISKISEA--NLPSPFANVATLKKNFSDKGLNTKDLVVLSGAHTIGVSSCGLISK  212

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKR  930
             R+YNFTG+GD DP++DPNY  +LK +C    PTD   +V+MDPGSV  FD+ YF  +A++
Sbjct  213   RIYNFTGRGDFDPAMDPNYVMQLKKRC---QPTDVTTIVDMDPGSVNIFDSHYFDTVAEK  269

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             +GLF SD+ALL+D ETK Y+ +Q  THG TF +DF ESMV +G + +LTG+QGEIR+ C 
Sbjct  270   KGLFISDSALLNDWETKFYIQKQVYTHGFTFNRDFSESMVKLGSVQILTGNQGEIRRRCD  329

Query  1111  AVN  1119
              VN
Sbjct  330   LVN  332



>ref|XP_006288216.1| hypothetical protein CARUB_v10001453mg [Capsella rubella]
 gb|EOA21114.1| hypothetical protein CARUB_v10001453mg [Capsella rubella]
Length=324

 Score =   377 bits (968),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/327 (57%), Positives = 231/327 (71%), Gaps = 13/327 (4%)
 Frame = +1

Query  154   LSLEILIFLAFACC---NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGP  324
             +++  +I L    C   +   T   GL+VGFY++ CP  E IVK+   + +   P+L  P
Sbjct  6     MTISCVILLQVLSCLLSSFAPTNVQGLKVGFYDKACPKAELIVKKFVFEAMKKDPTLGAP  65

Query  325   LLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSC  504
             LLR+ FHDCFVRGCEGSVLL+   K+ EK+A PN SLRGF+IID  K A+E+ CPG+VSC
Sbjct  66    LLRLFFHDCFVRGCEGSVLLELKNKKDEKNAMPNLSLRGFEIIDNAKAALEKECPGIVSC  125

Query  505   ADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGL  684
             +D+LAIVARD   A+ GP WEVETGRRDG V+NM EAL NL  P +NI+ L   F  KGL
Sbjct  126   SDVLAIVARDAMVALNGPSWEVETGRRDGLVTNMYEALSNLPSPLSNISSLITRFHSKGL  185

Query  685   SVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL  864
               KDLVVLSG       HC    +RLYNFTGKGD+DP+LD  YA KL+ KC    PTDN 
Sbjct  186   DKKDLVVLSGK-----GHCPQIRNRLYNFTGKGDSDPNLDTKYAAKLRNKC---KPTDNT  237

Query  865   --VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
               +EMDPGS +TFD SYF  +++RRGLF SDAALLD++ETK+YL++Q  + GSTFFKDFG
Sbjct  238   MALEMDPGSFKTFDVSYFKRVSQRRGLFQSDAALLDNQETKSYLLKQMNSDGSTFFKDFG  297

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SMV MGRIGVLTG  G++RK C  VN
Sbjct  298   VSMVKMGRIGVLTGKVGQVRKKCRMVN  324



>ref|XP_010931148.1| PREDICTED: peroxidase 1 [Elaeis guineensis]
Length=322

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/305 (62%), Positives = 226/305 (74%), Gaps = 14/305 (5%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL+VGFY +TCP +E I+++   Q+I+VAPSLAGPLLRMHFHDCFVRGC+GSVLL+S  K
Sbjct  27    GLQVGFYSKTCPDVELIIRQEMTQIISVAPSLAGPLLRMHFHDCFVRGCDGSVLLNSTGK  86

Query  400   Q--GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVE  573
                 EKDAPPN +LRGF +ID++K  +E+ACP  VSCADI A+VARD     KGPYW V 
Sbjct  87    NNVAEKDAPPNLTLRGFGVIDRIKARLEKACPQTVSCADITALVARDAVFLTKGPYWPVP  146

Query  574   TGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             TGRRDGRVS + +    L PP + I+ L   F  KGLSVKDLVVLSG HT+G SHC  F+
Sbjct  147   TGRRDGRVS-IAQETRQLPPPNSTISSLISSFQSKGLSVKDLVVLSGAHTLGTSHCVQFS  205

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAK  927
             +R+YN T     DP+LD NY  KL+ KCP   P DN  LVEMDPGS RTFDT Y+T ++K
Sbjct  206   NRIYNST-----DPNLDSNYIPKLRAKCP---PNDNTTLVEMDPGSFRTFDTGYYTHVSK  257

Query  928   RRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             RRGLF SDAALL + +T+AY+++ A     S FFKDFG+SM+NMG IGVLTG QGEIRK 
Sbjct  258   RRGLFKSDAALLQNSQTRAYVLRHASGAFASEFFKDFGDSMINMGNIGVLTGTQGEIRKT  317

Query  1105  CTAVN  1119
             C  VN
Sbjct  318   CAFVN  322



>ref|XP_009126036.1| PREDICTED: peroxidase 56-like [Brassica rapa]
 emb|CDX85561.1| BnaA02g02520D [Brassica napus]
Length=330

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/306 (60%), Positives = 220/306 (72%), Gaps = 5/306 (2%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL+VGFY++TCP  E IVK+     +   P++  PLLRM FHDCFVRGC+GSVLL+
Sbjct  28    TNAQGLKVGFYDKTCPKAEAIVKKSVSDAMKNDPTIGAPLLRMFFHDCFVRGCDGSVLLE  87

Query  388   SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWE  567
                K+ EK+APPN SLRGF++ID VK AVEE CPGVVSC+D+LA+VARD    + G  W 
Sbjct  88    LKNKKDEKNAPPNLSLRGFEVIDNVKAAVEEECPGVVSCSDVLALVARDAVVELDGLSWG  147

Query  568   VETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSS  747
             VETGRRDGRV+N+ EA  NL  P  NIT L   F  KGL  KDL VLSGGHT+G  HC  
Sbjct  148   VETGRRDGRVTNINEARSNLPSPLNNITSLITQFSSKGLDKKDLAVLSGGHTVGQGHCPL  207

Query  748   FTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLI  921
               +RLYNFTGKGD+DP LD  YA  L+ KC    PTD    +EMDPGS +TFD SYF L+
Sbjct  208   ILNRLYNFTGKGDSDPDLDTEYAATLRKKC---KPTDTTTALEMDPGSFKTFDESYFKLV  264

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             ++RRG F SDAALL+++ETK+Y+++Q  + GSTF  DFG SMV MGRIGVLTG  GE+RK
Sbjct  265   SQRRGFFQSDAALLNNKETKSYVLKQMNSQGSTFSGDFGVSMVKMGRIGVLTGKAGEVRK  324

Query  1102  VCTAVN  1119
              C  VN
Sbjct  325   KCRMVN  330



>ref|XP_010271617.1| PREDICTED: peroxidase 27-like [Nelumbo nucifera]
Length=330

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 222/301 (74%), Gaps = 3/301 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L+VGFY +TCP  E I++      I   PSLA PLLR+ FHDCFVRGC+GSVLLDS    
Sbjct  30    LQVGFYRKTCPPAEAIIRNTTTPYILEDPSLAAPLLRVQFHDCFVRGCDGSVLLDSTENN  89

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             + EK + PN SLRGF +ID VK AVEEACPGVVSCADILA+V RD    +KGP+WEV TG
Sbjct  90    ETEKASGPNQSLRGFHVIDAVKAAVEEACPGVVSCADILALVVRDAVFMLKGPFWEVPTG  149

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS  +E   NL PP +NIT LK  F  KGLS KDLVVLSG HTIG SHCS F+DR
Sbjct  150   RRDGRVSIDSEITENLPPPSSNITRLKTSFKSKGLSTKDLVVLSGAHTIGRSHCSIFSDR  209

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNF+G+GD DPSLDP YA KLK KC     T  +VE+DPGS +TF+  Y+ ++A+ RG+
Sbjct  210   LYNFSGRGDTDPSLDPKYAIKLKKKCKRGDVT-TVVELDPGSFKTFNKDYYKVVAEGRGI  268

Query  940   FTSDAALLDDEETKAYLVQQALTH-GSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             F SDAALLDD ET+ Y++ QA +   STF KDF E+M+N+G IGV+TG +GEIRK C  V
Sbjct  269   FQSDAALLDDNETRDYVISQAASAVSSTFLKDFAEAMINLGNIGVITGTEGEIRKRCAFV  328

Query  1117  N  1119
             N
Sbjct  329   N  329



>gb|AHJ86268.1| peroxidase [Pinus massoniana]
Length=325

 Score =   374 bits (961),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 227/318 (71%), Gaps = 10/318 (3%)
 Frame = +1

Query  175   FLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCF  354
             FL FAC + +A G  GL++ FY+QTCP +  +V+E+    I+ AP+LA  LLRMHFHDCF
Sbjct  15    FLIFACASTNAAG--GLQLNFYDQTCPGVSNVVEEVVASYISRAPTLAAALLRMHFHDCF  72

Query  355   VRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVAR  531
             VRGC+GSVLL++  + + EKDAPPN +LRGFQ+ID  K AVE+ CPGVVSCADILA+VAR
Sbjct  73    VRGCDGSVLLNTTKSSKAEKDAPPNVTLRGFQVIDAAKAAVEKVCPGVVSCADILALVAR  132

Query  532   DVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLS  711
             D    + GP+W V TGRRDG VS   EA+  L PP A  + LK  F   GL VKDLVVLS
Sbjct  133   DAVHMLGGPFWNVPTGRRDGVVSIQNEAVAKLPPPNATFSKLKSIFASNGLDVKDLVVLS  192

Query  712   GGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGS  885
             G HTIGISHC+SF+ RLYNFTGKGD DPSLD NYA +LK+KC    P DN  +VEMDPGS
Sbjct  193   GEHTIGISHCNSFSGRLYNFTGKGDMDPSLDKNYAARLKIKC---KPGDNKTIVEMDPGS  249

Query  886   VRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRI  1065
              RTFDT+YF  + K R LF SDAALL D E ++Y+ QQ      +FF DF  SM  MGRI
Sbjct  250   FRTFDTNYFVNVKKNRVLFQSDAALLTDNEAQSYINQQ--LQYLSFFSDFAVSMEKMGRI  307

Query  1066  GVLTGDQGEIRKVCTAVN  1119
              VLTG  G+IR+ C   N
Sbjct  308   RVLTGTAGQIRRHCAFSN  325



>emb|CDP11799.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 223/303 (74%), Gaps = 6/303 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL V FYE+TCP LE IVK++  + I+  PSLA PLLRMHFHDCFVRGC+GSVLL+S +K
Sbjct  28    GLDVNFYEKTCPFLEFIVKDVTAKFISRTPSLAPPLLRMHFHDCFVRGCDGSVLLNSTSK  87

Query  400   -QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EK A PN  L G+Q+ID VK+AVE+ CPGVVSCADI+A+VARD    +KGP W+VE 
Sbjct  88    NQAEKAAIPNQLLTGYQVIDAVKSAVEKICPGVVSCADIVALVARDAVTLIKGPSWQVEL  147

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDG VS  +EAL  L  PF NIT LK  F   GLSVKDLVVLSGGHTIGISHC     
Sbjct  148   GRRDGTVSKASEALNKLPAPFMNITQLKASFQSVGLSVKDLVVLSGGHTIGISHCIGVNP  207

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RL+NFTGKGD DPSLDP Y  KLK +C     T  +++MD  + + FD  Y+T +++RRG
Sbjct  208   RLFNFTGKGDTDPSLDPKYLSKLKRQCKPGDVT-TILQMDR-TPKKFDIDYYTTVSQRRG  265

Query  937   LFTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             LF SDAALLDD ETK Y VQQ L+H    +FF DFG SMVNMGRIGVLTG  GEIRK C 
Sbjct  266   LFQSDAALLDDTETKTY-VQQHLSHAGSKSFFDDFGVSMVNMGRIGVLTGKNGEIRKQCA  324

Query  1111  AVN  1119
              VN
Sbjct  325   FVN  327



>emb|CDP11800.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 223/303 (74%), Gaps = 6/303 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             GL V FYE+TCP LE IVK+   + I+  PSLA PLLRMHFHDCFVRGC+GSVLL+S  +
Sbjct  28    GLDVNFYEKTCPSLEYIVKDATAKFISRTPSLAPPLLRMHFHDCFVRGCDGSVLLNSTSS  87

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
              Q EK A PN  LRGFQ+ID VK+AVE+ CPGVVSCADI+A+VARD  A +KGP W+VE 
Sbjct  88    NQAEKAAIPNQFLRGFQVIDAVKSAVEKKCPGVVSCADIVALVARDAVALIKGPSWQVEL  147

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDG VS  +EAL  L  PF N+T LK  F   GLSVKDLVVLSGGHTIGISHC     
Sbjct  148   GRRDGTVSIASEALNKLPSPFMNMTQLKASFQSVGLSVKDLVVLSGGHTIGISHCIGVNP  207

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             RL+NFTGKGD DPSLDP Y  +LK +C     T  +++MD  S + FD  Y+T +++RRG
Sbjct  208   RLFNFTGKGDTDPSLDPKYLAQLKRQCKPGDIT-TILQMDR-SPKKFDIDYYTTVSQRRG  265

Query  937   LFTSDAALLDDEETKAYLVQQALTHGS--TFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             LF SDAALLDD ETK Y +QQ L+H    +FF DFG SMVNMGRIGVLTG  GEIRK C 
Sbjct  266   LFQSDAALLDDTETKTY-IQQHLSHAGSMSFFADFGVSMVNMGRIGVLTGKNGEIRKQCA  324

Query  1111  AVN  1119
              VN
Sbjct  325   FVN  327



>gb|EPS63360.1| hypothetical protein M569_11425 [Genlisea aurea]
Length=333

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 239/336 (71%), Gaps = 15/336 (4%)
 Frame = +1

Query  142   FSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
             FSR + L + +   +A CN  A   GGL + +Y +TCP +E IV+   ++++++AP+LA 
Sbjct  3     FSRKI-LMVSLLCIYASCNADAQ-RGGLSLDYYIETCPSVEEIVRSETERIMSIAPTLAA  60

Query  322   PLLRMHFHDCFVR------GCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEE  480
             PLLR+HFHDCFVR      GC+GSVLL+S    + EKD+PPNF+LRG+  I++VK AVEE
Sbjct  61    PLLRLHFHDCFVRVSSYDIGCDGSVLLNSTKNSKAEKDSPPNFTLRGYGSIERVKAAVEE  120

Query  481   ACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLK  660
              CPGVVSCADI+A+VARD  + +KGPYW+V  GRRDGR+SN +EAL N+  P  N T LK
Sbjct  121   KCPGVVSCADIVALVARDAVSILKGPYWKVPLGRRDGRISNASEALANIPAPTFNFTQLK  180

Query  661   QGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCP  840
               F  KGL+ KDLVVLSG HTIG SHCS+   RLYNF+G G  DPS+DP Y  +LK +C 
Sbjct  181   ASFAVKGLTSKDLVVLSGSHTIGTSHCSTIATRLYNFSGTGAPDPSMDPEYVARLKSRC-  239

Query  841   EESPTDN--LVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQ-ALTH  1011
                PTDN  LVEMDPGS RTFD  Y+  + KRRGLFTSD+ LL D    +Y+ +Q +L  
Sbjct  240   --RPTDNTTLVEMDPGSFRTFDLHYYENVGKRRGLFTSDSTLLSDGLAGSYVRRQGSLAT  297

Query  1012  GSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              + FF+DF +SMV +G IGVLTG +GEIRK C AVN
Sbjct  298   AAEFFEDFSDSMVKLGSIGVLTGKEGEIRKRCDAVN  333



>emb|CDX75919.1| BnaC03g40020D [Brassica napus]
Length=324

 Score =   372 bits (954),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/302 (59%), Positives = 224/302 (74%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
              L + FY+  CP  E IV+ I DQ ++  PSLA  LLR+HFHDCFVRGC+GSVLL SP K
Sbjct  23    NLDLNFYKNRCPDAEAIVRRITDQYVSHQPSLAAALLRLHFHDCFVRGCDGSVLLKSPNK  82

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA P+ SLRG+Q++D  KTA+E+ CPGVVSCAD+LA+VARD   A+ GP W V  G
Sbjct  83    DAERDALPSLSLRGYQVVDAAKTALEKKCPGVVSCADVLALVARDAVLAINGPGWAVPLG  142

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR S  +E   NL  PF  I  LKQ F DKGL+ KDLVVLS GHTIGIS+C     R
Sbjct  143   RRDGRFSRKSEV--NLPSPFTGIAALKQNFSDKGLTSKDLVVLSAGHTIGISNCGLINRR  200

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD D S+ P+Y  +LK +C    PTD  + VEMDPG+V+TFD++YF ++A+R+
Sbjct  201   IYNFTGKGDFDTSMKPSYVRELKRRC---KPTDFTSSVEMDPGNVKTFDSNYFNIVAQRK  257

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF+SD+ALLDD ETK+Y+  Q  T GS+F +DF ESMVN+G + +LTG++GEIRK C++
Sbjct  258   GLFSSDSALLDDPETKSYIDTQVATAGSSFNEDFSESMVNLGFVEILTGNKGEIRKRCSS  317

Query  1114  VN  1119
             VN
Sbjct  318   VN  319



>emb|CAA80502.1| peroxidase [Spirodela polyrhiza]
Length=329

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 226/306 (74%), Gaps = 8/306 (3%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPT  396
             LRVGFY ++CPH E I+ E  D+ I VAPS+ GPLLR+ FHDCFVRGC+ S+LL+  S +
Sbjct  25    LRVGFYSKSCPHAESIITEEIDRAIRVAPSIGGPLLRLFFHDCFVRGCDASLLLNATSSS  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EKDAPPN  LRGF +ID++K  +E ACP  VSCADILA++ARDV  A +GP+W+V T
Sbjct  85    NPTEKDAPPNQFLRGFALIDRIKARLERACPSTVSCADILALIARDVVHADQGPFWQVPT  144

Query  577   GRRDGRVSNMTEALFNLLPPF-ANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             GRRDG VS  +EA   LLP F ANI+ LK  F D GLS KDLV+LSGGHTIG +HC +FT
Sbjct  145   GRRDGFVSIASEAT-QLLPAFSANISTLKSQFNDVGLSAKDLVLLSGGHTIGNAHCFTFT  203

Query  754   DRLYNFTGKG---DADPSLDPNYAEKLKMKCPEE-SPTDNLVEMDPGSVRTFDTSYFTLI  921
              RLYNF+G+G   D DPSL+ NY  KL+ KC ++ S    LVEMDPGS  TFD SYF L+
Sbjct  204   TRLYNFSGRGDNSDTDPSLERNYLAKLRAKCAQDGSDALKLVEMDPGSFTTFDNSYFKLV  263

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             AKRRGLF SDAALLDD +T+++++  A +  S FFK+F  +MVNMG I VLTG QGEIRK
Sbjct  264   AKRRGLFQSDAALLDDADTRSHVIHLAESDNSVFFKEFAGAMVNMGNIAVLTGSQGEIRK  323

Query  1102  VCTAVN  1119
              C  VN
Sbjct  324   NCARVN  329



>emb|CDX91005.1| BnaC02g05920D [Brassica napus]
Length=330

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 219/306 (72%), Gaps = 5/306 (2%)
 Frame = +1

Query  208   TGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD  387
             T   GL+VGFY++TCP  E IVK+     +   P++  PLLRM FHDCFVRGC+GSVLL+
Sbjct  28    TNAQGLKVGFYDKTCPKAEAIVKKSVSDAMKNDPTIGAPLLRMFFHDCFVRGCDGSVLLE  87

Query  388   SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWE  567
                K+ EK+APPN SLRGF++ID VK AVE+ CPGVVSC+D+LA+VARD    + G  W 
Sbjct  88    LKNKKDEKNAPPNLSLRGFEVIDNVKAAVEKECPGVVSCSDVLALVARDAVVELDGLSWG  147

Query  568   VETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSS  747
             VETGR DGRV+N+ EA  NL  P  NIT L   F  KGL  KDL VLSGGHT+G  HC  
Sbjct  148   VETGRNDGRVTNINEARSNLPSPLDNITSLITQFSSKGLDKKDLAVLSGGHTVGQGHCPL  207

Query  748   FTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLI  921
               +RLYNFTGKGD+DP LD  YA  L+ KC    PTD    +EMDPGS +TFD SYF L+
Sbjct  208   ILNRLYNFTGKGDSDPDLDTEYAATLRKKC---KPTDTTTALEMDPGSFKTFDESYFKLV  264

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             ++RRG F SDAALL++++TK+Y+++Q  +  STF KDFG SMV MGRIGVLTG  GE+RK
Sbjct  265   SQRRGFFQSDAALLNNQDTKSYVLKQMNSQRSTFSKDFGVSMVKMGRIGVLTGKAGEVRK  324

Query  1102  VCTAVN  1119
              C  VN
Sbjct  325   KCRMVN  330



>ref|XP_006855827.1| hypothetical protein AMTR_s00037p00025630 [Amborella trichopoda]
 gb|ERN17294.1| hypothetical protein AMTR_s00037p00025630 [Amborella trichopoda]
Length=325

 Score =   370 bits (949),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 219/301 (73%), Gaps = 3/301 (1%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT-  396
             GL++GFY + CP  E I+++   + +  AP+LA PLLRMHFHDCFVRGC+ S+LL+S   
Sbjct  27    GLKLGFYNKICPQAEQIIQKTIARYVLRAPTLAAPLLRMHFHDCFVRGCDASLLLNSTKG  86

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EKD P N SLRGF I D VK AVE+ CPGVVSCADI+A+ ARD  + + GP W+V T
Sbjct  87    NTAEKDHPSNLSLRGFYIFDAVKEAVEKVCPGVVSCADIVALAARDAVSLIHGPTWDVPT  146

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS +++ L N   PF NIT LKQ F  KGL  KDL VLSGGHTIG SHC+ F+ 
Sbjct  147   GRRDGRVSKISDILSNSPSPFMNITQLKQMFSAKGLDSKDLAVLSGGHTIGNSHCTGFSY  206

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             R+Y+FTGKGD DP+LD  Y  KLK KC +   T  LVEMDPGS RTFDT Y++LI KRRG
Sbjct  207   RIYSFTGKGDTDPALDSKYIPKLKAKC-KPGDTTTLVEMDPGSFRTFDTHYYSLIQKRRG  265

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SD+ALL+D  T AY +  A+   +TFFKDF  SMV MG++GVLTG+ GEIRKVC  +
Sbjct  266   LFVSDSALLNDPVTNAY-ITTAVASPATFFKDFAASMVKMGKVGVLTGNAGEIRKVCYKI  324

Query  1117  N  1119
             N
Sbjct  325   N  325



>ref|XP_009405647.1| PREDICTED: peroxidase 1-like [Musa acuminata subsp. malaccensis]
Length=328

 Score =   369 bits (948),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 218/306 (71%), Gaps = 10/306 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL VG+Y +TCP  E IV E   ++I VAPSLAGPLLRMHFHDCFVRGC+GSVLL+S T 
Sbjct  27    GLSVGYYSKTCPQAEAIVFEEMTKIIEVAPSLAGPLLRMHFHDCFVRGCDGSVLLNSTTG  86

Query  400   Q-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EKDA PN SLRG+ +ID+VK  +E+ACPGVVSCADILA+VARD     KGP+W V T
Sbjct  87    NVAEKDARPNLSLRGYGVIDRVKAKLEKACPGVVSCADILALVARDAVVLSKGPFWPVPT  146

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDG VS   E    L PP ANIT L   F  +GLSVKDLVVLSGGHTIGISHC++F  
Sbjct  147   GRRDGVVSIANETR-QLPPPTANITTLISMFAAQGLSVKDLVVLSGGHTIGISHCAAFNA  205

Query  757   RLYNFTGKG---DADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLI  921
             RLYNFTGK    D DPSLD  Y  KL+  C    P D    VEMDPGS RTFDT Y+ L+
Sbjct  206   RLYNFTGKATPTDVDPSLDKYYLAKLRTIC---KPNDFVTFVEMDPGSFRTFDTDYYKLV  262

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             AKRRGLF SDA LL    TKAY++  A      FFKDFG+SM+NMG IGVLTG  G IR+
Sbjct  263   AKRRGLFHSDAELLQHPLTKAYVLSHAGASEPEFFKDFGDSMINMGNIGVLTGSVGVIRR  322

Query  1102  VCTAVN  1119
              C+ VN
Sbjct  323   QCSVVN  328



>ref|XP_010679747.1| PREDICTED: peroxidase 27-like [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   367 bits (942),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 220/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL VGFY  +C  +E I   +  Q ++VAPSL+GPLL+M FHDCFVRGC+ S+LLDSPT 
Sbjct  28    GLNVGFYANSCSLVESITSNVVKQTLSVAPSLSGPLLKMFFHDCFVRGCDASILLDSPTN  87

Query  400   QGEKDAPPNFSLR-GFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             Q EKDA PN + R GF+IID+VK+A+E  CPG+VSCADI+A+V+RDV     G  WEVET
Sbjct  88    QAEKDADPNKTYRSGFEIIDRVKSALEMHCPGIVSCADIIALVSRDVVVQTGGASWEVET  147

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS   EA   L P  ++IT LK  F  KGLSVKDLVVLSG HT+GISHC++F  
Sbjct  148   GRRDGRVSLRNEAFSELPPAASDITFLKLLFLQKGLSVKDLVVLSGAHTLGISHCAAFEK  207

Query  757   RLYNFTGKGD---ADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAK  927
             RLYNF G GD    DP +DP+Y   L+ KC   +  D  V+MDPGS + FD  Y+ L++K
Sbjct  208   RLYNFDGTGDINSTDPKMDPDYVAALRKKCTNNN-NDTFVQMDPGSSKVFDGHYYELVSK  266

Query  928   RRGLFTSDAALLDDEETKAYLVQQALT-HGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             RRGL  SDAALLDD+ET+ Y+    +  +  +FFKDF  SMVN+GR+GVLTG+ GEIRKV
Sbjct  267   RRGLLESDAALLDDDETRKYVETHKIKGNQKSFFKDFAISMVNLGRVGVLTGNAGEIRKV  326

Query  1105  CTAVN  1119
             C+  N
Sbjct  327   CSRTN  331



>gb|ABK26805.1| unknown [Picea sitchensis]
Length=324

 Score =   366 bits (939),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 229/332 (69%), Gaps = 11/332 (3%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MAK +  L      FL FAC    A G  GL + FY++TCP +  +V+ +    I+ AP+
Sbjct  1     MAKMATIL-FSAASFLIFACSLTDAAG--GLELNFYDKTCPGVSNVVEAVIAHYISKAPT  57

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             LA PLLRMHFHDCFVRGC+GSVLL+S  +++ EK+A PN +LRGFQ+ID  K AVE+ CP
Sbjct  58    LAAPLLRMHFHDCFVRGCDGSVLLNSTKSRKAEKEAAPNLTLRGFQVIDAAKAAVEKVCP  117

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADILA+VARD    + GP+W V TGRRDG VS   EA+  L PP    + LK  F
Sbjct  118   GVVSCADILALVARDAVHMLGGPFWNVPTGRRDGVVSIQNEAVAKLPPPNGTFSKLKSIF  177

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEES  849
                GL VKDLVVLSGGHTIG+SHC+SF+ RLYNFTGKGD DPSLD +YA  LK+KC    
Sbjct  178   ASNGLDVKDLVVLSGGHTIGMSHCNSFSSRLYNFTGKGDMDPSLDKSYAAHLKIKC---K  234

Query  850   PTDN--LVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
             P DN  +VEMDPGS RTFDT Y+  + K RGLF SDAALL + E ++Y + + L   S+F
Sbjct  235   PGDNKTIVEMDPGSFRTFDTHYYVNVKKNRGLFQSDAALLTNNEAQSY-INKGL-ESSSF  292

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
               DF  SM  MGRIGVLTG  G+IR+ C   N
Sbjct  293   LWDFARSMEKMGRIGVLTGTAGQIRRHCAFTN  324



>ref|XP_006418048.1| hypothetical protein EUTSA_v10008157mg [Eutrema salsugineum]
 gb|ESQ36401.1| hypothetical protein EUTSA_v10008157mg [Eutrema salsugineum]
Length=332

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 221/301 (73%), Gaps = 3/301 (1%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             GGL + +Y   CP  E IV+ +  Q ++  PSLA  LLRM+FHDCFVRGC+ S+LL SP 
Sbjct  35    GGLDLDYYRFKCPQAEAIVRRVTFQYVSRRPSLAAALLRMYFHDCFVRGCDASLLLKSPN  94

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             K  E+DA PN ++RG++++D  K+A+E  CPGVVSCAD+LA+VARD    +KGP+W V  
Sbjct  95    KDAERDAVPNLTVRGYEVVDAAKSALERKCPGVVSCADVLALVARDAVLVIKGPWWPVPL  154

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+S ++E   NL  PFA++  LKQ FF KGL+ KDLVVLSG HTIGIS C     
Sbjct  155   GRRDGRISKLSEV--NLPSPFADVNALKQDFFAKGLNTKDLVVLSGAHTIGISSCGLINR  212

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             R++NFTGKGD DPS++P+Y  +LK +C   +PT  +VEMDPGSV+ FD+ YF ++A+++G
Sbjct  213   RIHNFTGKGDFDPSMNPSYVRQLKKRCKPTTPT-TIVEMDPGSVKKFDSHYFNIVAQKKG  271

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SD+ LLDD ETK Y+ +Q +T G++F KDF ESM+ +G + +LTG QGEIRK C  V
Sbjct  272   LFKSDSTLLDDLETKLYIQKQVVTRGASFAKDFSESMLKLGFVEILTGTQGEIRKKCAFV  331

Query  1117  N  1119
             N
Sbjct  332   N  332



>emb|CDY65912.1| BnaAnng21310D [Brassica napus]
Length=321

 Score =   365 bits (936),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 219/302 (73%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y++ CP  E IV+    Q ++   SLA  LLRMHFHDCFVRGC+GS+LL SPTK
Sbjct  25    GLDLNYYKRRCPDAEAIVRRTTVQYVSRQTSLAAALLRMHFHDCFVRGCDGSILLKSPTK  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN S+RG++++D  K A+E+ CPGVVSCAD+LA+VARD    + GP+W V  G
Sbjct  85    DAERDAIPNLSVRGYEVVDAAKAALEKKCPGVVSCADVLALVARDAVLVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  PFA I  LK+ FFDKGL+ KDLVVLSG HTIGIS+C     R
Sbjct  145   RRDGRISRKSEV--NLPSPFAGIAALKKNFFDKGLNTKDLVVLSGAHTIGISNCGLINSR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD DPS++P+Y   LK +C    PTD    +EMDPGSV+ FD+ YF ++A+++
Sbjct  203   IYNFTGKGDFDPSMNPSYVRALKKRC---KPTDFKTSLEMDPGSVKKFDSHYFNIVAQKK  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD ETK Y+  Q  T GS+F KDF ESMV +G + +LTG++GEIR+ C  
Sbjct  260   GLFTSDSTLLDDAETKTYIDTQVSTAGSSFNKDFSESMVKLGFVEILTGNKGEIRRKCAF  319

Query  1114  VN  1119
             VN
Sbjct  320   VN  321



>emb|CDY65910.1| BnaAnng21290D [Brassica napus]
Length=336

 Score =   365 bits (936),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/302 (55%), Positives = 222/302 (74%), Gaps = 7/302 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             G L + +Y   CP +E IV+ +  Q ++  P+LA  LLRMHFHDCFVRGC+GS+L+ SP 
Sbjct  39    GNLDLDYYRYKCPQMEDIVRRVTIQYVSPKPTLAAALLRMHFHDCFVRGCDGSILIKSPN  98

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                E+DAPPN +L+G++++D VK+A+E ACPGVVSCAD+LA+VARD    ++GP+W V  
Sbjct  99    NDAERDAPPNLTLKGYEVVDAVKSALEIACPGVVSCADVLALVARDAVLVIRGPWWPVPL  158

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+S ++EA  NL  PFAN+  LK+ F DKGL+ KDLVVLSG HTIG+S C   + 
Sbjct  159   GRRDGRISRISEA--NLPSPFANVDTLKKNFSDKGLNTKDLVVLSGAHTIGVSSCGLISS  216

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKR  930
             R+YNFTG+GD DP+++PNY ++LK +C    PTD   +V+MDPGSV  FD+ YF  + +R
Sbjct  217   RIYNFTGRGDFDPAMNPNYVKELKKRC---QPTDVKTIVDMDPGSVDKFDSHYFDAVDQR  273

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             +GLF SD+ALL+D ETK Y+  Q    G++F +DF ESMV +G IG+LTGDQGE+R  C 
Sbjct  274   KGLFISDSALLNDWETKLYVKTQVWARGASFNRDFAESMVKLGFIGILTGDQGEVRNRCD  333

Query  1111  AV  1116
              V
Sbjct  334   RV  335



>ref|XP_009118606.1| PREDICTED: peroxidase 2-like [Brassica rapa]
Length=321

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 218/302 (72%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+    Q ++   SLA  LLRMHFHDCFVRGC+GS+LL SPTK
Sbjct  25    GLDLNYYKHRCPDAEAIVRRTTVQYVSRQTSLAAALLRMHFHDCFVRGCDGSILLKSPTK  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN S+RG++++D  K A+E+ CPGVVSCAD+LA+VARD    + GP+W V  G
Sbjct  85    DAERDAIPNLSVRGYEVVDAAKAALEKKCPGVVSCADVLALVARDAVLVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  PFA I  LK+ FFDKGL+ KDLVVLSG HTIGIS+C     R
Sbjct  145   RRDGRISRKSEV--NLPSPFAGIAALKKNFFDKGLNTKDLVVLSGAHTIGISNCGLINSR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD DPS++P+Y   LK +C    PTD    +EMDPGSV+ FD+ YF ++A+++
Sbjct  203   IYNFTGKGDFDPSMNPSYVRALKKRC---KPTDFRTSLEMDPGSVKKFDSHYFNIVAQKK  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD ETK Y+  Q  T GS+F KDF ESMV +G + +LTG++GEIR+ C  
Sbjct  260   GLFTSDSTLLDDAETKTYIDTQVSTAGSSFNKDFSESMVKLGFVEILTGNKGEIRRKCAF  319

Query  1114  VN  1119
             VN
Sbjct  320   VN  321



>emb|CDY59801.1| BnaAnng16320D [Brassica napus]
Length=336

 Score =   365 bits (936),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/302 (55%), Positives = 222/302 (74%), Gaps = 7/302 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             G L + +Y   CP +E IV+ +  Q ++  P+LA  LLRMHFHDCFVRGC+GS+L+ SP 
Sbjct  39    GNLDLDYYRYKCPQMEDIVRRVTIQYVSPKPTLAAALLRMHFHDCFVRGCDGSILIKSPN  98

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                E+DAPPN +L+G++++D VK+A+E ACPGVVSCAD+LA+VARD    ++GP+W V  
Sbjct  99    NDAERDAPPNLTLKGYEVVDAVKSALEIACPGVVSCADVLALVARDAVLVIRGPWWPVPL  158

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+S ++EA  NL  PFAN+  LK+ F DKGL+ KDLVVLSG HTIG+S C   + 
Sbjct  159   GRRDGRISRISEA--NLPSPFANVDTLKKNFSDKGLNTKDLVVLSGAHTIGVSSCGLISS  216

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKR  930
             R+YNFTG+GD DP+++PNY  +LK +C    PTD   +V+MDPGSV  FD+ YF  + +R
Sbjct  217   RIYNFTGRGDFDPAMNPNYVMELKKRC---QPTDVKTIVDMDPGSVDKFDSHYFDAVDQR  273

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             +GLF SD+ALL+D ETK Y+  Q  T G++F +DF ESMV +G +G+LTGDQGE+R  C 
Sbjct  274   KGLFISDSALLNDWETKLYIKTQVWTRGASFNRDFAESMVKLGFVGILTGDQGEVRSRCD  333

Query  1111  AV  1116
              V
Sbjct  334   LV  335



>ref|XP_009118605.1| PREDICTED: peroxidase 2-like [Brassica rapa]
Length=320

 Score =   364 bits (934),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 219/304 (72%), Gaps = 8/304 (3%)
 Frame = +1

Query  217   GGLRVGFYE-QTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSP  393
             G L  G+Y    CP +E IV+ +    I   P+LA  LLRMHFHDCFVRGC+GSVL+ SP
Sbjct  22    GDLYEGYYRYNNCPQMEDIVRNVTYHYIYKDPTLAAALLRMHFHDCFVRGCDGSVLIKSP  81

Query  394   TKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVE  573
                 E+DA PN SLRG++++D VK+ +E  CPGVVSCADILA+VARD   A+KGP+W V 
Sbjct  82    NNDAERDAIPNLSLRGYEVVDTVKSVLESECPGVVSCADILALVARDAVLAIKGPWWPVP  141

Query  574   TGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
              GRRDGRVSN++EA  NL  PFAN+T LK+ F DKGL+ KDLVVLSG HTIG+S C   +
Sbjct  142   LGRRDGRVSNISEA--NLPSPFANVTTLKKNFADKGLNTKDLVVLSGAHTIGVSSCGLIS  199

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAK  927
              R+YNFTGKGD+DP+++PNY  +LK +C    PTD    V+MDP SV  FD+ YF  +A+
Sbjct  200   SRIYNFTGKGDSDPAMNPNYVAELKKRC---QPTDVTTSVDMDPTSVDKFDSHYFNAVAE  256

Query  928   RRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             ++GLF SD+ LLDD ET  Y+ +Q L +G  F KDF +SMV +G +GVLTGDQGEIR  C
Sbjct  257   KKGLFISDSTLLDDWETNLYIQKQVLLNGFYFNKDFSDSMVKLGFVGVLTGDQGEIRNQC  316

Query  1108  TAVN  1119
               VN
Sbjct  317   DRVN  320



>gb|KFK42858.1| hypothetical protein AALP_AA1G048400 [Arabis alpina]
Length=320

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 223/302 (74%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP +E  V+ + +Q ++  PSLA  LLRMHFHDCFVRGC+ S+LL SP K
Sbjct  24    GLNLDYYKYKCPGVEATVRRVTEQYVSRQPSLAAALLRMHFHDCFVRGCDASLLLKSPNK  83

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN S+RG++++D  K A+E+ CPGVVSCAD+L++VARD    ++GP+W V  G
Sbjct  84    DAERDAIPNLSVRGYEVVDAAKAALEKKCPGVVSCADVLSLVARDAVLVIRGPWWPVPLG  143

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +EA  NL  PF  I  LK+ F  KGL+VKDLVVLSG HTIGIS C+    R
Sbjct  144   RRDGRISRKSEA--NLPSPFVGIGELKKNFRVKGLNVKDLVVLSGAHTIGISSCALINTR  201

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD+DPS++P+Y   LK KC    PTD    +EMDPGSV+TFD+ Y+T +A+++
Sbjct  202   IYNFTGKGDSDPSMNPSYVRSLKKKC---KPTDFRTPLEMDPGSVKTFDSHYYTAVAQKK  258

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ALLDD ET++Y+  Q  T GS+F KDF +SMV +G I +LTG++GEIRK C  
Sbjct  259   GLFTSDSALLDDPETRSYIETQVGTGGSSFAKDFSDSMVKLGLIEILTGNKGEIRKKCAF  318

Query  1114  VN  1119
             VN
Sbjct  319   VN  320



>ref|XP_009398185.1| PREDICTED: peroxidase 27-like [Musa acuminata subsp. malaccensis]
Length=320

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 219/306 (72%), Gaps = 9/306 (3%)
 Frame = +1

Query  205   ATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLL  384
             A   GGLRVG+Y QTCP  E I+     ++I  APSL GPLLR+HFHDCFVRGC+ SVLL
Sbjct  23    AEAQGGLRVGYYSQTCPKAEAIINAEMRKIIKYAPSLGGPLLRLHFHDCFVRGCDASVLL  82

Query  385   DSPTKQG-EKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPY  561
             +S   Q  EKD  PN SL G+ +ID VK  +E+ACPGVVSCADILA+VARDV A  KGPY
Sbjct  83    NSANGQAAEKDGIPNQSLGGYGVIDVVKVKLEKACPGVVSCADILALVARDVVALSKGPY  142

Query  562   WEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHC  741
             W+V TGRRDG VS  +EA F L  P   I+ L Q F  KGLSV+DLVVLSG HTIG+SHC
Sbjct  143   WQVPTGRRDGTVSIASEA-FQLPRPTDGISQLIQNFAGKGLSVQDLVVLSGAHTIGVSHC  201

Query  742   SSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLI  921
             SSF+ R+Y       +DPS+DP YA  L+MKC  +  T  LV+MDPGSV TFDT Y+  +
Sbjct  202   SSFSSRIYG------SDPSIDPKYAATLRMKCKPKDLT-TLVQMDPGSVTTFDTGYYKQV  254

Query  922   AKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             +  RGL  SDAALL + +TKAY+++Q+    S FFKDFG+SMV MG IGVLTG  G+IRK
Sbjct  255   SGNRGLLNSDAALLQNPQTKAYVLRQSTGSASQFFKDFGDSMVKMGNIGVLTGAAGQIRK  314

Query  1102  VCTAVN  1119
              C AVN
Sbjct  315   KCFAVN  320



>emb|CDY49516.1| BnaC05g03280D [Brassica napus]
Length=321

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 219/302 (73%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+ +  Q ++   SLA  LLR++FHDCFVRGC+GSVLL SP K
Sbjct  25    GLDLNYYKHRCPDAEAIVRRVTVQYVSRQTSLAAALLRVYFHDCFVRGCDGSVLLKSPNK  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN SLRG++++D  K+A+E+ CPGVVSCAD+LA+VARD    + GP+W V  G
Sbjct  85    DAERDAIPNLSLRGYEVVDAAKSALEKKCPGVVSCADVLALVARDAVLVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  PFA I  LK+ FFDKGL+ KDLVVLSG HTIGIS+C     R
Sbjct  145   RRDGRISRKSEV--NLPSPFAGIAALKKNFFDKGLNTKDLVVLSGAHTIGISNCGLINSR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD DPS++P+Y   LK +C    PTD    VEMDPGSV+ FD+ YF ++++++
Sbjct  203   IYNFTGKGDFDPSMNPSYVRTLKKRC---KPTDFRTSVEMDPGSVKKFDSHYFNIVSQKK  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD ETK Y+  Q  T GS+F KDF ESMV +G + +LTG++GEIR+ C  
Sbjct  260   GLFTSDSTLLDDPETKRYIDTQVATAGSSFNKDFSESMVKLGFVEILTGNKGEIRRKCAF  319

Query  1114  VN  1119
             VN
Sbjct  320   VN  321



>emb|CDY46843.1| BnaA10g03270D [Brassica napus]
Length=321

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 219/302 (73%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+ +  Q ++   SLA  LLR++FHDCFVRGC+GSVLL SP K
Sbjct  25    GLDLNYYKHRCPDAEAIVRRVTVQYVSRQTSLAAALLRVYFHDCFVRGCDGSVLLKSPNK  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN SLRG++++D  K+A+E+ CPGVVSCAD+LA+VARD    + GP+W V  G
Sbjct  85    DAERDAIPNLSLRGYEVVDAAKSALEKKCPGVVSCADVLALVARDAVLVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  PFA I  LK+ FFDKGL+ KDLVVLSG HTIGIS+C     R
Sbjct  145   RRDGRISRKSEV--NLPSPFAGIAALKKNFFDKGLNTKDLVVLSGAHTIGISNCGLINSR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD DPS++P+Y   LK +C    PTD    VEMDPGSV+ FD+ YF ++++++
Sbjct  203   IYNFTGKGDFDPSMNPSYVRTLKKRC---KPTDFRTTVEMDPGSVKKFDSHYFNIVSQKK  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD ETK Y+  Q  T GS+F KDF ESMV +G + +LTG++GEIR+ C  
Sbjct  260   GLFTSDSTLLDDPETKRYIDTQVATAGSSFNKDFSESMVKLGFVEILTGNKGEIRRKCAF  319

Query  1114  VN  1119
             VN
Sbjct  320   VN  321



>ref|XP_006418049.1| hypothetical protein EUTSA_v10008202mg [Eutrema salsugineum]
 gb|ESQ36402.1| hypothetical protein EUTSA_v10008202mg [Eutrema salsugineum]
Length=324

 Score =   362 bits (928),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 218/303 (72%), Gaps = 7/303 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             GGL + +Y   CP  E IV+ I  Q ++  PS A  LLRM+FHDCFVRGC+ S+LL SP 
Sbjct  27    GGLDLNYYRSKCPQAEAIVRRITFQYVSHRPSFAAALLRMYFHDCFVRGCDASLLLKSPN  86

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             K  E+DA PN ++RG++++D  KTA+E  CPGVVSCAD+LA+VARD  + +KGP+W V  
Sbjct  87    KDAERDAIPNLTVRGYEVVDAAKTALERKCPGVVSCADVLALVARDAVSVIKGPWWPVPL  146

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGRVS ++E   NL  PFA++  LKQ FF KGL+ KDLVVLSG HTIGIS C   + 
Sbjct  147   GRRDGRVSKLSEV--NLPSPFADVNALKQDFFAKGLNTKDLVVLSGAHTIGISSCGLISR  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKR  930
             R++NFTG GD DPS++P+Y  +LK +C    PTD   +V MDPGS + FD+ YF ++A++
Sbjct  205   RIHNFTGNGDFDPSMNPSYVRQLKKRC---KPTDRSTMVAMDPGSFKKFDSHYFNVVAQK  261

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             RGLFTSD+ LLDD ETK Y+  Q  T G++F KDF ESMV +G + +LTG QGEIRK C 
Sbjct  262   RGLFTSDSTLLDDVETKHYIQTQVETSGASFDKDFSESMVKLGFVEILTGTQGEIRKRCA  321

Query  1111  AVN  1119
              VN
Sbjct  322   FVN  324



>gb|EYU24799.1| hypothetical protein MIMGU_mgv1a019406mg [Erythranthe guttata]
Length=328

 Score =   362 bits (928),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 232/334 (69%), Gaps = 11/334 (3%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLA-FACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             MA   +++   +L+ L+ F  C+        L+ GFY+ TCP  E IVK+   ++I+VAP
Sbjct  1     MAFTYKHVIFNVLVLLSIFNTCHTEE-----LKFGFYKNTCPSAEAIVKQETSRIISVAP  55

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSP-TKQGEKDAPPNFSLRGFQIIDKVKTAVEEAC  486
             SLA   LRMHFHDCFVRGC+GSVLLDS    + EKD+ PN SLRGF  I +VK+ VE+ C
Sbjct  56    SLAAAFLRMHFHDCFVRGCDGSVLLDSTRNNKAEKDSFPNLSLRGFGSIARVKSTVEKQC  115

Query  487   PGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQG  666
             PGVVSCADILA++ARD  +   G +W V  GRRDGRVS  +E L NL  P  NI+ LK  
Sbjct  116   PGVVSCADILALLARDAISDKHGAFWPVRLGRRDGRVSKSSEVLANLPAPNFNISQLKAS  175

Query  667   FFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEE  846
             F  KG + KDLVVLSG HTIG+SHCSSF++RLYNFTGKGD+DP+L+ NY   L  +C + 
Sbjct  176   FASKGFTTKDLVVLSGAHTIGVSHCSSFSNRLYNFTGKGDSDPALESNYTAFLMRRC-KR  234

Query  847   SPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHG---S  1017
                 +LVEMDP S + FDTSY+  +A ++GLFTSD++LL D ET+AY+ + A T      
Sbjct  235   MDVGSLVEMDPRSYKVFDTSYYKAVANKKGLFTSDSSLLADGETRAYVTRHAATPDRGLK  294

Query  1018  TFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             +FF DF +SMV M  IGVLTG++GEIRK C+ VN
Sbjct  295   SFFGDFAKSMVKMSEIGVLTGNRGEIRKTCSFVN  328



>ref|XP_009119176.1| PREDICTED: peroxidase 2-like [Brassica rapa]
Length=321

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 219/302 (73%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+ +  Q ++   SLA  LLR++FHDCFVRGC+GSVLL SP K
Sbjct  25    GLDLNYYKHRCPDAEAIVRRVTVQYVSRQTSLAAALLRVYFHDCFVRGCDGSVLLKSPNK  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN SLRG++++D  K+A+E+ CPGVVSCAD+LA+VARD    + GP+W V  G
Sbjct  85    DAERDAIPNLSLRGYEVVDAAKSALEKKCPGVVSCADVLALVARDAVLVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  PFA I  L++ FFDKGL+ KDLVVLSG HTIGIS+C     R
Sbjct  145   RRDGRISRKSEV--NLPSPFAGIAALRKKFFDKGLNTKDLVVLSGAHTIGISNCGLINSR  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD DPS++P+Y   LK +C    PTD    VEMDPGSV+ FD+ YF ++++++
Sbjct  203   IYNFTGKGDFDPSMNPSYVRTLKKRC---KPTDFRTSVEMDPGSVKKFDSHYFNIVSQKK  259

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD ETK Y+  Q  T GS+F KDF ESMV +G + +LTG++GEIR+ C  
Sbjct  260   GLFTSDSTLLDDPETKRYIDTQVATAGSSFNKDFSESMVKLGFVEILTGNKGEIRRKCAF  319

Query  1114  VN  1119
             VN
Sbjct  320   VN  321



>ref|XP_006594891.1| PREDICTED: peroxidase 39-like [Glycine max]
Length=326

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 228/333 (68%), Gaps = 10/333 (3%)
 Frame = +1

Query  130   KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             KM    R+LSL +L  +A        + +  L++GFY Q+CP  E I+ +   + I  AP
Sbjct  2     KMGSNLRFLSLCLLALIA--------STHAQLQLGFYAQSCPKAEKIILKFVHEHIHNAP  53

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLA  L+RMHFHDCFVRGC+GSVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CP
Sbjct  54    SLAAALIRMHFHDCFVRGCDGSVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECP  113

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADIL + ARD   A  GPYW+V TGRRDG +SN+ EA  N+  PF NIT L+  F
Sbjct  114   GVVSCADILTLAARDTIVATGGPYWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLF  173

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEE  846
              ++GL +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  KC + 
Sbjct  174   ANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCKDL  233

Query  847   SPTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
             S  +   +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TK+ ++Q        F
Sbjct  234   SKLNTTKIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKSQIIQLLEGTVENF  293

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
               +F  S+  MGRI V TG +GEIRK C  VN+
Sbjct  294   SAEFATSIEKMGRINVKTGTEGEIRKHCAFVNS  326



>ref|XP_006306557.1| hypothetical protein CARUB_v10012652mg [Capsella rubella]
 gb|EOA39455.1| hypothetical protein CARUB_v10012652mg [Capsella rubella]
Length=320

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/302 (56%), Positives = 220/302 (73%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+ +  Q ++  PSLA  LLRMHFHDCFVRGC+GS+LL S   
Sbjct  24    GLHLDYYKHRCPDAEAIVRRVTVQYVSRKPSLAAGLLRMHFHDCFVRGCDGSILLKSLNN  83

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E++A PN SLRG++++D  K+A+E+ CPGVVSCAD+L++VARD    + GP+W V  G
Sbjct  84    DAERNAIPNLSLRGYEVVDAAKSALEKKCPGVVSCADVLSLVARDAVLVINGPWWPVPLG  143

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S ++EA  NL  PFA I  LKQ F  KGL+ KDLVVLSGGHTIGIS+C     R
Sbjct  144   RRDGRISRLSEA--NLPSPFAGIAALKQNFLVKGLNTKDLVVLSGGHTIGISNCGLINSR  201

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD DPS++P+Y   LK +C    PTD  + VEMDPGSV+ FD+ YF ++A+++
Sbjct  202   IYNFTGKGDFDPSMNPSYVRTLKKRC---KPTDFRSSVEMDPGSVKKFDSHYFNIVAQKK  258

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD ETK+Y+ +Q  T GS+F KDF +SMV +G + +LTG +GEIR+ C  
Sbjct  259   GLFTSDSTLLDDPETKSYIERQVATGGSSFAKDFSDSMVKLGLVEILTGKKGEIRRRCAF  318

Query  1114  VN  1119
              N
Sbjct  319   PN  320



>emb|CDY69305.1| BnaAnng29930D [Brassica napus]
Length=321

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 219/305 (72%), Gaps = 9/305 (3%)
 Frame = +1

Query  217   GGLRVGFYE-QTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSP  393
             G L  G+Y    CP +E IV+ +    I   P+LA  LLRMHFHDCFVRGC+GSVL+ SP
Sbjct  22    GDLYEGYYRYNNCPQMEDIVRNVTYHYIYKDPTLAAALLRMHFHDCFVRGCDGSVLIKSP  81

Query  394   TKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVE  573
                 E+DA PN SLRG++++D VK+ +E  CPGVVSCADILA+VARD   A+KGP+W V 
Sbjct  82    NNDAERDAIPNLSLRGYEVVDTVKSVLESECPGVVSCADILALVARDAVLAIKGPWWPVP  141

Query  574   TGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLS-GGHTIGISHCSSF  750
              GRRDGRVSN++EA  NL  PFAN+T LK+ F DKGL+ KDLVVLS G HTIG+S C   
Sbjct  142   LGRRDGRVSNISEA--NLPSPFANVTTLKKNFADKGLNTKDLVVLSAGAHTIGVSSCGLI  199

Query  751   TDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIA  924
             + R+YNFTGKGD+DP+++PNY  +LK +C    PTD    V+MDP SV  FD+ YF  +A
Sbjct  200   SSRIYNFTGKGDSDPAMNPNYVAELKKRC---QPTDVTTSVDMDPTSVDKFDSHYFNAVA  256

Query  925   KRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             +++GLF SD+ LLDD ET  Y+ +Q L +G  F KDF +SMV +G +GVLTGDQGEIR  
Sbjct  257   EKKGLFISDSTLLDDWETNLYIQKQVLLNGFYFNKDFSDSMVKLGFVGVLTGDQGEIRNQ  316

Query  1105  CTAVN  1119
             C  VN
Sbjct  317   CDRVN  321



>ref|XP_002889541.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65800.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=321

 Score =   359 bits (921),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 220/299 (74%), Gaps = 8/299 (3%)
 Frame = +1

Query  229   VGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGE  408
             + +Y+  CP  E IV+ + +Q ++  PSLA  LLRMHFHDCFVRGC+GSVLL +P    E
Sbjct  29    LDYYQSKCPDAERIVRRVTEQYVSRKPSLAASLLRMHFHDCFVRGCDGSVLLKTPKNDAE  88

Query  409   KDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRD  588
             ++A PN +LRGF+++D  KTA+E+ CP +VSCAD+LA+VARD  A +KGP+W V  GRRD
Sbjct  89    RNAIPNLTLRGFEVVDAAKTALEKKCPNLVSCADVLALVARDAVAVIKGPWWPVPLGRRD  148

Query  589   GRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYN  768
             GR+S +T+AL NL  PFA+I  LK+ F DKGL+ KDLVVLSGGHTIGIS C+    R+YN
Sbjct  149   GRISKLTDALQNLPSPFADIKTLKKNFADKGLNAKDLVVLSGGHTIGISSCALVNTRIYN  208

Query  769   FTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRRGLF  942
             FTGKGD DPS++P+Y   LK KC   SPTD  +++EMDPGS + FD  YFT +A+++GLF
Sbjct  209   FTGKGDFDPSMNPSYVRALKKKC---SPTDFKSVLEMDPGSAKKFDPHYFTAVAQKKGLF  265

Query  943   TSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SD+ LLDD ETK Y VQ A  +  TF KDF +SMV +G++ +LTG  GEIRK C   N
Sbjct  266   ISDSTLLDDLETKLY-VQTA--NEVTFNKDFSDSMVKLGKVQILTGKNGEIRKRCAFPN  321



>ref|XP_010484836.1| PREDICTED: peroxidase 2-like isoform X1 [Camelina sativa]
Length=322

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/304 (55%), Positives = 221/304 (73%), Gaps = 8/304 (3%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             G L + +Y+  CP  E IV+ +  Q ++  PSLA  LLRMHFHDCFVRGC+GS+LL SP 
Sbjct  24    GRLDLNYYKHRCPDAEAIVRRVTIQYVSRKPSLAAALLRMHFHDCFVRGCDGSILLKSPN  83

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                E++A PN SLRG++++D  K+A+E+ CPGVVSC D+L++VARD    + GP+W V  
Sbjct  84    NDAERNAVPNLSLRGYEVVDAAKSALEKKCPGVVSCTDVLSLVARDAVVVINGPWWPVPL  143

Query  577   GRRDGRVSNMTEALFNLLP-PFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             GRRDGR+S + +A  N LP PFA I  LKQ FF KGL+ KDLVVLSGGHTIGIS+C    
Sbjct  144   GRRDGRISRLADA--NSLPSPFAGIAALKQNFFAKGLNTKDLVVLSGGHTIGISNCGLIN  201

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAK  927
              R+YNFTG+GD DP+++P+Y   LK +C    PTD  + VEMDPGSV+ FD+ YF ++A+
Sbjct  202   SRIYNFTGRGDFDPAMNPSYVRTLKKRC---KPTDFRSAVEMDPGSVKKFDSHYFNIVAQ  258

Query  928   RRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             ++GLFTSD+ LLDD ETK+Y+  Q  T GS+F KDF +SM+ +G + +LTG+QGEIR+ C
Sbjct  259   KKGLFTSDSTLLDDPETKSYIETQVSTGGSSFAKDFSDSMLKLGFVEILTGNQGEIRRRC  318

Query  1108  TAVN  1119
                N
Sbjct  319   AFPN  322



>ref|XP_008777796.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=332

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 219/322 (68%), Gaps = 11/322 (3%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             I +FL   CC         L++GFY ++CP  E I+     + I  AP+LA PLLRMHFH
Sbjct  17    IWLFLGLLCCVK-----ADLQLGFYHKSCPKAEEIISGFVKEHIPHAPTLASPLLRMHFH  71

Query  346   DCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAI  522
             DCFVRGC+GSVL++S +K Q EK A PN +LRGF  ID+VK+ VE+ CPGVVSCADILA+
Sbjct  72    DCFVRGCDGSVLINSTSKNQAEKSATPNLTLRGFDFIDRVKSLVEKECPGVVSCADILAL  131

Query  523   VARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLV  702
             VARD    + GP+W V TGRRDG +SN TEAL N+  P  N + L+  F +KGLSV DLV
Sbjct  132   VARDAVGVIGGPFWRVPTGRRDGLISNSTEALNNIPAPTFNFSALQTSFANKGLSVADLV  191

Query  703   VLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDN--LVEM  873
              LSG HTIGISHCSSF+ RLYNFTGKGD DPSLD  YA  LK  KC  +SP DN  + EM
Sbjct  192   WLSGAHTIGISHCSSFSKRLYNFTGKGDQDPSLDSFYAANLKKNKC--KSPNDNTSIAEM  249

Query  874   DPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVN  1053
             DPGS RTFD  Y+  + KRRGLF SDAAL+ +  TK+ ++    +    FFK F  SM  
Sbjct  250   DPGSFRTFDLGYYKNVLKRRGLFQSDAALITNAATKSSIMSLVNSSPEVFFKVFAFSMEK  309

Query  1054  MGRIGVLTGDQGEIRKVCTAVN  1119
             MGRI V TG  GEIRK C  VN
Sbjct  310   MGRIEVKTGSMGEIRKNCAVVN  331



>gb|KHN36550.1| Peroxidase 39 [Glycine soja]
Length=326

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 228/333 (68%), Gaps = 10/333 (3%)
 Frame = +1

Query  130   KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             KM    R+LSL +L  +A        + +  L++GFY Q+CP  E I+ +   + I  AP
Sbjct  2     KMGSNLRFLSLCLLALIA--------STHAQLQLGFYAQSCPKAEKIILKFVHEHIHNAP  53

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLA  L+RMHFHDCFVRGC+GSVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CP
Sbjct  54    SLAAALIRMHFHDCFVRGCDGSVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECP  113

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADIL + +RD   A  GPYW+V TGRRDG +SN+ EA  N+  PF NIT L+  F
Sbjct  114   GVVSCADILTLASRDSIVATGGPYWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLF  173

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEE  846
              ++GL +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  KC + 
Sbjct  174   ANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCKDL  233

Query  847   SPTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
             S  +   +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TK+ ++Q        F
Sbjct  234   SKLNTTKIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKSQIIQLLEGTVENF  293

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
               +F  S+  MGRI V TG +GEIRK C  VN+
Sbjct  294   SAEFATSIEKMGRINVKTGTEGEIRKHCAFVNS  326



>ref|XP_010457607.1| PREDICTED: peroxidase 2-like [Camelina sativa]
Length=322

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 221/310 (71%), Gaps = 7/310 (2%)
 Frame = +1

Query  196   NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGS  375
             N  A  +  L + +Y   CP  E IV+ +  Q ++  PSLA  LLRM+FHDCFVRGC+GS
Sbjct  18    NSVAIPWYSLNLNYYRSRCPDTERIVRRVTQQYVSRKPSLAAALLRMYFHDCFVRGCDGS  77

Query  376   VLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKG  555
             +LL SP    E++A PN SLRG++++D  K A+E  CPGVVSCAD+LA+VARD    ++G
Sbjct  78    ILLKSPNNDAERNAVPNLSLRGYEVVDAAKAALERRCPGVVSCADVLALVARDAVLVIRG  137

Query  556   PYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGIS  735
             P+W V  GRRDGR+S ++E   NL  PFANIT LKQ F DKGL+ KDLVVLSG HTIGIS
Sbjct  138   PWWPVPLGRRDGRISRISEV--NLPSPFANITTLKQNFADKGLNAKDLVVLSGAHTIGIS  195

Query  736   HCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSY  909
              C+    R+YNFTG+GD DP+++P Y   LK +C    PTD  ++V+MDPGSV+ FD+ Y
Sbjct  196   TCALVNARIYNFTGRGDFDPAMNPGYVRALKKRC---KPTDFRSIVDMDPGSVKRFDSHY  252

Query  910   FTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQG  1089
             + ++A+R+GLFTSD+ LLDD +T+ Y+  QALT+G +F +DF +SM  +G + +LTG  G
Sbjct  253   YNVVAQRKGLFTSDSTLLDDFDTRHYVQIQALTNGISFNRDFSDSMFKLGFVEILTGRNG  312

Query  1090  EIRKVCTAVN  1119
             EIR+ C  VN
Sbjct  313   EIRRKCAFVN  322



>gb|AAD11482.1| peroxidase precursor, partial [Glycine max]
Length=351

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 228/337 (68%), Gaps = 10/337 (3%)
 Frame = +1

Query  118   ACISKMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVI  297
             AC  KM    R+LSL +L  +A        + +  L++GFY  +CP  E IV +     I
Sbjct  23    ACCIKMGSNLRFLSLCLLALIA--------STHAQLQLGFYANSCPKAEQIVLKFVHDHI  74

Query  298   AVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVE  477
               APSLA  L+RMHFHDCFVRGC+ SVLL+S T Q EK+APPN ++RGF  ID++K+ VE
Sbjct  75    HNAPSLAAALIRMHFHDCFVRGCDASVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVE  134

Query  478   EACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVL  657
               CPGVVSCADIL + ARD   A  GP+W+V TGRRDG VSN+TEA  N+  P +N T L
Sbjct  135   AECPGVVSCADILTLAARDTIVATGGPFWKVPTGRRDGVVSNLTEARNNIPAPSSNFTTL  194

Query  658   KQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MK  834
             +  F ++GL +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  K
Sbjct  195   QTLFANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFK  254

Query  835   CPEESPTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTH  1011
             C + +  +   +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TKA ++Q     
Sbjct  255   CTDLNKLNTTKIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGS  314

Query  1012  GSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
                FF +F  S+  MGRI V TG +GEIRK C  +N+
Sbjct  315   VENFFAEFATSIEKMGRINVKTGTEGEIRKHCAFINS  351



>ref|XP_003540317.1| PREDICTED: peroxidase 39-like [Glycine max]
Length=326

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/335 (54%), Positives = 232/335 (69%), Gaps = 14/335 (4%)
 Frame = +1

Query  130   KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             KM    R+LSL +L  +A        + +  L++GFY ++CP  E I+ +   + I  AP
Sbjct  2     KMGSNFRFLSLCLLALIA--------SSHAQLQLGFYAKSCPKAEQIILKFVHEHIHNAP  53

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLA  L+RMHFHDCFVRGC+GSVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CP
Sbjct  54    SLAAALIRMHFHDCFVRGCDGSVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECP  113

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADIL + +RD   A  GPYW+V TGRRDG +SN+ EA  N+  PF NIT L+  F
Sbjct  114   GVVSCADILTLASRDSIVATGGPYWKVPTGRRDGVISNLVEARNNIPAPFDNITTLQTLF  173

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEE  846
              ++GL +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  KC + 
Sbjct  174   ANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKTFKCKDL  233

Query  847   SPTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST-  1020
             +  +   +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TKA +++  L  GS  
Sbjct  234   NKLNTTKIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIE--LLEGSVE  291

Query  1021  -FFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
              FF +F  S+  MGRI V TG +GEIRK C  VN+
Sbjct  292   KFFAEFATSIEKMGRIKVKTGTEGEIRKHCAFVNS  326



>ref|XP_006304823.1| hypothetical protein CARUB_v10012469mg [Capsella rubella]
 gb|EOA37721.1| hypothetical protein CARUB_v10012469mg [Capsella rubella]
Length=324

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 222/301 (74%), Gaps = 5/301 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L + +Y   CP  E IV+ + +Q ++  PSLA  LLR++FHDCFVRGC+GS+LL SP   
Sbjct  27    LDLDYYRSKCPDTERIVRRVTEQYVSRKPSLAAALLRIYFHDCFVRGCDGSILLKSPNND  86

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              E++A PN SLRG++++D  K+A+E+ CPG+VSCAD+LA+VARD    ++GP+W V  GR
Sbjct  87    AERNAIPNLSLRGYEVVDAAKSALEKRCPGIVSCADVLALVARDAVLVIRGPWWPVPLGR  146

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDGR+S +++A  NL  PFANIT LK+ F DKGL+ KDLVVLSG HTIGIS C+    R+
Sbjct  147   RDGRISRVSDANANLPSPFANITTLKKNFADKGLNAKDLVVLSGAHTIGISTCALVNRRI  206

Query  763   YNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRRG  936
             YNFTG+GD DPS++P+Y   LK +C    P D  ++V+MDPGSV+ FD+ YF ++A+++G
Sbjct  207   YNFTGRGDFDPSMNPSYVRTLKKRC---KPNDFKSIVDMDPGSVKRFDSHYFNVVAQKKG  263

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LFTSD+ LLDD ET+ Y+  QALT+G +F +DF ESM  +G + +LTG  GEIR+ C  V
Sbjct  264   LFTSDSTLLDDFETRHYVEIQALTNGISFNRDFSESMFKLGFVEILTGRNGEIRRKCAFV  323

Query  1117  N  1119
             N
Sbjct  324   N  324



>ref|XP_010484845.1| PREDICTED: peroxidase 2-like [Camelina sativa]
Length=322

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 220/302 (73%), Gaps = 7/302 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
              L + +Y   CP  E IV+ +  Q ++  PSLA  LLRM+FHDCFVRGC+GS+LL SP  
Sbjct  26    SLNLDYYRYRCPDTERIVRRVTQQYVSRKPSLAAALLRMYFHDCFVRGCDGSILLKSPNN  85

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E++A PN SLRG++++D  K A+E  CPGVVSCAD+LA+VARD    ++GP+W V  G
Sbjct  86    DAERNAVPNLSLRGYEVVDAAKAALERRCPGVVSCADVLALVARDAVLVIRGPWWPVPLG  145

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S+++E   NL  PFANIT LKQ F DKGL+ KDLVVLSG HTIGIS C+    R
Sbjct  146   RRDGRISSISEV--NLPSPFANITTLKQNFADKGLNAKDLVVLSGAHTIGISTCALVNAR  203

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTG+GD DP+++P+Y   LK +C    PTD  + V+MDPGSV+ FD+ YF ++A+R+
Sbjct  204   IYNFTGRGDFDPAMNPSYVRALKKRC---KPTDFRSTVDMDPGSVKRFDSHYFNVVAQRK  260

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD +T+ Y+  QALT+G +F +DF +SM  +G + +LTG +GEIR+ C  
Sbjct  261   GLFTSDSTLLDDFDTRHYVQIQALTNGISFNRDFSDSMFKLGFVEILTGRKGEIRRKCAF  320

Query  1114  VN  1119
             VN
Sbjct  321   VN  322



>ref|NP_001068411.1| Os11g0661600 [Oryza sativa Japonica Group]
 tpe|CAH69376.1| TPA: class III peroxidase 134 precursor [Oryza sativa Japonica 
Group]
 gb|ABA95245.1| Peroxidase 1 precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28774.1| Os11g0661600 [Oryza sativa Japonica Group]
 dbj|BAG98499.1| unnamed protein product [Oryza sativa Japonica Group]
Length=335

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/305 (57%), Positives = 220/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L VGFY +TCP +E IV+E   +++AVAP+LAGPLLR+HFHDCFVRGC+GSVL+DS  + 
Sbjct  31    LDVGFYSKTCPKVEEIVREEMIRILAVAPTLAGPLLRLHFHDCFVRGCDGSVLIDSTASN  90

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDAPPN +LRGF  + ++K  ++ ACPG VSCAD+LA++ARD  A   GP W V  G
Sbjct  91    TAEKDAPPNQTLRGFGSVQRIKARLDAACPGTVSCADVLALMARDAVALSGGPRWAVPLG  150

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS   +    L PP ANIT L + F  KGL +KDLVVLSGGHT+G +HCS+FTDR
Sbjct  151   RRDGRVSAANDTTTQLPPPTANITQLARMFAAKGLDMKDLVVLSGGHTLGTAHCSAFTDR  210

Query  760   LYNFTG---KGDADPSLDPNYAEKLKMKCPEESPTD-NLVEMDPGSVRTFDTSYFTLIAK  927
             LYNFTG    GD DP+LD +Y  +L+ +C   +  +  L EMDPGS  TFD  Y+ L+A+
Sbjct  211   LYNFTGANNAGDVDPALDRSYLARLRSRCASLAGDNTTLAEMDPGSFLTFDAGYYRLVAR  270

Query  928   RRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             RRGLF SD++LLDD  T  Y+ +QA   + + FF+DF ESMV MG +GVLTG +GEIRK 
Sbjct  271   RRGLFHSDSSLLDDAFTAGYVRRQATGMYAAEFFRDFAESMVKMGGVGVLTGGEGEIRKK  330

Query  1105  CTAVN  1119
             C  +N
Sbjct  331   CYVIN  335



>ref|XP_003597023.1| Peroxidase [Medicago truncatula]
Length=350

 Score =   357 bits (917),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 235/356 (66%), Gaps = 13/356 (4%)
 Frame = +1

Query  61    REIRFHTISNTKQS*LINFACIS-KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGF  237
             REI+   +S+T    L+  + I  KM     Y  + IL  LA       A+ +  L +GF
Sbjct  6     REIQVFQVSHT----LVAASYIHMKMRNQCNYFKVLILCILA-------ASTHAQLELGF  54

Query  238   YEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDA  417
             Y ++CP  E IV     + I  APSLA  L+RMHFHDCFVRGC+ SVLL+S  +Q EK+A
Sbjct  55    YTKSCPKAEQIVANFVHEHIRNAPSLAAALIRMHFHDCFVRGCDASVLLNSTNQQAEKNA  114

Query  418   PPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRV  597
             PPN ++RGF  ID++K+ VE  CPGVVSCADI+A+ ARD  AA  GPYW+V TGRRDG V
Sbjct  115   PPNLTVRGFDFIDRIKSLVEAECPGVVSCADIIALSARDSIAATGGPYWKVPTGRRDGVV  174

Query  598   SNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTG  777
             SN+ EA  N+  PF+N T L+  F ++GL +KDLV+LSG HTIGIS C+SF++RLYNFTG
Sbjct  175   SNLLEANQNIPAPFSNFTTLQTLFANQGLDMKDLVLLSGAHTIGISLCTSFSNRLYNFTG  234

Query  778   KGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDA  954
             KGD DPSLD  YA+ LK  KC   +    +VE+DPGS  TFD  Y++ + KRRGLF SD+
Sbjct  235   KGDQDPSLDSEYAKNLKTFKCKNINDNTTIVELDPGSRNTFDLGYYSQVVKRRGLFESDS  294

Query  955   ALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             ALL +  TKA + Q        F+ +F +S+  MG+I V TG QG IRK C  VNN
Sbjct  295   ALLTNSVTKALVTQFLQGSLENFYAEFAKSIEKMGQIKVKTGSQGVIRKHCALVNN  350



>gb|AES67274.2| peroxidase family protein [Medicago truncatula]
Length=326

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 223/332 (67%), Gaps = 8/332 (2%)
 Frame = +1

Query  130   KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             KM     Y  + IL  LA       A+ +  L +GFY ++CP  E IV     + I  AP
Sbjct  2     KMRNQCNYFKVLILCILA-------ASTHAQLELGFYTKSCPKAEQIVANFVHEHIRNAP  54

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLA  L+RMHFHDCFVRGC+ SVLL+S  +Q EK+APPN ++RGF  ID++K+ VE  CP
Sbjct  55    SLAAALIRMHFHDCFVRGCDASVLLNSTNQQAEKNAPPNLTVRGFDFIDRIKSLVEAECP  114

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADI+A+ ARD  AA  GPYW+V TGRRDG VSN+ EA  N+  PF+N T L+  F
Sbjct  115   GVVSCADIIALSARDSIAATGGPYWKVPTGRRDGVVSNLLEANQNIPAPFSNFTTLQTLF  174

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEE  846
              ++GL +KDLV+LSG HTIGIS C+SF++RLYNFTGKGD DPSLD  YA+ LK  KC   
Sbjct  175   ANQGLDMKDLVLLSGAHTIGISLCTSFSNRLYNFTGKGDQDPSLDSEYAKNLKTFKCKNI  234

Query  847   SPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFF  1026
             +    +VE+DPGS  TFD  Y++ + KRRGLF SD+ALL +  TKA + Q        F+
Sbjct  235   NDNTTIVELDPGSRNTFDLGYYSQVVKRRGLFESDSALLTNSVTKALVTQFLQGSLENFY  294

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
              +F +S+  MG+I V TG QG IRK C  VNN
Sbjct  295   AEFAKSIEKMGQIKVKTGSQGVIRKHCALVNN  326



>ref|XP_010540729.1| PREDICTED: peroxidase 39 [Tarenaya hassleriana]
Length=371

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 231/340 (68%), Gaps = 9/340 (3%)
 Frame = +1

Query  115   FACISKMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQV  294
             F  +SKMAKF  +  L + + L F      +     L++GFY +TCP+ E IV++  ++ 
Sbjct  36    FFSVSKMAKFGSFQHLGLAMILGF--LGFVSLSEAELKMGFYHKTCPNAEKIVQDFVNEH  93

Query  295   IAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKT  468
             I  APSLA  L+RMHFHDCFVRGC+ S+L++  S  +Q EK +PPN ++RGF  ID+VK+
Sbjct  94    IHNAPSLAAALIRMHFHDCFVRGCDASILINATSNNRQVEKVSPPNLTVRGFDFIDRVKS  153

Query  469   AVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANI  648
              +E+ CPGVVSCAD++ +  RD   A  GP+W V TGRRDGR+SN  E+L N+ PPF N 
Sbjct  154   LLEKECPGVVSCADVITLATRDSIVATGGPFWNVPTGRRDGRISNAAESLNNIPPPFGNF  213

Query  649   TVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK  828
             + L++ F D+GL VKDLV+LSG HTIG+SHC+SF++RL+NFTG GD DPSLD  YA  L+
Sbjct  214   STLRKRFADQGLDVKDLVLLSGAHTIGVSHCTSFSNRLFNFTGVGDQDPSLDSEYAANLR  273

Query  829   -MKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQ  999
               KC   SP+DN+  VEMDPGS ++FD SY+ L+ KRRGLF SD AL  D    A + + 
Sbjct  274   SRKC--RSPSDNMTKVEMDPGSRKSFDLSYYNLLLKRRGLFESDNALTTDSTALALVRRL  331

Query  1000  ALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
                    FF +F +SM  MGRIGV TG  GEIR+ C  VN
Sbjct  332   VAGSMDEFFAEFAKSMEKMGRIGVKTGSDGEIRRYCAFVN  371



>ref|XP_003540316.1| PREDICTED: peroxidase 3 [Glycine max]
Length=326

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 228/333 (68%), Gaps = 10/333 (3%)
 Frame = +1

Query  130   KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             KM    R+LSL +L  +A        + +  L++GFY ++CP+ E IV +     I  AP
Sbjct  2     KMGSNFRFLSLCLLALIA--------STHAQLQLGFYAKSCPNAEQIVLKFVHDHIHNAP  53

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLA  L+RMHFHDCFVRGC+ SVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CP
Sbjct  54    SLAAALIRMHFHDCFVRGCDASVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECP  113

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADIL + ARD   A  GP+W+V TGRRDG +SN+TEA  N+  P +N T L+  F
Sbjct  114   GVVSCADILTLSARDTIVATGGPFWKVPTGRRDGVISNLTEARDNIPAPSSNFTTLQTLF  173

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEE  846
              ++GL +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  KC + 
Sbjct  174   ANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDL  233

Query  847   SPTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
             +  +   +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TKA +++        F
Sbjct  234   NKLNTTKIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENF  293

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             F +F  SM  MGRI V TG +GEIRK C  VN+
Sbjct  294   FAEFATSMEKMGRINVKTGTEGEIRKHCAFVNS  326



>ref|XP_002892275.1| hypothetical protein ARALYDRAFT_470522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68534.1| hypothetical protein ARALYDRAFT_470522 [Arabidopsis lyrata subsp. 
lyrata]
Length=288

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 216/292 (74%), Gaps = 8/292 (3%)
 Frame = +1

Query  250   CPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNF  429
             CP  E IV+ + +Q ++  PSLA  LLRMHFHDCFVRGC+GSVLL +P    E++A PN 
Sbjct  3     CPDAERIVRRVTEQYVSRKPSLAASLLRMHFHDCFVRGCDGSVLLKTPKNDAERNAIPNL  62

Query  430   SLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMT  609
             +LRGF+++D  KTA+E+ CP +VSCAD+LA+VARD  A +KGP+W V  GRRDGR+S +T
Sbjct  63    TLRGFEVVDAAKTALEKKCPNLVSCADVLALVARDAVAVIKGPWWPVPLGRRDGRISKLT  122

Query  610   EALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDA  789
             +AL NL  PFA+I  LK+ F DKGL+ KDLVVLSGGHTIGIS C+    R+YNFTGKGD 
Sbjct  123   DALQNLPSPFADIKTLKKNFADKGLNAKDLVVLSGGHTIGISSCALVNTRIYNFTGKGDF  182

Query  790   DPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALL  963
             DPS++P+Y   LK KC   SPTD  +++EMDPGS + FD  YFT +A+++GLF SD+ LL
Sbjct  183   DPSMNPSYVRALKKKC---SPTDFKSVLEMDPGSAKKFDPHYFTAVAQKKGLFISDSTLL  239

Query  964   DDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             DD ETK Y VQ A  +  TF KDF +SMV +G++ +LTG  GEIRK C   N
Sbjct  240   DDLETKLY-VQTA--NEVTFNKDFSDSMVKLGKVQILTGKNGEIRKRCAFPN  288



>ref|XP_009382695.1| PREDICTED: peroxidase 1-like [Musa acuminata subsp. malaccensis]
Length=330

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 216/314 (69%), Gaps = 7/314 (2%)
 Frame = +1

Query  190   CCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCE  369
             CC   ++    +  GFY  TCPH E IV     ++IA  P+LAG LLRM F DCFVRGC+
Sbjct  20    CC---SSTEAHVEFGFYNDTCPHAEAIVLHEMTRIIADDPTLAGSLLRMQFQDCFVRGCD  76

Query  370   GSVLLDSPTKQ-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAA  546
              S+LLDS      EKDA PN SLRGF +ID+VK  +EEACPG+VSCADI+A+ ARD    
Sbjct  77    ASILLDSSNNNVAEKDAIPNKSLRGFDVIDRVKAKLEEACPGIVSCADIIAMAARDSVYL  136

Query  547   MKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTI  726
               GPY+ ++TGRRDG  S  ++ + NL PP ANIT LK  F  K L+VKDLVVLSG HTI
Sbjct  137   ANGPYFPIQTGRRDGNKSEASDLMANLPPPTANITELKAFFLQKNLTVKDLVVLSGAHTI  196

Query  727   GISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFD  900
             G SHCSSF+ RLYNF+GKGD DPSLD  YAEKLK KC      D   LV+MDP S R FD
Sbjct  197   GFSHCSSFSQRLYNFSGKGDTDPSLDMEYAEKLKRKCKPHDHDDMRTLVKMDPKSPRRFD  256

Query  901   TSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLT  1077
               Y+ L+++ +GLF SD ALL D ET+AY+ +QA+ +    FF DFG SMV MG+IGVLT
Sbjct  257   LCYYRLVSEGKGLFASDEALLHDPETRAYVERQAMASSAEEFFNDFGSSMVIMGKIGVLT  316

Query  1078  GDQGEIRKVCTAVN  1119
               +GEIRK C  VN
Sbjct  317   HQKGEIRKKCAYVN  330



>ref|XP_007149959.1| hypothetical protein PHAVU_005G113800g [Phaseolus vulgaris]
 gb|ESW21953.1| hypothetical protein PHAVU_005G113800g [Phaseolus vulgaris]
Length=324

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 229/332 (69%), Gaps = 10/332 (3%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             M    R+LSL +L  +A        + +  L++GFY ++CP  E I+ +   + I  APS
Sbjct  1     MGSHFRFLSLCLLALVA--------STHAQLQLGFYAKSCPKAEKIILKFVHEHIHNAPS  52

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPG  492
             LA  L+RMHFHDCFVRGC+GSVLL+S T Q EKDAPPN ++RGF  ID++K+ VE  CPG
Sbjct  53    LAAALIRMHFHDCFVRGCDGSVLLNSTTNQAEKDAPPNLTVRGFDFIDRIKSLVEAECPG  112

Query  493   VVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFF  672
             VVSCADIL + ARD   A  GP+W+V TGRRDG VS + EA  N+  PF NIT L+  F 
Sbjct  113   VVSCADILTLTARDTIVATGGPFWKVPTGRRDGVVSILEEARNNIPAPFDNITTLQTLFD  172

Query  673   DKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEES  849
             ++GL +KDLV+LSG HTIG++HCSS ++RL+NFTGKGD DPSLD  YAE LK  KC + +
Sbjct  173   NQGLDLKDLVLLSGAHTIGVAHCSSLSNRLFNFTGKGDQDPSLDSEYAENLKTFKCNDIN  232

Query  850   PTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFF  1026
               +   +EMDPGS +TFD  Y+  + KRRGLF SDAALL++E TK+ +++        FF
Sbjct  233   KLNTTKIEMDPGSRKTFDLDYYRQVIKRRGLFESDAALLNNEVTKSQIIELLQGSIENFF  292

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
              +F +S+  MGRI V TG +GEIRK C  VN+
Sbjct  293   AEFADSIEKMGRIKVKTGTEGEIRKHCAFVNS  324



>ref|XP_008804375.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=325

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 211/302 (70%), Gaps = 2/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK-  399
             L++GFY+++CP  E I+ +   + I   PSLA PLLRMHFHDCFV GC+ S+L++S +K 
Sbjct  24    LKLGFYDESCPKAEKIIFDYVKKHIPHEPSLAAPLLRMHFHDCFVGGCDASILMNSTSKN  83

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK A PN SLRGF  ID+VKT +E  CPGVVSCADILA+VARD      GP+W V TG
Sbjct  84    QAEKSAFPNLSLRGFDFIDRVKTLIEAECPGVVSCADILALVARDSVIVTGGPFWNVPTG  143

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +SN  E L NL  P  N ++L+  F  KGLS+KDLV+LSG HTIG+SHCSSF+ R
Sbjct  144   RRDGLISNSIEVLKNLPAPTFNFSILQTSFASKGLSLKDLVLLSGAHTIGVSHCSSFSSR  203

Query  760   LYNFTGKGDADPSLDPNYAEKL-KMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             LYNFTGKGD DPSLD  YA  L K KC   + T  +VEMDPGS RTFD  Y+  + KRRG
Sbjct  204   LYNFTGKGDEDPSLDSFYAANLKKYKCQVPNDTTTIVEMDPGSFRTFDLGYYKHLLKRRG  263

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAAL+ +  TKAY++Q        FFK+F  SM  MGRI V TG  GEIRK C  V
Sbjct  264   LFQSDAALITNAATKAYIIQLVNNPLEVFFKEFALSMEKMGRIEVKTGSLGEIRKNCAVV  323

Query  1117  NN  1122
             N+
Sbjct  324   NS  325



>emb|CDY55444.1| BnaC08g46330D [Brassica napus]
Length=332

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 220/303 (73%), Gaps = 7/303 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             G L + +Y   CP +E IV+ +  Q ++  P+LA  LLRMHFHDCFVRGC+GSVLL SP 
Sbjct  35    GDLDLDYYRFKCPQMESIVRRVTFQYVSRRPTLAAALLRMHFHDCFVRGCDGSVLLKSPN  94

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             +  E+DAPPN +LRG++++D  K+A+E  CPGVVSCAD+LA+VARD  A ++GP+W V  
Sbjct  95    RDAERDAPPNLTLRGYEVVDAAKSALERKCPGVVSCADVLALVARDAVAVIRGPWWPVPL  154

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+S ++EA  NL  PFA++  LK  F  KGL+ KDLVVLSG HTIG+S C   + 
Sbjct  155   GRRDGRISRLSEA--NLPSPFADVKTLKNNFRVKGLNSKDLVVLSGAHTIGVSSCGLISS  212

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKR  930
             R++NFTGKGD DP+++P+Y   LK +C    PTD    V+MDPGS R FD+ YF ++A++
Sbjct  213   RIHNFTGKGDFDPAMNPSYVRTLKKRC---KPTDVRTPVDMDPGSARRFDSHYFNIVAQK  269

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             +GLF SD+ALL+D  TK Y+  Q +T G++F KDF +SMV +G I +LTG +GEIR+ C 
Sbjct  270   KGLFISDSALLNDFVTKRYIQTQVVTRGASFAKDFSDSMVKLGFIQILTGRKGEIRRKCA  329

Query  1111  AVN  1119
              VN
Sbjct  330   FVN  332



>ref|XP_004487389.1| PREDICTED: peroxidase 3-like [Cicer arietinum]
Length=325

 Score =   354 bits (908),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 224/327 (69%), Gaps = 12/327 (4%)
 Frame = +1

Query  151   YLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLL  330
             Y  + IL FL        A+ +  L++GFY ++CP  E I+     + I  APSLA  L+
Sbjct  8     YFKVLILCFLV-------ASTHAQLQLGFYAKSCPKAEKIILNFVHEHIHNAPSLAAALI  60

Query  331   RMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCAD  510
             RMHFHDCFVRGC+GS+LL+S T Q EK+APPN ++RGF  ID++K+ VE  CPGVVSCAD
Sbjct  61    RMHFHDCFVRGCDGSILLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCAD  120

Query  511   ILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSV  690
             I+A+ ARD      GP+W+V TGRRDG VS + EA  N+  PF N T L+  F ++GL +
Sbjct  121   IIALSARDSIVVTGGPFWKVPTGRRDGVVSKLQEATQNIPAPFFNFTSLQTSFANQGLDL  180

Query  691   KDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLV  867
             KDLV+LSG HTIGIS C+SF++RLYNFTGKGD DPSLD  YA+ LK +KC   +    +V
Sbjct  181   KDLVLLSGAHTIGISLCTSFSNRLYNFTGKGDQDPSLDSEYAKNLKTLKCKNINDNTTIV  240

Query  868   EMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGS--TFFKDFGE  1041
             EMDPGS  TFD SY+  + KRRGLF SD+ALL +  TK+ + Q  L HGS   F+ +F +
Sbjct  241   EMDPGSRNTFDLSYYNQVVKRRGLFQSDSALLTNSVTKSLVTQ--LLHGSIEIFYDEFAK  298

Query  1042  SMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             SM  MG+I V  G +GEIRK C  VN+
Sbjct  299   SMEKMGQIKVKIGSEGEIRKHCALVNS  325



>gb|AAD11481.1| peroxidase precursor, partial [Glycine max]
Length=352

 Score =   354 bits (909),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 228/333 (68%), Gaps = 10/333 (3%)
 Frame = +1

Query  130   KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             KM    R+LSL +L  +A        + +  L++GFY ++CP+ E IV +     I  AP
Sbjct  28    KMGSNFRFLSLCLLALIA--------STHAQLQLGFYAKSCPNAEQIVLKFVHDHIHNAP  79

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLA  L+RMHFHDCFVRGC+ SVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CP
Sbjct  80    SLAAALIRMHFHDCFVRGCDASVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECP  139

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADIL + ARD   A  GP+W+V TGRRDG +SN+TEA  N+  P +N T L+  F
Sbjct  140   GVVSCADILTLSARDTIVATGGPFWKVPTGRRDGVISNLTEARDNIPAPSSNFTTLQTLF  199

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEE  846
              ++GL +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  KC + 
Sbjct  200   ANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDL  259

Query  847   SPTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
             +  +   +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TKA +++        F
Sbjct  260   NKLNTTKIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENF  319

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             F +F  SM  MGRI V TG +GEIRK C  +N+
Sbjct  320   FAEFATSMEKMGRINVKTGTEGEIRKHCAFLNS  352



>emb|CDY13252.1| BnaC09g24040D [Brassica napus]
Length=326

 Score =   353 bits (906),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 181/332 (55%), Positives = 223/332 (67%), Gaps = 9/332 (3%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MA+F   + + IL+ L     +        L++GFY++TCP+ E IV+ + +Q I   PS
Sbjct  1     MARFG-LVFVTILVILGLVSFSEAQ-----LKLGFYDKTCPNAEKIVQAVVNQHIRNVPS  54

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEAC  486
             LA  L+RMHFHDCFVRGC+GS+L++  S  +Q EK APPN ++RGF  ID VKT +E  C
Sbjct  55    LAAGLIRMHFHDCFVRGCDGSILINATSSNQQVEKVAPPNLTVRGFDFIDLVKTVLERKC  114

Query  487   PGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQG  666
             PGVVSCADI+ +  RD  AA+ GP W V TGRRDGR+SN TEAL N+ PPF N T L   
Sbjct  115   PGVVSCADIITLATRDSVAAIGGPTWNVPTGRRDGRISNATEALNNIPPPFGNFTTLITL  174

Query  667   FFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPE  843
             F ++GL VKDLV+LSG HTIG+SHCSSF++RL+NFTG GD DPSLD  YA+ LK  KC  
Sbjct  175   FGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYADNLKSRKCLS  234

Query  844   ESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
              +     VEMDPGS  TFD SYF L+ KRRGLF SDAAL  D      +   A      F
Sbjct  235   IADNTTQVEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTKDPTALGQVRSFAGGSLQDF  294

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F +FG+SM  MGRIGV TG  GEIR+ C+ VN
Sbjct  295   FVEFGKSMEKMGRIGVKTGSDGEIRRTCSVVN  326



>ref|XP_006594890.1| PREDICTED: peroxidase 3 [Glycine max]
 gb|KHN36549.1| Peroxidase 3 [Glycine soja]
Length=324

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 224/327 (69%), Gaps = 10/327 (3%)
 Frame = +1

Query  148   RYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPL  327
             R+LSL +L  +A        + +  L++GFY  +CP  E IV +     I  APSLA  L
Sbjct  6     RFLSLCLLALIA--------STHAQLQLGFYANSCPKAEQIVLKFVHDHIHNAPSLAAAL  57

Query  328   LRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCA  507
             +RMHFHDCFVRGC+ SVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CPGVVSCA
Sbjct  58    IRMHFHDCFVRGCDASVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCA  117

Query  508   DILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLS  687
             DIL + ARD   A  GP+W+V TGRRDG VSN+TEA  N+  P +N T L+  F ++GL 
Sbjct  118   DILTLAARDTIVATGGPFWKVPTGRRDGVVSNLTEARNNIPAPSSNFTTLQTLFANQGLD  177

Query  688   VKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNL  864
             +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  KC + +  +  
Sbjct  178   LKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTT  237

Query  865   -VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGE  1041
              +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TKA ++Q        FF +F  
Sbjct  238   KIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFAT  297

Query  1042  SMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             S+  MGRI V TG +GEIRK C  +N+
Sbjct  298   SIEKMGRINVKTGTEGEIRKHCAFINS  324



>gb|EAY81751.1| hypothetical protein OsI_36925 [Oryza sativa Indica Group]
Length=308

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 219/305 (72%), Gaps = 6/305 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L VGFY +TCP +E IV+E   +++AVAP+LAGPLLR+HFHDCFVRGC+GSVL+DS  + 
Sbjct  4     LDVGFYSKTCPKVEEIVREEMIRILAVAPTLAGPLLRLHFHDCFVRGCDGSVLIDSTASN  63

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDAPPN +LRGF  + ++K  ++ ACPG VSCAD+LA++ARD  A   GP W V  G
Sbjct  64    TAEKDAPPNQTLRGFGSVQRIKARLDAACPGTVSCADVLALMARDAVALSGGPRWPVPLG  123

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS   +    L PP ANIT L + F  KGL +KDLVVLSGGHT+G +HCS+FTDR
Sbjct  124   RRDGRVSAANDTATQLPPPTANITQLARMFAAKGLDLKDLVVLSGGHTLGTAHCSAFTDR  183

Query  760   LYNFTGK---GDADPSLDPNYAEKLKMKCPEESPTD-NLVEMDPGSVRTFDTSYFTLIAK  927
             LYNFTG     D DP+LD +Y  +L+ +C   +  +  L EMDPGS  TFD  Y+ L+A+
Sbjct  184   LYNFTGADNDADVDPALDRSYLARLRSRCASLAADNTTLAEMDPGSFLTFDAGYYRLVAR  243

Query  928   RRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             RRGLF SD++LL D  T  Y+ +QA   + + FF+DF ESMV MG +GVLTG++GEIRK 
Sbjct  244   RRGLFHSDSSLLADAFTAGYVRRQATGMYAAEFFRDFAESMVKMGGVGVLTGEEGEIRKK  303

Query  1105  CTAVN  1119
             C  +N
Sbjct  304   CYVIN  308



>ref|XP_008379618.1| PREDICTED: peroxidase 3 [Malus domestica]
Length=326

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 229/334 (69%), Gaps = 14/334 (4%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             + +FS  L   +L+ + F+           L++GFY + CP  E IVK+  ++ I  APS
Sbjct  3     LIRFSGILVSCLLVIIGFS--------EAQLQLGFYSKNCPKAEKIVKDYIEKHIHNAPS  54

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             LA  L+R+HFHDCFVRGC+ SVLL+S  + Q EKDAPPN ++RGF  ID++K+ +E  CP
Sbjct  55    LAAALIRLHFHDCFVRGCDASVLLNSTSSNQAEKDAPPNLTVRGFDFIDRIKSRLEAQCP  114

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCAD++A+ ARD   A  GP W+V TGRRDG ++   EAL N+ PPF+N + L++ F
Sbjct  115   GVVSCADVIALAARDSIVATGGPTWKVPTGRRDGVIARRAEALANIPPPFSNFSTLQRTF  174

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KCPEE  846
              + GL +KDLV+LSG HTIG+SHC SF++RLYN TG GD DP+L+  YA  LK  KC  +
Sbjct  175   ANVGLDLKDLVLLSGAHTIGVSHCPSFSNRLYNXTGVGDQDPALNAQYAANLKANKC--K  232

Query  847   SPTDN--LVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGST  1020
             +PTDN  +VEMDPGSVRTFD SY+TL+ KRRGLF SDAAL     T  Y+ Q        
Sbjct  233   TPTDNTTIVEMDPGSVRTFDLSYYTLLLKRRGLFESDAALTSSSTTLNYINQLLKGSLQN  292

Query  1021  FFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             F+ +FG+SM  MGRI V TG  GEIRK C+ VN+
Sbjct  293   FYDEFGKSMEKMGRINVKTGSAGEIRKQCSVVNS  326



>ref|XP_009111057.1| PREDICTED: peroxidase 2-like [Brassica rapa]
Length=332

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 220/303 (73%), Gaps = 7/303 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             G L + +Y   CP +E IV+ +  Q ++  P+LA  LLRMHFHDCFVRGC+GSVLL SP 
Sbjct  35    GDLDLDYYRFKCPQVESIVRRVTFQYVSRRPTLAAALLRMHFHDCFVRGCDGSVLLKSPN  94

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                E+DAPPN +LRG++++D VK+ +E  CPGVVSCAD+LA+VARD  A ++GP+W V  
Sbjct  95    NDAERDAPPNLTLRGWEVVDAVKSVLERKCPGVVSCADVLALVARDAVAVIRGPWWPVPL  154

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+S ++EA  NL  PFA++  LK  F  KGL+ KDLVVLSG HTIG+S C   + 
Sbjct  155   GRRDGRISRLSEA--NLPSPFADVKTLKNNFRVKGLNSKDLVVLSGAHTIGVSSCGLISS  212

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKR  930
             R++NFTG+GD DP+++P+Y   LK +C    PTD    V+MDPGS R FD+ YF ++A++
Sbjct  213   RIHNFTGRGDFDPAMNPSYVRTLKKRC---KPTDVRTPVDMDPGSARRFDSHYFNIVAQK  269

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             +GLF SD+ALL+D  TK+Y+  Q +T G++F KDF +SMV +G I +LTG +GEIR+ C 
Sbjct  270   KGLFISDSALLNDFVTKSYIQTQVVTRGASFAKDFSDSMVKLGFIQILTGRKGEIRRKCA  329

Query  1111  AVN  1119
              VN
Sbjct  330   FVN  332



>ref|XP_002892276.1| hypothetical protein ARALYDRAFT_887707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68535.1| hypothetical protein ARALYDRAFT_887707 [Arabidopsis lyrata subsp. 
lyrata]
Length=330

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 217/301 (72%), Gaps = 7/301 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP +E IV  +  Q ++  PSLA  LLR+HFHDCFVRGC+GSVLL S   
Sbjct  24    GLDLNYYKHRCPDVEAIVLRVTVQYVSRQPSLAAALLRLHFHDCFVRGCDGSVLLRSRDN  83

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E +A P+ SLRGF+++D  K+AVE+ CPGVVSCADILA+VARD  + + GP W V  G
Sbjct  84    DAEINALPSLSLRGFEVVDAAKSAVEKKCPGVVSCADILALVARDAVSVINGPSWPVPLG  143

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  PFA I  LKQGFF KGL+  DLVVLSGGHTIGIS+C     R
Sbjct  144   RRDGRISRRSEV--NLPSPFAGIAALKQGFFAKGLNTTDLVVLSGGHTIGISNCGLINKR  201

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRR  933
             +YNFTGKGD DPS++P+Y  KLK +C    P D    VEMDPGSV+ F++ YF  +A+++
Sbjct  202   IYNFTGKGDFDPSMNPSYVRKLKKRC---KPNDFKTPVEMDPGSVKKFNSHYFDNVAQKK  258

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLFTSD+ LLDD ETK+Y+ +Q  T GS+F KDF +SMV +G + +LTG++GEIRK C  
Sbjct  259   GLFTSDSTLLDDPETKSYIDRQVATAGSSFPKDFSDSMVKLGFVQILTGEKGEIRKRCAF  318

Query  1114  V  1116
             V
Sbjct  319   V  319



>ref|XP_010233139.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=330

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 219/323 (68%), Gaps = 14/323 (4%)
 Frame = +1

Query  172   IFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDC  351
             I LA +C     + +  L  GFY  TCP +E IV+E   ++I+ APSLAGPLLR+HFHDC
Sbjct  18    IMLALSC-----SAFAQLETGFYSATCPKVEEIVREETVKIISAAPSLAGPLLRLHFHDC  72

Query  352   FVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVA  528
             FVRGC+ SVLLDS P    E+DA PN SLRGF  +++VK  +E ACPGVVSCAD+LA++A
Sbjct  73    FVRGCDASVLLDSTPGHLAERDAKPNKSLRGFGSVERVKAKLEAACPGVVSCADVLALMA  132

Query  529   RDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVL  708
             R+     KGP W V  GRRDG  S+  EA   L P F ++ +L + F  KGL VKDL VL
Sbjct  133   REAVVLAKGPTWTVPLGRRDGVASSAAEASKELPPSFGDVPLLAKIFASKGLGVKDLAVL  192

Query  709   SGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSV  888
             SG HT+G +HC S+ DRLY        D SLD  YAEKLK +C   + T  L EMDPGS 
Sbjct  193   SGAHTLGTAHCPSYADRLYGRV----VDASLDSEYAEKLKSRCKSVNDTATLSEMDPGSY  248

Query  889   RTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGS---TFFKDFGESMVNMG  1059
             +TFDTSY+  +AKRRGLF SDAALLDD+ TK Y VQ+    G+   TFF+DFGESMV MG
Sbjct  249   KTFDTSYYRHVAKRRGLFRSDAALLDDDTTKGY-VQRVAAAGNFDGTFFRDFGESMVKMG  307

Query  1060  RIGVLTGDQGEIRKVCTAVNNYY  1128
              +GVLTG QGEIR+ C  +N  +
Sbjct  308   NVGVLTGVQGEIRRKCYVINKTH  330



>ref|XP_010227737.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=322

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 212/301 (70%), Gaps = 6/301 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L +G+Y ++CP++E IV+E   ++I+ APSLAGPLLR+HFHDCFVRGC+ SVL+DS    
Sbjct  26    LEIGYYSKSCPNVEAIVREEMVKIISAAPSLAGPLLRLHFHDCFVRGCDASVLIDSTKGN  85

Query  403   -GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN SLRGF  +++VK  +E ACPGVVSCAD+L ++ARD     KGP W VE G
Sbjct  86    LAERDAKPNRSLRGFGSVERVKAKLESACPGVVSCADVLTLMARDAVVLAKGPSWPVELG  145

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR SN  EA   L P F +I +L + F  KGL +KDLVVLSG HT+G +HC S+ DR
Sbjct  146   RRDGRTSNAAEASDELPPAFGDIPLLTKIFASKGLDLKDLVVLSGAHTLGTAHCPSYADR  205

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYN T    ADPSLD  YAEKL+MKC   +    L EMDPGS +TFD SY+  +AKRRGL
Sbjct  206   LYNAT----ADPSLDSEYAEKLRMKCRSVNDGSTLSEMDPGSYKTFDGSYYRHVAKRRGL  261

Query  940   FTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             F SDAALL D  T+ Y+ + A       FFKDF ESM+ MG +GVLTG QGEIRK C  +
Sbjct  262   FRSDAALLTDATTREYVRRVATGKFDDAFFKDFSESMIKMGNVGVLTGVQGEIRKKCYVL  321

Query  1117  N  1119
             N
Sbjct  322   N  322



>gb|KFK31897.1| hypothetical protein AALP_AA6G173300 [Arabis alpina]
Length=326

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 225/334 (67%), Gaps = 13/334 (4%)
 Frame = +1

Query  133   MAKFSRYL--SLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVA  306
             MA+F   L  +L IL F++F+           L++GFY++TCP+ E IV+ + +Q I   
Sbjct  1     MARFGLVLVIALAILGFMSFS--------EAQLKMGFYDKTCPNAEKIVQSVVNQHIQNV  52

Query  307   PSLAGPLLRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEE  480
             PSLA  L+RMHFHDCFVRGC+GS+L++  S  +Q EK APPN ++RGF  ID VK  +E 
Sbjct  53    PSLAAGLIRMHFHDCFVRGCDGSILINATSRNQQVEKVAPPNLTVRGFDFIDLVKFVLES  112

Query  481   ACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLK  660
              CPG+VSCADI+ +  RD  AA+ GP W V TGRRDGR+SN TEA  N+ PPF N T L 
Sbjct  113   KCPGIVSCADIITLATRDSIAAIGGPTWSVPTGRRDGRISNATEARNNIPPPFGNFTTLI  172

Query  661   QGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KC  837
               F ++GL VKDLV+LSG HTIG+SHCSSF++RL+NFTG GD DPSLD  YA  LK  +C
Sbjct  173   TLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYAANLKTRRC  232

Query  838   PEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGS  1017
                +     VEMDPGS  TFD SYF L+ KRRGLF SDAAL  + E  + + + A     
Sbjct  233   LSLADNTTKVEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTMNSEALSQVRRFARGSEQ  292

Query  1018  TFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              FF +F +SM  MGRIGV TG  GEIR+ C+ VN
Sbjct  293   DFFAEFAKSMEKMGRIGVQTGSDGEIRRTCSVVN  326



>emb|CDY49517.1| BnaC05g03290D [Brassica napus]
Length=320

 Score =   351 bits (901),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 212/301 (70%), Gaps = 6/301 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+ +  Q ++  PSLA  LLRMHFHDCFVRGC+GS+LL  P  
Sbjct  25    GLYLNYYKYRCPDAEAIVRRVTVQYVSHEPSLAAALLRMHFHDCFVRGCDGSILLKYPYN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             + E+ A PN S+RG++++D VK+A+E  CPGVVSCAD+L++VARD    + GP+W V  G
Sbjct  85    ETERYAAPNLSVRGYEVVDAVKSALERKCPGVVSCADVLSLVARDAVVVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  P A I  LK+ FFDKGL+ KDLVVLSG HTIGISHCS     
Sbjct  145   RRDGRISRKSEV--NLPSPLAGIAALKKKFFDKGLNTKDLVVLSGAHTIGISHCSVIHQG  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN-LVEMDPGSVRTFDTSYFTLIAKRRG  936
             +YNFTGK D+D S++P Y   LK +C   +P DN  + MDP SV+ FD+ YF ++A+R+G
Sbjct  203   IYNFTGKADSDSSMNPRYVRALKRRC---NPADNRTIVMDPRSVKKFDSHYFNMVAQRKG  259

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SD  LLDD ETK+Y+  Q  T GS+F KDF  SMV +G + +LTG++GEIRK C  V
Sbjct  260   LFKSDRTLLDDPETKSYIYTQVATAGSSFNKDFAHSMVKLGFVEILTGNKGEIRKRCAFV  319

Query  1117  N  1119
             N
Sbjct  320   N  320



>ref|XP_003580604.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=333

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 220/307 (72%), Gaps = 5/307 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             G+RVGFY+ TCP+ E I+++   ++I+  PSLAGPLLRMHFHDCFV GC+GS+LL+S P 
Sbjct  26    GVRVGFYKYTCPNAEVIIRDEMTKIISGVPSLAGPLLRMHFHDCFVNGCDGSILLNSTPG  85

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EK++ PN +LRGF  ID VK+ +E+ACPGVVSCADILA+VARDV    KGP+W+V T
Sbjct  86    SPSEKESIPNLTLRGFGTIDLVKSKLEQACPGVVSCADILALVARDVVLLTKGPHWDVPT  145

Query  577   GRRDGRVSNMTEALFNLLPPFANITV-LKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             GRRDG  S   +AL NL PPF + T  L Q F  KGL  KD VVL GGHT+G SHCSSF+
Sbjct  146   GRRDGMRSAKEDALNNLPPPFFDATQNLNQFFIPKGLDAKDQVVLLGGHTLGTSHCSSFS  205

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             DRLYNF+G   ADP LD  Y  +LK KC + + T  LVEMDPGS RTFDTSY+ +IAK R
Sbjct  206   DRLYNFSGTHMADPMLDKQYTRRLKTKC-KPNDTTTLVEMDPGSFRTFDTSYYRVIAKGR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
              LFTSD  L+ D  T+ Y+++QA   G  + FF DF  SMV MG + VLTG QGEIRK C
Sbjct  265   ALFTSDETLMLDPFTRDYVLRQAGVAGYPAEFFADFAASMVKMGNMQVLTGAQGEIRKHC  324

Query  1108  TAVNNYY  1128
               VN  +
Sbjct  325   AFVNKMH  331



>ref|XP_002459202.1| hypothetical protein SORBIDRAFT_02g000470 [Sorghum bicolor]
 gb|EER95723.1| hypothetical protein SORBIDRAFT_02g000470 [Sorghum bicolor]
Length=336

 Score =   352 bits (902),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 212/306 (69%), Gaps = 6/306 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-P  393
              GL + FY  TCP +E IVKE   +++ V+P+LAGPLLR+HFHDCFVRGC+GSVLLDS P
Sbjct  32    AGLDMDFYSSTCPRVEAIVKEEMTEILKVSPTLAGPLLRLHFHDCFVRGCDGSVLLDSTP  91

Query  394   TKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVE  573
             +   EKDA PN +LRGF  + +VK  +E+ACPG VSCAD+LA++ARD      GP W V 
Sbjct  92    SSTSEKDATPNLTLRGFGSVQRVKDKLEQACPGTVSCADVLALMARDAVVLANGPSWPVA  151

Query  574   TGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
              GRRDGRVS   E    L PP AN T L Q F  KGLSVKDLVVLSGGHT+G +HC+ F+
Sbjct  152   LGRRDGRVSISNET-NQLPPPTANFTRLVQMFAAKGLSVKDLVVLSGGHTLGTAHCNLFS  210

Query  754   DRLYNFTGK---GDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIA  924
             DRLYNFTG     D DP+LD  Y  +L+ +C   +    L EMDPGS  +FD SY+ L+A
Sbjct  211   DRLYNFTGANNLADVDPALDATYLARLRSRCRSLADNTTLNEMDPGSFLSFDASYYRLVA  270

Query  925   KRRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRK  1101
             KRRGLF SDAALL D  T+AY+ +QA     + FF+DF +SMV M  I VLTG QGEIR 
Sbjct  271   KRRGLFHSDAALLTDPATRAYVQRQATGLFAAEFFRDFADSMVKMSTIDVLTGAQGEIRN  330

Query  1102  VCTAVN  1119
              C  VN
Sbjct  331   KCYLVN  336



>ref|XP_009108181.1| PREDICTED: peroxidase 39 [Brassica rapa]
 emb|CDX86795.1| BnaA09g21850D [Brassica napus]
Length=326

 Score =   351 bits (900),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 180/332 (54%), Positives = 223/332 (67%), Gaps = 9/332 (3%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MA+F   + + IL+ L     +        L++GFY++TCP+ E IV+ + +Q I   PS
Sbjct  1     MARFG-LVFVTILVILGLVSFSEAQ-----LKLGFYDKTCPNAEKIVQAVVNQHIRNVPS  54

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEAC  486
             LA  L+RMHFHDCFVRGC+GS+L++  S  +Q EK APPN ++RGF  ID VKT +E  C
Sbjct  55    LAAGLIRMHFHDCFVRGCDGSILINATSSNQQVEKVAPPNLTVRGFDFIDLVKTVLERKC  114

Query  487   PGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQG  666
             PGVVSCADI+ +  RD  AA+ GP W V TGRRDGR+SN TEAL N+ PPF N + L   
Sbjct  115   PGVVSCADIITLATRDSVAAIGGPTWNVPTGRRDGRISNATEALNNIPPPFGNFSTLITL  174

Query  667   FFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPE  843
             F ++GL VKDLV+LSG HTIG+SHCSSF++RL+NFTG GD DPSLD  YA+ LK  KC  
Sbjct  175   FGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYADNLKSRKCLS  234

Query  844   ESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
              +     VEMDPGS  TFD SYF L+ KRRGLF SDAAL  D      +   A      F
Sbjct  235   IADNTTQVEMDPGSRNTFDLSYFKLVLKRRGLFESDAALTKDPTALGQVRGFAGGSLQDF  294

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F +FG+SM  MGRIGV TG  GEIR+ C+ VN
Sbjct  295   FVEFGKSMEKMGRIGVKTGSDGEIRRTCSVVN  326



>ref|XP_006654599.1| PREDICTED: peroxidase 1-like [Oryza brachyantha]
Length=326

 Score =   351 bits (900),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 205/299 (69%), Gaps = 5/299 (2%)
 Frame = +1

Query  235   FYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSP-TKQGEK  411
             FY  +CP +E +V+    + +A APSLAGPLLRMHFHDCFVRGC+GSVLLDS      EK
Sbjct  29    FYSHSCPSVEAVVRREMVRALAAAPSLAGPLLRMHFHDCFVRGCDGSVLLDSAGNNTAEK  88

Query  412   DAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDG  591
             DA PN +LRGF  I++VK AVE+ACPG VSCAD+LA++ARD     KGP+W V  GRRDG
Sbjct  89    DATPNQTLRGFGFIERVKAAVEKACPGTVSCADVLALMARDAVWLSKGPFWAVPLGRRDG  148

Query  592   RVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNF  771
             RVS   E    L PP AN T L Q F  K L +KDLVVLS GHTIG SHCSSFTDRLYNF
Sbjct  149   RVSIANET-DQLPPPTANFTELTQMFAAKNLDLKDLVVLSAGHTIGTSHCSSFTDRLYNF  207

Query  772   TG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLF  942
             TG     D DP+L+  Y  +LK KC   +    LVEMDPGS RTFD  YF  +AKRRGLF
Sbjct  208   TGLDNAHDVDPTLELQYMARLKSKCTSLADNTTLVEMDPGSFRTFDLGYFKHVAKRRGLF  267

Query  943   TSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SD  LL +  T+AY+++ A      FF DF  SMV MG +GVLTG QGEIRK C  VN
Sbjct  268   HSDGELLTNGFTRAYVLRHAAGSQDEFFADFAASMVKMGNVGVLTGSQGEIRKKCNVVN  326



>gb|ACU24335.1| unknown [Glycine max]
Length=324

 Score =   351 bits (900),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 224/327 (69%), Gaps = 10/327 (3%)
 Frame = +1

Query  148   RYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPL  327
             R+LSL +L  +A        + +  L++GFY  +CP  E IV +     I  APSLA  L
Sbjct  6     RFLSLCLLALIA--------STHAQLQLGFYANSCPKAEQIVLKFVHDHIHNAPSLAAAL  57

Query  328   LRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCA  507
             +RMHFHDCFVRGC+ SVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CPGVVSCA
Sbjct  58    IRMHFHDCFVRGCDASVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECPGVVSCA  117

Query  508   DILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLS  687
             DIL + ARD   A  GP+W+V TGRRDG VSN+TEA  ++  P +N T L+  F ++GL 
Sbjct  118   DILTLAARDTIVATGGPFWKVPTGRRDGVVSNLTEARNDIPAPSSNFTTLQTLFANQGLD  177

Query  688   VKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNL  864
             +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSLD  YA  LK  KC + +  +  
Sbjct  178   LKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLDSEYAANLKAFKCTDLNKLNTT  237

Query  865   -VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGE  1041
              +EMDPGS +TFD SY++ + KRRGLF SDAALL +  TKA ++Q        FF +F  
Sbjct  238   KIEMDPGSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIQLLEGSVENFFAEFAT  297

Query  1042  SMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             S+  MGRI V TG +GEIRK C  +N+
Sbjct  298   SIEKMGRINVKTGTEGEIRKHCAFINS  324



>emb|CDY55446.1| BnaC08g46340D [Brassica napus]
Length=340

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 222/312 (71%), Gaps = 11/312 (4%)
 Frame = +1

Query  196   NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGS  375
             N  ATG   L + +Y  TCP LE IV+ +  Q ++  P+LA  LLRM+FHDCFVRGC+GS
Sbjct  36    NPRATG--DLDLDYYRSTCPQLESIVRRVTFQYVSRRPTLAAALLRMYFHDCFVRGCDGS  93

Query  376   VLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEE--ACPGVVSCADILAIVARDVTAAM  549
             +LL SP K  E+DA PN S+RG++++D VK ++E    C GVVSCADILA+VARD  A +
Sbjct  94    ILLKSPNKDAERDAIPNLSVRGYEVVDAVKASLERTWGCRGVVSCADILALVARDAVAVI  153

Query  550   KGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIG  729
              GP+W V  GRRDGR+S ++E   NL  PFAN+  LK+ F DKGL+ KDLVVLSG HTIG
Sbjct  154   GGPWWPVPLGRRDGRISKLSEV--NLPSPFANVKTLKKNFLDKGLNSKDLVVLSGAHTIG  211

Query  730   ISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDT  903
             +S C    +R++NFTGKGD DP+++P+Y   LK +C    PTD    V+MDPGS R FD+
Sbjct  212   VSSCGLINNRIHNFTGKGDFDPAMNPSYVRTLKKRC---KPTDVRTPVDMDPGSARKFDS  268

Query  904   SYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGD  1083
              YF ++A+++GLFTSDA LLDD +T  Y+  Q +T G++F +DF +SMV +G + +LTG 
Sbjct  269   HYFNIVAQKKGLFTSDATLLDDIDTNLYIQAQVVTRGASFARDFSDSMVKLGFVEILTGR  328

Query  1084  QGEIRKVCTAVN  1119
             QGEIR+ C  VN
Sbjct  329   QGEIRRRCAFVN  340



>ref|NP_192868.1| peroxidase 39 [Arabidopsis thaliana]
 sp|Q9SUT2.1|PER39_ARATH RecName: Full=Peroxidase 39; Short=Atperox P39; AltName: Full=ATP19a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB51413.1| peroxidase ATP19a [Arabidopsis thaliana]
 emb|CAB81230.1| peroxidase ATP19a [Arabidopsis thaliana]
 dbj|BAD95298.1| peroxidase ATP19a [Arabidopsis thaliana]
 gb|ABH04555.1| At4g11290 [Arabidopsis thaliana]
 gb|AEE82993.1| peroxidase 39 [Arabidopsis thaliana]
Length=326

 Score =   351 bits (900),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 213/302 (71%), Gaps = 3/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPT  396
             L++GFY+QTCP+ E IV+++ +Q I  APSLA  L+RMHFHDCFVRGC+GS+L++  S  
Sbjct  25    LKMGFYDQTCPYAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSN  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             +Q EK APPN ++RGF  IDKVK+A+E  CPG+VSCADI+ +  RD   A+ GP W V T
Sbjct  85    QQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPT  144

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+SN  EA+ N+ PPF N T L   F ++GL VKDLV+LSG HTIG+SHCSSF++
Sbjct  145   GRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSN  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             RL+NFTG GD DPSLD  YA+ LK  +C   +     VEMDPGS  TFD SY+ L+ KRR
Sbjct  205   RLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVLKRR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAAL  +    A + + A      FF +F  SM  MGRIGV TG  GEIR+ C  
Sbjct  265   GLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIRRTCAF  324

Query  1114  VN  1119
             VN
Sbjct  325   VN  326



>ref|XP_006855828.1| hypothetical protein AMTR_s00037p00030970 [Amborella trichopoda]
 gb|ERN17295.1| hypothetical protein AMTR_s00037p00030970 [Amborella trichopoda]
Length=326

 Score =   350 bits (899),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 225/334 (67%), Gaps = 12/334 (4%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             M + + Y  + +L+      C      +G L++GFY++TCP+ E IV +   + I   P 
Sbjct  1     MGRLNSYGVMGVLVLALLGTC------HGELKMGFYDKTCPNAEKIVSDFMKEHIPKVPI  54

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ-GEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             LA   LRMHFHDCFVRGC+GSVLL+S +    EK+A PN +LRGF  ID+VK  VE  CP
Sbjct  55    LAASFLRMHFHDCFVRGCDGSVLLNSTSNSTSEKEANPNLTLRGFDQIDRVKVLVEAECP  114

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADILA+ ARD    + GP+W+V TGRRDG VS   EA   +  P  N T LK+ F
Sbjct  115   GVVSCADILALSARDSVGVLGGPFWKVPTGRRDGSVSLRAEANAQIPAPTNNFTTLKESF  174

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KCPEE  846
              +K LSVKDLV+LSGGHTIGI+ C+SF+ RLYNFTG GD DPS+D NY   LK  KC  +
Sbjct  175   ANKSLSVKDLVLLSGGHTIGIARCTSFSRRLYNFTGVGDQDPSMDSNYVANLKQRKCRTQ  234

Query  847   SPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGS--T  1020
             +    +VEMDPGS RTFD SY+ L+ KRRGLFTSDAAL+ D  +K+ +  + LT+G+   
Sbjct  235   TDNTTIVEMDPGSFRTFDLSYYRLVLKRRGLFTSDAALITDSTSKSLV--EDLTNGTPED  292

Query  1021  FFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             FFK+F +SMV MG I V TG  GEIRK C  VN+
Sbjct  293   FFKEFAKSMVKMGEIDVKTGSSGEIRKHCAFVNS  326



>emb|CAA67337.1| peroxidase [Arabidopsis thaliana]
Length=326

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 213/302 (71%), Gaps = 3/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPT  396
             L++GFY+QTCP+ E IV+++ +Q I  APSLA  L+RMHFHDCFVRGC+GS+L++  S  
Sbjct  25    LKMGFYDQTCPYAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSN  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             +Q EK APPN ++RGF  IDKVK+A+E  CPG+VSCADI+ +  RD   A+ GP W V T
Sbjct  85    QQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPT  144

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+SN  EA+ N+ PPF N T L   F ++GL VKDLV+LSG HTIG+SHCSSF++
Sbjct  145   GRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSN  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             RL+NFTG GD DPSLD  YA+ LK  +C   +     VEMDPGS  TFD SY+ L+ KRR
Sbjct  205   RLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVLKRR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAAL  +    A + + A      FF +F  SM  MGRIGV TG  GEIR+ C  
Sbjct  265   GLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMGRIGVKTGSDGEIRRTCAF  324

Query  1114  VN  1119
             VN
Sbjct  325   VN  326



>dbj|BAK00543.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 212/301 (70%), Gaps = 2/301 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L +G+Y ++CP +E IV+E   ++I+ APSLAGPLLR+HFHDCFVRGC+ SVLLDS    
Sbjct  24    LEIGYYRKSCPDVEAIVREEMVKIISAAPSLAGPLLRLHFHDCFVRGCDASVLLDSTKGN  83

Query  403   -GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN SLRGF  +++VK  +E ACPG+VSCAD+L ++ARD     KGP W V  G
Sbjct  84    LAERDAKPNKSLRGFGSVERVKAKLEAACPGIVSCADVLTLMARDAVVLAKGPSWPVALG  143

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +S+ TEA   L P F ++ +L + F  KGL +KDLVVLSG HT+G +HC SF DR
Sbjct  144   RRDGSMSSATEASDELPPSFGDVPLLTRIFASKGLGLKDLVVLSGAHTLGTAHCPSFADR  203

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYN TG G ADPSLD  YA+KL++KC        L EMDPGS RTFDTSY+  +AKRRGL
Sbjct  204   LYNTTGNGLADPSLDSEYADKLRLKCKSVDDRSMLAEMDPGSYRTFDTSYYRHVAKRRGL  263

Query  940   FTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             F SDAALL D  T+ Y+ + A       FF+DF ESM+ MG +GVLTG  G+IRK C  +
Sbjct  264   FRSDAALLTDATTEEYVRRVATGKFDGAFFRDFSESMIKMGNVGVLTGGDGDIRKKCYVL  323

Query  1117  N  1119
             N
Sbjct  324   N  324



>ref|XP_002872571.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48830.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 223/332 (67%), Gaps = 8/332 (2%)
 Frame = +1

Query  133   MAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPS  312
             MAKF   L + IL+   F   +        L++GFY+QTCP+ E IV+++ +Q I  APS
Sbjct  1     MAKFGLALVMMILVIQGFVRFSE-----AQLKMGFYDQTCPYAEKIVQDVVNQHIHNAPS  55

Query  313   LAGPLLRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEAC  486
             LA  L+RMHFHDCFVRGC+GS+L++  S  +Q EK APPN ++RGF  IDKVK+A+E  C
Sbjct  56    LAAGLIRMHFHDCFVRGCDGSILINATSSNQQVEKLAPPNLTVRGFDFIDKVKSALESKC  115

Query  487   PGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQG  666
             PG+VSCADI+ +  RD   A+ GP W V TGRRDGR+SN  EA  N+ PPF N T L   
Sbjct  116   PGIVSCADIITLATRDSIVAIGGPTWNVPTGRRDGRISNFAEARNNIPPPFGNFTTLITL  175

Query  667   FFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPE  843
             F ++GL VKDLV+LSG HTIG+SHCSSF++RL+NFTG GD DPS+D  Y + LK  +C  
Sbjct  176   FGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSMDSEYVDNLKSRRCLA  235

Query  844   ESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
              +     VEMDPGS  TFD SY+ L+ KRRGLF SDAAL  +    A + + +      F
Sbjct  236   LADNTTTVEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFSGGSEQEF  295

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F +F +SM  MGRIGV TG  GEIR+ C  VN
Sbjct  296   FAEFSKSMEKMGRIGVKTGSDGEIRRTCAFVN  327



>gb|ACI00841.1| class III peroxidase [Triticum aestivum]
Length=329

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 210/306 (69%), Gaps = 9/306 (3%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L   FY ++CP +E +V+    + +++APSLAGPLLRMHFHDCFVRGC+GSVLLDS  K 
Sbjct  27    LHEKFYSESCPSVEDVVRREMVRALSLAPSLAGPLLRMHFHDCFVRGCDGSVLLDSANKT  86

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EKDA PN +LRGF  I++VK AVE+ACP  VSCAD+LAI+ARD     KGP+WEV  GR
Sbjct  87    AEKDALPNQTLRGFGFIERVKAAVEKACPDTVSCADLLAIIARDAVWLSKGPFWEVLLGR  146

Query  583   RDGRV--SNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             RDG V  SN T+A   L PP AN TVL Q F    L  KDLVVLS  HTIG SHC SF+D
Sbjct  147   RDGSVSISNDTDA---LPPPTANFTVLTQNFAAVNLDAKDLVVLSAAHTIGTSHCFSFSD  203

Query  757   RLYNFTG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAK  927
             RLYNFTG     D DPSL+P Y  KLK KC   +    LVEMDPGS +TFDT YF L++K
Sbjct  204   RLYNFTGMENASDIDPSLEPQYMMKLKSKCASLNDNTTLVEMDPGSFKTFDTDYFKLVSK  263

Query  928   RRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             RRGLF SD ALL D  T+AY+ + A       FF DF  SMV MG   VLTG QGEIRK 
Sbjct  264   RRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFAVSMVKMGNNQVLTGSQGEIRKK  323

Query  1105  CTAVNN  1122
             C+  N+
Sbjct  324   CSVANH  329



>gb|KDP25855.1| hypothetical protein JCGZ_22885 [Jatropha curcas]
Length=323

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 219/318 (69%), Gaps = 2/318 (1%)
 Frame = +1

Query  175   FLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCF  354
              + FA   + ++    L++GFY Q+CP+ E IV+   +Q I  APSLA PLLRMHFHDCF
Sbjct  6     LIVFALLVYMSSSQAQLQLGFYSQSCPNAEQIVQNFVNQHIHNAPSLAAPLLRMHFHDCF  65

Query  355   VRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVAR  531
             VRGC+GSVL++S +  Q EK A PN +LRGF  I+ VK+ +E ACPGVVSCADI+A+VAR
Sbjct  66    VRGCDGSVLINSTSNNQSEKAATPNLTLRGFGFIESVKSLLEAACPGVVSCADIIALVAR  125

Query  532   DVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLS  711
             D   A  GP W V TGRRDG +SN+TEA  ++ PP +N T L++ F + GL +KDLV+LS
Sbjct  126   DAIVATGGPSWSVPTGRRDGTISNVTEAQNDIPPPTSNFTNLQRLFANVGLDLKDLVLLS  185

Query  712   GGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSV  888
             G HTIG++HC SF++RLYNFTG GD DP+LD  YA  LK  KC   +    +VEMDPGS 
Sbjct  186   GAHTIGVAHCPSFSNRLYNFTGVGDQDPALDSEYAANLKSRKCTTPNDNTTIVEMDPGSR  245

Query  889   RTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIG  1068
             +TFD SY++ + KRRGLF SD+AL  +  T A + Q        F+ +F  SM  MGRI 
Sbjct  246   KTFDLSYYSNLLKRRGLFQSDSALTTNSATLATINQLLSGSLQNFYAEFATSMEKMGRIN  305

Query  1069  VLTGDQGEIRKVCTAVNN  1122
             V TG  GEIRK+C  VN+
Sbjct  306   VKTGSTGEIRKICAVVNS  323



>ref|XP_011100296.1| PREDICTED: peroxidase 3-like [Sesamum indicum]
Length=327

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 215/308 (70%), Gaps = 3/308 (1%)
 Frame = +1

Query  205   ATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLL  384
             A+ +  L + FY ++CP  E IV +  ++ I  APSLA  L+RMHFHDCFVRGC+ SVLL
Sbjct  20    ASTHADLEMNFYAKSCPKAEKIVLDYVNKHIPNAPSLAASLIRMHFHDCFVRGCDASVLL  79

Query  385   D---SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKG  555
             +   S   Q EK A PN +LRGF  ID+VK  +E  CPGVVSCADI+++VARD   A  G
Sbjct  80    NFTSSTGNQTEKVAIPNRTLRGFDFIDQVKGLLEAECPGVVSCADIVSLVARDAVVATGG  139

Query  556   PYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGIS  735
             P+W V TGRRDG +SN++EAL  +  P +N + L+  F +KGL++KDLV+LSG HTIGIS
Sbjct  140   PFWRVPTGRRDGVISNVSEALAQIPAPSSNFSTLQTDFANKGLNLKDLVLLSGAHTIGIS  199

Query  736   HCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFT  915
             HCSSFT+RLYNFTG GD DP+LD  YA  LK +      + N+VEMDPGS RTFD SY+T
Sbjct  200   HCSSFTNRLYNFTGVGDQDPALDSEYAVNLKARKCRSINSTNIVEMDPGSFRTFDLSYYT  259

Query  916   LIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEI  1095
             L+ KRRGLF SDAALL D  T++ + Q        F+++F +SM  MGRIGV TG  GEI
Sbjct  260   LVLKRRGLFQSDAALLTDSRTRSMITQLVEGPVGNFYREFAKSMEKMGRIGVKTGSAGEI  319

Query  1096  RKVCTAVN  1119
             RK C  VN
Sbjct  320   RKHCAVVN  327



>ref|XP_010931180.1| PREDICTED: peroxidase 3-like isoform X1 [Elaeis guineensis]
Length=325

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 216/321 (67%), Gaps = 8/321 (2%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             I + L+  C N        L++GFY++TCP  E I+ +   + I  APSLA PLLR+HFH
Sbjct  11    ICVALSLFCAN------ADLKLGFYDETCPKAEKIIFDYVKKHIPHAPSLAAPLLRVHFH  64

Query  346   DCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAI  522
             DCFVRGC+ SVL++S +K Q EK A PN S+RGF  ID+VK+ +E  CPGVVSCADILA+
Sbjct  65    DCFVRGCDASVLINSTSKNQAEKSAFPNLSIRGFDFIDRVKSLIEAECPGVVSCADILAL  124

Query  523   VARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLV  702
             VARD      GP+W V TGRRDG +SN  EAL NL  P  N + L+  F  KGL +KDLV
Sbjct  125   VARDSVVVTGGPFWNVPTGRRDGLISNSIEALKNLPAPTFNFSALQTSFASKGLDLKDLV  184

Query  703   VLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKL-KMKCPEESPTDNLVEMDP  879
             +LSG HTIG+SHCSSF+ RLYNFTGKGD DPSLD  YA  L K KC   + T  +VEMDP
Sbjct  185   LLSGAHTIGVSHCSSFSSRLYNFTGKGDEDPSLDSFYAANLKKYKCKVPNDTTTIVEMDP  244

Query  880   GSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMG  1059
             GS RTFD  Y+  + KRRGL  SDAAL  +  TKA +++   +    FFK+F  SM  MG
Sbjct  245   GSFRTFDLGYYKHLLKRRGLLQSDAALTTNTATKASIMELVSSPLEVFFKEFAFSMEKMG  304

Query  1060  RIGVLTGDQGEIRKVCTAVNN  1122
             RI V TG  GEIRK C  VN+
Sbjct  305   RIEVKTGSSGEIRKNCAVVNS  325



>ref|XP_008341973.1| PREDICTED: peroxidase 3-like [Malus domestica]
Length=325

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 213/303 (70%), Gaps = 5/303 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L++GFY + CP+ E IVK+   + I  APSLA  LLR+HFHDCFVRGC+ SVLL+S  + 
Sbjct  25    LQLGFYAKNCPNAEKIVKDYVGEHIHNAPSLAAALLRLHFHDCFVRGCDASVLLNSTSSN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAPPN SLRGF  ID++K+ +E  CPG+VSCAD++A+VARD   A  GP W+V TG
Sbjct  85    QAEKDAPPNLSLRGFDFIDRIKSQLEAQCPGIVSCADVVALVARDSIVATGGPTWKVPTG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG ++   EA+ NL PP +N + L+  F + GL  KDLV+LSG HTIGISHCSSF++R
Sbjct  145   RRDGMIARSAEAIANLPPPTSNFSNLQSLFANVGLDWKDLVLLSGAHTIGISHCSSFSNR  204

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKRR  933
             LYNFTG GD DP L   YA KLK KC  ++PTDN   VEMDPGS RTFD SY+T + KRR
Sbjct  205   LYNFTGVGDQDPDLKTEYAAKLKAKC--KTPTDNTTFVEMDPGSFRTFDLSYYTHLLKRR  262

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAAL    +   Y+ Q        FF +FG+SM  MGR  V TG  GEIRK C+ 
Sbjct  263   GLFQSDAALKTSPKAYNYINQLLKGPLQNFFYEFGKSMEKMGRANVKTGSAGEIRKQCSV  322

Query  1114  VNN  1122
             VN+
Sbjct  323   VNS  325



>ref|XP_004287925.1| PREDICTED: peroxidase 3-like [Fragaria vesca subsp. vesca]
Length=326

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 207/302 (69%), Gaps = 2/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L++GFY + CP  E IVK   ++ I  APSLA  LLRMHFHDCFVRGC+ SVL++S +  
Sbjct  25    LQLGFYTKNCPKAEKIVKNFVEEHIRNAPSLAAALLRMHFHDCFVRGCDASVLVNSTSSN  84

Query  403   -GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDA PN +LRGF  ID+VK+ VE  CPGVVSCAD++A+ ARD      GP+W V TG
Sbjct  85    TAEKDATPNLTLRGFDFIDRVKSLVEAQCPGVVSCADVIALAARDSVVTTGGPFWNVPTG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +S  +EAL ++  PF+N T L+  F ++GL++KDLV+LSG HTIG+SHC+SFT+R
Sbjct  145   RRDGVISKSSEALASIPSPFSNFTTLQTNFANQGLNLKDLVLLSGAHTIGVSHCTSFTNR  204

Query  760   LYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             LYNFTGKGD DP LD  YA  LK  KC   S    +VEMDPGS RTFD SY+ L+ KRRG
Sbjct  205   LYNFTGKGDQDPDLDSEYAANLKAKKCKSLSDNTTIVEMDPGSHRTFDLSYYALLLKRRG  264

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SD+AL     T  Y+ Q        F  +F +SM  MGRI V TG  GEIRK C  V
Sbjct  265   LFQSDSALTKSSTTYNYIKQLIQGSSPNFHAEFAKSMEKMGRINVKTGSSGEIRKHCAVV  324

Query  1117  NN  1122
             N+
Sbjct  325   NS  326



>ref|XP_004978254.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=359

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 212/307 (69%), Gaps = 7/307 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GLRVGFY+ TCP+ E IV++   ++I+  PSLAGPLLRMHFHDCFV GC+GS+LL+S   
Sbjct  53    GLRVGFYQYTCPNAEAIVRDEMTKIISQVPSLAGPLLRMHFHDCFVNGCDGSILLNSVWG  112

Query  400   -QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EK+A PN SLRGF  ID+VK  +E+ACPGVVSCADILA+VARDV    KGP+W+V T
Sbjct  113   LPSEKEAIPNLSLRGFGTIDRVKAKLEKACPGVVSCADILALVARDVVVLTKGPHWDVPT  172

Query  577   GRRDGRVSNMTEALFNLLPPFANI-TVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             GRRDGR S   +AL NL PPF N    L Q F  KGL  KD VVL GGHT+G SHCS F 
Sbjct  173   GRRDGRRSVKQDALDNLPPPFFNAGQNLYQFFIPKGLDAKDQVVLLGGHTLGTSHCSQFA  232

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             DRLYNF+G    DPSLD  Y  +LK KC     T  LVEMDPGS RTFD SY+  +A+ R
Sbjct  233   DRLYNFSGTTMPDPSLDKRYIPRLKSKCASPGDTTTLVEMDPGSFRTFDASYYRHVARGR  292

Query  934   GLFTSDAALLDDEETKAYLVQQALT-----HGSTFFKDFGESMVNMGRIGVLTGDQGEIR  1098
              LFTSD  L++D    AY+ +QA       + + FF DF  SMV MG +GVLTG QGE+R
Sbjct  293   SLFTSDQTLMNDPAAGAYVRRQAAVADAGAYPAEFFADFAASMVKMGGVGVLTGAQGEVR  352

Query  1099  KVCTAVN  1119
             + C  VN
Sbjct  353   RHCAFVN  359



>ref|XP_010908222.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=326

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 221/323 (68%), Gaps = 13/323 (4%)
 Frame = +1

Query  169   LIFLAFA--CCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHF  342
             +I+L+F   CC         L++GFY+++CP  E  + +   + I  AP+LA PLLRMHF
Sbjct  10    MIWLSFGLLCCVK-----ADLQLGFYDKSCPKAEQTISDFVKEHIPHAPTLASPLLRMHF  64

Query  343   HDCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILA  519
             HDCFVRGC+GSVL++S +  Q EK A PN +LRGF  ID+VK+ VE+ CPGVVSCADILA
Sbjct  65    HDCFVRGCDGSVLINSTSNNQAEKAATPNLTLRGFDFIDRVKSLVEKECPGVVSCADILA  124

Query  520   IVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDL  699
             +VARD    + GP+W V TGRRDG +SN TEAL N+  P  N + L+  F +KGLSV DL
Sbjct  125   LVARDAVGVIGGPFWRVPTGRRDGTISNSTEALNNIPAPTFNFSALQTSFANKGLSVADL  184

Query  700   VVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDN--LVE  870
             + LSG HTIGISHCSSF+ RLYNFTGKG  DPSLD  YA  LK  KC  +SP DN  + E
Sbjct  185   IWLSGAHTIGISHCSSFSSRLYNFTGKGGQDPSLDSFYAANLKKNKC--KSPNDNTSIAE  242

Query  871   MDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMV  1050
             MDPGS RTFD  Y+  + KRRGLF SDAAL+ +  +K+ ++    +    FF+ F  SM 
Sbjct  243   MDPGSFRTFDLGYYKNVLKRRGLFQSDAALITNAASKSAILNIVNSPPEVFFQVFAASME  302

Query  1051  NMGRIGVLTGDQGEIRKVCTAVN  1119
              MGRI VLTG  GEIRK C  VN
Sbjct  303   KMGRIEVLTGSAGEIRKHCAVVN  325



>ref|XP_009119175.1| PREDICTED: peroxidase 2-like [Brassica rapa]
Length=320

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 212/301 (70%), Gaps = 6/301 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+ +  Q ++  PSLA  LLRMHFHDCFVRGC+GS+LL  P  
Sbjct  25    GLYLNYYKHRCPDAESIVRRVTVQYVSHEPSLAAALLRMHFHDCFVRGCDGSILLKYPYN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             + E+ A PN S+RG++++D VK+A+E  CPGVVSCAD+L++VARD    + GP+W V  G
Sbjct  85    ETERYAAPNLSVRGYEVVDAVKSALERKCPGVVSCADVLSLVARDAVIVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  P + I  LK+ FFDKGL+ +DLVVLSG HTIGISHCS     
Sbjct  145   RRDGRISRKSEV--NLPSPLSGIAALKKKFFDKGLNTRDLVVLSGAHTIGISHCSVIHHG  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN-LVEMDPGSVRTFDTSYFTLIAKRRG  936
             +YNFTGK D+D S++P Y   LK +C   +P DN  + MDP SV+ FD+ YF ++A+R+G
Sbjct  203   IYNFTGKSDSDSSMNPRYVRALKRRC---NPADNRTIVMDPRSVKKFDSHYFNMVAQRKG  259

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SD  LLDD ETK+Y+  Q  T GS+F KDF  SMV +G + +LTG++GEIRK C  V
Sbjct  260   LFKSDRTLLDDPETKSYIYTQVATAGSSFNKDFAHSMVKLGFVEILTGNKGEIRKRCAFV  319

Query  1117  N  1119
             N
Sbjct  320   N  320



>gb|ACU19509.1| unknown [Glycine max]
Length=326

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 226/333 (68%), Gaps = 10/333 (3%)
 Frame = +1

Query  130   KMAKFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAP  309
             KM    R+LSL +L  +A        + +  L++GFY ++CP+ E IV +     I  AP
Sbjct  2     KMGSNFRFLSLCLLALIA--------STHAQLQLGFYAKSCPNAEQIVLKFVHDHIHNAP  53

Query  310   SLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACP  489
             SLA  L+RMHFHDCFVRGC+ SVLL+S T Q EK+APPN ++RGF  ID++K+ VE  CP
Sbjct  54    SLAAALIRMHFHDCFVRGCDASVLLNSTTNQAEKNAPPNLTVRGFDFIDRIKSLVEAECP  113

Query  490   GVVSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGF  669
             GVVSCADIL + ARD   A  GP+W+V TGRRDG +SN+TEA  N+  P +N T L+  F
Sbjct  114   GVVSCADILTLSARDTIVATGGPFWKVPTGRRDGVISNLTEARDNIPAPSSNFTTLQTLF  173

Query  670   FDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEE  846
              ++GL +KDLV+LSG HTIGI+HCSS ++RL+NFTGKGD DPSL   YA  LK  KC + 
Sbjct  174   ANQGLDLKDLVLLSGAHTIGIAHCSSLSNRLFNFTGKGDQDPSLGSEYAANLKAFKCTDL  233

Query  847   SPTDNL-VEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTF  1023
             +  +   +EMDP S +TFD SY++ + KRRGLF SDAALL +  TKA +++        F
Sbjct  234   NKLNTTKIEMDPRSRKTFDLSYYSHVIKRRGLFESDAALLTNSVTKAQIIELLEGSVENF  293

Query  1024  FKDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             F +F  SM  MGRI V TG +GEIRK C  VN+
Sbjct  294   FAEFATSMEKMGRINVKTGTEGEIRKHCAFVNS  326



>ref|XP_010231205.1| PREDICTED: peroxidase 1-like [Brachypodium distachyon]
Length=326

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 212/304 (70%), Gaps = 5/304 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L+  FY +TCP +E +V++   + ++VAPSLAGPLLRMHFHDCFVRGC+GSVLLDS  K 
Sbjct  24    LQEKFYSETCPSVEEVVRKEMVRALSVAPSLAGPLLRMHFHDCFVRGCDGSVLLDSANKT  83

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EKDA PN +LRGF  +++VK AVE+ACP  VSCAD+LA++ARD     KGP+WEV  GR
Sbjct  84    AEKDALPNQTLRGFGFVERVKAAVEKACPDTVSCADVLALMARDAVWLSKGPFWEVPLGR  143

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDG VS ++     L PP AN TVL Q F  K L +KDLVVLS GHTIG SHC SF+DRL
Sbjct  144   RDGSVS-ISNETDQLPPPTANFTVLTQLFAAKNLDIKDLVVLSAGHTIGTSHCFSFSDRL  202

Query  763   YNFTGK---GDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             +NFTG+    D DP+LD  Y  KLK KC   +    LVEMDPGS +TFD  YFT++AKRR
Sbjct  203   FNFTGRVNPQDVDPTLDSEYMAKLKGKCASLNDNTTLVEMDPGSFKTFDLDYFTIVAKRR  262

Query  934   GLFTSDAALLDDEETKAYLVQQA-LTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             GLF SD ALL +  T+AY+ + A       FF DF  SM+ MG   VLTG QGEIRK C+
Sbjct  263   GLFHSDGALLTNAFTRAYVQRHAGGAFKEEFFADFAASMIKMGNADVLTGSQGEIRKKCS  322

Query  1111  AVNN  1122
               N 
Sbjct  323   VPNQ  326



>ref|XP_008455840.1| PREDICTED: peroxidase 39-like [Cucumis melo]
Length=329

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 222/330 (67%), Gaps = 9/330 (3%)
 Frame = +1

Query  154   LSLEILIFLAFACCNHHATGYGG----LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAG  321
             + +E L FL  A      +  G     L++GFY ++CP  E IV +   Q I  APSLA 
Sbjct  1     MRMERLTFLVLATIVGLLSLIGSTQAQLKLGFYAKSCPKAEKIVLDFVHQHIHNAPSLAA  60

Query  322   PLLRMHFHDCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
               +RMHFHDCFVRGC+ SVL++S +  Q EKD+ PN +LRGF  ID+VK+ +E+ CPGVV
Sbjct  61    TFIRMHFHDCFVRGCDASVLINSTSNNQAEKDSQPNQTLRGFDFIDRVKSLLEDECPGVV  120

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCAD+L+++ARD   A  GPYWEV TGRRDG +S  +EAL ++ PPF N++ L++ F ++
Sbjct  121   SCADVLSLIARDTIVATGGPYWEVPTGRRDGVISRSSEALNDIPPPFGNLSTLQRLFANQ  180

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD  858
             GL +KDLV+LSG HTIGI+HC SF++RLYNFTG GD DPSLDP YA  LK         +
Sbjct  181   GLDLKDLVLLSGAHTIGIAHCQSFSNRLYNFTGVGDQDPSLDPRYAANLKANKCRTPTAN  240

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHG--STFFKD  1032
             N VEMDPGS  TFD SY++L+ KRRGLF SDAAL  D  T   +  Q L  G    FF +
Sbjct  241   NKVEMDPGSRNTFDLSYYSLLLKRRGLFESDAALTTDATTLGLV--QKLVEGPIEEFFAE  298

Query  1033  FGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
             F  SM  MGRI V TG +GEIR+ C  VNN
Sbjct  299   FAASMEKMGRIKVKTGTEGEIRRKCAVVNN  328



>ref|XP_009111058.1| PREDICTED: peroxidase 2-like [Brassica rapa]
Length=340

 Score =   349 bits (896),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 223/312 (71%), Gaps = 11/312 (4%)
 Frame = +1

Query  196   NHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGS  375
             N  ATG   L + +Y  TCP LE IV+ +  Q ++  P+LA  LLRM+FHDCFVRGC+GS
Sbjct  36    NPRATG--DLDLDYYRSTCPQLESIVRRVTFQYVSRRPTLAAALLRMYFHDCFVRGCDGS  93

Query  376   VLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEE--ACPGVVSCADILAIVARDVTAAM  549
             +LL SP K  E+DA PN S+RG++++D VK+++E    C GVVSCADILA+VARD  A +
Sbjct  94    ILLKSPNKDAERDAIPNLSVRGYEVVDAVKSSLERTWGCRGVVSCADILALVARDAVAVI  153

Query  550   KGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIG  729
              GP+W V  GRRDGR+S ++E   NL  PFA++  LK+ F DKGL+ KDLVVLSG HTIG
Sbjct  154   GGPWWPVPLGRRDGRISKLSEV--NLPSPFADVKTLKKNFMDKGLNSKDLVVLSGAHTIG  211

Query  730   ISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDT  903
             +S C    +R++NFTGKGD DP+++P+Y   LK +C    PTD    V+MDPGS R FD+
Sbjct  212   VSSCGLINNRIHNFTGKGDFDPAMNPSYVRTLKKRC---KPTDVKTPVDMDPGSARKFDS  268

Query  904   SYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGD  1083
              Y+ ++A+++GLFTSDA LLDD +T  Y+  Q +T G++F +DF +SMV +G + +LTG 
Sbjct  269   HYYNIVAQKKGLFTSDATLLDDIDTSLYIQAQVVTRGASFARDFSDSMVKLGFVEILTGK  328

Query  1084  QGEIRKVCTAVN  1119
             QGEIR+ C  VN
Sbjct  329   QGEIRRRCAFVN  340



>gb|ACI00835.1| class III peroxidase [Triticum aestivum]
Length=326

 Score =   348 bits (894),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 211/306 (69%), Gaps = 9/306 (3%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L   FY ++CP +E +V+    + +++APSLAGPLLRMHFHDCFVRGC+GSVLLDS  K 
Sbjct  24    LHEKFYSESCPSVEDVVRREMVRALSLAPSLAGPLLRMHFHDCFVRGCDGSVLLDSANKT  83

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EKDA PN +LRGF  +++VK AVE+ACP  VSCAD+LA++ARD     KGP+WEV  GR
Sbjct  84    AEKDAQPNQTLRGFGFVERVKAAVEKACPDTVSCADVLALIARDAVWLSKGPFWEVPLGR  143

Query  583   RDGRV--SNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             RDG V  SN T+A   L PP AN TVL Q F    L  KDLVVLS GHTIG SHC SF+D
Sbjct  144   RDGSVSISNETDA---LPPPTANFTVLTQLFAAVNLDAKDLVVLSAGHTIGTSHCFSFSD  200

Query  757   RLYNFTG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAK  927
             RLYNFTG     D DP+L+P Y  +LK KC   +    LVEMDPGS +TFDT YF L++K
Sbjct  201   RLYNFTGMENPSDIDPTLEPQYMMRLKSKCASLNDNTTLVEMDPGSFKTFDTDYFKLVSK  260

Query  928   RRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             RRGLF SD ALL D  T+AY+ + A       FF DF  SM+ MG    LTG QGEIRK 
Sbjct  261   RRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFAASMIKMGNANPLTGSQGEIRKK  320

Query  1105  CTAVNN  1122
             C+ VN+
Sbjct  321   CSVVNH  326



>ref|XP_002436934.1| hypothetical protein SORBIDRAFT_10g011530 [Sorghum bicolor]
 gb|EER88301.1| hypothetical protein SORBIDRAFT_10g011530 [Sorghum bicolor]
Length=331

 Score =   348 bits (894),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 211/302 (70%), Gaps = 4/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT-K  399
             L+VG+Y +TCP++E IV+    ++I  APSLAGPLLR+HFHDCFVRGC+ SVLL+S    
Sbjct  31    LQVGYYSKTCPNVEAIVRNETAKIIGAAPSLAGPLLRLHFHDCFVRGCDASVLLESNGGN  90

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             + EKDA PN SLRGF  +++VK  +E ACP  VSCAD+L ++ARD     +GP W V  G
Sbjct  91    KAEKDAKPNKSLRGFGSVERVKAKLEAACPNTVSCADVLTLMARDAVVLARGPSWPVALG  150

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS+ TEA  +L P F ++ +L + F   GL VKDL VLSGGHT+G +HC S+  R
Sbjct  151   RRDGRVSSATEAADHLPPAFGDVPLLTKIFAANGLDVKDLAVLSGGHTLGTAHCGSYAGR  210

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNF+    ADPSLD  YA +L+ +C        L EMDPGS +TFDTSY+  +AKRRGL
Sbjct  211   LYNFSSGYSADPSLDSEYAHRLRTRCKSADDKATLSEMDPGSYKTFDTSYYRQVAKRRGL  270

Query  940   FTSDAALLDDEETKAYLVQQALT--HGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             F SDAALL D  T+ Y VQ+  T      FFKDFGESM+ MG +GVLTG QGEIRK C  
Sbjct  271   FQSDAALLADATTREY-VQRIATGKFDDVFFKDFGESMIKMGNVGVLTGAQGEIRKKCYI  329

Query  1114  VN  1119
             VN
Sbjct  330   VN  331



>emb|CDY46844.1| BnaA10g03280D [Brassica napus]
Length=320

 Score =   348 bits (893),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 212/301 (70%), Gaps = 6/301 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK  399
             GL + +Y+  CP  E IV+ +  Q ++  PSLA  LLRMHFHDCFVRGC+GS+LL  P  
Sbjct  25    GLYLYYYKHRCPDAEAIVRRVTVQYVSHEPSLAAALLRMHFHDCFVRGCDGSILLKYPYN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             + E+ A PN S+RG++++D VK+A+E  CPGVVSCAD+L++VARD    + GP+W V  G
Sbjct  85    ETERYAAPNLSVRGYEVVDAVKSALERKCPGVVSCADVLSLVARDAVIVINGPWWPVPLG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR+S  +E   NL  P + I  LK+ FFDKGL+ +DLVVLSG HTIGISHCS     
Sbjct  145   RRDGRISRKSEV--NLPSPLSGIAALKKKFFDKGLNTRDLVVLSGAHTIGISHCSVIHQG  202

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDN-LVEMDPGSVRTFDTSYFTLIAKRRG  936
             +YNFTGK D+D S++P Y   LK +C   +P DN  + MDP SV+ FD+ YF ++A+R+G
Sbjct  203   IYNFTGKSDSDSSMNPRYVRALKRRC---NPADNRTIVMDPRSVKKFDSHYFNMVAQRKG  259

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SD  LLDD ETK+Y+  Q  T GS+F KDF  SMV +G + +LTG++GEIRK C  V
Sbjct  260   LFKSDRTLLDDPETKSYIYTQVATAGSSFNKDFAHSMVKLGFVEILTGNKGEIRKRCAFV  319

Query  1117  N  1119
             N
Sbjct  320   N  320



>ref|XP_004151878.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
 ref|XP_004158555.1| PREDICTED: peroxidase 39-like [Cucumis sativus]
Length=326

 Score =   348 bits (893),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 213/303 (70%), Gaps = 5/303 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK-  399
             L++GFY ++CPH E IV +   Q I  APSLA   +RMHFHDCFVRGC+ SVL++S +  
Sbjct  26    LKLGFYAKSCPHAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINSTSNN  85

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q E+D+ PN +LRGF  ID+VK+ +E+ CPGVVSCAD+L+++ARD   A  GPYWEV TG
Sbjct  86    QAERDSAPNQTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTIVATGGPYWEVPTG  145

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +S   EAL N+ PPF N++ L++ F ++GL +KDLV+LSG HTIGI+HC SF++R
Sbjct  146   RRDGVISRSREALNNIPPPFGNLSTLQRLFSNQGLDLKDLVLLSGAHTIGIAHCQSFSNR  205

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTG GD DPSLDP YA  LK         +N VEMDPGS  TFD SY++L+ KRRGL
Sbjct  206   LYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLLLKRRGL  265

Query  940   FTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             F SDAAL  D  T   +  Q L  G    FF +F  SM  MGRI V TG +GEIR+ C  
Sbjct  266   FESDAALTTDATTLGLV--QKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRRRCGV  323

Query  1114  VNN  1122
             VN+
Sbjct  324   VNS  326



>gb|KGN63270.1| hypothetical protein Csa_2G421020 [Cucumis sativus]
Length=328

 Score =   348 bits (893),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 213/303 (70%), Gaps = 5/303 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTK-  399
             L++GFY ++CPH E IV +   Q I  APSLA   +RMHFHDCFVRGC+ SVL++S +  
Sbjct  28    LKLGFYAKSCPHAEKIVLDFVHQHIHNAPSLAATFIRMHFHDCFVRGCDASVLINSTSNN  87

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q E+D+ PN +LRGF  ID+VK+ +E+ CPGVVSCAD+L+++ARD   A  GPYWEV TG
Sbjct  88    QAERDSAPNQTLRGFDFIDRVKSLLEDECPGVVSCADVLSLIARDTIVATGGPYWEVPTG  147

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +S   EAL N+ PPF N++ L++ F ++GL +KDLV+LSG HTIGI+HC SF++R
Sbjct  148   RRDGVISRSREALNNIPPPFGNLSTLQRLFSNQGLDLKDLVLLSGAHTIGIAHCQSFSNR  207

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNFTG GD DPSLDP YA  LK         +N VEMDPGS  TFD SY++L+ KRRGL
Sbjct  208   LYNFTGVGDQDPSLDPRYAANLKANKCRTPTANNKVEMDPGSRNTFDLSYYSLLLKRRGL  267

Query  940   FTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             F SDAAL  D  T   +  Q L  G    FF +F  SM  MGRI V TG +GEIR+ C  
Sbjct  268   FESDAALTTDATTLGLV--QKLVEGPIEEFFAEFAASMEKMGRIKVKTGTEGEIRRRCGV  325

Query  1114  VNN  1122
             VN+
Sbjct  326   VNS  328



>emb|CDY15538.1| BnaA08g28220D [Brassica napus]
Length=332

 Score =   348 bits (894),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 217/303 (72%), Gaps = 7/303 (2%)
 Frame = +1

Query  217   GGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT  396
             G L + +Y   CP +E IV  +  Q ++  P+LA  LLRMHFHDCFVRGC+GSVLL SP 
Sbjct  35    GDLDLDYYRFKCPQVESIVHRVTFQYVSRRPTLAAALLRMHFHDCFVRGCDGSVLLKSPN  94

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                E+DAPPN +L+GF+++D VK+ +E  CPGVVSCAD++A+VARD  A ++GP+W V  
Sbjct  95    NDAERDAPPNLTLKGFEVVDAVKSVLERKCPGVVSCADVIALVARDAVAVIRGPWWPVPL  154

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+S ++EA  NL  PFA+I  LK  F  KGL+ KDLVVLSG HTIG+S C   + 
Sbjct  155   GRRDGRISRLSEA--NLPSPFADIKTLKNNFRVKGLNSKDLVVLSGAHTIGVSSCGLISS  212

Query  757   RLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKR  930
             R++NFTGKGD DP+++P+Y   LK +C    PTD    V+MDPGS R FD+ YF ++A++
Sbjct  213   RIHNFTGKGDFDPAMNPSYVRTLKKRC---KPTDVRTPVDMDPGSARKFDSHYFDIVAQK  269

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             +GLF SD+ALL+D  TK Y+  Q  T G++F +DF ESMV +G I +LTG +GEIR+ C 
Sbjct  270   KGLFISDSALLNDFVTKRYIQTQVETRGASFDRDFSESMVKLGFIQILTGRKGEIRRRCA  329

Query  1111  AVN  1119
              VN
Sbjct  330   FVN  332



>ref|NP_563732.1| peroxidase 1 [Arabidopsis thaliana]
 ref|NP_563733.1| peroxidase 2 [Arabidopsis thaliana]
 sp|Q67Z07.1|PER2_ARATH RecName: Full=Peroxidase 2; AltName: Full=ATP12a; AltName: Full=Atperox 
P2; Flags: Precursor [Arabidopsis thaliana]
 sp|P0DI10.1|PER1_ARATH RecName: Full=Peroxidase 1; AltName: Full=ATP11a; AltName: Full=Atperox 
P1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67334.1| peroxidase [Arabidopsis thaliana]
 gb|AAB71453.1| Strong similarity to Arabidopsis peroxidase ATP11A (gb|X98802) 
[Arabidopsis thaliana]
 gb|AAB71454.1| Strong similarity to Arabidopsis peroxidase ATP11A (gb|X98802) 
[Arabidopsis thaliana]
 gb|AAM74501.1| At1g05250/YUP8H12_14 [Arabidopsis thaliana]
 gb|AAN18153.1| At1g05250/YUP8H12_14 [Arabidopsis thaliana]
 dbj|BAD43989.1| putative peroxidase ATP12a [Arabidopsis thaliana]
 dbj|BAD44074.1| putative peroxidase ATP12a [Arabidopsis thaliana]
 gb|AEE27813.1| peroxidase [Arabidopsis thaliana]
 gb|AEE27814.1| Peroxidase superfamily protein [Arabidopsis thaliana]
Length=325

 Score =   348 bits (893),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 166/303 (55%), Positives = 215/303 (71%), Gaps = 7/303 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L + +Y   CP  E IV+ +  Q ++   +LA  LLRMHFHDCFVRGC+GSVLL S    
Sbjct  26    LDLDYYRSKCPKAEEIVRGVTVQYVSRQKTLAAKLLRMHFHDCFVRGCDGSVLLKSAKND  85

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              E+DA PN +L+G++++D  KTA+E  CP ++SCAD+LA+VARD  A + GP+W V  GR
Sbjct  86    AERDAVPNLTLKGYEVVDAAKTALERKCPNLISCADVLALVARDAVAVIGGPWWPVPLGR  145

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDGR+S + +AL NL  PFA+I  LK+ F +KGL+ KDLVVLSGGHTIGIS C+    RL
Sbjct  146   RDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGHTIGISSCALVNSRL  205

Query  763   YNFTGKGDADPSLDPNYAEKLKMKCPEESPTD--NLVEMDPGSVRTFDTSYFTLIAKRRG  936
             YNFTGKGD+DPS++P+Y  +LK KCP   PTD    + MDPGS  TFDT YF ++A+++G
Sbjct  206   YNFTGKGDSDPSMNPSYVRELKRKCP---PTDFRTSLNMDPGSALTFDTHYFKVVAQKKG  262

Query  937   LFTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             LFTSD+ LLDD ETK Y+  QA+     S+F KDF +SMV +G + +LTG  GEIRK C 
Sbjct  263   LFTSDSTLLDDIETKNYVQTQAILPPVFSSFNKDFSDSMVKLGFVQILTGKNGEIRKRCA  322

Query  1111  AVN  1119
               N
Sbjct  323   FPN  325



>ref|XP_008784560.1| PREDICTED: peroxidase 3-like [Phoenix dactylifera]
Length=324

 Score =   348 bits (893),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 216/319 (68%), Gaps = 6/319 (2%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             + + L   CC         L++GFY+++CP  E I+ +   + I  AP+LA PLLRMHFH
Sbjct  10    VWLLLGLLCCVR-----ADLQLGFYDKSCPKAEKIISDFVKEHIPNAPTLASPLLRMHFH  64

Query  346   DCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAI  522
             DCFVRGC+GSVL++S  + Q EK A PN +LRGF  ID+VK+ VE+ CPGVVSCADI+A+
Sbjct  65    DCFVRGCDGSVLINSTSSNQAEKAATPNQTLRGFSFIDRVKSLVEKECPGVVSCADIVAL  124

Query  523   VARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLV  702
             VARD    + GP+W V TGRRDG +SN TEAL ++  P  N + L+  F +KGL++ DLV
Sbjct  125   VARDAVGVIGGPFWRVPTGRRDGLISNSTEALNDIPAPTFNFSALQTSFANKGLNLTDLV  184

Query  703   VLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPG  882
             +LSG HTIGISHC SF  RLYNFTGKGD DPSLD  YAE LK KC   +     VEMDPG
Sbjct  185   LLSGAHTIGISHCLSFDTRLYNFTGKGDQDPSLDKFYAENLKKKCKSLNDNVTFVEMDPG  244

Query  883   SVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGR  1062
             S RTFD  Y+  + KRRGLF SDAAL+ +  TK+ ++    +    FF++F  SM  MGR
Sbjct  245   SFRTFDLGYYKNVLKRRGLFQSDAALITNAGTKSSIMNLVDSPPEVFFQEFALSMEKMGR  304

Query  1063  IGVLTGDQGEIRKVCTAVN  1119
             + V TG  GEIRK C  VN
Sbjct  305   VEVKTGSTGEIRKNCAVVN  323



>ref|XP_009342252.1| PREDICTED: peroxidase 3 [Pyrus x bretschneideri]
Length=326

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 217/304 (71%), Gaps = 6/304 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L++GFY + CP  E IVK+  ++ I  APSLA  L+R+HFHDCFVRGC+ SVLL+S  + 
Sbjct  25    LQLGFYAKNCPKAEKIVKDYVEEHIHNAPSLAAALIRLHFHDCFVRGCDASVLLNSTSSN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAPPN +LRGF  ID++K+ +E  CPG+VSCAD++A+ ARD   A  GP W+V TG
Sbjct  85    QAEKDAPPNLTLRGFDFIDRIKSRLEAQCPGIVSCADVIALAARDSIVATGGPTWKVPTG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG ++   EAL N+ PP +N + L++ F + GL +KDLV+LSG HTIG+SHCSSF++R
Sbjct  145   RRDGVIARRAEALANIPPPTSNFSNLQRIFANVGLDLKDLVLLSGAHTIGVSHCSSFSNR  204

Query  760   LYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKR  930
             LYNFTG GD DP+L+  YA  LK  KC  ++PTDN  +VEMDPGSVRTFD SY+TL+ KR
Sbjct  205   LYNFTGVGDQDPALNTQYAANLKANKC--KTPTDNTTIVEMDPGSVRTFDLSYYTLLLKR  262

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             RGLF SDAAL     T  ++ Q        F+  FG+SM  MGR  V TG  GEIRK C+
Sbjct  263   RGLFQSDAALTTSSTTYNHINQLLKGSLQNFYDKFGKSMEKMGRANVKTGSAGEIRKQCS  322

Query  1111  AVNN  1122
              VN+
Sbjct  323   VVNS  326



>emb|CDY10037.1| BnaC08g44140D [Brassica napus]
Length=326

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/301 (54%), Positives = 211/301 (70%), Gaps = 1/301 (0%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L++ FY  TCP+ E IV++     I+ APSLA  LLRMHFHDCFVRGC+GSVL++S +  
Sbjct  26    LQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTSGN  85

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EKDA PN ++RGF  I+ +KT +E  CPG+VSCADI+A+ +RD      GP W V TGR
Sbjct  86    AEKDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAVVFTGGPSWSVPTGR  145

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDGR+SN +EAL N+ PP +N T L+  F ++GL +KDLV+LSG HTIG+SHCSSFT+RL
Sbjct  146   RDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRL  205

Query  763   YNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             YNFTG+GD DP+LD  YA  LK  KCP  +    +VEMDPGS +TFD SY+ L+ KRRGL
Sbjct  206   YNFTGRGDQDPALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F SD+AL  +  T + + Q       +FF +F +SM  MGRI V TG  G +R+ C+  N
Sbjct  266   FQSDSALTTNPTTLSNINQLLKGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQCSVAN  325

Query  1120  N  1122
             +
Sbjct  326   S  326



>gb|EMT00309.1| Peroxidase 1 [Aegilops tauschii]
Length=326

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 211/304 (69%), Gaps = 5/304 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L   FY +TCP +E +V++   + +++APSLAGPLLRMHFHDCFVRGC+GSVLLDS  K 
Sbjct  24    LHEKFYGETCPSVEDVVRKEMVRALSLAPSLAGPLLRMHFHDCFVRGCDGSVLLDSANKT  83

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EKDA PN +LRGF  ++KVK AVE+ACP  VSCADILA++ARD     KGP+WEV  GR
Sbjct  84    AEKDAKPNQTLRGFDFVEKVKAAVEKACPDTVSCADILALMARDAVWLSKGPFWEVPLGR  143

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDG VS ++     L PP AN TVL Q F  K L  KDLVVLS GHTIG SHC SF+DRL
Sbjct  144   RDGSVS-ISNETNQLPPPTANFTVLTQLFAAKNLDSKDLVVLSAGHTIGTSHCFSFSDRL  202

Query  763   YNFTGK---GDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             YNFTG+    D DP+L+P Y  KL+ KC   +    LVEMDPGS RTFD +YF  + KRR
Sbjct  203   YNFTGRVNPTDIDPTLEPQYMAKLRNKCTSLNDNTTLVEMDPGSFRTFDLAYFKNVVKRR  262

Query  934   GLFTSDAALLDDEETKAYLVQQA-LTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             GLF SD ALL +  T+AY+ + A  ++   FF DF  SM+ MG   VLTG QGEIRK C 
Sbjct  263   GLFHSDGALLTNAFTRAYVERHAGGSYKEEFFADFAASMIKMGNADVLTGSQGEIRKKCN  322

Query  1111  AVNN  1122
               N+
Sbjct  323   VPNH  326



>ref|XP_006657390.1| PREDICTED: peroxidase 1-like [Oryza brachyantha]
Length=340

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 216/325 (66%), Gaps = 6/325 (2%)
 Frame = +1

Query  166   ILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFH  345
             I+     A C+  A     L + FY +TCP +E IV+   ++++ V P+LAGPLLR+HFH
Sbjct  17    IMAAAVLALCSCAAVTTAQLEMDFYSKTCPKVEEIVRREMEEILTVTPTLAGPLLRLHFH  76

Query  346   DCFVRGCEGSVLLDSPTKQ-GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAI  522
             DCFVRGC+ SVL+DS      EKDA PN +LRGF  + +VK  ++ ACP  VSCAD+LA+
Sbjct  77    DCFVRGCDASVLIDSTAGNVAEKDAKPNLTLRGFGTVQRVKDKLDAACPATVSCADVLAL  136

Query  523   VARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLV  702
             +ARD     KGP W V  GRRDGR+S +      L PP AN T L Q F  KGL VKDLV
Sbjct  137   MARDAVVLSKGPSWPVSLGRRDGRLS-IANDTNQLPPPTANFTQLAQMFAAKGLDVKDLV  195

Query  703   VLSGGHTIGISHCSSFTDRLYNFTG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEM  873
             VLSGGHT+G +HC+ F+DRLYNFTG    GD DP+LD  Y  KLK +C   S    L EM
Sbjct  196   VLSGGHTLGTAHCALFSDRLYNFTGLENDGDVDPALDSAYMAKLKARCRSLSDNTTLGEM  255

Query  874   DPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTH-GSTFFKDFGESMV  1050
             DPGS  TFD SY+ L+AKRRG+F SD++LL D  T+AY+ +QA  H    FF+DF +SMV
Sbjct  256   DPGSFLTFDASYYRLVAKRRGIFHSDSSLLTDPVTRAYVERQASGHFADEFFRDFADSMV  315

Query  1051  NMGRIGVLTGDQGEIRKVCTAVNNY  1125
              M  I VLTG QGEIR  C A+NN+
Sbjct  316   KMSTIDVLTGSQGEIRTKCYAINNH  340



>ref|XP_010931166.1| PREDICTED: peroxidase 56-like [Elaeis guineensis]
Length=336

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/313 (57%), Positives = 217/313 (69%), Gaps = 13/313 (4%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
              L+VGFY+ +CP+ E IV++      +  P+++GPLLR+HFHDCFVRGC+GSVLL+S  T
Sbjct  25    ALKVGFYKNSCPYAEAIVRKAVAGYFSQDPTVSGPLLRLHFHDCFVRGCDGSVLLNSTKT  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAM-----KGPY  561
                EKDA PN SL GF +ID  K A+E+ACPG+VSCADI+A+ ARD  +       KG +
Sbjct  85    NLAEKDAMPNQSLDGFYVIDAAKEALEKACPGIVSCADIVALAARDAVSLATRSVGKGSW  144

Query  562   ------WEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHT  723
                   WEV TGRRDG VS  +EAL NL  P+A IT LK  F  KGLS KDL +LSG HT
Sbjct  145   MASNNLWEVPTGRRDGLVSVASEALANLPSPYAEITQLKASFAAKGLSAKDLAILSGAHT  204

Query  724   IGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDT  903
             IG SHC SF  RLYNFTGKGD DP+LDP YA KL+ +C     T   VEM PGS  TFDT
Sbjct  205   IGNSHCYSFERRLYNFTGKGDTDPTLDPKYAIKLRSQCKPGDETTT-VEMVPGSSTTFDT  263

Query  904   SYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGD  1083
             +Y+ L+ +RRGLF SD ALL D+ET+ Y+  +  +  S+FF DFG SMV MG+IGVLTG 
Sbjct  264   TYYKLVVRRRGLFHSDEALLQDKETRDYVYSRLDSPKSSFFFDFGVSMVKMGQIGVLTGK  323

Query  1084  QGEIRKVCTAVNN  1122
              GEIRK C  VN+
Sbjct  324   AGEIRKQCALVNS  336



>ref|XP_010422076.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 212/302 (70%), Gaps = 3/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPT  396
             L++GFY++TCP+ E IV+++ +Q I  APSLA  L+RMHFHDCFVRGC+GS+L++  S  
Sbjct  25    LKMGFYDKTCPNAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSN  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             +Q EK APPN ++RGF  IDKVK+A+E  CPG+VSCADI+ +  RD   A+ GP W V T
Sbjct  85    QQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPT  144

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+SN  EA  N+ PPF N T L   F ++GL VKDLV+LSG HTIG+SHCSSF++
Sbjct  145   GRRDGRISNFAEARDNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHCSSFSN  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             RL+NFTG GD DPSLD  YA  LK  +C   +     VEMDPGS  TFD SYF L+ KRR
Sbjct  205   RLFNFTGVGDEDPSLDSEYAANLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVLKRR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAAL  +    A + + A      FF +F ++M  MGRIGV TG  GEIR+ C  
Sbjct  265   GLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKAMEKMGRIGVKTGSAGEIRRTCAF  324

Query  1114  VN  1119
             VN
Sbjct  325   VN  326



>ref|XP_009118603.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Brassica rapa]
 emb|CDY59800.1| BnaAnng16310D [Brassica napus]
Length=326

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 211/301 (70%), Gaps = 1/301 (0%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L++ FY  TCP+ E IV++     I+ APSLA  LLRMHFHDCFVRGC+GSVL++S +  
Sbjct  26    LQMNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTSGN  85

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              E+DA PN ++RGF  I+ +KT +E  CPG+VSCADI+A+ +RD      GP W V TGR
Sbjct  86    AERDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAVVFTGGPSWSVPTGR  145

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDGR+SN +EAL N+ PP +N T L+  F ++GL +KDLV+LSG HTIG+SHCSSFT+RL
Sbjct  146   RDGRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRL  205

Query  763   YNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             YNFTG+GD DP+LD  YA  LK  KCP  +    +VEMDPGS +TFD SY+ L+ KRRGL
Sbjct  206   YNFTGRGDQDPALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  940   FTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
             F SD+AL  +  T + + Q       +FF +F +SM  MGRI V TG  G +R+ C+  N
Sbjct  266   FQSDSALTTNPTTLSNINQLLKGSVESFFSEFAKSMEKMGRINVKTGSAGVVRRQCSVAN  325

Query  1120  N  1122
             +
Sbjct  326   S  326



>gb|AHL39150.1| class III peroxidase [Populus trichocarpa]
Length=327

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/328 (53%), Positives = 219/328 (67%), Gaps = 8/328 (2%)
 Frame = +1

Query  148   RYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPL  327
             RY  +     L F       +    L++GFY  +CP+ E IV++  ++ I  APSLA  +
Sbjct  5     RYFGMMFFCLLVFM-----GSTEAQLQMGFYSSSCPNAERIVQDYVNRHIHNAPSLAAAI  59

Query  328   LRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVS  501
             +RMHFHDCFVRGC+ SVLL+  S   Q EK A PN +LRGF  IDKVK+ +E ACP VVS
Sbjct  60    IRMHFHDCFVRGCDASVLLNTTSSNNQTEKVATPNLTLRGFDFIDKVKSLLEAACPAVVS  119

Query  502   CADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKG  681
             CADI+A+VARD   A  GP+W V TGRRDG +S  +EAL N+ PP +N T L++ F ++G
Sbjct  120   CADIVALVARDAVVATGGPFWRVPTGRRDGTISRSSEALNNIPPPTSNFTNLQRLFANQG  179

Query  682   LSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTD  858
             L +KDLV+LSG HTIGISHCSSF++RLYNFTG GD DP+LD  YA  LK  KC   +   
Sbjct  180   LDLKDLVLLSGAHTIGISHCSSFSNRLYNFTGVGDQDPALDSEYAANLKARKCRSLNDNT  239

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
              +VEMDPGS RTFD SY++L+ KRRGLF SD+AL  +  T +++ Q        FF +F 
Sbjct  240   TIVEMDPGSFRTFDLSYYSLLLKRRGLFQSDSALTTNSATLSFVNQLLQGPLQNFFAEFA  299

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
              SM  MGRI V TG  GEIRK C  VN+
Sbjct  300   NSMEKMGRINVKTGTTGEIRKHCAVVNS  327



>ref|XP_006396925.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
 gb|ESQ38378.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
Length=326

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 211/302 (70%), Gaps = 3/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPT  396
             L++GFY++TCP+ E IV+ + +Q I   PSLA  L+RMHFHDCFVRGC+GS+L++  S  
Sbjct  25    LKIGFYDKTCPNAEKIVQNLVNQHIGNVPSLAAGLIRMHFHDCFVRGCDGSILINATSRN  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             +Q EK +PPN ++RGF  ID VK  +E  CPG+VSCADI+ +  RD  AA+ GP W V T
Sbjct  85    QQVEKVSPPNLTVRGFDFIDLVKKVLESKCPGIVSCADIITLATRDSVAAIGGPTWSVPT  144

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+SN  E+L N+ PPF N T L   F ++GL VKDLV+LSG HTIG+SHCSSF++
Sbjct  145   GRRDGRISNANESLNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSN  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             RL+NFTG GD DPSLD  YA+ LK  +C   +     VEMDPGS  TFD SYF L+ KRR
Sbjct  205   RLFNFTGVGDQDPSLDSEYADNLKARRCLSLADNTTKVEMDPGSRNTFDLSYFRLVLKRR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAAL  +    A + + A      FF +FG+SM  MGRIGV TG  GEIR+ C  
Sbjct  265   GLFESDAALTMNSAALALVRRFAGGSEQDFFVEFGKSMEKMGRIGVKTGSDGEIRRTCAV  324

Query  1114  VN  1119
             VN
Sbjct  325   VN  326



>ref|XP_008341978.1| PREDICTED: peroxidase 3-like [Malus domestica]
 ref|XP_008362256.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Malus domestica]
Length=326

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/304 (55%), Positives = 217/304 (71%), Gaps = 6/304 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L++GFY + CP+ E IVK+  ++ I  +PSLA  L+R+HFHDCFVRGC+ S+LL+S  + 
Sbjct  25    LQLGFYAKNCPNAEKIVKDYVEEHIHNSPSLAAALIRLHFHDCFVRGCDASILLNSTSSN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKDAPPN +LRGF  ID++K+ +E  CPG+VSCAD +A+ ARD   A  GP W+V TG
Sbjct  85    QAEKDAPPNLTLRGFDFIDRIKSRLEAQCPGIVSCADTIALAARDSIVATGGPTWKVPTG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG ++   +AL N+ PP +N + L++ F + GL +KDLV+LSG HTIG+SHCSSF++R
Sbjct  145   RRDGVIARRADALANIPPPTSNFSNLQRTFANTGLDLKDLVLLSGAHTIGVSHCSSFSNR  204

Query  760   LYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDN--LVEMDPGSVRTFDTSYFTLIAKR  930
             LYNFTG GD DP+L+  YA  LK  KC  ++PTDN  +VEMDPGSVRTFD SY+TL+ KR
Sbjct  205   LYNFTGVGDQDPALNTQYAANLKANKC--KTPTDNTTIVEMDPGSVRTFDLSYYTLLLKR  262

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             RGLF SDAAL     T  Y+ Q        F+ +FG+SM  MGR    TG  GEIRK C+
Sbjct  263   RGLFQSDAALTTSSTTYNYIHQLLKGSLQNFYDEFGKSMEKMGRANXKTGSAGEIRKQCS  322

Query  1111  AVNN  1122
              VN+
Sbjct  323   VVNS  326



>ref|XP_006288205.1| hypothetical protein CARUB_v10001445mg [Capsella rubella]
 gb|EOA21103.1| hypothetical protein CARUB_v10001445mg [Capsella rubella]
Length=326

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 211/302 (70%), Gaps = 3/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPT  396
             L++GFY++TCP+ E IV+++ +Q I  APSLA  L+RMHFHDCFVRGC+GS+L++  S  
Sbjct  25    LKMGFYDKTCPYAEKIVQDVVNQHIHNAPSLAAGLIRMHFHDCFVRGCDGSILINATSRN  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             +Q EK APPN ++RGF  IDKVK+A+E  CPG+VSCADI+ +  RD   A+ GP W V T
Sbjct  85    QQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPT  144

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+SN  EA  N+ PPF N T L   F ++GL VKDLV+LSG HTIG+SHCSSF+ 
Sbjct  145   GRRDGRISNFIEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSK  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             RL+NFTG GD DPSLD  YA  LK  +C   +     VEMDPGS  TFD SYF L+ KRR
Sbjct  205   RLFNFTGVGDQDPSLDSEYAANLKSRRCLSIADNTTKVEMDPGSRNTFDLSYFRLVLKRR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAAL  D    A + + A      FF +F ++M  MGRIGV TG  GEIR+ C  
Sbjct  265   GLFESDAALTMDPAALAQVRRFAGGSEQEFFAEFAKAMEKMGRIGVKTGSDGEIRRTCAF  324

Query  1114  VN  1119
             VN
Sbjct  325   VN  326



>ref|XP_008663625.1| PREDICTED: peroxidase 1-like [Zea mays]
 gb|AFW59540.1| hypothetical protein ZEAMMB73_992495 [Zea mays]
Length=352

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 214/307 (70%), Gaps = 7/307 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS--P  393
             GLRVGFY+ TCP+ E IV++   ++I+  PSLAGPLLRMHFHDCFV GC+GSVLL+S  P
Sbjct  46    GLRVGFYQYTCPNAEAIVRDEMAKIISRVPSLAGPLLRMHFHDCFVNGCDGSVLLNSTVP  105

Query  394   TKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVE  573
                 EK+A PN +LRGF  +D+VK  +E+ACPGVVSCADILA+VARDV    KGP+W+V 
Sbjct  106   GLPSEKEAIPNLTLRGFGTVDRVKAKLEQACPGVVSCADILALVARDVVVLTKGPHWDVP  165

Query  574   TGRRDGRVSNMTEALFNLLPPFANI-TVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSF  750
             TGRRDGR S   +AL NL  PF +    L Q F  KGL  KD VVL G HT+G SHCSSF
Sbjct  166   TGRRDGRRSVKQDALDNLPAPFFDAGRNLYQFFIPKGLDAKDQVVLLGAHTLGTSHCSSF  225

Query  751   TDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKR  930
              DRLYNF+G   ADPSLD  Y  +LK KC     T  LVEMDPGS RTFD SY+  +A+ 
Sbjct  226   ADRLYNFSGTTAADPSLDRRYLPRLKSKCGSPGDTTTLVEMDPGSFRTFDASYYRRVARG  285

Query  931   RGLFTSDAALLDDEETKAYLVQQ----ALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIR  1098
             R LF SD  L++D   +AY+ +Q    A  + + FF DF +SMV MG + VLTG QGE+R
Sbjct  286   RSLFASDQTLMNDPAARAYVQRQAGAGAGAYPAEFFADFAKSMVKMGAVQVLTGAQGEVR  345

Query  1099  KVCTAVN  1119
             + C AVN
Sbjct  346   RHCAAVN  352



>ref|XP_010522326.1| PREDICTED: peroxidase 3 [Tarenaya hassleriana]
Length=330

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 221/332 (67%), Gaps = 7/332 (2%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             K + Y ++ ++I  +     H       L++ FY  +CP+ E IV+    Q I  APSLA
Sbjct  2     KGANYSAIVVVIAASLVILGHVGKVQAQLQMNFYADSCPNAEEIVQGFVKQHIPNAPSLA  61

Query  319   GPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVV  498
               LLRMHFHDCFVRGC+GSVL++S     E+D+ PN +LRGF  ID +K  +E  CPG+V
Sbjct  62    AALLRMHFHDCFVRGCDGSVLINSTRGNAERDSAPNLTLRGFSFIDGIKAVLEAQCPGIV  121

Query  499   SCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDK  678
             SCAD++A+ ARD      GPYW V TGRRDGR+SN +EAL N+ PP +N T L++ F ++
Sbjct  122   SCADVIALSARDSVVLTGGPYWRVPTGRRDGRISNASEALANIPPPTSNFTTLQRLFGNQ  181

Query  679   GLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPT  855
             GL +KDLV+LSG HTIG+SHCSSF++RLYNFTG+GD DP+LD  YA  LK  KCP  +  
Sbjct  182   GLDLKDLVLLSGAHTIGVSHCSSFSNRLYNFTGRGDQDPALDSEYAANLKSRKCPTLNDN  241

Query  856   DNLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAY---LVQQALTHGSTFF  1026
               +VEMDPGS +TFD SY+TL+ KRRGLF SD+AL  +  T +    LVQ  L +   F+
Sbjct  242   VTIVEMDPGSRKTFDLSYYTLVLKRRGLFQSDSALTTNPTTLSAINGLVQGTLQN---FY  298

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
              +F  SM  MGRI V TG  G +R+ C   N+
Sbjct  299   TEFANSMEKMGRINVKTGSAGVVRRQCGVANS  330



>ref|XP_004961613.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=326

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 176/300 (59%), Positives = 207/300 (69%), Gaps = 6/300 (2%)
 Frame = +1

Query  235   FYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ-GEK  411
             FY Q+CP +E +V++   + ++ APSLAGPLLRMHFHDCFVRGC+GSVLLDS      EK
Sbjct  28    FYSQSCPSVEDVVRKEMVRALSAAPSLAGPLLRMHFHDCFVRGCDGSVLLDSTANTTAEK  87

Query  412   DAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDG  591
             DA PN +LRGF  I++VK AVE+ACP  VSCAD+LA++ARD     KGP+W V  GRRDG
Sbjct  88    DAKPNLTLRGFGFIERVKAAVEKACPDTVSCADVLALMARDAVWLSKGPFWAVPLGRRDG  147

Query  592   RVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNF  771
             RVS   E    L PP  N T L Q F  K L  KDLVVLS GHT+G SHC SF+DRLYNF
Sbjct  148   RVSISNETD-QLPPPTGNFTELTQIFATKNLDAKDLVVLSAGHTLGTSHCFSFSDRLYNF  206

Query  772   TG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLF  942
             TG     D DP+LDP Y  +L+ KCP       LVEMDPGS +TFD SYF  +AKRRGLF
Sbjct  207   TGMDNAHDTDPTLDPMYMARLRGKCPSLDDNTTLVEMDPGSFKTFDLSYFGHVAKRRGLF  266

Query  943   TSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SD ALL D  T+AY+++ A   +   FF DF  SMV MG + VLTG QGEIRK C+ VN
Sbjct  267   HSDGALLTDPFTRAYVLRHATGAYREEFFADFAASMVKMGSVEVLTGSQGEIRKKCSVVN  326



>ref|XP_008230094.1| PREDICTED: peroxidase 3 [Prunus mume]
Length=327

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 208/302 (69%), Gaps = 2/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L++GFY + CP  E IVK+  D+ I  APS+A  L+RMHFHDCFVRGC+ SVLL+S  + 
Sbjct  26    LQLGFYAKNCPKAEKIVKDFVDEHIHNAPSVAAALIRMHFHDCFVRGCDASVLLNSTSSN  85

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK +PPN +LRGF  ID++KT +E  CPGVVSCAD +A+ ARD   A  GP+W+V TG
Sbjct  86    QAEKVSPPNLTLRGFNFIDRIKTLLEAECPGVVSCADTIALAARDSIVATGGPFWKVPTG  145

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +S   EAL N+  P +N T L+  F + GL +KDLV+LSG HTIGISHCSSF++R
Sbjct  146   RRDGVISRRAEALANIPAPTSNFTTLQTRFGNLGLDLKDLVLLSGAHTIGISHCSSFSNR  205

Query  760   LYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             LYNFTG GD DP+LD  YA  LK  KC   +    +VEMDPGS RTFD SY+TL+ KRRG
Sbjct  206   LYNFTGVGDQDPALDKQYAANLKANKCKSSTDNTTIVEMDPGSHRTFDLSYYTLLLKRRG  265

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAAL     T  Y+ Q        F+ +F +SM  MGR+ V TG  GEIRK C  V
Sbjct  266   LFQSDAALTTSSTTLNYINQLLKGPLQNFYDEFAKSMEKMGRVNVKTGSAGEIRKQCAVV  325

Query  1117  NN  1122
             N+
Sbjct  326   NS  327



>gb|EMS60389.1| Peroxidase 1 [Triticum urartu]
Length=327

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 210/302 (70%), Gaps = 9/302 (3%)
 Frame = +1

Query  235   FYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQGEKD  414
             FY ++CP +E +V++   + +++APSLAGPLLRMHFHDCFVRGC+GSVLLDS  K  EKD
Sbjct  29    FYSESCPSVEDVVRKEMVRALSLAPSLAGPLLRMHFHDCFVRGCDGSVLLDSANKTAEKD  88

Query  415   APPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDGR  594
             A PN +LRGF  +++VK AVE+ACP  VSCADILA++ARD     KGP+W V  GRRDG 
Sbjct  89    AQPNQTLRGFGFVERVKAAVEKACPDTVSCADILALIARDAVWLSKGPFWTVPLGRRDGS  148

Query  595   V--SNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYN  768
             V  SN T+A   L PP +N TVL Q F    L  KDLVVLS GHTIG SHC SF+DRLYN
Sbjct  149   VSISNETDA---LPPPTSNFTVLTQLFAAVNLDAKDLVVLSAGHTIGTSHCFSFSDRLYN  205

Query  769   FTG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             FTG     D DPSL+P Y  +LK KC   +    LVEMDPGS +TFDT YF L++KRRGL
Sbjct  206   FTGMENPSDIDPSLEPQYMMRLKSKCASLNDNTTLVEMDPGSFKTFDTDYFKLVSKRRGL  265

Query  940   FTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             F SD ALL D  T+AY+ + A       FF DF  SM+ MG    LTG QGEIRK C+ V
Sbjct  266   FHSDGALLTDPFTRAYVQRHATGAFKDEFFADFAASMIKMGNANPLTGSQGEIRKKCSVV  325

Query  1117  NN  1122
             N+
Sbjct  326   NH  327



>ref|XP_010455535.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 211/302 (70%), Gaps = 3/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLD--SPT  396
             L++GFY +TCP+ E IV+++ +Q I  APSLA  L+RMHFHDCFVRGC+GS+L++  S  
Sbjct  25    LKMGFYGKTCPNAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSN  84

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
             +Q EK APPN ++RGF  IDKVK+A+E  CPG+VSCADI+ +  RD   A+ GP W V T
Sbjct  85    QQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPT  144

Query  577   GRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             GRRDGR+SN  EA  N+ PPF N T L   F ++GL VKDLV+LSG HTIG+SHCSSF++
Sbjct  145   GRRDGRISNFAEARNNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHCSSFSN  204

Query  757   RLYNFTGKGDADPSLDPNYAEKLK-MKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             RL+NFTG GD DPSLD  YA  LK  +C   +     VEMDPGS  TFD SYF L+ KRR
Sbjct  205   RLFNFTGVGDEDPSLDSEYAANLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVLKRR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             GLF SDAAL  +    A + + A      FF +F ++M  MGRIGV TG  GEIR+ C  
Sbjct  265   GLFESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKAMEKMGRIGVKTGSAGEIRRTCAF  324

Query  1114  VN  1119
             VN
Sbjct  325   VN  326



>ref|XP_010931832.1| PREDICTED: peroxidase 3-like [Elaeis guineensis]
Length=324

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 214/325 (66%), Gaps = 6/325 (2%)
 Frame = +1

Query  151   YLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLL  330
             ++   + + L   CC         L++GFY+++CP  E I+ +   + I  AP+LA PLL
Sbjct  5     FMGFIVWLLLGLFCCVK-----ADLQLGFYDKSCPKAEKIISDFVKKHIPNAPTLASPLL  59

Query  331   RMHFHDCFVRGCEGSVLLDSPTK-QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCA  507
             RMHFHDCFVRGC+GSVL++S +  Q EK A PN +LRGF  ID VK+ VE+ CPGVVSCA
Sbjct  60    RMHFHDCFVRGCDGSVLINSTSNNQAEKAATPNLTLRGFGFIDSVKSLVEKECPGVVSCA  119

Query  508   DILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLS  687
             DI+A+VARD    + GPYW V TGRRDG +SN TEAL N+  P  N + L+  F +KGL+
Sbjct  120   DIVALVARDAVGVIGGPYWRVPTGRRDGLISNSTEALNNIPAPTFNFSALQTSFANKGLN  179

Query  688   VKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLV  867
             V DL+ LSG HTIGI HCSSF+ RLYNFTGKG  DPSLD  YA  LK  C   +     V
Sbjct  180   VTDLIWLSGAHTIGIGHCSSFSSRLYNFTGKGGQDPSLDRFYAANLKKACKSLNDNVTFV  239

Query  868   EMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESM  1047
             EMDPGS RTFD  Y+  + KRRGLF SDAAL+ +  TK+ ++    +    FF++F  SM
Sbjct  240   EMDPGSFRTFDLGYYKNVLKRRGLFQSDAALITNAPTKSSIMNLVNSPPEVFFQEFALSM  299

Query  1048  VNMGRIGVLTGDQGEIRKVCTAVNN  1122
               MGRI V  G  GEIRK C  VN+
Sbjct  300   EKMGRIEVKAGTTGEIRKNCAVVNS  324



>ref|XP_007215666.1| hypothetical protein PRUPE_ppa008540mg [Prunus persica]
 gb|EMJ16865.1| hypothetical protein PRUPE_ppa008540mg [Prunus persica]
Length=327

 Score =   346 bits (888),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 207/302 (69%), Gaps = 2/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L++GFY + CP  E IVK+  D+ I  APS+A  L+RMHFHDCFVRGC+ SVLL+S  + 
Sbjct  26    LQLGFYAKNCPKAEKIVKDFVDEHIHNAPSVAAALIRMHFHDCFVRGCDASVLLNSTSSN  85

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EK APPN +LRGF  ID++KT +E  CPGVVSCAD +A+ ARD   A  GP+W+V TG
Sbjct  86    QAEKVAPPNLTLRGFNFIDRIKTLLEAECPGVVSCADAIALAARDSIVATGGPFWKVPTG  145

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +S   EAL N+  P +N T L+  F + GL + DLV+LSG HTIGISHCSSF++R
Sbjct  146   RRDGVISRRAEALANIPAPTSNFTTLQTSFGNLGLDLMDLVLLSGAHTIGISHCSSFSNR  205

Query  760   LYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             LYNFTG GD DP+LD  YA  LK  KC   +    +VEMDPGS RTFD SY+TL+ KRRG
Sbjct  206   LYNFTGVGDQDPALDKQYAANLKANKCKSSTDNTTIVEMDPGSHRTFDLSYYTLLLKRRG  265

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAAL     T  Y+ Q        F+ +F +SM  MGR+ V TG  GEIRK C  V
Sbjct  266   LFQSDAALTTSSTTLNYINQLLKGPLQNFYDEFAKSMEKMGRVNVKTGSAGEIRKQCAVV  325

Query  1117  NN  1122
             N+
Sbjct  326   NS  327



>ref|XP_009353255.1| PREDICTED: peroxidase 3 [Pyrus x bretschneideri]
Length=326

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 226/332 (68%), Gaps = 14/332 (4%)
 Frame = +1

Query  139   KFSRYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLA  318
             +FS  L   +L+ + F+           L++GFY + CP  E IVK+  ++ I  APSLA
Sbjct  5     RFSGILVSCLLVIIGFS--------EAKLQLGFYSKNCPKAEKIVKDYVEEHIHNAPSLA  56

Query  319   GPLLRMHFHDCFVRGCEGSVLLDS-PTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGV  495
               L+R+HFHDCFVRGC+ SVLL+S  + Q EKDAPPN +LRGF  ID++K+ +E  C  V
Sbjct  57    AALIRLHFHDCFVRGCDASVLLNSTSSNQAEKDAPPNLTLRGFDFIDRIKSRLEAQCTSV  116

Query  496   VSCADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFD  675
             VSCAD++A+ ARD   A  GP W+V TGRRDG ++   EAL N+  PF+N++ L++ F +
Sbjct  117   VSCADVIALAARDSIVATGGPTWKVPTGRRDGVIARRAEALANIPIPFSNLSTLQRTFAN  176

Query  676   KGLSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KCPEESP  852
              GL +KDLV+LSG HTIG+SHC SF++RLYNFTG GD DP+L P YA  LK  KC  ++P
Sbjct  177   VGLDLKDLVLLSGAHTIGVSHCPSFSNRLYNFTGVGDQDPALTPQYAANLKANKC--KTP  234

Query  853   TDN--LVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFF  1026
             TDN  +VEMDPGS RTFD SY+TL+ KRRGLF SDAAL     T  Y+ +        F+
Sbjct  235   TDNTTIVEMDPGSFRTFDRSYYTLLLKRRGLFESDAALTTSSTTLNYINRLLKGSLQNFY  294

Query  1027  KDFGESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
              +FG+SM  MGRI V TG  GEIRK C+ VN+
Sbjct  295   DEFGKSMEKMGRINVKTGSAGEIRKQCSVVNS  326



>ref|XP_004965313.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=327

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/302 (58%), Positives = 213/302 (71%), Gaps = 5/302 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L VG+Y +TCP+ E IV++  +++I+ APSLAGPLLR+HFHDCFVRGC+ SVLL+S    
Sbjct  28    LEVGYYSKTCPNAEAIVRDEMEKIISAAPSLAGPLLRLHFHDCFVRGCDASVLLNSTEGN  87

Query  403   -GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               E+DA PN SLRGF  +D+VK  +E ACP  VSCAD+LAI+ARD     KGP W V  G
Sbjct  88    LAERDAKPNKSLRGFGSVDRVKAKLEAACPNTVSCADVLAIMARDAVVLAKGPSWPVPLG  147

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS+ TEA  NL P F +I +L + F   GL +KDLVVLSG HT+G +HC S+  R
Sbjct  148   RRDGRVSSATEAADNLPPAFGDIPLLTKIFAANGLDLKDLVVLSGAHTLGTAHCPSYAAR  207

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNF+  G ADP+LD  YA++L+ +C     T  L E DPGS +TFDTSY+  +AKRRGL
Sbjct  208   LYNFSAAG-ADPTLDSEYADRLRTRCKSVDDTAMLSETDPGSYKTFDTSYYRNLAKRRGL  266

Query  940   FTSDAALLDDEETKAYLVQQALT--HGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             F SDAALL D  T+ Y VQ+  T      +F+DFGESMV MG  GVLTG QGEIRK C  
Sbjct  267   FQSDAALLTDATTREY-VQRIATGKFDDMYFEDFGESMVKMGNAGVLTGAQGEIRKKCYI  325

Query  1114  VN  1119
             VN
Sbjct  326   VN  327



>emb|CAJ86371.1| OSIGBa0117N13.15 [Oryza sativa Indica Group]
 emb|CAJ86421.1| H0303G06.10 [Oryza sativa Indica Group]
Length=328

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 213/304 (70%), Gaps = 5/304 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             GL +GFY+ TCP  E IV++   ++I+  PSLAGPLLRMHFHDCFV GC+GS+LLDS P 
Sbjct  26    GLNIGFYQYTCPKAEVIVRDEMTKIISRVPSLAGPLLRMHFHDCFVNGCDGSILLDSTPG  85

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EK++ PN SLRGF  ID+VK  +E+ACPGVVSCADILA+VARDV    KGP+WEV T
Sbjct  86    SPSEKESIPNLSLRGFGTIDRVKAKLEQACPGVVSCADILALVARDVVFLTKGPHWEVPT  145

Query  577   GRRDGRVSNMTEALFNLLPPFANITV-LKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             GRRDG  S   +A+ NL PPF + T  L Q F  KGL  KD VVL GGHT+G SHCSSF 
Sbjct  146   GRRDGTRSVKDDAVNNLPPPFFDATRNLYQFFIPKGLDAKDQVVLLGGHTLGTSHCSSFA  205

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
              RLYNF+G   ADP+LD  Y  +LK KC     T  LVEMDPGS RTFDTSY+  IA+ R
Sbjct  206   SRLYNFSGTMMADPTLDKYYVPRLKSKCQPGDKT-TLVEMDPGSFRTFDTSYYRHIARGR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
              LFTSD  L+ D  T+ Y+++QA   G  + FF DF  SMV MG + VLTG QGEIRK C
Sbjct  265   ALFTSDETLMLDPFTRGYILRQAGVAGYPAEFFADFAASMVKMGNMQVLTGAQGEIRKHC  324

Query  1108  TAVN  1119
               VN
Sbjct  325   AFVN  328



>dbj|BAK02643.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 175/302 (58%), Positives = 212/302 (70%), Gaps = 5/302 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L +GFY +TCP  E IV+E   ++IA APSLAGPLLR+HFHDCFVRGC+ SVLL+S    
Sbjct  27    LEIGFYSKTCPDAEKIVREEMAKIIAAAPSLAGPLLRLHFHDCFVRGCDASVLLESTEGN  86

Query  403   -GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDA PN SLRGF  +++VK  +E ACPG+VSCAD+LA+++RD     KGP+W V  G
Sbjct  87    VAEKDAKPNKSLRGFGSVERVKAKLEAACPGIVSCADVLALMSRDAVVLAKGPFWPVALG  146

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS+ TEA   L P   ++ +L + F  KGL +KDLVVLSG HT+G +HC SF DR
Sbjct  147   RRDGRVSSATEASNELPPASGDVPLLAKIFASKGLGLKDLVVLSGAHTLGTAHCPSFADR  206

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYN T  G  DPSLD  YA+KL++KC        L EMDPGS +TFDTSY+  +AKRRGL
Sbjct  207   LYN-TTSGSVDPSLDSEYADKLRLKCRSVDDRTMLSEMDPGSFKTFDTSYYRHVAKRRGL  265

Query  940   FTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             F SDAALL D  T+ Y VQ+  T      FF DF  SM+ MG +GVLTG QGEIRK C A
Sbjct  266   FRSDAALLFDATTRDY-VQRIATGKLDGDFFSDFSASMIKMGDVGVLTGTQGEIRKKCYA  324

Query  1114  VN  1119
             +N
Sbjct  325   LN  326



>gb|ACR61552.1| peroxidase 2 [Zea mays]
 gb|AFW78556.1| peroxidase R15 [Zea mays]
Length=323

 Score =   345 bits (886),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 206/300 (69%), Gaps = 6/300 (2%)
 Frame = +1

Query  235   FYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ-GEK  411
             FY Q+CP +E +V++   + ++VAPSLAGPLLRMHFHDCFVRGC+GSVLLDS      EK
Sbjct  25    FYGQSCPSVEDVVRKEMVRALSVAPSLAGPLLRMHFHDCFVRGCDGSVLLDSTANNTAEK  84

Query  412   DAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGRRDG  591
             DA PN +LRGF  I++VK AVE+ACP  VSCAD+LA++ARD     KGP+W V  GRRDG
Sbjct  85    DAKPNLTLRGFGFIERVKAAVEKACPDTVSCADVLALMARDAVWLSKGPFWAVPLGRRDG  144

Query  592   RVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRLYNF  771
             RVS ++     L PP  N T L Q F  KGL  +DL VLS GHTIG SHC SF+DRLYNF
Sbjct  145   RVS-ISNETDQLPPPTGNFTELAQLFGAKGLDTRDLAVLSAGHTIGTSHCFSFSDRLYNF  203

Query  772   TGKGDA---DPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGLF  942
             TG  DA   DP LD  Y  +L+ KC        LVEMDPGS RTFD  Y+  +AKRRGLF
Sbjct  204   TGLDDARDTDPELDRAYMARLRAKCASLDDNTTLVEMDPGSFRTFDLGYYANVAKRRGLF  263

Query  943   TSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAVN  1119
              SDA LL D  T+AY+++ A   H   FF DF  SMV MG +GVLTG QGE+RK C  VN
Sbjct  264   HSDAQLLADPSTRAYVLRHATGAHRDEFFADFAASMVKMGSVGVLTGGQGEVRKKCNVVN  323



>ref|XP_002436932.1| hypothetical protein SORBIDRAFT_10g011510 [Sorghum bicolor]
 gb|EER88299.1| hypothetical protein SORBIDRAFT_10g011510 [Sorghum bicolor]
Length=339

 Score =   346 bits (888),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 213/302 (71%), Gaps = 4/302 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPT-K  399
             L VG+Y +TCP++E +V+E  +++++ A SLAGPLLR+HFHDCFVRGC+ SVLL+S    
Sbjct  39    LEVGYYSKTCPNVEALVREEMEKIMSAASSLAGPLLRLHFHDCFVRGCDASVLLNSTDGN  98

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDA PN SLRGF  +++VK  +E ACP  VSCAD+L ++ARD     +GP+W V  G
Sbjct  99    TAEKDATPNKSLRGFGSVERVKAKLEAACPNTVSCADVLTLMARDAVVLARGPFWPVALG  158

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS+ TEA   L P + +I +L + F  KGL  KDLVVLSGGHT+G +HC+S+  R
Sbjct  159   RRDGRVSSATEAADQLPPAYGDIPLLTKIFASKGLDAKDLVVLSGGHTLGTAHCTSYAGR  218

Query  760   LYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRGL  939
             LYNF+   +ADPSLD  YA++L+ +C  +     L EMDPGS +TFDTSY+  +AKRRGL
Sbjct  219   LYNFSSAYNADPSLDSEYADRLRTRCKSDDDKAMLSEMDPGSYKTFDTSYYRHVAKRRGL  278

Query  940   FTSDAALLDDEETKAYLVQQALT--HGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTA  1113
             F SDAALL D  T+ Y VQ+  T      FFKDF ESM+ MG +GVLTG  GEIRK C  
Sbjct  279   FQSDAALLTDATTREY-VQRIATGKFDDVFFKDFSESMIKMGSVGVLTGVDGEIRKKCYV  337

Query  1114  VN  1119
              N
Sbjct  338   AN  339



>emb|CAE04245.3| OSJNBa0089N06.6 [Oryza sativa Japonica Group]
 tpe|CAH69298.1| TPA: class III peroxidase 56 precursor [Oryza sativa Japonica 
Group]
 gb|EAY95665.1| hypothetical protein OsI_17531 [Oryza sativa Indica Group]
 gb|EAZ32074.1| hypothetical protein OsJ_16263 [Oryza sativa Japonica Group]
Length=328

 Score =   345 bits (886),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 213/304 (70%), Gaps = 5/304 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             GL +GFY+ TCP  E IV++   ++I+  PSLAGPLLRMHFHDCFV GC+GS+LLDS P 
Sbjct  26    GLNIGFYQYTCPKAEVIVRDEMTKIISRVPSLAGPLLRMHFHDCFVNGCDGSILLDSTPG  85

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EK++ PN SLRGF  ID+VK  +E+ACPGVVSCADILA+VARDV    KGP+WEV T
Sbjct  86    SPSEKESIPNLSLRGFGTIDRVKAKLEQACPGVVSCADILALVARDVVFLTKGPHWEVPT  145

Query  577   GRRDGRVSNMTEALFNLLPPFANITV-LKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             GRRDG  S   +A+ NL PPF + T  L Q F  KGL  KD VVL GGHT+G SHCSSF 
Sbjct  146   GRRDGTRSVKDDAVNNLPPPFFDATRNLYQFFIPKGLDAKDQVVLLGGHTLGTSHCSSFA  205

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
              RLYNF+G   ADP+LD  Y  +LK KC     T  LVEMDPGS RTFDTSY+  IA+ R
Sbjct  206   SRLYNFSGMMMADPTLDKYYVPRLKSKCQPGDKT-TLVEMDPGSFRTFDTSYYRHIARGR  264

Query  934   GLFTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
              LFTSD  L+ D  T+ Y+++QA   G  + FF DF  SMV MG + VLTG QGEIRK C
Sbjct  265   ALFTSDETLMLDPFTRGYILRQAGVAGYPAEFFADFAASMVKMGNMQVLTGAQGEIRKHC  324

Query  1108  TAVN  1119
               VN
Sbjct  325   AFVN  328



>ref|XP_002280274.1| PREDICTED: peroxidase 3 [Vitis vinifera]
Length=326

 Score =   345 bits (886),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 211/301 (70%), Gaps = 2/301 (1%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L++GFY ++CP  E IV +   + I  APSLA  L+RMHFHDCFVRGC+GSVL++S  + 
Sbjct  25    LKLGFYGESCPKAEKIVLDYVKKHIPNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSSN  84

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
             Q EKD  PN +LRGF  I++VK+ VE  CPG+VSCADILA+VARD      GP+W V TG
Sbjct  85    QAEKDGTPNLTLRGFDFIERVKSVVEAECPGIVSCADILALVARDSIVVTGGPFWNVPTG  144

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDG +SN +EA+ ++  P  N T L+  F +KGL + DLV+LSG HTIG+SHCSSF++R
Sbjct  145   RRDGLISNSSEAVSDIPRPVNNFTTLQTLFANKGLDLNDLVLLSGAHTIGVSHCSSFSNR  204

Query  760   LYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRRG  936
             LYNFTG GD DP+LD  YA  LK  KC   +    +VEMDPGS RTFD SY+TL+ KRRG
Sbjct  205   LYNFTGVGDEDPALDSEYAANLKARKCKVATDNTTIVEMDPGSFRTFDLSYYTLLLKRRG  264

Query  937   LFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCTAV  1116
             LF SDAAL  +  TKA++ Q      S+F  +F +SM  MGRI V TG  GE+RK C  +
Sbjct  265   LFESDAALTTNSGTKAFITQILQGPLSSFLAEFAKSMEKMGRIEVKTGTAGEVRKQCAVI  324

Query  1117  N  1119
             N
Sbjct  325   N  325



>gb|ACI00836.1| class III peroxidase [Triticum aestivum]
 gb|ACI00837.1| class III peroxidase [Triticum aestivum]
 gb|ACI00838.1| class III peroxidase [Triticum aestivum]
 gb|ACI00839.1| class III peroxidase [Triticum aestivum]
 gb|ACI00840.1| class III peroxidase [Triticum aestivum]
Length=327

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 210/306 (69%), Gaps = 9/306 (3%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L   FY +TCP +E +V++   + +++APSLAGPLLRMHFHDCFVRGC+GSVLLDS  K 
Sbjct  25    LHEKFYGETCPSVEDVVRKEMVRALSLAPSLAGPLLRMHFHDCFVRGCDGSVLLDSANKT  84

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EKDA PN +LRGF  +++VK AVE+ACP  VSCADILA++ARD     KGP+W V  GR
Sbjct  85    AEKDAQPNQTLRGFGFVERVKAAVEKACPDTVSCADILALIARDAVWLSKGPFWTVPLGR  144

Query  583   RDGRV--SNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTD  756
             RDG V  SN T+A   L PP +N TVL Q F    L  KDLVVLS GHTIG SHC SF+D
Sbjct  145   RDGSVSISNETDA---LPPPTSNFTVLTQLFAAVNLDAKDLVVLSAGHTIGTSHCFSFSD  201

Query  757   RLYNFTG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAK  927
             RLYNFTG     D DP+L+P Y  +LK KC   +    LVEMDPGS +TFDT YF L++K
Sbjct  202   RLYNFTGMENPSDIDPTLEPQYMMRLKSKCASLNDNTTLVEMDPGSFKTFDTDYFKLVSK  261

Query  928   RRGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKV  1104
             RRGLF SD ALL D  T+AY+ + A       FF DF  SM+ MG    LTG QGEIRK 
Sbjct  262   RRGLFHSDGALLTDPFTRAYVQRHATGAFKDEFFADFAASMIKMGNANPLTGSQGEIRKK  321

Query  1105  CTAVNN  1122
             C  VN+
Sbjct  322   CNVVNH  327



>ref|XP_008804399.1| PREDICTED: peroxidase 1-like [Phoenix dactylifera]
Length=327

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 210/303 (69%), Gaps = 7/303 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDSPTKQ  402
             L  GFY+ +CPH E IV +   ++IA AP L GP LRM +HDCFV GC+ S+LL+S    
Sbjct  28    LEYGFYKNSCPHAEFIVFQEMTKIIANAPFLTGPFLRMQYHDCFVNGCDASLLLNSTNNN  87

Query  403   -GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDAPPN SLRGF  ID +K  +E ACPG+VSCADILA++ARD      GPY+ +ETG
Sbjct  88    PAEKDAPPNQSLRGFDAIDDIKAKLEMACPGIVSCADILAMIARDSVKLTYGPYYAIETG  147

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGR S  ++   NL PP +NITVLK  F  KGL+ KDL VL+G HTIG S CSSFT+R
Sbjct  148   RRDGRRSEASDTQANLQPPTSNITVLKNIFIQKGLTAKDLAVLTGAHTIGQSLCSSFTER  207

Query  760   LYNFTGKG-DADPSLDPNYAEKLKMKCPEESPTDNL--VEMDPGSVRTFDTSYFTLIAKR  930
             LYNFTG+G   DP+LDP Y  +L  +C    P DN   VEMDPGS R FD +Y+  +++ 
Sbjct  208   LYNFTGRGFGLDPALDPTYVPQLMCEC---KPNDNTTRVEMDPGSSRNFDLAYYKGVSRG  264

Query  931   RGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             RGLFTSD  LL D ETKAY+ +QA+     FFKDF ESMV MGRI VLT  +GEIRK C 
Sbjct  265   RGLFTSDDQLLHDPETKAYVERQAMAWPEEFFKDFAESMVKMGRIEVLTHGKGEIRKKCA  324

Query  1111  AVN  1119
              VN
Sbjct  325   FVN  327



>ref|XP_006652863.1| PREDICTED: peroxidase 1-like [Oryza brachyantha]
Length=339

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 215/304 (71%), Gaps = 5/304 (2%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PT  396
             GL++GFY+ TCP+ E IV++   ++I+  PSLAGPLLRMHFHDCFV GC+ S+LL+S P 
Sbjct  37    GLKIGFYQYTCPNAEVIVRDEMTKIISRVPSLAGPLLRMHFHDCFVNGCDASILLNSSPG  96

Query  397   KQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVET  576
                EK++ PN SLRGF  ID+VK  +E+ CPG+VSCADILA+VARDV    KGP+W+V T
Sbjct  97    SPSEKESAPNLSLRGFGTIDRVKAKLEQTCPGIVSCADILALVARDVVVLTKGPHWDVPT  156

Query  577   GRRDGRVSNMTEALFNLLPPFANITV-LKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFT  753
             GRRDG  S   +AL NL PPF + T  L Q F  KGL  KD VVL GGHT+G SHCSSF+
Sbjct  157   GRRDGTRSVKDDALNNLPPPFFDATRNLYQFFIPKGLDAKDQVVLLGGHTLGTSHCSSFS  216

Query  754   DRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
              RLYNF+G   ADP+LD +Y  +LK KC     T  LVEMDPGS RTFDTSY+  IAK R
Sbjct  217   SRLYNFSGTTMADPTLDKHYVPRLKSKCQPGDKT-TLVEMDPGSFRTFDTSYYRHIAKGR  275

Query  934   GLFTSDAALLDDEETKAYLVQQALTHG--STFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
              LFTSD  L+ D  T+ Y+++QA   G  + FF DF  SMV MG + VLTG QGEIRK C
Sbjct  276   ALFTSDETLMLDPFTRDYVLRQASAAGYPAEFFADFAASMVKMGNMQVLTGMQGEIRKHC  335

Query  1108  TAVN  1119
               VN
Sbjct  336   AFVN  339



>ref|XP_002309832.1| peroxidase precursor family protein [Populus trichocarpa]
 gb|EEE90282.1| peroxidase precursor family protein [Populus trichocarpa]
Length=327

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/328 (53%), Positives = 218/328 (66%), Gaps = 8/328 (2%)
 Frame = +1

Query  148   RYLSLEILIFLAFACCNHHATGYGGLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPL  327
             RY  +     L F       +    L++GFY  +CP+ E I ++  ++ I  APSLA  +
Sbjct  5     RYFGMMFFCLLVFM-----GSTEAQLQMGFYSSSCPNAERIAQDYVNRHIHNAPSLAAAI  59

Query  328   LRMHFHDCFVRGCEGSVLLD--SPTKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVS  501
             +RMHFHDCFVRGC+ SVLL+  S   Q EK A PN +LRGF  IDKVK+ +E ACP VVS
Sbjct  60    IRMHFHDCFVRGCDASVLLNTTSSNNQTEKVATPNLTLRGFDFIDKVKSLLEAACPAVVS  119

Query  502   CADILAIVARDVTAAMKGPYWEVETGRRDGRVSNMTEALFNLLPPFANITVLKQGFFDKG  681
             CADI+A+VARD   A  GP+W V TGRRDG +S  +EAL N+ PP +N T L++ F ++G
Sbjct  120   CADIVALVARDAVVATGGPFWRVPTGRRDGTISRSSEALNNIPPPTSNFTNLQRLFANQG  179

Query  682   LSVKDLVVLSGGHTIGISHCSSFTDRLYNFTGKGDADPSLDPNYAEKLKM-KCPEESPTD  858
             L +KDLV+LSG HTIGISHCSSF++RLYNFTG GD DP+LD  YA  LK  KC   +   
Sbjct  180   LDLKDLVLLSGAHTIGISHCSSFSNRLYNFTGVGDQDPALDSEYAANLKARKCRSLNDNT  239

Query  859   NLVEMDPGSVRTFDTSYFTLIAKRRGLFTSDAALLDDEETKAYLVQQALTHGSTFFKDFG  1038
              +VEMDPGS RTFD SY++L+ KRRGLF SD+AL  +  T +++ Q        FF +F 
Sbjct  240   TIVEMDPGSFRTFDLSYYSLLLKRRGLFQSDSALTTNSATLSFVNQLLQGPLQNFFAEFA  299

Query  1039  ESMVNMGRIGVLTGDQGEIRKVCTAVNN  1122
              SM  MGRI V TG  GEIRK C  VN+
Sbjct  300   NSMEKMGRINVKTGTTGEIRKHCAVVNS  327



>ref|XP_006663651.1| PREDICTED: peroxidase 1-like [Oryza brachyantha]
Length=325

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 211/304 (69%), Gaps = 6/304 (2%)
 Frame = +1

Query  223   LRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTK  399
             L VG+Y +TCP +  IV+E   +++A AP+LAGPLLR+HFHDCFVRGC+GSVL+DS  + 
Sbjct  23    LDVGYYRKTCPKVAEIVREEMVRILAAAPTLAGPLLRLHFHDCFVRGCDGSVLIDSTASN  82

Query  400   QGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETG  579
               EKDAPPN +LRGF  + ++K  ++  CP  VSCAD+LA++ARD     KGPYW V  G
Sbjct  83    TAEKDAPPNQTLRGFGSVQRIKARLDAVCPDTVSCADVLALMARDAVVLSKGPYWAVPLG  142

Query  580   RRDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDR  759
             RRDGRVS   E    L PP ANIT L Q F  KGL +KDLVVLSGGHT+G +HC +F DR
Sbjct  143   RRDGRVSIANET-SQLPPPTANITQLAQMFAAKGLGLKDLVVLSGGHTLGTAHCPAFADR  201

Query  760   LYNFTG---KGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKR  930
             LYNFTG     D DP+LD +Y  +L+ +C   +    L EMDPGS  TFD  Y+ L+AKR
Sbjct  202   LYNFTGANNAADVDPALDRSYLARLRARCASLADNTTLAEMDPGSFLTFDAGYYRLLAKR  261

Query  931   RGLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVC  1107
             RGLF SD++LL D  T  Y+ +QA   + + FF+DF ESMV M  +GVLTG QGEIRK C
Sbjct  262   RGLFHSDSSLLADAFTAGYVRRQATGMYVAEFFRDFAESMVKMAGVGVLTGGQGEIRKKC  321

Query  1108  TAVN  1119
               +N
Sbjct  322   YVIN  325



>ref|XP_002447146.1| hypothetical protein SORBIDRAFT_06g029370 [Sorghum bicolor]
 gb|EES11474.1| hypothetical protein SORBIDRAFT_06g029370 [Sorghum bicolor]
Length=344

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 213/308 (69%), Gaps = 8/308 (3%)
 Frame = +1

Query  220   GLRVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS--P  393
             GLRVGFY+ TCP+ E IV++   ++I+  PSLAGPLLR+HFHDCFV GC+GSVLL+S  P
Sbjct  37    GLRVGFYQYTCPNAEAIVRDEMTKIISQVPSLAGPLLRLHFHDCFVNGCDGSVLLNSSIP  96

Query  394   TKQGEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVE  573
                 EK+A PN +LRGF  ID+VK  +E ACPGVVSCADILA+VARDV    KGP+W+V 
Sbjct  97    GVPTEKEAIPNLTLRGFGTIDRVKAKLERACPGVVSCADILALVARDVVVLTKGPHWDVP  156

Query  574   TGRRDGRVSNMTEALFNLLPPFANI-TVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSF  750
             TGRRDGR+S   +AL NL  PF +    L Q F  KGL  KD +VL GGHT+G SHCSSF
Sbjct  157   TGRRDGRISVKQDALNNLPAPFFDAGRNLFQFFIPKGLDAKDQIVLLGGHTLGTSHCSSF  216

Query  751   TDRLYNFTGKGDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKR  930
              DRLYNF+G   ADPSLD  Y  +LK KC     T  LVEMDPGS RTFD SY+  +A+ 
Sbjct  217   ADRLYNFSGTMTADPSLDKRYLPRLKSKCSNPGDTTTLVEMDPGSFRTFDASYYRHVARG  276

Query  931   RGLFTSDAALLDDEETKAYLVQQALT-----HGSTFFKDFGESMVNMGRIGVLTGDQGEI  1095
             R LF SD  L++D   +AY+ +QA       + + FF DF  SMV MG + VLTG QGE+
Sbjct  277   RSLFFSDQTLMNDAFARAYVQRQAAVADAGAYPAEFFADFAASMVKMGGVQVLTGAQGEV  336

Query  1096  RKVCTAVN  1119
             R+ C  VN
Sbjct  337   RRHCALVN  344



>ref|XP_004987268.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=331

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 209/303 (69%), Gaps = 6/303 (2%)
 Frame = +1

Query  226   RVGFYEQTCPHLEPIVKEIADQVIAVAPSLAGPLLRMHFHDCFVRGCEGSVLLDS-PTKQ  402
             ++ FY  TCP +E IVK+   +++  AP+LAGPLLR+HFHDCFVRGC+GSVLLDS P   
Sbjct  30    QMDFYSSTCPRVEEIVKDEMVEILRAAPTLAGPLLRLHFHDCFVRGCDGSVLLDSTPANT  89

Query  403   GEKDAPPNFSLRGFQIIDKVKTAVEEACPGVVSCADILAIVARDVTAAMKGPYWEVETGR  582
              EKDA PN +LRGF  + +VK  +E+ACPG VSCADILA++ARD     +GP W V  GR
Sbjct  90    AEKDATPNLTLRGFGSVQRVKDRLEQACPGTVSCADILALMARDAVVLARGPSWPVALGR  149

Query  583   RDGRVSNMTEALFNLLPPFANITVLKQGFFDKGLSVKDLVVLSGGHTIGISHCSSFTDRL  762
             RDGRVS   E    L PP AN T L Q F  KGL VKDLVVLSGGHT+G +HC+ F+DRL
Sbjct  150   RDGRVSIANET-NQLPPPTANFTRLVQMFAAKGLGVKDLVVLSGGHTLGTAHCNLFSDRL  208

Query  763   YNFTGK---GDADPSLDPNYAEKLKMKCPEESPTDNLVEMDPGSVRTFDTSYFTLIAKRR  933
             YNFTG     D DP+LD  Y  +L+ +C   +    L EMDPGS  +FD SY+ L+AKRR
Sbjct  209   YNFTGANNLADVDPALDATYLARLRSRCQSLADNTTLNEMDPGSFLSFDASYYRLVAKRR  268

Query  934   GLFTSDAALLDDEETKAYLVQQAL-THGSTFFKDFGESMVNMGRIGVLTGDQGEIRKVCT  1110
             GLF SDAALL D  T+AY+ +QA       FF+DF +SMV M  + VLTG QGEIRK C 
Sbjct  269   GLFHSDAALLSDPATRAYVQRQATGLFADEFFRDFADSMVKMSTVDVLTGAQGEIRKKCY  328

Query  1111  AVN  1119
              VN
Sbjct  329   LVN  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3203616478220