BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34268_g1_i1 len=2054 path=[1:0-2053]

Length=2054
                                                                      Score     E

ref|XP_009607162.1|  PREDICTED: cytochrome P450 CYP749A22-like          812   0.0      
ref|XP_004239025.1|  PREDICTED: cytochrome P450 CYP749A22-like          801   0.0      
ref|XP_009762791.1|  PREDICTED: cytochrome P450 CYP749A22-like          793   0.0      
emb|CDP00470.1|  unnamed protein product                                763   0.0      
gb|EYU22576.1|  hypothetical protein MIMGU_mgv1a004757mg                733   0.0      
ref|XP_011070908.1|  PREDICTED: cytochrome P450 CYP749A22-like          717   0.0      
ref|XP_006348799.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      690   0.0      
gb|AJD25259.1|  cytochrome P450 CYP749A37                               613   0.0      
sp|H2DH17.1|C7A22_PANGI  RecName: Full=Cytochrome P450 CYP749A22;...    601   0.0      
ref|XP_009356447.1|  PREDICTED: cytochrome P450 CYP749A22-like          599   0.0      
ref|XP_008243806.1|  PREDICTED: cytochrome P450 CYP749A22-like          589   0.0      
ref|XP_007221838.1|  hypothetical protein PRUPE_ppa023692mg             589   0.0      
ref|XP_011070909.1|  PREDICTED: cytochrome P450 CYP749A22-like          586   0.0      
ref|XP_007222985.1|  hypothetical protein PRUPE_ppa004328mg             583   0.0      
ref|XP_007226531.1|  hypothetical protein PRUPE_ppa025196mg             583   0.0      
ref|XP_004303121.1|  PREDICTED: cytochrome P450 734A1-like              582   0.0      
ref|XP_008243779.1|  PREDICTED: cytochrome P450 CYP749A22-like          582   0.0      
ref|XP_008350887.1|  PREDICTED: cytochrome P450 CYP749A22-like          581   0.0      
ref|XP_007223137.1|  hypothetical protein PRUPE_ppa004329mg             581   0.0      
ref|XP_007226460.1|  hypothetical protein PRUPE_ppa024660mg             581   0.0      
ref|XP_006437867.1|  hypothetical protein CICLE_v10033321mg             580   0.0      
ref|XP_004298351.1|  PREDICTED: cytochrome P450 734A1-like              580   0.0      
ref|XP_004297206.1|  PREDICTED: cytochrome P450 734A1-like              580   0.0      
ref|XP_006484250.1|  PREDICTED: cytochrome P450 734A1-like              577   0.0      
ref|XP_002316006.2|  hypothetical protein POPTR_0010s14900g             576   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007201527.1|  hypothetical protein PRUPE_ppa016887mg             576   0.0      
ref|XP_008390037.1|  PREDICTED: uncharacterized protein LOC103452311    594   0.0      
ref|XP_007226180.1|  hypothetical protein PRUPE_ppa015588mg             575   0.0      
ref|XP_008243803.1|  PREDICTED: cytochrome P450 CYP749A22-like          574   0.0      
ref|XP_007226762.1|  hypothetical protein PRUPE_ppa018724mg             574   0.0      
ref|XP_004297211.1|  PREDICTED: cytochrome P450 734A1-like              573   0.0      
ref|XP_011015632.1|  PREDICTED: cytochrome P450 CYP749A22-like          573   0.0      
ref|XP_006348652.1|  PREDICTED: cytochrome P450 734A1-like              571   0.0      
ref|XP_008367031.1|  PREDICTED: cytochrome P450 CYP749A22-like          571   0.0      
ref|XP_008243778.1|  PREDICTED: cytochrome P450 CYP749A22-like          571   0.0      
ref|XP_004297209.1|  PREDICTED: cytochrome P450 734A1-like              570   0.0      
ref|XP_010049898.1|  PREDICTED: cytochrome P450 CYP749A22-like          568   0.0      
ref|XP_008360080.1|  PREDICTED: cytochrome P450 CYP749A22-like          568   0.0      
ref|XP_007224470.1|  hypothetical protein PRUPE_ppa022621mg             568   0.0      
ref|XP_011009723.1|  PREDICTED: cytochrome P450 CYP749A22-like          567   0.0      
gb|EYU22575.1|  hypothetical protein MIMGU_mgv1a004725mg                567   0.0      
ref|XP_006437870.1|  hypothetical protein CICLE_v10031156mg             567   0.0      
ref|XP_008243777.1|  PREDICTED: cytochrome P450 CYP749A22-like          584   0.0      
gb|KCW82725.1|  hypothetical protein EUGRSUZ_C04102                     566   0.0      
ref|XP_006484252.1|  PREDICTED: cytochrome P450 734A1-like              566   0.0      
gb|KCW86463.1|  hypothetical protein EUGRSUZ_B03131                     566   0.0      
ref|XP_009356202.1|  PREDICTED: cytochrome P450 CYP749A22-like          565   0.0      
ref|XP_009607163.1|  PREDICTED: cytochrome P450 CYP749A22-like          565   0.0      
ref|XP_007223262.1|  hypothetical protein PRUPE_ppa004463mg             565   0.0      
ref|XP_002316010.2|  hypothetical protein POPTR_0010s14950g             565   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002316008.1|  hypothetical protein POPTR_0010s14920g             565   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010044378.1|  PREDICTED: cytochrome P450 CYP749A22-like is...    566   0.0      
ref|XP_010091621.1|  Cytochrome P450 734A1                              564   0.0      
ref|XP_009357376.1|  PREDICTED: cytochrome P450 CYP749A22-like          564   0.0      
ref|XP_008243892.1|  PREDICTED: cytochrome P450 CYP749A22-like          564   0.0      
ref|XP_008243895.1|  PREDICTED: cytochrome P450 CYP749A22-like          579   0.0      
ref|XP_008367032.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    561   0.0      
ref|XP_004297208.1|  PREDICTED: cytochrome P450 734A1-like              561   0.0      
ref|XP_008364583.1|  PREDICTED: cytochrome P450 CYP749A22-like          561   0.0      
ref|XP_011008174.1|  PREDICTED: cytochrome P450 CYP749A22-like          560   0.0      
ref|XP_008219236.1|  PREDICTED: cytochrome P450 CYP749A22-like          559   0.0      
ref|XP_002512037.1|  cytochrome P450, putative                          559   0.0      Ricinus communis
gb|KDO70288.1|  hypothetical protein CISIN_1g009043mg                   559   0.0      
ref|XP_009356448.1|  PREDICTED: cytochrome P450 CYP749A22-like          558   0.0      
gb|KDP41351.1|  hypothetical protein JCGZ_15758                         557   0.0      
ref|XP_008243804.1|  PREDICTED: cytochrome P450 CYP749A22-like          558   0.0      
ref|XP_004298348.1|  PREDICTED: cytochrome P450 734A1-like              557   0.0      
ref|XP_008389250.1|  PREDICTED: cytochrome P450 CYP749A22-like          557   0.0      
ref|XP_009346500.1|  PREDICTED: cytochrome P450 CYP749A22-like          557   0.0      
ref|XP_008356573.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    557   0.0      
ref|XP_010044379.1|  PREDICTED: cytochrome P450 CYP749A22-like          557   0.0      
ref|XP_010044377.1|  PREDICTED: cytochrome P450 CYP749A22-like is...    559   0.0      
ref|XP_009356543.1|  PREDICTED: uncharacterized protein LOC103947364    575   0.0      
gb|KDO70287.1|  hypothetical protein CISIN_1g039293mg                   556   0.0      
ref|XP_004298350.1|  PREDICTED: cytochrome P450 734A1-like              556   0.0      
ref|XP_007224838.1|  hypothetical protein PRUPE_ppa023100mg             556   0.0      
ref|XP_007226407.1|  hypothetical protein PRUPE_ppa022752mg             555   0.0      
ref|XP_008346697.1|  PREDICTED: cytochrome P450 CYP749A22-like          556   0.0      
ref|XP_007222983.1|  hypothetical protein PRUPE_ppa004319mg             555   0.0      
gb|KCW86467.1|  hypothetical protein EUGRSUZ_B03135                     555   0.0      
ref|XP_004297210.1|  PREDICTED: cytochrome P450 734A1-like              555   0.0      
ref|XP_002325505.1|  hypothetical protein POPTR_0019s09980g             557   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010049897.1|  PREDICTED: cytochrome P450 CYP749A22-like          555   0.0      
ref|XP_007224155.1|  hypothetical protein PRUPE_ppa016800mg             554   0.0      
ref|XP_009346501.1|  PREDICTED: cytochrome P450 CYP749A22-like          554   0.0      
ref|XP_010044380.1|  PREDICTED: cytochrome P450 CYP749A22-like          555   0.0      
ref|XP_010049895.1|  PREDICTED: cytochrome P450 CYP749A22-like          554   0.0      
ref|XP_008351041.1|  PREDICTED: cytochrome P450 CYP749A22-like          572   0.0      
ref|XP_011009686.1|  PREDICTED: cytochrome P450 CYP749A22-like          553   0.0      
ref|XP_007222124.1|  hypothetical protein PRUPE_ppa004646mg             553   0.0      
gb|KCW44246.1|  hypothetical protein EUGRSUZ_L02324                     553   0.0      
ref|XP_004298349.1|  PREDICTED: cytochrome P450 734A1-like              553   0.0      
ref|XP_008243887.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    571   0.0      
ref|XP_008243805.1|  PREDICTED: cytochrome P450 CYP749A22-like          553   0.0      
ref|XP_007045778.1|  Cytochrome P450                                    552   0.0      
ref|XP_007045779.1|  Cytochrome P450, putative                          552   0.0      
ref|XP_009356542.1|  PREDICTED: uncharacterized protein LOC103947363    571   0.0      
ref|XP_002512038.1|  cytochrome P450, putative                          552   0.0      Ricinus communis
ref|XP_008389384.1|  PREDICTED: cytochrome P450 CYP749A22-like          552   0.0      
ref|XP_002316007.2|  hypothetical protein POPTR_0010s14910g             551   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006437871.1|  hypothetical protein CICLE_v10031156mg             552   0.0      
ref|XP_007034363.1|  Cytochrome P450                                    553   0.0      
ref|XP_006484251.1|  PREDICTED: cytochrome P450 734A1-like              551   0.0      
gb|KCW73229.1|  hypothetical protein EUGRSUZ_E01694                     550   0.0      
gb|KCW82720.1|  hypothetical protein EUGRSUZ_C04097                     550   0.0      
ref|XP_008374265.1|  PREDICTED: cytochrome P450 CYP749A22-like          550   0.0      
ref|XP_010044376.1|  PREDICTED: cytochrome P450 CYP749A22-like          548   0.0      
ref|XP_007034362.1|  Cytochrome P450                                    551   0.0      
ref|XP_010320842.1|  PREDICTED: cytochrome P450 CYP749A22               547   0.0      
ref|XP_010056458.1|  PREDICTED: cytochrome P450 CYP749A22-like          547   0.0      
ref|XP_010056464.1|  PREDICTED: cytochrome P450 CYP749A22-like          549   0.0      
ref|XP_007045774.1|  Cytochrome P450                                    546   0.0      
gb|KDO70289.1|  hypothetical protein CISIN_1g009043mg                   546   0.0      
ref|XP_007045772.1|  Secologanin synthase, putative                     562   0.0      
ref|XP_008361867.1|  PREDICTED: uncharacterized protein LOC103425555    569   0.0      
emb|CDP00472.1|  unnamed protein product                                563   0.0      
gb|KHG03731.1|  Secologanin synthase                                    542   0.0      
gb|KCW82722.1|  hypothetical protein EUGRSUZ_C04098                     541   0.0      
ref|XP_011009712.1|  PREDICTED: cytochrome P450 CYP749A22-like          541   0.0      
gb|KDP41353.1|  hypothetical protein JCGZ_15760                         539   0.0      
gb|KCW85140.1|  hypothetical protein EUGRSUZ_B01983                     540   0.0      
ref|XP_008340298.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    557   0.0      
ref|XP_010041584.1|  PREDICTED: cytochrome P450 CYP749A22-like          553   0.0      
ref|XP_010044348.1|  PREDICTED: cytochrome P450 CYP749A22-like          539   0.0      
ref|XP_004297212.1|  PREDICTED: cytochrome P450 734A1-like              539   0.0      
ref|XP_002512040.1|  cytochrome P450, putative                          536   0.0      Ricinus communis
ref|XP_011101779.1|  PREDICTED: cytochrome P450 CYP749A22-like          536   1e-180   
ref|XP_008446466.1|  PREDICTED: cytochrome P450 CYP749A22-like          536   1e-180   
emb|CDP00469.1|  unnamed protein product                                533   2e-180   
ref|XP_011102246.1|  PREDICTED: cytochrome P450 CYP749A22-like          535   3e-180   
ref|XP_010040838.1|  PREDICTED: cytochrome P450 CYP749A22-like          538   4e-180   
ref|XP_011102247.1|  PREDICTED: cytochrome P450 CYP749A22-like          534   6e-180   
ref|XP_002325324.2|  hypothetical protein POPTR_0019s03160g             534   9e-180   Populus trichocarpa [western balsam poplar]
ref|XP_008229697.1|  PREDICTED: cytochrome P450 CYP749A22-like          533   1e-179   
ref|XP_006388777.1|  hypothetical protein POPTR_0102s00210g             532   4e-179   
gb|EYU22577.1|  hypothetical protein MIMGU_mgv1a004830mg                531   7e-179   
ref|XP_010091618.1|  Cytochrome P450 734A1                              532   1e-178   
gb|AJD25260.1|  cytochrome P450 CYP749A38                               530   2e-178   
ref|XP_004295657.1|  PREDICTED: cytochrome P450 734A1-like              529   2e-178   
ref|XP_007045776.1|  Cytochrome P450                                    530   3e-178   
gb|AJD25262.1|  cytochrome P450 CYP749A40                               530   4e-178   
ref|XP_004135431.1|  PREDICTED: cytochrome P450 734A1-like              530   5e-178   
gb|EYU22581.1|  hypothetical protein MIMGU_mgv1a004745mg                528   1e-177   
ref|XP_004295655.1|  PREDICTED: cytochrome P450 734A1-like              527   1e-177   
gb|KDO36840.1|  hypothetical protein CISIN_1g012962mg                   525   5e-177   
gb|EYU22578.1|  hypothetical protein MIMGU_mgv1a004881mg                526   8e-177   
gb|AEM42984.1|  cytochrome P450                                         526   1e-176   
ref|XP_004297193.1|  PREDICTED: cytochrome P450 734A1-like              526   2e-176   
ref|XP_004297207.1|  PREDICTED: cytochrome P450 734A1-like              525   3e-176   
ref|XP_010046611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    542   3e-176   
ref|XP_007045775.1|  Cytochrome P450                                    525   4e-176   
ref|XP_008339765.1|  PREDICTED: cytochrome P450 CYP749A22-like          525   5e-176   
ref|XP_008352941.1|  PREDICTED: cytochrome P450 CYP749A22-like          525   5e-176   
ref|XP_010091620.1|  Cytochrome P450 734A1                              522   1e-175   
gb|KHG06141.1|  Cytochrome P450 protein                                 522   7e-175   
gb|KCW86460.1|  hypothetical protein EUGRSUZ_B03128                     520   1e-174   
gb|KHG18356.1|  Cytochrome P450 protein                                 520   2e-174   
ref|XP_008446465.1|  PREDICTED: cytochrome P450 CYP749A22-like          518   7e-174   
ref|XP_009356544.1|  PREDICTED: uncharacterized protein LOC103947365    536   1e-172   
ref|XP_006388779.1|  hypothetical protein POPTR_0102s00240g             517   2e-172   
gb|KHG11625.1|  Cytochrome P450 protein                                 516   2e-172   
gb|KHG26927.1|  Cytochrome P450 protein                                 513   6e-172   
gb|AJD25261.1|  cytochrome P450 CYP749A39                               513   1e-171   
ref|XP_006437868.1|  hypothetical protein CICLE_v10033709mg             511   2e-171   
gb|KCW86459.1|  hypothetical protein EUGRSUZ_B03127                     512   2e-171   
gb|KHG08051.1|  Cytochrome P450 protein                                 511   3e-171   
gb|KHG08441.1|  Cytochrome P450 protein                                 511   6e-171   
ref|XP_011070904.1|  PREDICTED: cytochrome P450 CYP749A22-like          511   6e-171   
gb|KHG27490.1|  Cytochrome P450 protein                                 509   4e-170   
gb|KHG07569.1|  Cytochrome P450 protein                                 509   5e-170   
ref|XP_002316009.1|  hypothetical protein POPTR_0010s14940g             509   3e-169   Populus trichocarpa [western balsam poplar]
gb|KHG21314.1|  Secologanin synthase                                    506   5e-169   
gb|KHG09815.1|  Cytochrome P450 protein                                 505   2e-168   
ref|XP_004170856.1|  PREDICTED: cytochrome P450 734A1-like              505   2e-168   
gb|KCW76384.1|  hypothetical protein EUGRSUZ_D00766                     504   3e-168   
gb|KDP35171.1|  hypothetical protein JCGZ_10705                         502   6e-168   
ref|XP_004135429.1|  PREDICTED: cytochrome P450 734A1-like              503   2e-167   
gb|KHG26170.1|  Secologanin synthase                                    502   3e-167   
ref|XP_002512042.1|  cytochrome P450, putative                          498   8e-167   Ricinus communis
gb|KHG14401.1|  Cytochrome P450 protein                                 504   8e-166   
gb|KHG27367.1|  Cytochrome P450 protein                                 498   1e-165   
emb|CDP12576.1|  unnamed protein product                                496   6e-165   
ref|XP_004173451.1|  PREDICTED: cytochrome P450 734A1-like              494   1e-164   
gb|KDP35176.1|  hypothetical protein JCGZ_10710                         491   4e-164   
gb|KDP35170.1|  hypothetical protein JCGZ_10704                         494   6e-164   
ref|XP_002512039.1|  cytochrome P450, putative                          491   1e-163   Ricinus communis
gb|KCW86465.1|  hypothetical protein EUGRSUZ_B03133                     493   1e-163   
ref|XP_010052417.1|  PREDICTED: cytochrome P450 CYP749A22-like          492   2e-163   
gb|KCW76385.1|  hypothetical protein EUGRSUZ_D00767                     490   3e-163   
gb|KHG09429.1|  Cytochrome P450 protein                                 491   4e-163   
gb|KCW85137.1|  hypothetical protein EUGRSUZ_B01976                     489   9e-163   
ref|XP_010054392.1|  PREDICTED: cytochrome P450 CYP749A22-like          489   1e-162   
gb|KHG20728.1|  hypothetical protein F383_28301                         505   2e-162   
ref|XP_011015642.1|  PREDICTED: cytochrome P450 CYP749A22-like          486   2e-162   
gb|KHG14937.1|  Cytochrome P450 protein                                 489   2e-162   
ref|XP_006437869.1|  hypothetical protein CICLE_v10033485mg             486   3e-162   
gb|KCW85143.1|  hypothetical protein EUGRSUZ_B01987                     488   3e-162   
gb|KHG16899.1|  Secologanin synthase                                    489   4e-162   
ref|XP_008446467.1|  PREDICTED: cytochrome P450 CYP749A22-like          487   2e-161   
ref|XP_007224911.1|  hypothetical protein PRUPE_ppa021901mg             484   5e-161   
gb|KHG20842.1|  Secologanin synthase                                    484   3e-160   
gb|KHG24669.1|  Secologanin synthase                                    483   6e-160   
gb|KDP41345.1|  hypothetical protein JCGZ_15752                         479   1e-159   
gb|KHG17439.1|  Secologanin synthase                                    482   2e-159   
gb|KCW44611.1|  hypothetical protein EUGRSUZ_L01872                     479   1e-158   
gb|KHG16163.1|  Cytochrome P450 protein                                 478   1e-158   
ref|XP_011101783.1|  PREDICTED: cytochrome P450 CYP749A22-like          477   6e-158   
gb|KDO70290.1|  hypothetical protein CISIN_1g009043mg                   475   1e-157   
ref|XP_007210003.1|  hypothetical protein PRUPE_ppa016601mg             467   7e-153   
gb|KDP41344.1|  hypothetical protein JCGZ_15751                         460   3e-152   
gb|KHG20729.1|  hypothetical protein F383_28301                         476   1e-151   
gb|KHG14912.1|  Cytochrome P450 protein                                 461   1e-151   
gb|AAZ39644.1|  cytochrome P450 monooxygenase                           460   4e-151   Petunia x hybrida [garden petunia]
gb|KHG26580.1|  Cytochrome P450 protein                                 459   8e-151   
ref|XP_010046246.1|  PREDICTED: cytochrome P450 CYP749A22-like          453   5e-149   
ref|XP_008243893.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    449   3e-148   
gb|KHG08575.1|  Cytochrome P450 protein                                 450   9e-148   
ref|XP_010046249.1|  PREDICTED: cytochrome P450 CYP749A22-like          449   7e-147   
gb|KCW44878.1|  hypothetical protein EUGRSUZ_L01541                     443   5e-146   
gb|KCW44686.1|  hypothetical protein EUGRSUZ_L01780                     436   5e-143   
ref|XP_010041134.1|  PREDICTED: cytochrome P450 CYP749A22-like          434   7e-142   
gb|KHG30791.1|  Cytochrome P450 protein                                 435   8e-142   
gb|KHG29404.1|  Cytochrome P450 protein                                 429   4e-140   
ref|XP_010041049.1|  PREDICTED: cytochrome P450 734A1-like              439   8e-139   
gb|KDP41343.1|  hypothetical protein JCGZ_15750                         425   2e-138   
ref|XP_010091619.1|  Cytochrome P450 734A1                              426   6e-138   
gb|KCW85138.1|  hypothetical protein EUGRSUZ_B01978                     416   6e-135   
ref|XP_010046256.1|  PREDICTED: cytochrome P450 CYP749A22-like          401   7e-130   
ref|XP_008339617.1|  PREDICTED: cytochrome P450 CYP749A22-like          394   7e-127   
gb|KCW82723.1|  hypothetical protein EUGRSUZ_C04098                     394   7e-127   
ref|XP_010254918.1|  PREDICTED: cytochrome P450 734A1                   397   7e-127   
gb|ABK25130.1|  unknown                                                 396   5e-126   Picea sitchensis
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    389   4e-123   
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    389   4e-123   
ref|XP_008358468.1|  PREDICTED: cytochrome P450 CYP749A22-like          383   5e-123   
dbj|BAF56240.1|  cytochrome P450 enzyme                                 386   3e-122   Pisum sativum [garden pea]
emb|CDP07542.1|  unnamed protein product                                386   3e-122   
gb|KCW73209.1|  hypothetical protein EUGRSUZ_E016722                    380   7e-122   
ref|XP_003549781.1|  PREDICTED: cytochrome P450 734A1-like              383   5e-121   
ref|XP_010058553.1|  PREDICTED: cytochrome P450 CYP749A22-like          380   5e-121   
ref|XP_004969234.1|  PREDICTED: secologanin synthase-like               383   8e-121   
gb|KCW44245.1|  hypothetical protein EUGRSUZ_L02323                     376   9e-121   
ref|XP_004508536.1|  PREDICTED: cytochrome P450 734A1-like              382   1e-120   
ref|NP_001043634.1|  Os01g0627800                                       382   1e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002455992.1|  hypothetical protein SORBIDRAFT_03g028630          382   2e-120   Sorghum bicolor [broomcorn]
emb|CDM83378.1|  unnamed protein product                                381   3e-120   
ref|XP_004969233.1|  PREDICTED: secologanin synthase-like               382   3e-120   
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          380   7e-120   
dbj|BAN19913.1|  cytochrome P450                                        379   1e-119   
ref|XP_010046258.1|  PREDICTED: cytochrome P450 CYP749A22-like          374   2e-119   
dbj|BAJ95191.1|  predicted protein                                      378   2e-119   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     378   3e-119   
dbj|BAJ89369.1|  predicted protein                                      379   4e-119   
ref|NP_001168846.1|  uncharacterized protein LOC100382651               378   4e-119   Zea mays [maize]
ref|XP_008675320.1|  PREDICTED: cytochrome P450 72A13-like              379   4e-119   
gb|EMT26606.1|  Secologanin synthase                                    378   5e-119   
ref|XP_004309425.1|  PREDICTED: secologanin synthase-like               371   5e-119   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    377   8e-119   
dbj|BAN19927.1|  cytochrome P450                                        377   8e-119   
gb|ABR16167.1|  unknown                                                 377   1e-118   Picea sitchensis
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          377   1e-118   
gb|KHN27404.1|  Cytochrome P450 734A1                                   375   2e-118   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              376   2e-118   
ref|XP_007154955.1|  hypothetical protein PHAVU_003G161200g             377   3e-118   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              375   3e-118   
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          376   3e-118   
ref|XP_003524531.1|  PREDICTED: cytochrome P450 734A1-like              376   3e-118   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          376   3e-118   
ref|XP_011012397.1|  PREDICTED: cytochrome P450 734A1-like              375   4e-118   
ref|XP_006646126.1|  PREDICTED: secologanin synthase-like               376   4e-118   
ref|XP_004969232.1|  PREDICTED: secologanin synthase-like               375   4e-118   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    375   4e-118   
ref|XP_002455994.1|  hypothetical protein SORBIDRAFT_03g028650          375   6e-118   Sorghum bicolor [broomcorn]
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          375   6e-118   Sorghum bicolor [broomcorn]
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          375   7e-118   
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              374   1e-117   
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    374   1e-117   
ref|XP_003569406.1|  PREDICTED: cytochrome P450 72A14-like              374   2e-117   
ref|XP_006644394.1|  PREDICTED: secologanin synthase-like               374   2e-117   
dbj|BAN19916.1|  cytochrome P450                                        374   3e-117   
dbj|BAN19928.1|  cytochrome P450                                        373   4e-117   
ref|XP_002455993.1|  hypothetical protein SORBIDRAFT_03g028640          373   4e-117   
ref|XP_002324347.2|  hypothetical protein POPTR_0018s06550g             373   4e-117   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              373   4e-117   
ref|XP_007013339.1|  Cytochrome P450                                    373   4e-117   
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    373   5e-117   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              372   6e-117   
dbj|BAF98466.1|  cytochrome P450                                        372   6e-117   
ref|XP_011013342.1|  PREDICTED: cytochrome P450 734A1-like              372   6e-117   
gb|KHG02010.1|  Cytochrome P450 protein                                 372   7e-117   
gb|ABR16379.1|  unknown                                                 372   8e-117   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          372   8e-117   
gb|KDP32358.1|  hypothetical protein JCGZ_13283                         372   1e-116   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    372   1e-116   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               372   1e-116   
ref|XP_003569408.1|  PREDICTED: cytochrome P450 72A13-like              372   1e-116   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    371   1e-116   
ref|XP_003566917.1|  PREDICTED: cytochrome P450 72A15-like              371   2e-116   
ref|XP_006451003.1|  hypothetical protein CICLE_v10007914mg             372   2e-116   
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    371   3e-116   
dbj|BAH01411.1|  unnamed protein product                                370   4e-116   
gb|EAY75046.1|  hypothetical protein OsI_02942                          370   4e-116   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              370   5e-116   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             369   7e-116   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    370   8e-116   
gb|EMT11454.1|  Secologanin synthase                                    369   9e-116   
ref|XP_010232048.1|  PREDICTED: cytochrome P450 72A15-like              369   1e-115   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              369   2e-115   
ref|XP_002285021.2|  PREDICTED: cytochrome P450 734A1                   369   2e-115   
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              369   2e-115   
dbj|BAJ98958.1|  predicted protein                                      369   2e-115   
ref|XP_002455997.1|  hypothetical protein SORBIDRAFT_03g028680          369   2e-115   
gb|EAY75042.1|  hypothetical protein OsI_02938                          368   3e-115   
ref|XP_006646124.1|  PREDICTED: secologanin synthase-like               369   3e-115   
ref|XP_002281648.1|  PREDICTED: cytochrome P450 734A1                   367   4e-115   
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              368   4e-115   
ref|XP_008361238.1|  PREDICTED: cytochrome P450 734A1-like              368   4e-115   
ref|XP_010510871.1|  PREDICTED: cytochrome P450 734A1                   367   4e-115   
gb|KHN14193.1|  Secologanin synthase                                    367   4e-115   
emb|CBI19667.3|  unnamed protein product                                367   4e-115   
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               367   5e-115   
ref|XP_003569402.1|  PREDICTED: cytochrome P450 72A13-like              367   6e-115   
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               367   7e-115   
gb|ABG85296.1|  P450 monooxygenase                                      367   8e-115   
ref|XP_010098987.1|  Cytochrome P450 734A1                              368   8e-115   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       367   9e-115   
ref|XP_003569398.1|  PREDICTED: cytochrome P450 72A15-like              367   1e-114   
ref|XP_008676348.1|  PREDICTED: cytochrome P450 72A15-like              367   1e-114   
gb|KHG26069.1|  hypothetical protein F383_05868                         367   1e-114   
ref|NP_001043635.1|  Os01g0627900                                       366   2e-114   
ref|XP_002458201.1|  hypothetical protein SORBIDRAFT_03g028620          367   2e-114   
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             366   2e-114   
dbj|BAB87118.1|  cytochrome P450                                        366   2e-114   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              365   2e-114   
gb|KFK33156.1|  hypothetical protein AALP_AA6G337900                    365   2e-114   
ref|NP_001043632.1|  Os01g0627500                                       366   2e-114   
ref|XP_009790069.1|  PREDICTED: cytochrome P450 734A1                   365   2e-114   
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    366   3e-114   
ref|XP_010417817.1|  PREDICTED: cytochrome P450 734A1-like              365   3e-114   
emb|CBI28155.3|  unnamed protein product                                366   3e-114   
gb|EMT07075.1|  Secologanin synthase                                    365   4e-114   
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          365   4e-114   
ref|XP_002283107.1|  PREDICTED: cytochrome P450 734A1                   364   5e-114   
ref|XP_009784939.1|  PREDICTED: cytochrome P450 734A1-like              365   5e-114   
ref|XP_006293376.1|  hypothetical protein CARUB_v10022970mg             365   5e-114   
ref|XP_010473056.1|  PREDICTED: cytochrome P450 734A1-like              365   5e-114   
ref|XP_006434955.1|  hypothetical protein CICLE_v10000905mg             364   5e-114   
ref|XP_008385883.1|  PREDICTED: cytochrome P450 734A1                   365   6e-114   
ref|XP_002524439.1|  cytochrome P450, putative                          365   6e-114   
ref|XP_002456000.1|  hypothetical protein SORBIDRAFT_03g028710          365   6e-114   
ref|XP_003566907.1|  PREDICTED: cytochrome P450 72A13-like              365   6e-114   
ref|XP_002281622.1|  PREDICTED: cytochrome P450 734A1                   364   7e-114   
gb|KHG16086.1|  Secologanin synthase                                    358   8e-114   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              364   9e-114   
ref|XP_003569401.1|  PREDICTED: cytochrome P450 72A13-like              364   9e-114   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               364   9e-114   
gb|KHN36820.1|  Secologanin synthase                                    363   1e-113   
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      364   1e-113   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          363   1e-113   
ref|XP_009588274.1|  PREDICTED: cytochrome P450 734A1-like              363   1e-113   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               364   2e-113   
ref|XP_006473472.1|  PREDICTED: cytochrome P450 734A1-like              363   2e-113   
ref|XP_004969238.1|  PREDICTED: secologanin synthase-like               363   2e-113   
ref|NP_001043498.1|  Os01g0602400                                       364   2e-113   
ref|XP_002879001.1|  hypothetical protein ARALYDRAFT_901457             363   2e-113   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             363   2e-113   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              363   2e-113   
ref|XP_008352112.1|  PREDICTED: cytochrome P450 CYP72A219-like          362   3e-113   
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    363   3e-113   
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     363   3e-113   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    363   4e-113   
ref|XP_008242719.1|  PREDICTED: cytochrome P450 734A1                   363   4e-113   
ref|XP_003609250.1|  Cytochrome P450                                    363   4e-113   
ref|XP_010541892.1|  PREDICTED: cytochrome P450 734A1-like              362   4e-113   
ref|XP_002455996.1|  hypothetical protein SORBIDRAFT_03g028670          363   5e-113   
ref|XP_010233466.1|  PREDICTED: cytochrome P450 72A15-like              362   5e-113   
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          362   5e-113   
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          362   5e-113   
ref|XP_010249983.1|  PREDICTED: cytochrome P450 734A1-like              362   7e-113   
ref|NP_180239.1|  cytochrome P450 734A1                                 362   8e-113   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          361   1e-112   
ref|XP_002455991.1|  hypothetical protein SORBIDRAFT_03g028590          362   1e-112   
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            362   1e-112   
ref|XP_006434956.1|  hypothetical protein CICLE_v10003134mg             361   1e-112   
ref|XP_006397283.1|  hypothetical protein EUTSA_v10028574mg             361   1e-112   
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             361   2e-112   
emb|CDP15982.1|  unnamed protein product                                360   2e-112   
gb|EAY75040.1|  hypothetical protein OsI_02936                          360   2e-112   
dbj|BAJ85869.1|  predicted protein                                      361   2e-112   
gb|EEE55021.1|  hypothetical protein OsJ_02678                          362   2e-112   
ref|XP_008656688.1|  PREDICTED: cytochrome P450 72A15-like              361   2e-112   
ref|XP_007203674.1|  hypothetical protein PRUPE_ppa026777mg             361   2e-112   
ref|XP_010666256.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    360   2e-112   
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    360   2e-112   
ref|XP_009348187.1|  PREDICTED: cytochrome P450 734A1                   361   2e-112   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             360   2e-112   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              360   3e-112   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             360   3e-112   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          360   3e-112   
ref|XP_006830579.1|  hypothetical protein AMTR_s00117p00135700          360   3e-112   
ref|NP_001043631.1|  Os01g0627400                                       361   3e-112   
ref|XP_010533180.1|  PREDICTED: cytochrome P450 734A1                   360   3e-112   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               361   3e-112   
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          360   3e-112   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          360   3e-112   
ref|XP_002455998.1|  hypothetical protein SORBIDRAFT_03g028690          360   4e-112   
ref|XP_011072254.1|  PREDICTED: cytochrome P450 734A1                   360   4e-112   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              360   4e-112   
dbj|BAJ99602.1|  predicted protein                                      360   5e-112   
ref|XP_002302479.1|  cytochrome P450 family protein                     359   6e-112   
emb|CDO98112.1|  unnamed protein product                                359   6e-112   
ref|XP_006473892.1|  PREDICTED: cytochrome P450 734A1-like              359   6e-112   
ref|XP_006856070.1|  hypothetical protein AMTR_s00059p00107930          359   6e-112   
ref|XP_009404407.1|  PREDICTED: cytochrome P450 CYP72A219-like          359   6e-112   
gb|AAK38092.1|  putative cytochrome P450                                359   6e-112   
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        359   9e-112   
ref|XP_010254323.1|  PREDICTED: cytochrome P450 734A1-like              359   9e-112   
gb|AAL60592.1|  cytochrome P450 monooxygenase CYP72A26                  359   1e-111   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          359   1e-111   
gb|KHN44056.1|  Secologanin synthase                                    358   1e-111   
gb|KGN51993.1|  hypothetical protein Csa_5G606830                       353   1e-111   
ref|XP_002281661.1|  PREDICTED: cytochrome P450 734A1                   358   2e-111   
ref|XP_011017306.1|  PREDICTED: cytochrome P450 734A1-like              359   2e-111   
gb|KHG16087.1|  Secologanin synthase                                    353   2e-111   
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    358   2e-111   
ref|XP_010667610.1|  PREDICTED: cytochrome P450 734A6 isoform X2        358   2e-111   
ref|XP_006841892.1|  hypothetical protein AMTR_s00042p00080860          358   2e-111   
gb|EAY74842.1|  hypothetical protein OsI_02734                          358   2e-111   
gb|EMT23021.1|  Secologanin synthase                                    357   3e-111   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              357   3e-111   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              357   3e-111   
ref|XP_008450912.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    357   3e-111   
gb|AJD25255.1|  cytochrome P450 CYP734A33                               357   3e-111   
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               357   3e-111   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          357   3e-111   
emb|CDJ26325.1|  unnamed protein product                                357   4e-111   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          357   4e-111   
gb|KCW44685.1|  hypothetical protein EUGRSUZ_L01779                     350   4e-111   
gb|KHG26068.1|  hypothetical protein F383_05868                         358   5e-111   
gb|AAK38094.1|  putative cytochrome P450                                357   5e-111   
emb|CDY04463.1|  BnaA07g12890D                                          357   6e-111   
ref|XP_004139422.1|  PREDICTED: cytochrome P450 734A1-like              357   6e-111   
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          357   6e-111   
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    357   6e-111   
ref|NP_001044129.1|  Os01g0728300                                       357   7e-111   
ref|XP_004169401.1|  PREDICTED: cytochrome P450 734A1-like              357   7e-111   
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    357   7e-111   
gb|AAK38093.1|  putative cytochrome P450                                357   7e-111   
gb|AAQ13548.1|AF123610_4  cytochrome P450                               357   8e-111   
ref|XP_008457893.1|  PREDICTED: cytochrome P450 734A1                   356   8e-111   
gb|KHG09430.1|  Secologanin synthase                                    351   8e-111   
ref|XP_011074600.1|  PREDICTED: cytochrome P450 734A1-like              356   9e-111   
gb|KEH38478.1|  cytochrome P450 family 72 protein                       356   9e-111   
gb|EAY75694.1|  hypothetical protein OsI_03601                          356   1e-110   
ref|XP_003566910.1|  PREDICTED: cytochrome P450 72A15-like              356   1e-110   
ref|XP_002455092.1|  hypothetical protein SORBIDRAFT_03g004210          356   1e-110   
gb|KHG14489.1|  Secologanin synthase                                    356   1e-110   
gb|ACN39923.1|  unknown                                                 353   1e-110   
ref|NP_001233940.1|  castasterone 26-hydroxylase                        355   2e-110   
ref|XP_010098361.1|  Secologanin synthase                               355   2e-110   
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          355   2e-110   
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    356   2e-110   
ref|XP_002455990.1|  hypothetical protein SORBIDRAFT_03g028570          357   2e-110   
emb|CDP15975.1|  unnamed protein product                                355   2e-110   
gb|AAQ13551.1|AF123610_7  cytochrome P450                               356   2e-110   
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          355   2e-110   
ref|XP_009103555.1|  PREDICTED: cytochrome P450 734A1                   355   2e-110   
gb|AAK38091.1|  putative cytochrome P450                                355   3e-110   
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               355   3e-110   
ref|XP_003569207.1|  PREDICTED: cytochrome P450 72A15-like              355   3e-110   
ref|XP_002308312.1|  hypothetical protein POPTR_0006s15940g             356   3e-110   
ref|XP_004287367.1|  PREDICTED: cytochrome P450 734A1-like              355   3e-110   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    355   4e-110   
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    357   4e-110   
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          355   4e-110   
ref|XP_004287619.1|  PREDICTED: secologanin synthase-like               353   5e-110   
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          354   5e-110   
gb|KEH38469.1|  cytochrome P450 family 709 protein                      354   5e-110   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     354   6e-110   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             354   7e-110   
ref|XP_004968389.1|  PREDICTED: cytochrome P450 734A6-like isofor...    354   7e-110   
ref|XP_003557757.2|  PREDICTED: cytochrome P450 72A14-like              355   7e-110   
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          355   7e-110   
emb|CAN60082.1|  hypothetical protein VITISV_019084                     353   8e-110   
gb|KHG18227.1|  Secologanin synthase                                    354   8e-110   
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          353   8e-110   
gb|KGN51994.1|  hypothetical protein Csa_5G606840                       349   9e-110   
ref|XP_004969230.1|  PREDICTED: secologanin synthase-like               354   1e-109   
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          353   1e-109   
ref|XP_004969239.1|  PREDICTED: secologanin synthase-like               353   1e-109   
ref|XP_009362707.1|  PREDICTED: cytochrome P450 CYP72A219-like          353   1e-109   
ref|XP_003562610.1|  PREDICTED: cytochrome P450 734A6-like              353   1e-109   
ref|XP_008656689.1|  PREDICTED: cytochrome P450 72A14-like              354   1e-109   
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    353   1e-109   
ref|XP_006644395.1|  PREDICTED: secologanin synthase-like               354   2e-109   
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    353   2e-109   
ref|XP_006341671.1|  PREDICTED: cytochrome P450 734A1-like              353   2e-109   
ref|XP_004969229.1|  PREDICTED: secologanin synthase-like               353   2e-109   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    352   2e-109   
emb|CAN60080.1|  hypothetical protein VITISV_019082                     352   2e-109   



>ref|XP_009607162.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana tomentosiformis]
Length=515

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/511 (76%), Positives = 453/511 (89%), Gaps = 1/511 (0%)
 Frame = +3

Query  48    ITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMR  227
             I   FL  ++ +YLLW +++L+   WW P +++  M  QGI GPPYSFPHGNTK+IS MR
Sbjct  6     IILIFLFSTLCLYLLWTIIKLLYLIWWMPLQIQNRMSFQGIKGPPYSFPHGNTKEISLMR  65

Query  228   SQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKE  407
             SQ+M KPM DISH+IF RIQPHV++W  +YG  FLTWHG+KPYLF+TEPELIKE+LANKE
Sbjct  66    SQTMDKPMMDISHYIFPRIQPHVYSWTRMYGRNFLTWHGSKPYLFVTEPELIKEILANKE  125

Query  408   GAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLE  587
              +YPKMD++ +AKKLLG+ALITNEGEKWAKVRKLANHTFHAESLKRMVPEM ASV+ MLE
Sbjct  126   DSYPKMDMEGYAKKLLGKALITNEGEKWAKVRKLANHTFHAESLKRMVPEMSASVQTMLE  185

Query  588   RWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFP  767
             +WKE EGK+ DVFKDFG+LTTEVISRTAFGSS++EGKHIF+MV+ LTAITVKN+YNV+FP
Sbjct  186   KWKEHEGKDFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFEMVAKLTAITVKNIYNVRFP  245

Query  768   GISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSD  947
             GISML R+ DEIEAEKLERGIK +ILELVRKREK  +G+ EN+G DYLGQLMK+     D
Sbjct  246   GISMLIRTDDEIEAEKLERGIKSSILELVRKREKVKDGMFENFGTDYLGQLMKL-LHEPD  304

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
              +K+I++DQMIDE+KALYGAGHLTTTSLLGW +FLLA H EWQEKAR+E+ E  G   PT
Sbjct  305   TNKSITIDQMIDEVKALYGAGHLTTTSLLGWSVFLLAHHPEWQEKARKEVFEFCGLRTPT  364

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
             SD I RLRTMNMILNECMRLYPPVIT+TRKVEREV+LG++T+PA++TIFMPILALHHDPQ
Sbjct  365   SDAITRLRTMNMILNECMRLYPPVITMTRKVEREVRLGSMTLPANMTIFMPILALHHDPQ  424

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
             IWG+DVH+F P RFA+GVAKATNNNAA+FFPFG+GPRTCVGLNFTTNEAKIALSMILQRY
Sbjct  425   IWGKDVHIFKPERFAKGVAKATNNNAASFFPFGLGPRTCVGLNFTTNEAKIALSMILQRY  484

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             KFTLSPNYVHYP+DIFILTPK+GV+V+L+++
Sbjct  485   KFTLSPNYVHYPSDIFILTPKDGVKVVLESI  515



>ref|XP_004239025.1| PREDICTED: cytochrome P450 CYP749A22-like [Solanum lycopersicum]
Length=515

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/512 (76%), Positives = 442/512 (86%), Gaps = 2/512 (0%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             +I  FF + ++  YLLW L++ V   WW P + +  M SQGI GP YSFPHGNTK IS M
Sbjct  6     LILVFFFS-TLCFYLLWTLLKFVYSVWWMPLQTQNKMNSQGIKGPSYSFPHGNTKDISLM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             RSQ+M KPM DISH IF+RIQPHVHTW  +YG  FLTWHG+KPYLF+TEPELIKEVL+NK
Sbjct  65    RSQTMDKPMIDISHDIFSRIQPHVHTWTRMYGRNFLTWHGSKPYLFVTEPELIKEVLSNK  124

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             E  YPKMD++ +AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEM  SV  ML
Sbjct  125   EDIYPKMDMEGYAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMSESVAEML  184

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             ERWKE EGKE DVFKDFG+LTTEVISRTAFGSS++EGKHIF+MV+ LTAITVKN+Y VKF
Sbjct  185   ERWKEHEGKEFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFEMVAKLTAITVKNLYTVKF  244

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGS  944
             PGIS L R+ DEIEAEKLERGIK +ILELV KREK  +G+ E +GNDYLGQLMK+    S
Sbjct  245   PGISWLIRTDDEIEAEKLERGIKNSILELVSKREKGKDGMYEKFGNDYLGQLMKL-LHES  303

Query  945   DISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
             D +K I++DQMIDE++ LYGAGHLTTTSLLGW +FLLALH EWQEKAR+E+    G E P
Sbjct  304   DTNKRITIDQMIDEVRTLYGAGHLTTTSLLGWSVFLLALHPEWQEKARKEVFLFCGLEKP  363

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
             TSD IARLRTMNMILNECMRLYPPVITVTRKVEREV+LG++T+P ++TIFMPILALHHDP
Sbjct  364   TSDAIARLRTMNMILNECMRLYPPVITVTRKVEREVRLGSMTLPGNMTIFMPILALHHDP  423

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
             QIWG+DVHVF P RFA+GVAKATNN AAAFFPFG+GPRTCVGLNFTTNE KI LSMILQR
Sbjct  424   QIWGEDVHVFKPERFAEGVAKATNNKAAAFFPFGLGPRTCVGLNFTTNETKITLSMILQR  483

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             YKFTLSPNYVHYP+DIF+LTPK+GV+V+L+++
Sbjct  484   YKFTLSPNYVHYPSDIFLLTPKDGVKVVLESI  515



>ref|XP_009762791.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana sylvestris]
Length=515

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/515 (74%), Positives = 451/515 (88%), Gaps = 2/515 (0%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             L  I   FF + ++ +YLLW +++ +   WW P +++  M  QGI GP YSFPHGNTK+I
Sbjct  3     LGGIFIIFFFS-TLCLYLLWTIIKFLYLVWWIPLQIQNRMSFQGIKGPLYSFPHGNTKEI  61

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
             S MRSQ+M KPM DISH+IF RIQPHV++W  +YG  FLTWHG+KPYLF+TEPELIKE+L
Sbjct  62    SLMRSQTMDKPMMDISHYIFPRIQPHVYSWTRMYGRNFLTWHGSKPYLFVTEPELIKEIL  121

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVE  575
             ANKE  YPKMD++ +AKKLLGEALITNEGEKWAKVRKLANHTFHAESLK MVPEM ASV+
Sbjct  122   ANKEDTYPKMDMEGYAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKHMVPEMSASVQ  181

Query  576   VMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYN  755
              MLE+WK+ EGKE DVFKDFG+LTTEVISRTAFGSS++EGKHIF+MV+ LTAITVKN+YN
Sbjct  182   TMLEKWKKHEGKEFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFEMVAKLTAITVKNIYN  241

Query  756   VKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITT  935
             V+FPGI ML R++DEIEAEKLERGIK +ILELVRKREK  +   EN+G DYLGQLMK+  
Sbjct  242   VRFPGIIMLIRTNDEIEAEKLERGIKSSILELVRKREKVKDRTFENFGTDYLGQLMKL-L  300

Query  936   GGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH  1115
               SD++K+I++DQMIDE+KAL+GAGHLTTTSLLGW +FLLA H EWQEKAR+E+LE  G 
Sbjct  301   HESDMNKSITIDQMIDEVKALFGAGHLTTTSLLGWSVFLLAHHPEWQEKARKEVLEFCGL  360

Query  1116  ENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALH  1295
             +NPTSD I RLRTMNMILNECMRLYP VIT+TRKV+REV+LG++T+PA++TIFMPILALH
Sbjct  361   KNPTSDAITRLRTMNMILNECMRLYPRVITMTRKVKREVRLGSMTLPANMTIFMPILALH  420

Query  1296  HDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMI  1475
             HDPQIWG+DVH+F P RFA+GVAKATNNNAAAFFPFG+GPRTCVGLNFTTNEAKIALSMI
Sbjct  421   HDPQIWGKDVHIFKPERFAEGVAKATNNNAAAFFPFGLGPRTCVGLNFTTNEAKIALSMI  480

Query  1476  LQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LQRYKFTLSPNYVH P DIFILTPK+GV+V+L+++
Sbjct  481   LQRYKFTLSPNYVHNPCDIFILTPKDGVKVVLESI  515



>emb|CDP00470.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/512 (71%), Positives = 441/512 (86%), Gaps = 4/512 (1%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             I+   F TF   IY+LW   R + + WW P R++++M SQGI GP Y FP+GNTK+I+NM
Sbjct  7     IMFCLFSTFL--IYILWTFFRFLHKVWWIPCRIKRIMSSQGISGPAYKFPYGNTKEITNM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             R+QSM KPM +ISH IF RIQPHV+ W +IYG  +++WHG++  LF+T+ E+IKEVL N+
Sbjct  65    RNQSMSKPM-EISHDIFQRIQPHVYLWTKIYGKNYISWHGSQAQLFVTDTEMIKEVLTNR  123

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             E AYPKMD++  AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEM ASVEVML
Sbjct  124   EDAYPKMDMEGIAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMSASVEVML  183

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             E WK  EGKE+D FK+FG+LTTEVI+RTAFGSS+ EGKHIF+MV+ LTAI V+NVY VKF
Sbjct  184   ENWKHHEGKEIDAFKEFGLLTTEVIARTAFGSSYREGKHIFEMVAKLTAIDVRNVYKVKF  243

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGS  944
             PGISML +SSDEIEAEKLERGIK +ILELV+KREK   G  E+   DYLG+LMK+T   +
Sbjct  244   PGISMLMKSSDEIEAEKLERGIKTSILELVKKREKGRKGETEDNAIDYLGELMKLTR-DT  302

Query  945   DISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
             +I+K I+L+QMIDEIKAL+GAGHLTTT+LLGWC F+L++H +WQEKAR+E+ E+FG++NP
Sbjct  303   NINKRITLEQMIDEIKALFGAGHLTTTNLLGWCAFVLSVHGDWQEKARKEVFEIFGNKNP  362

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
             +SDGIARL+TMNMI+NEC+RLYPPV+T+TRKV  EV+LGNL +P +I I++PILALHH+P
Sbjct  363   SSDGIARLKTMNMIINECLRLYPPVLTMTRKVGTEVRLGNLRLPTNINIYLPILALHHNP  422

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
             +IWG+DVH+F P RFA+GVAKATN+ AAAFFPFG+GPRTCVGLNFTTNEAKIALSMILQR
Sbjct  423   EIWGKDVHLFKPERFAEGVAKATNSTAAAFFPFGLGPRTCVGLNFTTNEAKIALSMILQR  482

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             YK TLSPNYVH+PADIFILTPK GVQVILQ +
Sbjct  483   YKLTLSPNYVHFPADIFILTPKYGVQVILQAI  514



>gb|EYU22576.1| hypothetical protein MIMGU_mgv1a004757mg [Erythranthe guttata]
Length=511

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/500 (70%), Positives = 423/500 (85%), Gaps = 5/500 (1%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             +YLL  L+R +++ W  P RL+  M SQG+ GPPY FPHGNTK+ISNMR QSM KP+ + 
Sbjct  17    LYLLHTLIRFLNKIWRNPIRLQTTMSSQGVKGPPYKFPHGNTKEISNMRIQSMSKPIDNF  76

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             SH IF RIQPHV+ W + YG  F+TWHG++  LFITEPE+IKEVL N+EGA+PKM+++ +
Sbjct  77    SHDIFPRIQPHVYAWTKAYGTKFVTWHGSQCQLFITEPEIIKEVLMNREGAFPKMEMEGY  136

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELD  620
             AKKLLGEALITNEGEKWAK+RKLANHTFHAESLK MVPEM  SV  MLE+WK  EG E+D
Sbjct  137   AKKLLGEALITNEGEKWAKIRKLANHTFHAESLKSMVPEMSYSVSKMLEKWKNYEGIEID  196

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDE  800
             VFK+FG+LTTEVISRTAFGSS+LEGKHIF+MV+NLTAITV+NVY VK PGISM+ +S DE
Sbjct  197   VFKEFGLLTTEVISRTAFGSSYLEGKHIFEMVANLTAITVRNVYKVKVPGISMILKSDDE  256

Query  801   IEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMI  980
             IEA++LE+ IK +ILE+ RKR +    +VEN G+DYLGQL+KI +  SD+ K I+++QMI
Sbjct  257   IEADRLEKKIKSSILEIARKRGE----LVENIGSDYLGQLVKI-SNESDLKKRITVEQMI  311

Query  981   DEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMN  1160
             DEIKA+YGAGHLTTTSLLGWC+FLLAL+TEWQEKAR E+   FG   P SDGIARL+ MN
Sbjct  312   DEIKAVYGAGHLTTTSLLGWCVFLLALNTEWQEKARDEVKRTFGDNKPDSDGIARLKIMN  371

Query  1161  MILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNP  1340
             MI+NECMRLYPPV+TVTRKV +E K+G L IP +I IF+ ILALHH+P+IWG+DVH+F P
Sbjct  372   MIINECMRLYPPVLTVTRKVAKEAKIGELIIPPNINIFVSILALHHNPKIWGKDVHLFRP  431

Query  1341  HRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHY  1520
              RF++GVAKATNNN AAF PFG+GPRTCVGLNFTTNEAKIAL+MILQ+Y+F LSPNYVH+
Sbjct  432   ERFSEGVAKATNNNGAAFLPFGLGPRTCVGLNFTTNEAKIALTMILQKYEFVLSPNYVHH  491

Query  1521  PADIFILTPKNGVQVILQNV  1580
             P D FILTPKNGVQVIL+ +
Sbjct  492   PTDAFILTPKNGVQVILKGI  511



>ref|XP_011070908.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=514

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/517 (66%), Positives = 432/517 (84%), Gaps = 5/517 (1%)
 Frame = +3

Query  33    ALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQ  212
             A+  +I  FF T  + +YLL  L++ + + WW P +L+  M SQGI GPPY FPHGNTK+
Sbjct  2     AVDRLILLFFST--MLLYLLQTLIKFLHKVWWGPVQLQAKMSSQGIRGPPYRFPHGNTKE  59

Query  213   ISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEV  392
             IS MR+QSM KPM  ISH IF RIQPHV+ W + YG  FL WHG++  LF+TEPELIKE+
Sbjct  60    ISYMRTQSMEKPM-AISHDIFPRIQPHVYAWTKAYGKNFLNWHGSECQLFVTEPELIKEI  118

Query  393   LANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASV  572
             L N++GA+PKMD+D +AKKLLGEALITNEGEKWAK+RKLANHTFHAESLKRMVP+M +S+
Sbjct  119   LMNRDGAFPKMDMDGYAKKLLGEALITNEGEKWAKIRKLANHTFHAESLKRMVPKMSSSI  178

Query  573   EVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVY  752
             E ML RWK  EGKE+DVFK+FG+LTTEVISRTAFG+ +++GKH F+MV+ LTA+TV+N+Y
Sbjct  179   EEMLGRWKNYEGKEIDVFKEFGLLTTEVISRTAFGNRYVDGKHTFEMVAKLTALTVRNIY  238

Query  753   NVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKI  929
              V+FPGISM+ +S DE+EA+KL++ IK +ILE+V+KRE    +G  +++G+DYLGQL+++
Sbjct  239   KVRFPGISMVLKSDDEVEAKKLQQRIKSSILEIVKKREINVKDGEFQSFGSDYLGQLVEM  298

Query  930   TTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELF  1109
             T   SD+ K I+ DQMIDEIKA+YGAGHLTTT+LLGWC+ LLA +TEWQ++AR E+   F
Sbjct  299   THE-SDVKKRITTDQMIDEIKAMYGAGHLTTTNLLGWCVLLLATNTEWQDRAREEVNRTF  357

Query  1110  GHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILA  1289
             G ++P SDGIARL+ +NM++NEC+RLYPPV+TVTRKV +E K+G L IP  I I++ ILA
Sbjct  358   GRKSPDSDGIARLKIINMVINECLRLYPPVLTVTRKVAKEAKIGELRIPPKINIYISILA  417

Query  1290  LHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALS  1469
             LHH+P+IWG+DVH+F P RFA+GVAKATNNN AAF PFG+GPRTCVGLNFTTNEAK+ALS
Sbjct  418   LHHNPEIWGKDVHLFRPERFAEGVAKATNNNTAAFLPFGLGPRTCVGLNFTTNEAKVALS  477

Query  1470  MILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             MILQ+YKF LSPNY H+PAD+FILTPK+GVQVIL+ +
Sbjct  478   MILQKYKFVLSPNYAHHPADVFILTPKHGVQVILETI  514



>ref|XP_006348799.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=423

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/423 (79%), Positives = 383/423 (91%), Gaps = 1/423 (0%)
 Frame = +3

Query  312   IYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKW  491
             I G  FLTWHG+KPYLF+TEPELIKE+L+NKE  YPKMD++ +AKKLLGEALITNEGEKW
Sbjct  2     IAGRNFLTWHGSKPYLFVTEPELIKEILSNKEDTYPKMDMEGYAKKLLGEALITNEGEKW  61

Query  492   AKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTA  671
             AKVRKLANHTFHAESLKRMVPEM  SV+ MLERWKE EGKE DVFKDFG+LTTEVISRTA
Sbjct  62    AKVRKLANHTFHAESLKRMVPEMSESVQKMLERWKEHEGKEFDVFKDFGLLTTEVISRTA  121

Query  672   FGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILEL  851
             FGSS++EGKHIF+MV+ LTAITVKNVY V+FPGIS L R+ DEIEAEKLERGIK +ILEL
Sbjct  122   FGSSYMEGKHIFEMVAKLTAITVKNVYTVRFPGISWLIRTDDEIEAEKLERGIKNSILEL  181

Query  852   VRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSL  1031
             V KREK  +G+ E +GNDYLGQLMK+    SD +K+I++DQMIDE++ LYGAGHLTTTSL
Sbjct  182   VSKREKGKDGMSEKFGNDYLGQLMKLL-HESDTNKSITIDQMIDEVRTLYGAGHLTTTSL  240

Query  1032  LGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVT  1211
             LGW +FLLALH EWQEKAR+E++   G ENPTSD IARLRTMNMI+NECMRLYPPVI VT
Sbjct  241   LGWSVFLLALHPEWQEKARKEVVAFCGLENPTSDAIARLRTMNMIINECMRLYPPVIIVT  300

Query  1212  RKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaa  1391
             RKVEREV+LG++T+PA++TIFMPILALHHDP+IWG+DVHVF P RFA+GVAKATNNNAAA
Sbjct  301   RKVEREVRLGSMTLPANMTIFMPILALHHDPRIWGEDVHVFKPERFAEGVAKATNNNAAA  360

Query  1392  FFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVIL  1571
             FFPFG GPRTCVGLNFTTNEAKI LSMILQRYKFTLSPNYVHYP+DIF+LTPK+GV+V+L
Sbjct  361   FFPFGSGPRTCVGLNFTTNEAKITLSMILQRYKFTLSPNYVHYPSDIFLLTPKDGVKVVL  420

Query  1572  QNV  1580
             +++
Sbjct  421   ESI  423



>gb|AJD25259.1| cytochrome P450 CYP749A37 [Salvia miltiorrhiza]
Length=508

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/505 (58%), Positives = 385/505 (76%), Gaps = 10/505 (2%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
              S  L +  +R + + W  P RL+   RSQGI GP Y FPHGNTK+IS MRSQ   KPM 
Sbjct  11    CSTLLCFCFLRFLHKIWVAPTRLQAKWRSQGIRGPSYKFPHGNTKEISYMRSQFFDKPM-  69

Query  255   DISHHI---FARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKM  425
             DISH++   F R+ PHV+ W ++YG  F+ WHG+K  LF+TE EL KE+L N++ A+ KM
Sbjct  70    DISHYVHDLFPRLHPHVYAWTKVYGRNFICWHGSKCQLFVTEVELSKEILMNRDDAFRKM  129

Query  426   DLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELE  605
             D++ + +KLLGEAL TNEG+KWAKVRKLA+ +FH+ESL  MVPEM +SV  ML++W   +
Sbjct  130   DMEGYLRKLLGEALTTNEGQKWAKVRKLADRSFHSESLNSMVPEMRSSVAKMLDKWGSYQ  189

Query  606   GKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLT  785
             G+E+DVFK+FG+LT EVISRTAFGSS ++GKHIF+M   L A+  KN++ V+ PGIS++ 
Sbjct  190   GREIDVFKEFGMLTIEVISRTAFGSSCMDGKHIFEMKEKLAALAAKNLHKVRVPGISLVV  249

Query  786   RSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNIS  965
             RS DE+EAE+LE+ I G+I+E VR+RE+E        G+DYLGQL++I+   SD+ K I+
Sbjct  250   RSDDEVEAERLEQRINGSIMEKVREREREGE-----LGSDYLGQLIRISHE-SDVKKRIT  303

Query  966   LDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIAR  1145
               Q+IDE+KA+YGAG+ TTTSLLGWC+ LLA HTEWQ++AR E+ E FG   P  +GIAR
Sbjct  304   RHQLIDEVKAIYGAGNYTTTSLLGWCVVLLATHTEWQDRAREEVKETFGGNIPDFEGIAR  363

Query  1146  LRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDV  1325
             L+ MNMI+NEC+RLYPP +++TR V +E K+G L +  +  IF+ +LALHH+P+IWG DV
Sbjct  364   LKIMNMIINECLRLYPPALSLTRTVAKETKIGQLCLFPNTNIFISVLALHHNPRIWGDDV  423

Query  1326  HVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSP  1505
             H+F P RFA GV +AT+NNAAAF PFG+GPRTCVGLNF+TNEAKIALSMIL  YKF LSP
Sbjct  424   HLFKPERFAHGVVEATHNNAAAFIPFGIGPRTCVGLNFSTNEAKIALSMILHNYKFVLSP  483

Query  1506  NYVHYPADIFILTPKNGVQVILQNV  1580
             NYVH P +  IL P+NG+QVIL+ +
Sbjct  484   NYVHCPIENIILVPRNGIQVILEKI  508



>sp|H2DH17.1|C7A22_PANGI RecName: Full=Cytochrome P450 CYP749A22; AltName: Full=Cytochrome 
P450 CYP749A20 [Panax ginseng]
 gb|AEY75214.1| cytochrome P450 CYP749A20 [Panax ginseng]
Length=524

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/507 (58%), Positives = 386/507 (76%), Gaps = 4/507 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             FL  S+ ++LL+  +R ++  WWTP RL++V R QGI GP Y F +GNTK+I NMR +SM
Sbjct  18    FLLSSLCVFLLFVFIRFLNDIWWTPIRLQRVFRQQGIRGPSYGFLYGNTKEILNMRKESM  77

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              +PM  +SH+IF R+QPH+++W  IYG  FL W+G +    +T+ + +KE +  K+ AYP
Sbjct  78    SRPMDYLSHNIFPRLQPHLYSWLNIYGKNFLNWYGPRAQFVVTQVDFVKETMI-KDQAYP  136

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             KMD + FAKKLLG+ ++T++G+KWAK R+LANH FHAESLK M P MIASVE+ML+RWK+
Sbjct  137   KMDPEWFAKKLLGDGIVTSKGKKWAKHRRLANHAFHAESLKSMTPAMIASVEMMLKRWKQ  196

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EG+E+DVF++F +LT+EVISRTAFGSS+L+GK IF  ++ L  I  +N Y VK PGIS+
Sbjct  197   HEGREIDVFQEFKILTSEVISRTAFGSSYLDGKDIFDRLTQLGIIITRNSYKVKLPGISL  256

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKES--NGVVENYGNDYLGQLMKITTGGSDIS  953
               +S+DEIEAEKL++G+  +IL ++ KREKES  +G V ++G D+LG LMK     +D  
Sbjct  257   FYKSNDEIEAEKLDQGLYDSILRIMEKREKESTMSGEVGSFGTDFLGLLMK-AMNDADEK  315

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
               I+   ++DE K  Y AG  TTT+LL W IFLL +HT+WQEKAR+E+L LFG E P SD
Sbjct  316   NRITAQDVVDECKTFYVAGQETTTTLLAWVIFLLGIHTDWQEKARQEVLNLFGQEIPNSD  375

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             G+A+L+T+NMI+NE +RLYPPVI +TRKV+ E K G LT+PA++ I +P LALHHD QIW
Sbjct  376   GLAKLKTVNMIINETLRLYPPVIFLTRKVKEETKFGKLTLPANVHIVVPTLALHHDEQIW  435

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G D  +F P RF+QGVAKATNNNAAAFFPFG+GPR+CVGLNF TNEAKIAL+MILQ Y F
Sbjct  436   GDDALLFKPERFSQGVAKATNNNAAAFFPFGLGPRSCVGLNFATNEAKIALAMILQCYSF  495

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
              LSP Y+H P  I  + P++G+QV+LQ
Sbjct  496   ALSPTYIHSPVQILTVRPQHGLQVMLQ  522



>ref|XP_009356447.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/514 (56%), Positives = 389/514 (76%), Gaps = 8/514 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             II A FL     ++L+  L++++ + WWTP R+RK+M SQGI GPPY   HGNTK+IS+M
Sbjct  9     IIFASFL----CLFLILGLIKILHKIWWTPTRIRKLMASQGIRGPPYRLIHGNTKEISDM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             R + MG+P   +SH + + +QP++HTW +IYG  +L WHG+   L ITE EL KE+L NK
Sbjct  65    RKEVMGRPQI-LSHDVLSVVQPNMHTWIKIYGKNYLQWHGSTAQLVITETELCKEILNNK  123

Query  405   EGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             + AYPK D  +F KKLLG+ L  T E EKW K+RKLA H FH E+LK M+PEM+AS E M
Sbjct  124   DRAYPKADTPNFVKKLLGDGLAATTEAEKWGKLRKLATHAFHGETLKSMIPEMVASAEAM  183

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERWK  EGKE++V+++F + T+EVISRTAFGSS++EGK+IF+M+  L+++  KN + V+
Sbjct  184   LERWKFFEGKEIEVYEEFRLFTSEVISRTAFGSSYIEGKNIFEMLMKLSSLLFKNAFKVR  243

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTG  938
              PGIS   ++SDEIE++KLE+ +   I+E+V+KRE K      +++G+D+LG L+K    
Sbjct  244   VPGISKFFKTSDEIESDKLEKEVHATIIEIVKKRENKAGTEEKDSFGSDFLGLLLKARHS  303

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D ++ IS+D++IDE K  Y AG  TT +LLGW +FLLAL+T+WQE+AR+E+++LFG +
Sbjct  304   AND-NQRISVDELIDECKTFYFAGQETTNTLLGWTVFLLALNTDWQEEARKEVIQLFGKQ  362

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P  DGIA++RTMNMI+NEC+RLY P + +TRKVEREVKLG L +PA++ + +  +ALHH
Sbjct  363   TPNHDGIAKMRTMNMIINECLRLYTPAVYLTRKVEREVKLGKLIVPANLELVISTIALHH  422

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQIWG+DVH+F P RF++GV KATNNN  AF PFG+G RTCVGLNF+T EAKIALSMIL
Sbjct  423   DPQIWGKDVHLFKPDRFSEGVLKATNNNVGAFIPFGLGTRTCVGLNFSTTEAKIALSMIL  482

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY FTLSP+YVH P     + P +GVQVIL ++
Sbjct  483   QRYSFTLSPSYVHLPLHYVTVRPYHGVQVILHSL  516



>ref|XP_008243806.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/511 (54%), Positives = 382/511 (75%), Gaps = 4/511 (1%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
             A  L+ SV ++L   L+++  + WW PR ++++M  QGI GP Y   HGNTK+I NM+++
Sbjct  8     AIILSSSVCLFLFLALIKIFHKLWWKPRSIQRLMALQGIKGPAYRLVHGNTKEIFNMQNE  67

Query  234   SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGA  413
             +MGKP   +SH IF R+QPH H+W ++YG  FL W+G +P L ITEPEL KE+L +K+ A
Sbjct  68    AMGKPQ-GLSHDIFPRVQPHFHSWTKLYGKNFLQWYGLRPQLIITEPELCKEILNDKDRA  126

Query  414   YPKMDLDDFAKKLLGEALITNEG-EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLER  590
             YPK     F K+LLG+ L+T    EKW K+RK+AN+ FH ESLK M P  IAS E+MLER
Sbjct  127   YPKSKPKSFVKQLLGDGLVTTTNTEKWGKLRKVANYAFHGESLKSMTPATIASAEIMLER  186

Query  591   WKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG  770
             WK  +GKE+++F++F +LT+EVISRTAFGSS+LEG+ IF+M+  L+ ++ KN   ++ PG
Sbjct  187   WKNQDGKEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFEMLMKLSFLSFKNFLKLRIPG  246

Query  771   ISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSD  947
             IS   ++ DEIE+E LE+G+  +I+E+V+KREK++  G  + +G+D+LG L+K     +D
Sbjct  247   ISKFYKTCDEIESENLEKGVYNSIMEIVKKREKKAMAGEEDGFGSDFLGLLLKAHHDAND  306

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
              +++IS+D ++DE K  Y  G  T++SLL W +FLLA+HT+WQE+AR+E+LE+FG +NP 
Sbjct  307   -NQSISVDDLVDECKTFYFGGQETSSSLLAWTVFLLAIHTDWQEEARKEVLEIFGKQNPN  365

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
             +DGIARL+TM MI+NE +RLYPP++ + R+ EREV+LGNL IPA + + +P LA HH+P 
Sbjct  366   TDGIARLKTMTMIINETLRLYPPIVVLEREAEREVRLGNLIIPAAVELVIPCLAFHHEPG  425

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
             +WGQDVH+F P RF++GVAKAT NN A F PFGMGPR CVGLNF TNE KI LSMILQRY
Sbjct  426   LWGQDVHLFKPERFSEGVAKATKNNIATFLPFGMGPRNCVGLNFATNEVKIVLSMILQRY  485

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              FTLSP YVH P  +  + P++G+QV+L ++
Sbjct  486   SFTLSPAYVHSPFRLLTVRPQHGLQVMLHSL  516



>ref|XP_007221838.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
 gb|EMJ23037.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
Length=516

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 383/511 (75%), Gaps = 4/511 (1%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
             A  L+ SV ++L   L+++  + WW P  ++++M  QGI GP Y   HGNTK+I NM+++
Sbjct  8     AIILSSSVCLFLFLALIKIFHKLWWKPTSIQRLMALQGIKGPAYRLVHGNTKEIFNMQNE  67

Query  234   SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGA  413
             +MGKP   +SH IF+R+QPH H+W ++YG  FL W+G +P L ITEPEL KE+L +K+ A
Sbjct  68    AMGKPR-GLSHDIFSRVQPHFHSWTKLYGKNFLQWYGLRPQLIITEPELCKEILNDKDRA  126

Query  414   YPKMDLDDFAKKLLGEALITNEG-EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLER  590
             Y K     F K+LLG+ L+T    EKW K+RK+AN+ FH ESLK M P  IAS E+MLER
Sbjct  127   YTKSKPKSFVKQLLGDGLVTTTNIEKWGKLRKVANYAFHGESLKSMTPATIASAEIMLER  186

Query  591   WKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG  770
             WK  +GKE+++F++F +LT+EVISRTAFGSS+LEG+ IF+M+  L+ ++ KN+  ++ PG
Sbjct  187   WKNQDGKEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFEMLMKLSFLSFKNILKLRIPG  246

Query  771   ISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSD  947
             IS   ++ DEIE+E LE+G+  +I+E+V+KREK++  G  + +G+D+LG L+K     +D
Sbjct  247   ISKFYKTCDEIESENLEKGVYNSIIEIVKKREKKAMAGEEDGFGSDFLGLLLKAYHDAND  306

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
              ++ IS+D ++DE K  Y  G  T+ SLL W +FLLA+HT+WQE+AR+E+LE+FG +NP 
Sbjct  307   -NQRISVDDLVDECKTFYFGGQETSNSLLAWTVFLLAIHTDWQEEARKEVLEIFGKQNPN  365

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
             +DGIARL+TM+MI+NE +RLYPP++++ RKVEREV+LG L +PA++ IF+P LA+HH+PQ
Sbjct  366   TDGIARLKTMSMIINESLRLYPPIVSIARKVEREVRLGKLIVPANVEIFIPSLAIHHEPQ  425

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
             +WG+DVH+F P RF++G+AKAT    AAF PFGMGPR CVGL++ T EAKI LSMILQRY
Sbjct  426   LWGEDVHLFKPERFSEGIAKATEKRIAAFLPFGMGPRNCVGLDYATTEAKIVLSMILQRY  485

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              FTLSP YVH P     + P++G QVIL ++
Sbjct  486   SFTLSPAYVHSPLQYITVRPQHGAQVILHSL  516



>ref|XP_011070909.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=510

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/509 (54%), Positives = 372/509 (73%), Gaps = 6/509 (1%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
                L  S+ IY+L  L+ L+ + W  P R++ +MRSQGI GP Y F HGNTK+I +M+ +
Sbjct  8     VILLASSLFIYILLTLIGLIKKVWLNPIRVQHLMRSQGINGPSYRFLHGNTKEIISMKRE  67

Query  234   SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGA  413
             +MGK M +ISH IF R+ PHVH+W ++YG  FL W+G +  L +TE EL+KE+L NK+  
Sbjct  68    TMGKAMDEISHDIFPRVLPHVHSWAKLYGANFLNWYGPQAQLVVTEAELVKEILNNKDEN  127

Query  414   YPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERW  593
             YPK+DL+ +AKKLLG+ L +++G+KWA++RKLAN  FHAESLK M+P MI SVE MLE+W
Sbjct  128   YPKIDLEGYAKKLLGDGLSSSKGQKWARMRKLANSVFHAESLKNMIPAMITSVETMLEKW  187

Query  594   KELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGI  773
             KE E KE++VF++F +LT+E+ISRTA GSS++EGK+IF M+  LT I  +N + +KFPGI
Sbjct  188   KEYEDKEIEVFEEFRILTSEIISRTALGSSYMEGKNIFDMLMKLTLIVSRNAHKIKFPGI  247

Query  774   SMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDIS  953
             S+  RS DEIE+EKL +GI+  +++++ KRE       E +  D+LG+L++     +D  
Sbjct  248   SLFLRSKDEIESEKLGQGIRDCVVQIITKRE-----TGETFRTDFLGKLLE-ANQDTDER  301

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             K IS++ + DE K  Y AGH T+TS L W I LL++H EWQ+KAR E++ELFG   P  D
Sbjct  302   KRISVEDITDECKTFYFAGHETSTSSLAWTILLLSVHQEWQDKARNEVIELFGQSKPNPD  361

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             GIARL+ + MI+ E +RLY PV  + RKVE+EVKLG LT+P    +++  LALHHDP IW
Sbjct  362   GIARLKILTMIIEESLRLYCPVPAIKRKVEKEVKLGKLTLPPQTELYISQLALHHDPNIW  421

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G+DVH+F P RF QG+ KATNNN  AF PFG GPRTCVGLNF   EAKIALSMILQRY+ 
Sbjct  422   GEDVHLFRPERFEQGIVKATNNNPVAFLPFGFGPRTCVGLNFAMTEAKIALSMILQRYRL  481

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              LSP Y+H P  +F++ P++GVQVILQ +
Sbjct  482   ILSPTYIHSPVQVFMVRPQHGVQVILQKI  510



>ref|XP_007222985.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
 gb|EMJ24184.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
Length=516

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/519 (54%), Positives = 386/519 (74%), Gaps = 9/519 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  I+++F     + + L+   ++++ + WWTP R++K+M  QGI GP Y F HGNTK
Sbjct  5     GGLIVILSSF-----LCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIHGNTK  59

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM+ + MG+P   +SH I + +QPH+H+W +IYG  +L WHG +  L ITEPEL KE
Sbjct  60    EISNMKKEVMGRPQL-LSHDILSVVQPHIHSWTKIYGKNYLQWHGCRAQLVITEPELCKE  118

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +L NK+ AY K +  + AKKLLG+ L+ T E EKWAK+RKLA H FH ESLK M+PEM+A
Sbjct  119   ILNNKDRAYQKREPTNIAKKLLGDGLVVTTEAEKWAKLRKLATHAFHGESLKSMIPEMVA  178

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E MLERW   EGKE++V+++F + T+EVISRTAFGSS++EG+ IF+++  L  +  KN
Sbjct  179   SAESMLERWTVYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQDIFEILMKLGFLIFKN  238

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLM  923
                V+ PGIS   ++SDEIE+EKLE+GI  +I+E+V+KREK++  G  +++G+D+LG L+
Sbjct  239   FLKVRVPGISKFFKTSDEIESEKLEKGIHASIIEMVKKREKKTMGGEKDSFGSDFLGLLL  298

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K     ++ ++ IS+ ++IDE K  Y AG  TT +LL W +FLLALHT+WQE+AR+E+L+
Sbjct  299   KANHEANE-NQRISVQEIIDECKTFYFAGQETTNTLLAWTVFLLALHTDWQEEARKEVLQ  357

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG + P  DGI +L+TM+MI+NE +RLYPP ++V R VEREV+LG L +P+++ + + I
Sbjct  358   LFGKQTPNLDGIGKLKTMSMIINEALRLYPPAVSVIRNVEREVRLGKLIVPSNLDVVVSI  417

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             +A+HHDPQIWGQDV +F P RF++GVAKATNNN  AF PF MGPRTCVGLNF   EAKIA
Sbjct  418   VAVHHDPQIWGQDVQLFKPERFSEGVAKATNNNIGAFLPFSMGPRTCVGLNFAITEAKIA  477

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSMILQRY FTLSP YVH P     + P++GVQV+L ++
Sbjct  478   LSMILQRYAFTLSPGYVHLPLHYLTVRPQHGVQVMLHSL  516



>ref|XP_007226531.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
 gb|EMJ27730.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
Length=516

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/511 (53%), Positives = 380/511 (74%), Gaps = 4/511 (1%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
             A  L+ SV ++L   L+++  + WW P  ++++M  QGI GP Y   HGNTK+I NM+++
Sbjct  8     AIILSSSVCLFLFLVLIKIFHKLWWKPTSIQRLMALQGIKGPAYRLVHGNTKEIFNMQNE  67

Query  234   SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGA  413
             +MGKP   +SH IF+R+QPH H+W ++YG  FL W+G +P L ITEPEL KE+L +K+ A
Sbjct  68    AMGKPK-GLSHDIFSRVQPHFHSWTKLYGKNFLQWYGLRPQLIITEPELCKEILNDKDRA  126

Query  414   YPKMDLDDFAKKLLGEALITNEG-EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLER  590
             YPK     F K+LLG+ L+T    EKW K+RK+AN  FH ESLK M P  IAS E+MLER
Sbjct  127   YPKSKPKSFVKQLLGDGLVTTTNIEKWGKLRKVANFAFHGESLKSMTPATIASAEIMLER  186

Query  591   WKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG  770
             WK  +GKE+++F++F +LT+EVISRTAFGSS+LEG+ IF+M+  L+ ++ KN+  ++ PG
Sbjct  187   WKNQDGKEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFEMLMKLSFLSFKNILKLRIPG  246

Query  771   ISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSD  947
             IS   ++ DEIE+E LE+GI  +I+E+V+KR K++  G  + +G+D+LG L+K     +D
Sbjct  247   ISKFYKTCDEIESENLEKGIYNSIIEIVKKRGKKAMAGEEDGFGSDFLGLLLKAHHDAND  306

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
              ++ IS+D ++DE K  Y AG  T++SLL W +FLLA+HT+WQE+AR+E+LE+FG +NP 
Sbjct  307   -NQRISVDDLVDECKTFYLAGQETSSSLLAWTVFLLAIHTDWQEEARKEVLEIFGKQNPN  365

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
             +DGIARL+TM MI+NE +RLYPP++ + R+ EREV+LGNL IPA + + +P LA HH+P 
Sbjct  366   TDGIARLKTMTMIINETLRLYPPIVVLEREAEREVRLGNLIIPATVELVIPCLAFHHEPG  425

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
              WGQDVH+F P RF++GVAKAT NN A F PFGMGPR CVGLNF TNE KI LSMILQRY
Sbjct  426   FWGQDVHLFKPERFSEGVAKATKNNIATFLPFGMGPRNCVGLNFATNEVKIVLSMILQRY  485

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              FTLSP YVH P  +  + P++G+Q++L ++
Sbjct  486   SFTLSPAYVHSPFRLLTVRPQHGLQIMLHSL  516



>ref|XP_004303121.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/516 (54%), Positives = 380/516 (74%), Gaps = 10/516 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  II+  F   ++       L + + + WWTP R++K+M SQGI GPPY   HGNTK
Sbjct  5     GGLVVIISVLFCFVAL-------LFKTLHKIWWTPNRIQKLMASQGIRGPPYRLIHGNTK  57

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM  ++  +P+  +SH+IFA ++PHV +W +IYG  +L WHG+   L I EPEL K+
Sbjct  58    EISNMHKEARSRPL-GLSHNIFAYVEPHVDSWSKIYGKNYLQWHGSGAQLVIREPELCKQ  116

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIAS  569
             +L NK+GAYPK   +DFAKKLLG  L+T E EKW K+RK++NH FH ESLK M+P+MIA 
Sbjct  117   ILNNKDGAYPKKPPEDFAKKLLGYGLVTAEAEKWVKLRKISNHAFHGESLKTMIPDMIAG  176

Query  570   VEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNV  749
              E+MLERW+  EGKE++VF++F + T++VISRTAFGSS+LEG+HIF+M+  LT +  KN 
Sbjct  177   TEIMLERWRNYEGKEIEVFEEFRLFTSDVISRTAFGSSYLEGQHIFEMLMKLTLLLFKNS  236

Query  750   YNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMK  926
               +K PGIS    +SDEIE+EKLE+ I+ +I+ELV+KRE K ++G   ++G+D+LG L+K
Sbjct  237   LKIKVPGISKFFDTSDEIESEKLEKEIRDSIIELVKKREHKATSGEENSFGSDFLGSLLK  296

Query  927   ITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILEL  1106
                  ++ ++ IS+D ++D+ K  Y AG  TT +L+ W +FLLA HT+WQE+AR+E+L+L
Sbjct  297   -AHHDANQNQRISVDDLVDDCKTFYFAGQETTNTLIAWTVFLLAHHTDWQEEARKEVLQL  355

Query  1107  FGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPIL  1286
             FG ENP  DGI++L+TM+MILNE +RLYPP++ + R   REV+LG L +PA++ + + +L
Sbjct  356   FGKENPHPDGISKLKTMSMILNESLRLYPPIVGIPRNTGREVRLGKLIVPANVDLLVSVL  415

Query  1287  ALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIAL  1466
             A HH+PQ WG DVH+F P RF+ GV KATNNN  AF PFG+GPRTCVG+NF T EAKIAL
Sbjct  416   APHHEPQFWGPDVHIFKPERFSGGVVKATNNNGGAFVPFGIGPRTCVGMNFATIEAKIAL  475

Query  1467  SMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             SMILQRY FTLSP Y+H P     L P+ G+QV+LQ
Sbjct  476   SMILQRYSFTLSPAYIHSPTHKITLRPQYGLQVLLQ  511



>ref|XP_008243779.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/519 (54%), Positives = 388/519 (75%), Gaps = 9/519 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  I+++F     + + L+   ++++ + WWTP R++K+M  QGI GP Y F HGNTK
Sbjct  5     GGLIIILSSF-----LCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIHGNTK  59

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM+ + M +P   +SH I + +QPH+H+W + YG  +L WHG++  L ITEPEL K+
Sbjct  60    EISNMKKEVMDRPQI-LSHDILSVVQPHIHSWTKKYGKNYLQWHGSQAQLVITEPELCKQ  118

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +L NK  AYPK +  +  KKL+G+ L+ T + EKWAK+RKLA H FH E LK M+PEMIA
Sbjct  119   ILNNKGSAYPKREPPNLVKKLVGDGLVATTKAEKWAKLRKLATHAFHGEGLKSMIPEMIA  178

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E MLERW   EGKE++V+++F + T+EVISRTAFGSS++EG++IF+M+  L  +  KN
Sbjct  179   SAETMLERWTFYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQNIFEMLMKLGFLIAKN  238

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLM  923
                V+ PGIS   ++SDEIE++KLE+GI  +I+E+ +KREK++  G ++++G+D+LG L+
Sbjct  239   FLKVRVPGISKFFKTSDEIESDKLEKGIHASIIEMAKKREKKTMAGEMDSFGSDFLGLLL  298

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K     ++ ++ IS+D++ DE K  Y AG  TT +LL W +FLLALHT+WQE+AR+E+L+
Sbjct  299   KANHETNE-NQGISVDELTDECKTFYFAGQETTNTLLSWTVFLLALHTDWQEEARKEVLQ  357

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG + P  DGI +L+TM+MI+NE +RLYPPV++V RKVEREV+LG L +P ++ + + I
Sbjct  358   LFGKQTPNLDGIGKLKTMSMIINEALRLYPPVVSVIRKVEREVRLGKLIVPGNLELIVSI  417

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             +ALHHDPQIWGQDV +F P RF++GVAKATNN+  AF PFG+GPRTCVGLNF T EAKIA
Sbjct  418   VALHHDPQIWGQDVQLFKPERFSEGVAKATNNHVGAFIPFGLGPRTCVGLNFGTTEAKIA  477

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSMILQRY FTLSP YVH P     + P++GVQV+LQ++
Sbjct  478   LSMILQRYAFTLSPGYVHLPLRYLTVRPQHGVQVMLQSL  516



>ref|XP_008350887.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=518

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/490 (55%), Positives = 369/490 (75%), Gaps = 4/490 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+ K+M SQGI GPPY F HGNTKQI+ MR ++M KP  D+SH I + +QPH+
Sbjct  31    KLWWTPTRISKLMASQGIRGPPYRFIHGNTKQIATMRKEAMSKPK-DLSHDILSVVQPHM  89

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALI-T  473
             H+W  IYG  +L WHGT+    ITEPEL KE+L NK+ AYPK ++  F +KLLG+ L+ T
Sbjct  90    HSWIMIYGKNYLQWHGTRAQFVITEPELCKEILNNKDRAYPKREVQGFVRKLLGDGLVST  149

Query  474   NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTE  653
              EGEKW K+RK+ANH FH ESLK M  EM+AS E MLERWK+ +GKE++VF +  + ++E
Sbjct  150   TEGEKWGKLRKIANHAFHGESLKSMFSEMVASAETMLERWKDYDGKEIEVFGELKLFSSE  209

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VISRTAFGSS++EGK+IF+M++N+  +  KN   ++ PGIS   ++ DEIEAEKLE+ + 
Sbjct  210   VISRTAFGSSYIEGKNIFEMLNNIGFLIFKNALTIRIPGISKFLKTRDEIEAEKLEKAVH  269

Query  834   GAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAG  1010
              +I+E+VRKRE+++  G  +++G+D+LG L+K     +D  + IS+D ++DE K  Y AG
Sbjct  270   ASIVEIVRKREEKAMTGGEDSFGSDFLGLLLKAYHDSND-DQRISVDDLVDECKTFYFAG  328

Query  1011  HLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLY  1190
               T  +LL W +FLLALHT+WQE+AR+E++ LFG + P  DGIA+++ M+MI+NE +RLY
Sbjct  329   QETANTLLAWTVFLLALHTDWQEEARKEVIRLFGKQTPNHDGIAKMKRMSMIINESLRLY  388

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
              P +++TRKVEREV+LG L +PA++ + +  +A+HHDPQIWG+DV +F P RF++GVAKA
Sbjct  389   TPPVSITRKVEREVRLGQLIVPANVDLVISTIAIHHDPQIWGKDVQLFKPDRFSEGVAKA  448

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
             TNNN   F PFG+GPRTCVGLNF T EAKIALSMILQR+ FTLSP Y+H P       P+
Sbjct  449   TNNNVGVFIPFGLGPRTCVGLNFATTEAKIALSMILQRFSFTLSPGYIHSPLHYLTCRPQ  508

Query  1551  NGVQVILQNV  1580
             +GVQV+L ++
Sbjct  509   HGVQVMLHSL  518



>ref|XP_007223137.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
 gb|EMJ24336.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
Length=516

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/519 (53%), Positives = 389/519 (75%), Gaps = 9/519 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  I+++F     + + L+   ++++ + WWTP R++K+M  QGI GP Y F HGNTK
Sbjct  5     GGLIIILSSF-----LCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIHGNTK  59

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM+ + M +P   +SH I + +QPH+H+W + YG  +L WHG++  L ITEPEL K+
Sbjct  60    EISNMKKEVMDRPQI-LSHDILSVVQPHIHSWTKKYGKNYLQWHGSQAQLVITEPELCKQ  118

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +L NK  AYPK +  +  KKL+G+ L+ T + EKWAK+RKLA H FH + LK M+PEM+A
Sbjct  119   ILNNKGSAYPKREPPNLVKKLVGDGLVATTKAEKWAKLRKLATHAFHGDGLKSMIPEMVA  178

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E MLERW   EGKE++V+++F + T+EVISRTAFGSS++EG++IF+M+  L  +   N
Sbjct  179   SAETMLERWTFYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQNIFEMLMKLGFLIANN  238

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLM  923
                V+ PGIS   ++SDEIE++KLE+GI  +I+E+ +KREK++  G ++++G+D+LG L+
Sbjct  239   FLKVRVPGISKFFKTSDEIESDKLEKGIHASIIEMAKKREKKTMAGEMDSFGSDFLGLLL  298

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K     ++ ++ IS+D++IDE K  Y AG  TT +LL W +FLLALHT+WQE+AR+E+L+
Sbjct  299   KANNEANE-NQGISVDELIDECKTFYFAGQETTNTLLSWTVFLLALHTDWQEEARKEVLQ  357

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG + P  DGI +L+TM+MI+NE +RLYPPV++V RKVEREV+LG L +P+++ + + I
Sbjct  358   LFGKQTPNLDGIGKLKTMSMIINEALRLYPPVVSVIRKVEREVRLGKLIVPSNLELIVSI  417

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             ++LHHDPQIWGQDV +F P RF++GVAKATNN+  AF PFG+GPRTCVGLNF T EAKIA
Sbjct  418   VSLHHDPQIWGQDVQLFKPERFSEGVAKATNNHVGAFIPFGLGPRTCVGLNFGTTEAKIA  477

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSMILQRY FTLSP YVH P     + P++GVQV+LQ++
Sbjct  478   LSMILQRYAFTLSPGYVHLPLRYLTVRPQHGVQVMLQSL  516



>ref|XP_007226460.1| hypothetical protein PRUPE_ppa024660mg [Prunus persica]
 gb|EMJ27659.1| hypothetical protein PRUPE_ppa024660mg [Prunus persica]
Length=518

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/491 (57%), Positives = 365/491 (74%), Gaps = 4/491 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM-FDISHHIFARIQPH  293
             + W  P RL+K+M  QGI GPPY   HGNTK ISNM  ++M KP     SH I + +QPH
Sbjct  29    KLWLAPARLQKLMALQGIKGPPYRLIHGNTKDISNMIKEAMSKPKSLSSSHDILSVVQPH  88

Query  294   VHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALIT  473
             VH+W +IYG  +L WHG++  L ITEPEL KE+L NK+ AYPK   + F KKLLG+ L+T
Sbjct  89    VHSWTKIYGKNYLQWHGSEAQLVITEPELCKEILNNKDKAYPKRVPESFVKKLLGDGLVT  148

Query  474   N-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTT  650
               EGEKWAK+R+LA H FH ESLK M+P M+AS E MLERWK  EGKE++VF++F   T+
Sbjct  149   TAEGEKWAKMRRLATHAFHGESLKSMIPAMVASAETMLERWKNYEGKEIEVFEEFRFFTS  208

Query  651   EVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGI  830
             EVISRTAFGSS++EG+HIF+M+  L  +  KN + ++ PGIS L ++ DEIE+EKLE+ +
Sbjct  209   EVISRTAFGSSYIEGQHIFEMLMKLGFLLTKNSFTIRVPGISKLFKTGDEIESEKLEKDV  268

Query  831   KGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGA  1007
             + +ILE+VRKRE K   G  +++G+D+LG L+K     +D S+ IS+D +ID+ K  Y A
Sbjct  269   RASILEIVRKREEKVMTGGEDSFGSDFLGLLVKAHHDAND-SQRISVDDLIDDCKTFYVA  327

Query  1008  GHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRL  1187
             G  TT SLL W +FLLA HT+WQE+ R+E++++FG + P  DGIA+L+TM+M++NEC+RL
Sbjct  328   GQETTNSLLAWTVFLLAHHTDWQEETRKEVIQMFGKQTPNPDGIAKLKTMSMVINECLRL  387

Query  1188  YPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVak  1367
             Y PV T+ RK EREVKLG LT+PA++ + M  L+LHHDP IWGQD  +F P RFA+GVAK
Sbjct  388   YSPVGTLLRKAEREVKLGKLTVPANVELVMSCLSLHHDPLIWGQDAQIFKPERFAEGVAK  447

Query  1368  atnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTP  1547
             A+NNNA AF PFG+GPRTCVGLNF T EAKIALSM+LQRY FTLSP YVH P  +    P
Sbjct  448   ASNNNAGAFLPFGVGPRTCVGLNFATIEAKIALSMVLQRYSFTLSPGYVHLPFQLVTNRP  507

Query  1548  KNGVQVILQNV  1580
               GVQV+L ++
Sbjct  508   LRGVQVMLHSL  518



>ref|XP_006437867.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
 gb|ESR51107.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
Length=509

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/506 (54%), Positives = 378/506 (75%), Gaps = 3/506 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             ++T  V ++ L  L+  +++ WWTP R++  MRSQGI GP + F HG+TK I NM++++M
Sbjct  4     YITICVCLFFLLVLIWFINKVWWTPVRIQSRMRSQGIKGPSHKFIHGSTKDILNMKNETM  63

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
               PM ++SH I+ R+ PHV++W ++YG  FL W+G +  L +TEP+LIKE+L++K  AYP
Sbjct  64    RSPM-ELSHQIYPRVSPHVYSWIKLYGKNFLMWYGLEAQLVVTEPQLIKEILSDKHRAYP  122

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K +  ++ KKLLG  L+T +GEKW K RKLANH FHAE+LK M+P+MIAS E+ML+RW++
Sbjct  123   KREPREYTKKLLGNGLVTAQGEKWFKQRKLANHAFHAETLKSMIPDMIASAEMMLDRWRD  182

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EG+E+DV+++F +LT E ISRTAFGSS+LEG++IF M++ LT    KN Y V+ P I  
Sbjct  183   NEGQEIDVYQEFKILTLEAISRTAFGSSYLEGENIFNMLTKLTFFISKNEYRVRIPVIGK  242

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISK  956
             L ++ D+IE+ K E+ I+ +I+++++KRE     G VE+YG+D LG LM+      D + 
Sbjct  243   LVKTHDDIESHKTEQDIRDSIIKIIKKRESNVMTGEVESYGSDLLGVLMQ-AYHNVDETL  301

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              ISLD +IDE K  Y AGH TT SLL W + LLA+H +WQ+KAR E+L+LFG ++P +D 
Sbjct  302   KISLDDLIDECKTFYIAGHETTASLLTWTVLLLAIHNDWQDKARNEVLQLFGQQSPNADN  361

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I+RL+ M+MI+NE +RLYPPV+ + RKV++EVKLG   IPAD+ I +P LA+HHDPQIWG
Sbjct  362   ISRLKIMSMIINESLRLYPPVVLILRKVKKEVKLGKFVIPADVDITIPTLAVHHDPQIWG  421

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             ++ H+F P RFA GVA ATNNN AAF PFG+GPRTCVG N+   EAKIALSMILQ+YKFT
Sbjct  422   EEFHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYKFT  481

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH PA I  L P++G+QV+L 
Sbjct  482   LSPTYVHSPASIITLRPQHGLQVLLH  507



>ref|XP_004298351.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=517

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/518 (53%), Positives = 385/518 (74%), Gaps = 8/518 (2%)
 Frame = +3

Query  27    SGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNT  206
             SG L  II++F   F    Y +  L ++  + WWTP R++K+M SQGI GP Y   HGNT
Sbjct  4     SGGLVIIISSFLCLF----YFVALLFKIFHKLWWTPNRIQKLMASQGIKGPSYKLVHGNT  59

Query  207   KQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIK  386
             K+ISNM  ++M +P+  +SH+IFA +QPH H+W  IYG  +L W G++  L I EPEL +
Sbjct  60    KEISNMYKEAMSRPL-SLSHNIFAYVQPHFHSWSNIYGKNYLQWLGSRAQLVIREPELCR  118

Query  387   EVLANKEGAYPKMDLDDFAKKLLGEALIT-NEGEKWAKVRKLANHTFHAESLKRMVPEMI  563
             ++L NK+GAY K+  ++F KKLLG  L+T  EG+KW+ +RK++NH FH ESLK M+P++I
Sbjct  119   QILNNKDGAYLKIPPENFVKKLLGYGLVTIAEGQKWSNLRKISNHAFHGESLKTMIPDII  178

Query  564   ASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVK  743
             A  E+ML+RW+  EGKE+DV ++F + T+EVISRTAFGSS+LEG+HIF+M+  L  I  +
Sbjct  179   ACAEIMLKRWESHEGKEIDVVEEFRLFTSEVISRTAFGSSYLEGQHIFEMLKKLALILFR  238

Query  744   NVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQL  920
             N   +K PG+S L +++DEIE+EKLE+GI+ +I+ELV+KRE K ++G  +N+G+D+LG L
Sbjct  239   NSLQIKVPGVSKLFKTNDEIESEKLEKGIQDSIIELVKKREHKVTSGEQDNFGSDFLGLL  298

Query  921   MKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREIL  1100
             +K      ++++ IS+D ++D+ K  Y AG  TT++LL W +FLLAL+T+WQE+AR+E+L
Sbjct  299   LK-AHHNDNLNQRISVDDIVDDCKTFYLAGQDTTSTLLTWTVFLLALNTDWQEEARKEVL  357

Query  1101  ELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMP  1280
             +LFG +NP  D I++L+TM+MILNE +RLYPP + + R   REV+LG L +PAD+ + + 
Sbjct  358   QLFGKQNPNPDDISKLKTMSMILNESLRLYPPALAIPRITGREVRLGKLIVPADVELLVS  417

Query  1281  ILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKI  1460
             +L LHH+PQ WG DVH+F P RF +GVAKATNNN   F PFG+G RTCVGLNF T EAKI
Sbjct  418   VLTLHHEPQFWGPDVHLFKPERFLEGVAKATNNNIGTFMPFGLGSRTCVGLNFATTEAKI  477

Query  1461  ALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             ALSMILQRY FTLSP Y+H P    +L P++G+QV+LQ
Sbjct  478   ALSMILQRYSFTLSPAYIHSPCQSLLLRPQHGLQVLLQ  515



>ref|XP_004297206.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=511

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/514 (53%), Positives = 374/514 (73%), Gaps = 6/514 (1%)
 Frame = +3

Query  42    SIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN  221
             S      ++  V + LL   +++  + WWTP R++ +M  QGI GP Y F HGNT++I+N
Sbjct  3     SFCQVIIVSIFVCVLLLLAFIKIFHKLWWTPTRIQNLMALQGIRGPSYRFVHGNTREINN  62

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             MR ++M  P   +SH+IF  + PH+H+W + YG T+L WHG K  L   EPEL KE+L  
Sbjct  63    MRKEAMSTPK-SLSHNIFPEVHPHIHSWTKNYGKTYLQWHGAKAQLVTMEPELCKEIL--  119

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
               GA+PK +   F KKLLG+ L  +EGEKW K+RKLANH FH E+LK M+P MI S E M
Sbjct  120   -NGAFPKTETKRFVKKLLGDGLTRSEGEKWVKMRKLANHAFHGENLKTMIPAMITSAETM  178

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERW    GKE++VF++F + T+EVISRTAFGSS++EGK IF+M+  +  +T KN +N++
Sbjct  179   LERWTNHNGKEIEVFEEFRLFTSEVISRTAFGSSYIEGKQIFEMLIKMGFLTFKNAFNLR  238

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENY-GNDYLGQLMKITTG  938
             FPGIS + ++SDEIE++KLE+GI+ +I+E+V+KRE ++    E+Y G+D+LG L+K    
Sbjct  239   FPGISKIYKTSDEIESDKLEKGIRDSIIEIVKKREDKAMSGQEDYFGSDFLGLLLK-AHH  297

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              S+  + IS+D ++DE KA Y AG  T+TSLL W +FLLALHT+WQE+AR E+L+LFG +
Sbjct  298   DSNEKQRISMDDLVDECKAFYFAGQETSTSLLAWTVFLLALHTDWQEEARNEVLQLFGKQ  357

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P  DG ++L+TM+MI+NE +RLYPPV+ + R+VE+EV+LGN+ IPA++ + +  LALHH
Sbjct  358   TPNPDGFSKLKTMSMIINESLRLYPPVLAMERRVEKEVRLGNVIIPANVELHVSSLALHH  417

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             +PQ WGQDV +F P RF++G+ KAT NN  AF PFGMGPRTCVG NF T E KIALSMIL
Sbjct  418   EPQFWGQDVQLFKPERFSEGIVKATGNNIVAFLPFGMGPRTCVGFNFATIEVKIALSMIL  477

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY FTLSP YVH P     L P++GVQV+L ++
Sbjct  478   QRYSFTLSPGYVHSPFHFLTLRPQHGVQVLLHSL  511



>ref|XP_006484250.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=509

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/506 (54%), Positives = 377/506 (75%), Gaps = 3/506 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             ++T  V ++ L  L+  +++ WWTP R++  MRSQGI GP + F HG+TK I  M++++M
Sbjct  4     YITTCVCLFFLLVLIWFINKVWWTPVRIQSRMRSQGIKGPSHKFIHGSTKDILTMKNETM  63

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
               PM ++SH I+ R+ PHV++W ++YG  FL W+G +  L +TEP+LIKE+L++K  AYP
Sbjct  64    RSPM-ELSHQIYPRVSPHVYSWIKLYGKNFLMWYGLEAQLVVTEPQLIKEILSDKHRAYP  122

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K +  ++ KKLLG  L+T +GEKW K RKLANH FHAE+LK M+P+MIAS E+ML+RW++
Sbjct  123   KREPREYTKKLLGNGLVTAQGEKWFKQRKLANHAFHAETLKSMIPDMIASAEMMLDRWRD  182

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EG+E+DV+++F +LT E ISRTAFGSS+LEG++IF M++ LT    KN Y V+ P I  
Sbjct  183   NEGQEIDVYQEFKILTLEAISRTAFGSSYLEGENIFNMLTKLTFFISKNEYRVRIPVIGK  242

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISK  956
             L ++ D+IE+ K E+ I+ +I+++++KRE     G VE+YG+D LG LM+      D + 
Sbjct  243   LVKTHDDIESHKTEQDIRDSIIKIIKKRESNVMTGEVESYGSDLLGVLMQ-AYHNVDETL  301

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              ISLD +IDE K  Y AGH TT SLL W + LLA+H +WQ+KAR E+L+LFG ++P +D 
Sbjct  302   KISLDDLIDECKTFYIAGHETTASLLTWTVLLLAIHNDWQDKARNEVLQLFGQQSPNADN  361

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I+RL+ M+MI+NE +RLYPPV+ + RKV++EVKLG   IPAD+ I +P LA+HHDPQIWG
Sbjct  362   ISRLKIMSMIINESLRLYPPVVLILRKVKKEVKLGKFVIPADVDITIPTLAVHHDPQIWG  421

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             ++ H+F P RFA GVA ATNNN AAF PFG+GPRTCVG N+   EAKIALSMILQ+YKFT
Sbjct  422   EEFHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYKFT  481

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH PA I  L P++G+QV+L 
Sbjct  482   LSPTYVHSPASIITLRPQHGLQVLLH  507



>ref|XP_002316006.2| hypothetical protein POPTR_0010s14900g [Populus trichocarpa]
 gb|EEF02177.2| hypothetical protein POPTR_0010s14900g [Populus trichocarpa]
Length=517

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/507 (53%), Positives = 374/507 (74%), Gaps = 3/507 (1%)
 Frame = +3

Query  57    FFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS  236
             F+ +  + + ++  LV+   + WWTP R++  M+SQGI GP Y F HGNTK+I NM S+ 
Sbjct  6     FYFSSCLFLSIVIILVKFFHKVWWTPIRIQSSMKSQGIKGPSYRFLHGNTKEIINMISKI  65

Query  237   MGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAY  416
                P  ++ HH F  IQPH+++W ++YG  FL W+G +P L ITEPELIKE+L NK+ AY
Sbjct  66    RSSPK-EVLHHTFPIIQPHIYSWIKLYGMNFLQWYGPQPQLIITEPELIKEILNNKDRAY  124

Query  417   PKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             PK    ++ K+LLG+ L+T+EGEKW K+RKLANH FH  SLK M+P MIAS E++L+RW+
Sbjct  125   PKAKAPNYVKQLLGDGLVTSEGEKWLKMRKLANHAFHGGSLKNMIPAMIASSEIILQRWR  184

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
               E KE+DVF++F VLT+E+ISRTAFGSS+LEG+HIF M++ +  I   N Y ++ PGI 
Sbjct  185   HYESKEIDVFREFKVLTSEIISRTAFGSSYLEGQHIFDMLTRMAHIISGNNYRIRIPGIG  244

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDIS  953
                ++SD+IE+E LE  I+ + + +++KRE+E+  G ++ YG+D+ G L++     SD +
Sbjct  245   KFFKTSDDIESENLEATIRSSFMNMMKKREQEAMLGNIDGYGHDFFGLLLE-AYHDSDKT  303

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             K IS+D +IDE K  Y  G  TT+SLL W + LLA+HT+WQ+KAR E+LELFG +NP  D
Sbjct  304   KKISVDDLIDECKTFYVGGQETTSSLLTWSVLLLAIHTDWQDKARNEVLELFGQQNPGQD  363

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
              IA+L+ M+M++NE +RLY P   V R+VERE+K+G +T+PA++ + +  LALH +P+IW
Sbjct  364   SIAKLKIMSMVINESLRLYSPAAVVIRRVEREIKMGKITVPANMEVLISTLALHQNPEIW  423

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G+DVH+F P RFA+G+AKAT NN AAFFPFG+GPRTCVG+NF   E K+ALSMILQRY+F
Sbjct  424   GEDVHLFKPERFAEGLAKATKNNIAAFFPFGLGPRTCVGVNFALTETKVALSMILQRYRF  483

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             TLSP Y H P ++  + P++GVQVILQ
Sbjct  484   TLSPTYAHCPVEVLTMCPQHGVQVILQ  510



>ref|XP_007201527.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
 gb|EMJ02726.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
Length=516

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/490 (56%), Positives = 372/490 (76%), Gaps = 4/490 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R++K M  QGI GPPY   HGN K+IS M  ++M +P   ISH     +QPH+
Sbjct  29    KLWWTPTRIQKQMGLQGIQGPPYRLIHGNNKEISQMMKEAMARPK-SISHDTLPLVQPHI  87

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALI-T  473
             H W +IYG  +L WHG++  L ITEPEL K++L NK+GAYPK ++ +F KKLLG+ L+ T
Sbjct  88    HYWTKIYGKNYLQWHGSQAQLVITEPELCKQILNNKDGAYPKKEVQNFVKKLLGDGLVST  147

Query  474   NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTE  653
              + EKW K+RKLA  +FH ESLK M+P M+AS E ML RWK  EGKE+DV ++F +LT+E
Sbjct  148   TKAEKWEKLRKLATLSFHGESLKSMIPAMVASTETMLGRWKNYEGKEIDVLQEFRLLTSE  207

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VISRTAFGSS++EGKHIF+M++ L  I  KN   ++ P IS   ++SDEIE+EKLE+GI+
Sbjct  208   VISRTAFGSSYIEGKHIFEMLTKLGFIIYKNYLAIRVPVISKFFKTSDEIESEKLEKGIR  267

Query  834   GAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAG  1010
              +I+E+++KRE+++  GV + +G+DYLG L+K     +D S+ IS+D+++D+ K  Y +G
Sbjct  268   DSIIEIIKKREEKAMTGVEDRFGSDYLGLLVKAQHDAND-SQRISVDEVVDDCKTFYMSG  326

Query  1011  HLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLY  1190
               TTT+LL W + LLA+HT+WQEKAR+E+++LFG E P  DGI++L+T++MI+NE +RLY
Sbjct  327   QETTTTLLSWTVLLLAIHTDWQEKARKEVIQLFGKETPHPDGISKLKTISMIINESLRLY  386

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
             PP +++ RKVE+EV+LG LT+P ++ + +  +A+HHDP+IWGQDVH+F P RF +GVAKA
Sbjct  387   PPPVSIIRKVEKEVRLGKLTLPPNLDLVISTIAIHHDPEIWGQDVHLFKPERFLEGVAKA  446

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
             TNNN  AF PFG+GPRTCVGLNF + EAKIALSMILQRY FTLSP YVH+P     + P+
Sbjct  447   TNNNIGAFIPFGLGPRTCVGLNFGSTEAKIALSMILQRYSFTLSPGYVHFPLHYLTVRPQ  506

Query  1551  NGVQVILQNV  1580
              GVQVIL ++
Sbjct  507   LGVQVILHSL  516



>ref|XP_008390037.1| PREDICTED: uncharacterized protein LOC103452311 [Malus domestica]
Length=1032

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/486 (58%), Positives = 370/486 (76%), Gaps = 4/486 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+RK+M SQGI GPPY   HGNTK+IS+MR + MG+P   +SH I + +QPH 
Sbjct  29    KIWWTPTRIRKLMASQGIRGPPYRLIHGNTKEISDMRKEVMGRPQI-LSHDILSVVQPHT  87

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
             H+W +IYG  +L WHG+K  L ITEPEL KE+L NK  AYPK D  +F  KLLG+ L+T 
Sbjct  88    HSWIKIYGKNYLQWHGSKAQLVITEPELCKEILNNKNRAYPKTDTPNFVNKLLGDGLVTT  147

Query  477   -EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTE  653
              E EKW K+RKLA H FH E+LK M+PEM+AS E MLERWK  EGKE++V+++F + T+E
Sbjct  148   TEAEKWGKLRKLATHAFHGETLKSMIPEMVASAEAMLERWKFFEGKEIEVYEEFRLFTSE  207

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VISRTAFGSS++EGK+IF+M+  L +I  KN + V+ PGIS   ++SDEIE++KLE+ + 
Sbjct  208   VISRTAFGSSYIEGKNIFEMLMKLGSILFKNAFKVRVPGISKFFKTSDEIESDKLEKEVH  267

Query  834   GAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAG  1010
               I+E+V+KRE K      +N+G+D+LG L+K      D ++ IS+D++IDE K  Y AG
Sbjct  268   ATIIEIVKKRENKAGTKEKDNFGSDFLGLLLKAXQSADD-NQRISVDELIDECKTFYFAG  326

Query  1011  HLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLY  1190
               TT +LLGW +FLLAL+T+WQE+AR+E+++LFG + P  DGIA++RTMNMI+NEC+RLY
Sbjct  327   QETTNTLLGWTVFLLALNTDWQEEARKEVIQLFGKQTPNHDGIAKMRTMNMIINECLRLY  386

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
              P + +TRKVE+EVKLG L +PA++ + +  +ALHHDPQIWG+DVH+F P RF++GV KA
Sbjct  387   TPPVYLTRKVEKEVKLGKLIVPANLELVISTIALHHDPQIWGKDVHLFKPDRFSEGVLKA  446

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
             TNNN  AF PFG+GPRTCVGLNF+T EAKIALSMILQRY FTLSP+YVH P     + P 
Sbjct  447   TNNNVGAFIPFGLGPRTCVGLNFSTTEAKIALSMILQRYSFTLSPSYVHLPLHYVTVRPY  506

Query  1551  NGVQVI  1568
             +GVQ +
Sbjct  507   HGVQPV  512


 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/490 (55%), Positives = 368/490 (75%), Gaps = 4/490 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+ K+M SQGI GPPY F HGNTKQI+ MR ++M KP  D+SH I + +QPH+
Sbjct  545   KLWWTPTRISKLMASQGIRGPPYRFIHGNTKQIATMRKEAMSKPK-DLSHDILSVVQPHM  603

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALI-T  473
             H+W  IYG  +L WHGT+    ITEPEL KE+L NK+ AYPK ++  F +KLLG+ L+ T
Sbjct  604   HSWIMIYGKNYLQWHGTRAQFVITEPELCKEILNNKDRAYPKREVQGFVRKLLGDGLVST  663

Query  474   NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTE  653
              EGEKW K+RK+ANH FH ESLK M  EM+AS E MLERWK+ +GKE++VF +  + ++E
Sbjct  664   TEGEKWGKLRKIANHAFHGESLKSMFSEMVASAETMLERWKDYDGKEIEVFGELKLFSSE  723

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VISRTAFGSS++EGK+IF+M++N+  +  KN   ++ PGIS   ++ DEIEAEKLE+ + 
Sbjct  724   VISRTAFGSSYIEGKNIFEMLNNIGFLIFKNALTIRIPGISKFLKTRDEIEAEKLEKAVH  783

Query  834   GAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAG  1010
              +I+E+V KRE+++  G  +++G+D+LG L+K     +D  + IS+D ++DE K  Y AG
Sbjct  784   ASIVEIVXKREEKAMTGGEDSFGSDFLGLLLKAYHDSND-DQRISVDDLVDECKTFYFAG  842

Query  1011  HLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLY  1190
               T  +LL W +FLLALHT+WQE+AR+E++ LFG + P  DGIA+++ M+MI+NE +RLY
Sbjct  843   QETANTLLAWTVFLLALHTDWQEEARKEVIXLFGXQTPNHDGIAKMKRMSMIINESLRLY  902

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
              P +++TRKVEREV+LG L +PA++ + +  +A+HHDPQIWG+DV +F P RF++GVAKA
Sbjct  903   TPPVSITRKVEREVRLGQLIVPANVDLVISTIAIHHDPQIWGKDVQLFKPDRFSEGVAKA  962

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
             TNNN   F PFG+GPRTCVGLNF T EAKIALSMILQR+ FTLSP Y+H P       P+
Sbjct  963   TNNNVGVFIPFGLGPRTCVGLNFATTEAKIALSMILQRFSFTLSPGYIHSPLHYLTCRPQ  1022

Query  1551  NGVQVILQNV  1580
             +GVQV+L ++
Sbjct  1023  HGVQVMLHSL  1032



>ref|XP_007226180.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
 gb|EMJ27379.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
Length=516

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/494 (56%), Positives = 372/494 (75%), Gaps = 4/494 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
              ++++ + WWTP R++K+M  QGI GP Y F HGNTK+ISNM+ + MG+P   +SH IF+
Sbjct  23    FIKILHKLWWTPIRMQKLMALQGIKGPSYRFIHGNTKEISNMKKEVMGRPRI-LSHDIFS  81

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
              +QPH+H+W +IYG  FL WHG++  L ITEPEL KE+L NK  AYPK +  + +KKLLG
Sbjct  82    VVQPHIHSWTKIYGKNFLQWHGSRAQLVITEPELCKEILNNKGRAYPKREPTNISKKLLG  141

Query  459   EALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDF  635
             + L+ T + EKWAK+R+LA H FH ESLK M+PEM+AS E MLERWK  EGKE++V+++F
Sbjct  142   DGLVATTKAEKWAKLRRLATHAFHGESLKSMIPEMVASAENMLERWKVYEGKEIEVYEEF  201

Query  636   GVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEK  815
              + T+EVISRTAFGSS+ EG+ IF M+  L ++  KN++ V+ PGIS L ++SDEI++E+
Sbjct  202   RLFTSEVISRTAFGSSYTEGQDIFGMLMKLGSLVFKNIFKVRVPGISKLFKTSDEIKSEQ  261

Query  816   LERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIK  992
             LE+GI  +I E+V+KRE K   G  +++G+D+LG L+K     ++ ++ IS+ ++IDE K
Sbjct  262   LEKGIHASITEMVKKRETKTMTGENDSFGSDFLGLLLKANHETNE-NQRISVQEIIDECK  320

Query  993   ALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILN  1172
               Y AG  TT +LL W +FLLALHT+WQE+AR+E+L+LFG   P  DGI +L TM+MI+N
Sbjct  321   TFYFAGQETTNTLLAWTVFLLALHTDWQEEARKEVLQLFGKGTPNLDGIGKLTTMSMIIN  380

Query  1173  ECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
             E +RLYPP + V R VEREV+LG L +P+++ + + I+ALHHDPQIWGQDV +F P RF+
Sbjct  381   ETLRLYPPAVLVLRNVEREVRLGKLIVPSNLELVVSIVALHHDPQIWGQDVQLFKPERFS  440

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             +G+AKATNNN  AF PF MGPR CVGLNF T EAKIALSMILQRY FTLSP YVH P   
Sbjct  441   EGIAKATNNNVGAFIPFSMGPRICVGLNFATTEAKIALSMILQRYAFTLSPGYVHSPFHH  500

Query  1533  FILTPKNGVQVILQ  1574
               + P++GVQV LQ
Sbjct  501   LTVRPQHGVQVRLQ  514



>ref|XP_008243803.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=508

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/504 (54%), Positives = 375/504 (74%), Gaps = 12/504 (2%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
             + +++L  L++   + WWTPRR++ +M  QGI GP Y   HGNTK+I NM+ ++MG P  
Sbjct  15    LCLFVLLALIKAFHKVWWTPRRIQNLMALQGIKGPSYRLIHGNTKEIFNMKMETMGSPR-  73

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
             ++S  + + +QPH+ +W +IYG  +L WHG++  L ITEPEL KE+L+NK+GAYPK + +
Sbjct  74    NLSDDVLSAVQPHIRSWTKIYGKNYLQWHGSQAQLVITEPELCKEILSNKDGAYPKREPE  133

Query  435   DFAKKLLGEAL-ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
              + KKL+G+++  TN+ +KW+KVRKLANH FH ESLK M+P MIAS E ML+ WK  EGK
Sbjct  134   GYVKKLVGDSMGTTNQADKWSKVRKLANHAFHGESLKSMIPAMIASAETMLDGWKNHEGK  193

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++V++ F + T+EVISRTAF SS+LEGK  F  +  L+ + VKN +NV+FPGIS + +S
Sbjct  194   EIEVYEQFRLFTSEVISRTAFSSSYLEGKSFFDNLMKLSFLLVKNSFNVRFPGISKIFKS  253

Query  792   SDEIEAEKLERGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMKITTGGSDISKNISL  968
             SD+IE+EKL++ ++ +I+ +V+KREK +    EN +GNDYLG L+K          ++  
Sbjct  254   SDDIESEKLDKAMRDSIIAIVKKREKAATTGEENKFGNDYLGLLLK---------AHLDT  304

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             + ++DE K  Y AG  T+  LL W IFLLALHT+WQE+AR+E+L+LFG +NPT D I++L
Sbjct  305   NDLVDECKTFYFAGQETSNGLLAWIIFLLALHTDWQEEARKEVLQLFGKQNPTHDDISKL  364

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM+MI+NE +RLYP V+++ RKV REVKLG L +PA++ + +  LALHH+P+ WG+DVH
Sbjct  365   KTMSMIINESLRLYPSVLSIDRKVTREVKLGRLIVPANVELLISCLALHHEPEFWGEDVH  424

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RF++GVAKATNNN  AF PFGMGPRTCVG NF   EAKIALSMILQRY+FTLSP 
Sbjct  425   LFKPDRFSEGVAKATNNNITAFLPFGMGPRTCVGFNFAAIEAKIALSMILQRYQFTLSPG  484

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             YVH P D   + P++GVQV+L  +
Sbjct  485   YVHSPVDYLTIRPQHGVQVMLHKL  508



>ref|XP_007226762.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
 gb|EMJ27961.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
Length=516

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/517 (54%), Positives = 382/517 (74%), Gaps = 9/517 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  ++++F     + + L+   ++++ + WWTP R++K+M  QGI GP Y F +GNTK
Sbjct  5     GGLIIVLSSF-----LCLLLVLGFIKILHKLWWTPIRMQKLMALQGIRGPSYRFIYGNTK  59

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM+ + MG+P   +SH IF+ +QPHVH+W  IYG  +L WHG++  L +TEPEL KE
Sbjct  60    EISNMQKEVMGRPHI-LSHDIFSVVQPHVHSWTNIYGKNYLQWHGSRAQLVVTEPELCKE  118

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +L NK  AY K +  + +KKL G+ L  TN+ EKWAK+RKLA H FH ESLK M+PEM+A
Sbjct  119   ILNNKGRAYLKKEAPNISKKLFGDGLAATNKAEKWAKLRKLATHAFHGESLKSMIPEMVA  178

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E M+ERWK  EGKE++VF++F + T+EVISRTAFGSS+ EG+ IF+M+  L+ +  KN
Sbjct  179   SAEKMVERWKVYEGKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFEMLRKLSFLIFKN  238

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLM  923
             +  V+ PGIS L ++SDEIE+EKLE+GI  +I+E+V+KREK++  G   ++G+D+LG L+
Sbjct  239   ILKVRVPGISKLFKTSDEIESEKLEKGIHASIIEMVKKREKKTMTGENGSFGSDFLGLLL  298

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K     ++ ++ IS+ ++IDE K  Y AG  T  +LL W +FLLALHT+WQE+AR+E+L+
Sbjct  299   KANHEANE-NQRISVQEIIDECKTFYFAGQETANTLLCWTVFLLALHTDWQEEARKEVLQ  357

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG + P  DGI +L TM+MI+NE +RLYPP + V R+VEREV+LG L +P+++   + I
Sbjct  358   LFGKQTPNLDGIGKLTTMSMIINETLRLYPPAVQVQRRVEREVRLGKLIVPSNLEFDVSI  417

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             +ALHHDPQIWGQDV +F P RF++GVAKATNN+  AF PF MGPR CVGLNF T E KIA
Sbjct  418   VALHHDPQIWGQDVQLFKPERFSEGVAKATNNHVGAFIPFSMGPRICVGLNFATTEVKIA  477

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSMILQRY FTLSP YVH P  +  + P++GVQV LQ
Sbjct  478   LSMILQRYAFTLSPGYVHSPLHLITVRPQHGVQVRLQ  514



>ref|XP_004297211.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=520

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/495 (54%), Positives = 371/495 (75%), Gaps = 2/495 (0%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
              +++  + WW P R +K M +QGI GP Y   HGN K+ISNM  ++M +P+ ++SH + +
Sbjct  27    FIKIFHKLWWIPTRTQKFMAAQGIRGPSYKLIHGNNKEISNMLMEAMSRPVLNLSHEVLS  86

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
              +QPH+H+W +IYG  +L W+G +P L ITEPEL+KE+L NK+G + K     + KKLLG
Sbjct  87    AVQPHIHSWTKIYGKNYLQWYGLQPVLVITEPELVKEILHNKDGVFTKQKPSIYVKKLLG  146

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
             +++   EGEKW+K+RKL+NH FH +SLK M+P+MIAS E MLE WK+ E KE++V++ F 
Sbjct  147   DSISMAEGEKWSKLRKLSNHAFHGDSLKNMIPDMIASAETMLEGWKKHEEKEIEVYEHFR  206

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
               T+EVISRTAFGSS+LEGK IF M+  L ++  +N +  + PGIS   ++SDE E+EKL
Sbjct  207   RFTSEVISRTAFGSSYLEGKDIFDMLMKLGSLIFRNAHKFRVPGISKFYKTSDEKESEKL  266

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+  I+E+V+KRE+E+  G   ++G D+LG L+K   G +D  + IS++++++E K 
Sbjct  267   EKGIRDTIVEIVKKREREAVTGEEGSFGTDFLGLLLKAHHGAND-KQRISVNELVEECKT  325

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  TT SLL W +FLLALH +WQE+AR+E+L++FG + P+ DG+A+L+TM+MI+NE
Sbjct  326   FYFAGQDTTNSLLVWTVFLLALHPDWQEEARKEVLQIFGKQPPSPDGLAKLKTMSMIINE  385

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPVIT+ R V++EV+LGNLTIP ++   +P LALHH+PQ WGQDV VF P RF++
Sbjct  386   SLRLYPPVITLARNVDKEVRLGNLTIPPNVEFLVPNLALHHEPQFWGQDVKVFKPERFSE  445

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             GVA ATNNN AAF PFGMGPRTCVGLNF T EAKIAL+MILQRY FTLSP YVH P    
Sbjct  446   GVASATNNNMAAFLPFGMGPRTCVGLNFATIEAKIALAMILQRYSFTLSPAYVHSPFQFL  505

Query  1536  ILTPKNGVQVILQNV  1580
              + P++G+QVIL ++
Sbjct  506   TVRPQHGLQVILHSL  520



>ref|XP_011015632.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=517

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/507 (53%), Positives = 374/507 (74%), Gaps = 3/507 (1%)
 Frame = +3

Query  57    FFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS  236
             F+ +  + + ++  LV+   + WWTP R++  M+SQGI GP Y F HGNTK+I NM S+ 
Sbjct  6     FYFSSCLLLSIVIILVKFFHKVWWTPIRIQSSMKSQGIKGPSYRFLHGNTKEIINMISKI  65

Query  237   MGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAY  416
                P  ++ HH F  IQPH+++W ++YG  FL W+G +P L ITEPELIKE+L NK+ AY
Sbjct  66    RSSPK-EVLHHTFPIIQPHIYSWIKLYGMNFLQWYGPQPQLIITEPELIKEILNNKDRAY  124

Query  417   PKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             PK    ++ K+LLG+ L+T+EGEKW K+RKLANH FH  SLK M+P MIAS E+ML+RW+
Sbjct  125   PKAKAPNYVKQLLGDGLVTSEGEKWLKMRKLANHAFHGGSLKNMIPAMIASSEIMLQRWR  184

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
               E KE+DVF++F VLT+E+ISRTAFGSS+LEG+HIF M++ +  I   N Y ++ PGI 
Sbjct  185   HYESKEIDVFREFKVLTSEIISRTAFGSSYLEGQHIFDMLTRMAHIISGNNYRIRIPGIG  244

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDIS  953
                ++ DEIE+E LE  I+ + + +++KRE+E+  G ++ YG+D+ G L++     ++ +
Sbjct  245   KFFKTIDEIESENLEATIRSSFMNMMKKREQEAMLGNIDGYGHDFFGLLLE-AYHHTEKT  303

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             K IS+D +IDE K  Y AG  TT+S L W + LLA+HT+WQ+K R E+LELFG +NP+ D
Sbjct  304   KKISVDDLIDECKTFYVAGQETTSSSLTWSVLLLAIHTDWQDKVRNEVLELFGQQNPSQD  363

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
              IA+L+ M+M++NE +RLY P   VTR+VERE+K+G +T+PA++ + +  LALH +P+IW
Sbjct  364   SIAKLKIMSMVINESLRLYSPAAVVTRRVEREIKMGKITVPANMEVLISTLALHQNPEIW  423

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G DVH+F P RFA+G+AKATNNN AAFFPFG+GPRTCVG+NF   E K+ALSMILQRY+F
Sbjct  424   GGDVHLFKPERFAEGLAKATNNNIAAFFPFGLGPRTCVGVNFALTETKVALSMILQRYRF  483

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             TLSP Y H P ++  + P++GVQVILQ
Sbjct  484   TLSPTYAHCPVEVLTMCPQHGVQVILQ  510



>ref|XP_006348652.1| PREDICTED: cytochrome P450 734A1-like [Solanum tuberosum]
Length=505

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/512 (54%), Positives = 376/512 (73%), Gaps = 9/512 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             II A FL  S    LL  LVR+V +  WTP  ++ +MRSQGI GP Y F HGN K+I  +
Sbjct  3     IILASFLFIS----LLVILVRIVKKLLWTPFHVQFMMRSQGIQGPSYKFLHGNFKEIFEI  58

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             + +S+ K M  +SH IF R+ PH+ +WK++YG  FL W+G +P L +TEPEL+KE+L+N+
Sbjct  59    KKESINKAMDHLSHDIFPRVLPHIFSWKKLYGPNFLYWYGLQPELVVTEPELLKEILSNR  118

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
                YPKMDL+ F KKL G+ + +++GEKW K+RKLANH FH ESLK M+P MI S E ML
Sbjct  119   NNNYPKMDLEGFPKKLFGDGVASSKGEKWVKMRKLANHVFHGESLKSMIPMMIMSCETML  178

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             ERWK  E KE++VF++F +LT+E+ISRTAFGSS+ EGK+IF+M+  L ++   N   V+F
Sbjct  179   ERWKIYEDKEIEVFEEFRLLTSEIISRTAFGSSYSEGKNIFQMLMKLASLVSGNANKVRF  238

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGS  944
             P IS + +S DEIE+EKLE+GI   I  +++KRE+E  G   N+G+D+LG+L++      
Sbjct  239   PRISQIWKSYDEIESEKLEQGIHDCITRIIKKREEEKIGEDHNFGSDFLGKLLEAYQ---  295

Query  945   DISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
                  IS+D +IDE K  Y AGH TTT LLGW IFLLA + +WQE+AR+E++E FGH+ P
Sbjct  296   --DNRISIDDIIDECKTFYFAGHKTTTILLGWTIFLLATNKKWQERARKEVVESFGHKVP  353

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
              +DG++RL+ MNMIL+E +RLYPPV  + RKV+++V+LG LT+P ++  ++  LA+ HD 
Sbjct  354   NADGLSRLKIMNMILDESLRLYPPVPFIKRKVDKKVELGKLTLPPEMHFYISALAVQHDC  413

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
             +IWG+DVHVF P RFA+GV KA+NNN  A+ PFG GPRTC+GLNF   EAKI LSMILQR
Sbjct  414   KIWGEDVHVFKPDRFAEGVVKASNNNPVAYLPFGYGPRTCLGLNFAMTEAKITLSMILQR  473

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             Y FT+SP YVH PAD+F+L P++GV+VIL  +
Sbjct  474   YMFTISPTYVHSPADLFMLRPQHGVKVILHKI  505



>ref|XP_008367031.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=515

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/523 (52%), Positives = 376/523 (72%), Gaps = 13/523 (2%)
 Frame = +3

Query  42    SIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN  221
             S +  F   F VS+     L+ ++ + WW P R++K+M SQGI GP Y   +GNTK+IS+
Sbjct  2     SSLEGFLCFFLVSV-----LISILHKLWWKPARMQKLMASQGIKGPSYKLVYGNTKEISS  56

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             M+ ++M  P   +SH I + + PH H+W  +YG  FL WHG++P L I +PEL KE+L N
Sbjct  57    MKKETMSSPK-SLSHDILSHVLPHFHSWTNVYGKYFLQWHGSQPQLVIRDPELCKEILQN  115

Query  402   KEGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEV  578
             K+ AYPK  + D+ KKLLG++++T  E EKW K+RKLANH FH E+LK M+P M+AS E 
Sbjct  116   KDRAYPKSKIKDYPKKLLGDSVLTTPEYEKWTKLRKLANHAFHGENLKGMLPAMVASAES  175

Query  579   MLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNV  758
             MLERWK  EGKE++VF++F ++T+EVIS+TAFGSS+LEGK IF+++  L+    KN Y V
Sbjct  176   MLERWKNYEGKEIEVFEEFKLMTSEVISKTAFGSSYLEGKLIFELLMKLSFFAFKNFYTV  235

Query  759   KFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES---NGVVENYGNDYLGQLMKI  929
             +FPGIS   ++SDEIEAEK+E+ +  +++E+++KR++++   NG  + +G+DYLG L+K 
Sbjct  236   RFPGISKFYKTSDEIEAEKIEKALHNSVMEIIKKRKEKAILRNGEEDRFGSDYLGLLLKD  295

Query  930   TTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELF  1109
                  D  + IS++ +I E KA Y AG  TTT LL W + LLA+H +WQEKAR+E+L++F
Sbjct  296   HDDADD-KQRISVEDLISECKAFYFAGQETTTVLLAWTVLLLAIHADWQEKARKEVLQIF  354

Query  1110  GHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILA  1289
             G   P +DGI++L+TM+MILNE +RLYPP ++++R V++E +LG   +P ++ + +PILA
Sbjct  355   GERTPNADGISKLKTMSMILNESLRLYPPAVSISRTVKKEARLGKFMVPVNLDLVIPILA  414

Query  1290  LHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALS  1469
             LHH+P+ WG D  +F P RF+ GVAKATNNN  AF PFGMGPRTC G+NF  NEAKIALS
Sbjct  415   LHHEPEFWGPDAQLFKPDRFSDGVAKATNNNMGAFMPFGMGPRTCAGMNFVANEAKIALS  474

Query  1470  MILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV*LLSCP  1598
             MILQRY F+LSP Y H P  +  L P+ GVQVIL    L+ CP
Sbjct  475   MILQRYSFSLSPAYTHSPFQLLTLRPRYGVQVILHP--LVDCP  515



>ref|XP_008243778.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/517 (54%), Positives = 381/517 (74%), Gaps = 9/517 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  I+ +F     + + L+   ++++ + WWTP R++KVM  QGI GP Y F +GNTK
Sbjct  5     GGLIIILPSF-----LCLLLVLAFIKILHKLWWTPIRIQKVMALQGIKGPSYRFIYGNTK  59

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM+ + MG+P   +SH IF+ +QPHVH+W  IYG  +L WHG++  L ITEPEL KE
Sbjct  60    EISNMKKEVMGRPHI-LSHDIFSVVQPHVHSWTNIYGKNYLQWHGSRAQLVITEPELCKE  118

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +L NK  AYPK +  + +KKL G+ L+ TN+ EKWAK+RKLA   FH ESLK M+P+M+A
Sbjct  119   ILNNKGRAYPKREPPNISKKLFGDGLVATNKAEKWAKLRKLATLAFHGESLKSMIPDMVA  178

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E M+ERWK  EGKE++VF++F + T+EVISRTAFGSS+ EG+ IF+M+  L  +  KN
Sbjct  179   SAEKMVERWKVYEGKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFEMLRKLGFLIFKN  238

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLM  923
             +  V+ P IS L ++SDEIE+EKLE+GI  +I+E+V+KREK++  G  +++G+D+LG L+
Sbjct  239   ILKVRVPVISKLFKTSDEIESEKLEKGIHASIIEMVKKREKKTMTGENDSFGSDFLGLLL  298

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K     ++ ++ IS+ ++IDE K  Y AG  T  +LL W +FLLALHT+WQE+AR+E+L+
Sbjct  299   KANHEANE-NQRISVQEIIDECKTFYFAGQETANTLLCWTVFLLALHTDWQEEARKEVLQ  357

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG + P  DGI +L TM+MI+NE +RLYPP + V R+VEREV LG L +P+++ + + I
Sbjct  358   LFGKQTPNLDGIGKLTTMSMIINETLRLYPPAVHVVRRVEREVTLGKLIVPSNLELDVSI  417

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             +ALHHDPQIWGQDV +F P RF++GVAKATNN+  AF PF MGPR CVGLNF T E KIA
Sbjct  418   VALHHDPQIWGQDVQLFKPERFSEGVAKATNNHVGAFIPFSMGPRICVGLNFATTEVKIA  477

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSMILQRY FTLSP YVH P  +  + P++GVQV LQ
Sbjct  478   LSMILQRYAFTLSPGYVHSPLHLLTVRPQHGVQVRLQ  514



>ref|XP_004297209.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=518

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/496 (54%), Positives = 371/496 (75%), Gaps = 6/496 (1%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             ++++R WW P R++K+M  QGI GP Y F HGN+K+IS+M+ ++M +P   +SH IF+ +
Sbjct  25    KILNRLWWKPTRIQKLMALQGIKGPSYRFIHGNSKEISSMQKEAMSRPK-SLSHDIFSYV  83

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
             QPH + W   YG  FL WHG++  L ITEP+L KEVL NK+  + K D+  F KKLLG+ 
Sbjct  84    QPHFYLWSRAYGKNFLQWHGSRAQLVITEPDLCKEVLNNKDRTFVKTDIPIFIKKLLGDG  143

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE-LEGKELDVFKDFGV  641
             L+T EGEKW ++RKLAN  FH ESLK ++P  IAS E+MLERWK   EGKE+++F++F V
Sbjct  144   LVTTEGEKWGRLRKLANFAFHGESLKSLIPATIASTELMLERWKNHEEGKEIEIFEEFRV  203

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
             LT+EVISRTAFGSS+ EGK IF M+  L+ +T KN +  + P IS + ++SD+IEAE LE
Sbjct  204   LTSEVISRTAFGSSYSEGKSIFDMLMKLSFLTFKNAFKARIPIISNIFKTSDDIEAENLE  263

Query  822   RGIKGAILELVRKREKES---NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIK  992
             +G++ +ILE+V+KRE+++   +   +++G+D+LG L+K      D+++ I++D ++DE K
Sbjct  264   KGVRDSILEMVKKREQKAMTTSKEKQSFGSDFLGLLVK-AHHDVDVNQRITVDDLVDECK  322

Query  993   ALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILN  1172
               Y AG  TT SLL W +FLLA +T+WQE+AR+E+L+LFG + P  DGI++L+TM MI+N
Sbjct  323   TFYFAGQETTNSLLAWTVFLLAFNTDWQEEARKEVLQLFGKQTPNPDGISKLKTMGMIIN  382

Query  1173  ECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
             E +RLYPPV+++ RKV REV+LG L +PAD+ IF+P LAL HDPQ WGQD  +F P RF+
Sbjct  383   ESLRLYPPVVSIERKVAREVRLGKLLVPADLEIFIPALALQHDPQFWGQDAELFKPERFS  442

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             +GVAKATNNN   F PFGMGPR CVG NF  NEAKIAL+MILQR+ FTLSP+YVH P  I
Sbjct  443   EGVAKATNNNMVTFLPFGMGPRNCVGYNFAINEAKIALAMILQRHSFTLSPSYVHSPFRI  502

Query  1533  FILTPKNGVQVILQNV  1580
               + P++GVQV+L ++
Sbjct  503   LTVRPQHGVQVMLHSL  518



>ref|XP_010049898.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82721.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=508

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/487 (53%), Positives = 373/487 (77%), Gaps = 3/487 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+++ M SQGI GPPY   +GNT++I   ++++  +P+ ++SH IF R+QPH+
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRPL-NLSHDIFPRVQPHI  80

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
              TW   YG  +L+W+G  P L +TEPELIKEVL NK+ A+PK ++D+F KKLLG+ L+T 
Sbjct  81    STWTGTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVTT  140

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
             EGEKW K RKLAN+ FH +SLK M+P M+ SV +ML+RWK L G E++V+++F +LT+E+
Sbjct  141   EGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEI  200

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS++EG++IF+M+  LT I  +N + ++FPGIS L +++DE+E+EKLE GI+ 
Sbjct  201   ISRTAFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRD  260

Query  837   AILELVRKR-EKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
             A+LE++RKR EK   G +++ GND+LG L+K  +   D S+ I++  ++DE K  Y AG+
Sbjct  261   AMLEIIRKREEKVKAGELDDLGNDFLGLLVK-ASHSDDESRRITITDLVDECKTFYIAGY  319

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYP  1193
              T+ ++L W +FLLA+H EWQ++AR+E+L +FG+++P  DGIA+L+TM MI+NE +RLYP
Sbjct  320   DTSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPDPDGIAKLKTMGMIINESLRLYP  379

Query  1194  PVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakat  1373
             PV+ + RK+  + +LG L +PA++ +++P L LHH+PQIWG D  +F P RF++GVAKA+
Sbjct  380   PVVGLIRKIATKTRLGKLVLPANMGLYIPNLKLHHNPQIWGDDAQLFKPERFSEGVAKAS  439

Query  1374  nnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKN  1553
             NNN AAFFPFG+GPRTCVG NF T EAKIALSMILQRY F+LSP YVH P  +   +P++
Sbjct  440   NNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFSLSPAYVHSPTQLLTTSPQH  499

Query  1554  GVQVILQ  1574
             G+QVI  
Sbjct  500   GLQVIFH  506



>ref|XP_008360080.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=520

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/514 (54%), Positives = 375/514 (73%), Gaps = 6/514 (1%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             I T+ FL   + I L   L++   + WWTP R++  M +QG+ GP Y F HGNTK+I +M
Sbjct  11    ITTSSFLCLFLVILL--ALIKNFQKLWWTPNRIQNRMAAQGVHGPSYKFIHGNTKEIWSM  68

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             + ++MG+P   ++H IF+ +QPH+H W +IYG  FL W+G +P + I EPEL KEVL NK
Sbjct  69    KRETMGRPR-SLTHDIFSAVQPHIHAWNKIYGKNFLQWYGVQPQMIIAEPELCKEVLNNK  127

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             +  Y K     + KKLLG+++   EGEKW K+RKLA+H FH ESLK M+PEMI S E M+
Sbjct  128   DRNYRKQRSQGYIKKLLGDSISMAEGEKWVKLRKLAHHAFHGESLKNMIPEMIKSSETMV  187

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             +RWK  EGKE++V ++F   T+EVISRTAFGSSFLEGK IF+M+  LT++  +N + ++ 
Sbjct  188   KRWKTYEGKEIEVNEEFRFFTSEVISRTAFGSSFLEGKDIFEMLRELTSLIFRNTFKLRL  247

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGG  941
             PGISM  ++SDEI+++KLE+GI+ +I E+VRKREK +  G  + +G+DYLG L+K     
Sbjct  248   PGISMFYKTSDEIKSDKLEKGIRDSITEIVRKREKTAMTGEADGFGSDYLGILLKAHHDA  307

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFG-HE  1118
              +  + IS+D ++DE K  Y AG  TT SLL W +FLLALHT+WQE+AR+E+LELFG  E
Sbjct  308   HE-KQRISVDDLVDECKTFYFAGQETTNSLLAWTVFLLALHTDWQEEARKEVLELFGKDE  366

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P SDG+ +L+TM MI+NE +RLYPPV+++TR+  +EV+LG + +PAD+ + +  LALHH
Sbjct  367   TPNSDGLNKLKTMGMIINESLRLYPPVVSLTRESLKEVRLGQVVVPADVELHVSNLALHH  426

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             + + WG+DV +F P RF++GVAKATNNNA AF PFGMGPRTCVG+NF   EAKIALSMIL
Sbjct  427   EREYWGKDVQLFKPERFSEGVAKATNNNAVAFMPFGMGPRTCVGMNFAIIEAKIALSMIL  486

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY FTLSP YVH P     + P++GVQVIL  V
Sbjct  487   QRYSFTLSPGYVHSPIQFLTVRPQHGVQVILHPV  520



>ref|XP_007224470.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
 gb|EMJ25669.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
Length=510

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 367/511 (72%), Gaps = 5/511 (1%)
 Frame = +3

Query  57    FFLTFSVSIYL--LWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRS  230
             F ++  V ++L  L  L+R+  + WW P R++K M  QGI GP Y   HG+TK+I +M+ 
Sbjct  2     FTVSSCVCVFLVILLALIRIFRKVWWVPNRIQKFMGLQGIHGPAYRLVHGSTKEIMSMKK  61

Query  231   QSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEG  410
             ++M +P  ++SH IF  +QPH H W +IYG  FL W GT+P L I EPEL KE+L NK+ 
Sbjct  62    EAMSRPR-NMSHDIFPTVQPHTHQWTKIYGKNFLQWQGTQPQLLIAEPELSKEILNNKDR  120

Query  411   AYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLER  590
              + K     + KKL GE++   EGEKW K+RKLANH FH ESLK MVP+MI S E ML+R
Sbjct  121   LFRKQKSQGYVKKLFGESISMAEGEKWVKLRKLANHAFHGESLKGMVPDMITSTETMLQR  180

Query  591   WKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG  770
             WK  EGKE++VF++F +LT+EVISR+AFGSS+LEGK IF M+  LT++  +N    +FPG
Sbjct  181   WKNHEGKEIEVFEEFRLLTSEVISRSAFGSSYLEGKRIFDMLMELTSVIFQNALRPRFPG  240

Query  771   ISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSD  947
             ISM  ++S EI A+KLE+GI+  I E+V+KRE K   G  + +G+D+LG L+K     ++
Sbjct  241   ISMFYKTSAEIRADKLEKGIRDTIAEIVKKRENKAMKGEADEFGSDFLGVLLKAHHDTNE  300

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
              ++ IS D ++DE K  Y AG  TT +LL W +FLLALH +WQE+AR+E+L+LFG + PT
Sbjct  301   -NQRISFDDIVDECKTFYFAGQETTNALLAWTVFLLALHPDWQEEARKEVLQLFGQQTPT  359

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
              DGI++L+TM+MI+NE +RLYPPV+++ R+VE+ VKLG L IPA+  + +P LA HHDP+
Sbjct  360   LDGISKLKTMSMIINESLRLYPPVVSLNRQVEKNVKLGGLVIPANAELHVPNLAFHHDPK  419

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
              WG+DV++F P RF++GVAKAT +N  AF PFG+GPRTCVG+NF   E KIAL+MILQRY
Sbjct  420   FWGEDVNLFKPERFSEGVAKATKSNTVAFLPFGLGPRTCVGMNFANAEVKIALAMILQRY  479

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              FTLSP YVH P     + P  GVQVIL ++
Sbjct  480   SFTLSPGYVHSPIQYMTVRPHRGVQVILHSL  510



>ref|XP_011009723.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=515

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/504 (53%), Positives = 379/504 (75%), Gaps = 3/504 (1%)
 Frame = +3

Query  72    SVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM  251
             S+ IYL + LV+++ + WWTP R++  M SQGI GP Y F HG+TK++  M+ ++M KPM
Sbjct  14    SLCIYLTFMLVKVLHKLWWTPIRIQNFMASQGIRGPSYRFIHGSTKEVLIMKKEAMAKPM  73

Query  252   FDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL  431
               +SH+IF ++ P ++TW   YG  +L+W+G K +  ++EPEL+KE+L NK+ +YPK D+
Sbjct  74    -TLSHNIFPKVLPQIYTWINTYGRNYLSWYGPKAHFVVSEPELVKEILNNKDRSYPKGDI  132

Query  432   DDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
               + + LLG  + T+EGEKW K RKL+ + F+AE+LK M+PEMIASVE++LERWK+ EG+
Sbjct  133   PAYFRLLLGNGVSTSEGEKWTKHRKLSTYAFNAENLKDMIPEMIASVEMLLERWKQNEGR  192

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++V+++  +LT+E+ISRTAFGSS++EGK IF M++ L+ I  +N+Y ++ PGIS   R+
Sbjct  193   EIEVYQELRLLTSEIISRTAFGSSYVEGKDIFDMLTKLSLIIHRNIYKLRLPGISKFWRT  252

Query  792   SDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISL  968
              DEIE+EKL +GI  +++E+++KRE K   G  + +GND+LG L+  +   +D  K IS+
Sbjct  253   RDEIESEKLVKGIHNSVMEIIKKREEKVKTGEADGFGNDFLGVLLN-SYHDADEKKRISI  311

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             + ++DE K  Y AG  +T SLL W I LLA+HT+WQE+AR+E+  +FG + P  DGIA+L
Sbjct  312   EDLVDECKTFYIAGQESTNSLLSWTILLLAIHTDWQEEARKEVFNIFGRQKPNLDGIAKL  371

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             + + MI+NE +RLYPPV+ + RKVEREV++G LT+PA++ +++   ALHHDP+IWG+DVH
Sbjct  372   KILTMIINETLRLYPPVLGLMRKVEREVQIGQLTLPANMNLYIANAALHHDPEIWGEDVH  431

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RF+ GVAKATNN  AAFFPFG+GPRTCVGLNF T EAKI LSMILQ+Y FTLSP 
Sbjct  432   LFKPERFSGGVAKATNNIPAAFFPFGLGPRTCVGLNFATTEAKITLSMILQKYLFTLSPT  491

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             Y H P +   L P+NGVQVIL ++
Sbjct  492   YTHSPYEAVTLCPRNGVQVILHSL  515



>gb|EYU22575.1| hypothetical protein MIMGU_mgv1a004725mg [Erythranthe guttata]
Length=513

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/517 (53%), Positives = 373/517 (72%), Gaps = 9/517 (2%)
 Frame = +3

Query  42    SIITAFFLTFSVS--IY-LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQ  212
             +II    + FS+S  IY LL  LV+ +++ W  P R++K MR QGI GPPY F HGNTK+
Sbjct  2     AIIVKIIILFSISLTIYALLLTLVKFLNKVWLNPIRIQKTMRCQGIEGPPYKFLHGNTKE  61

Query  213   ISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEV  392
             I +MR ++MGK M DISH+IF RI PHVH+W  +YG  FL W+G +  L +TE EL+KE+
Sbjct  62    IIDMRKETMGKSMHDISHNIFPRILPHVHSWAILYGENFLNWYGPQAQLVVTEAELVKEI  121

Query  393   LANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASV  572
             L NK+  YPK++L+  AKKLLG+ L +++GEKWA +RKLAN  FHA+SLK M+PEMI SV
Sbjct  122   LNNKDENYPKINLEGHAKKLLGDGLSSSKGEKWANMRKLANRVFHADSLKNMIPEMITSV  181

Query  573   EVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVY  752
             E MLE+WKE EGKE++VF++F +LT+E+IS+TAFGSS+LEGK IF M+  L  I  +N +
Sbjct  182   ETMLEKWKEYEGKEIEVFEEFRLLTSEIISKTAFGSSYLEGKSIFDMLMKLAFIVSRNAH  241

Query  753   NVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKIT  932
              +K P IS    S D+ E+EKLE+GI+  I+ ++ KRE E     E   ND+LG+L++  
Sbjct  242   TIKLPFISRFLPSKDDYESEKLEQGIRDCIVRIIAKRETE-----ETSRNDFLGKLLETN  296

Query  933   TGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFG  1112
                 + +  +S++ ++DE K  Y AGH TTTSLL W + LLA++ EWQ+KAR E +E FG
Sbjct  297   NNNQNKNTKMSVEDIVDECKTFYFAGHETTTSLLAWTVLLLAINQEWQDKARNETIESFG  356

Query  1113  H-ENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILA  1289
                NP  D I+RL+ MNMI+ E +RLYPPV  + RKV+++V LG +T+P  + +++  LA
Sbjct  357   QTTNPNPDNISRLKIMNMIIEESLRLYPPVPAIKRKVDKKVTLGKITLPPQMELYISPLA  416

Query  1290  LHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALS  1469
             L HDP IWG+DVH F P RF QG+AKA+N+N  AF PFG GPRTCVGL+F   EAKIALS
Sbjct  417   LQHDPNIWGEDVHFFRPERFGQGIAKASNDNTVAFLPFGFGPRTCVGLSFAITEAKIALS  476

Query  1470  MILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             MIL+RY+  +SP Y+H P  +F++ P++G+QVIL+ +
Sbjct  477   MILRRYRLIVSPGYIHSPVQVFMIRPQHGIQVILEKI  513



>ref|XP_006437870.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51110.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=520

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/514 (53%), Positives = 373/514 (73%), Gaps = 9/514 (2%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             L++  + F L F + I      +RL ++ WW P R + VM SQG+ GP Y   +GNTK+I
Sbjct  7     LYAATSCFCLVFFLFI------IRLFNKLWWIPNRTQAVMGSQGVRGPAYRLVYGNTKEI  60

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
              ++R+Q    PM  +SH I  RI PH+ +W + YG  FLTW+G++  L IT+PELIKE+L
Sbjct  61    LSLRNQIWISPM-GLSHDILPRILPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEIL  119

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVE  575
             +N +G YPK+    F +K+LG+ L+T  GE W + RKLA   F+AESL+ M+P M+ASVE
Sbjct  120   SNSDGTYPKVQAPGFLRKILGDGLVTAGGENWHRQRKLATLAFYAESLRDMIPAMVASVE  179

Query  576   VMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYN  755
             +ML+RW+  EGKE++V +DF +LT+E+ISRTAFGSS+LEG+ IF  ++N++ I  +N Y 
Sbjct  180   IMLKRWRHNEGKEIEVSQDFTLLTSEIISRTAFGSSYLEGESIFNKLTNMSFIASRNAYK  239

Query  756   VKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKIT  932
             +K P I    ++SD++EA+KLE+GI+ +I+++++ RE+++  G  E YGNDY G L+K  
Sbjct  240   IKIPLIGDFVKTSDDVEADKLEQGIRDSIIKMMKTREEKAMKGESEGYGNDYFGLLLK-A  298

Query  933   TGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFG  1112
                 D++K ISLD +IDE K  Y AGH TTT LL W I LLA HT+WQEK R E+LELFG
Sbjct  299   YHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFG  358

Query  1113  HENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILAL  1292
              +NPT DGI +L+TM+M++NE +RLYPP + ++R VEREV+LG   +PA++ + +PILA+
Sbjct  359   QQNPTPDGIGKLKTMSMVINESLRLYPPAVNISRNVEREVRLGKYILPANMELVIPILAI  418

Query  1293  HHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSM  1472
             HHDPQIWG+DV +F P RFA+GVAKA+NN  AAF PF  GPR CVGLNF   EAKIALSM
Sbjct  419   HHDPQIWGEDVDIFKPERFAEGVAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSM  478

Query  1473  ILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             ILQRY+F LSP+YVH P  +  L P++G+QVI Q
Sbjct  479   ILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQ  512



>ref|XP_008243777.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1030

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/529 (54%), Positives = 392/529 (74%), Gaps = 11/529 (2%)
 Frame = +3

Query  6     IKQLSMMS--GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGP  179
             ++ L MM+  G L  I+ +F     + + L+   ++++ + WWTP R++K+M  QGI GP
Sbjct  509   VQVLEMMTTLGGLIIILPSF-----LCLLLVLAFIKILHKLWWTPIRIKKLMALQGIKGP  563

Query  180   PYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYL  359
              Y F +GNTK+ISNM+ + MG+P   +SH I + +QPH+H+W +IYG  +L WHG++  L
Sbjct  564   SYRFFYGNTKEISNMKKEVMGRPQL-LSHDILSVVQPHIHSWTKIYGKNYLQWHGSRAQL  622

Query  360   FITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAES  536
              ITEPEL KE+L N+  AY K +     KKLLG+ L+ T E EKWAK+RKLA H FH ES
Sbjct  623   VITEPELCKEILNNRGRAYSKREPPHLVKKLLGDGLVATTEAEKWAKLRKLATHAFHGES  682

Query  537   LKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMV  716
             LK M+PEM+AS E MLERW   EGKE++VF++F + T+EVISRTAFGSS++EG+ IF+M+
Sbjct  683   LKSMIPEMVASAETMLERWTVYEGKEIEVFEEFRLFTSEVISRTAFGSSYVEGQDIFEML  742

Query  717   SNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVEN-  893
               L  +  KN+  V+ PGIS   ++SDEIE++KLE+GI  +I+ELVRKREK++  V +N 
Sbjct  743   MKLGFLIFKNILKVRIPGISKFFKTSDEIESDKLEKGIHASIIELVRKREKKTMAVEKNS  802

Query  894   YGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEW  1073
             +G+D+LG L+K     ++ ++ IS+D++IDE K  Y AG  TT +LL W +FLLALHT+W
Sbjct  803   FGSDFLGLLLK-ANHEANKNQRISVDELIDECKTFYFAGQETTNTLLSWTVFLLALHTDW  861

Query  1074  QEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTI  1253
             QE+AR+E+L+LFG + P  DGI +L+TM+MI+NE +RLYPP + V R +EREV+LG L +
Sbjct  862   QEEARKEVLQLFGKQTPNLDGIGKLKTMSMIINEALRLYPPAVWVMRNIEREVRLGKLIV  921

Query  1254  PADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGL  1433
             P+++ + + I+ALHHDPQIWGQDV +F P RF++GVAKATNN+  AF PFG+GPRTCVGL
Sbjct  922   PSNLELVVSIVALHHDPQIWGQDVQLFKPERFSEGVAKATNNHVGAFIPFGLGPRTCVGL  981

Query  1434  NFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             NF T EAKIALSMILQ+Y FTLSP YVH P     + P++GVQV+L ++
Sbjct  982   NFATTEAKIALSMILQQYAFTLSPVYVHLPLHYLTVRPQHGVQVMLHSL  1030


 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/515 (54%), Positives = 380/515 (74%), Gaps = 9/515 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             GAL  I++ F     + + L+   ++++ + WWTP R++++M  QGI GP Y F HGN K
Sbjct  5     GALIIILSTF-----LCLLLVLAFIKILHKLWWTPIRMQRLMALQGIKGPSYRFIHGNIK  59

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM+ + MG+P   +SH IF+ +QPH+H+W +IYG  FL WHG++  L IT PEL KE
Sbjct  60    EISNMKKEVMGRPHI-LSHDIFSVVQPHIHSWTKIYGKNFLQWHGSRAQLVITAPELCKE  118

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +L NK+ AYPK +    +KKLLG++L+ T E  KWAK+R+LA H FH +SLK M+PEM+A
Sbjct  119   ILNNKDRAYPKREPTKISKKLLGDSLVATTEARKWAKLRRLATHAFHGDSLKSMIPEMVA  178

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E MLERWK  EGKE++V+++F + T+EVISRTAFGSS+ EG+ IF M+  L ++  KN
Sbjct  179   SAENMLERWKVYEGKEIEVYEEFRLFTSEVISRTAFGSSYTEGQDIFGMLMKLGSLVFKN  238

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLM  923
             ++ V+ PGIS L ++SDEIE+E+LE+GI  +I E+V+KRE K   G  +++G+D+LG L+
Sbjct  239   IFKVRVPGISELFKTSDEIESEQLEKGIHASITEMVKKRETKTMTGENDSFGSDFLGLLL  298

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K     ++ ++ IS+ ++IDE K  Y AG  TT +LL W +FLLALHT+WQE+AR+E+L+
Sbjct  299   KANHETNE-NQRISVQEIIDECKTFYFAGQETTNTLLAWTVFLLALHTDWQEEARKEVLQ  357

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG E P  DGI +L  M+MI+NE +RLYPP + V R VEREVKLG L +P+++ + + I
Sbjct  358   LFGKETPNLDGIGKLTIMSMIINETLRLYPPAVFVLRNVEREVKLGKLIVPSNLELVVSI  417

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             +ALHHDPQIWGQDV +F P RF++GVAKATNN   AF PF MGPRTCVGLNF T EAKIA
Sbjct  418   IALHHDPQIWGQDVQLFKPERFSEGVAKATNNYVGAFIPFSMGPRTCVGLNFATTEAKIA  477

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVI  1568
             LSMILQRY FTLSP YVH P     + P++GVQV+
Sbjct  478   LSMILQRYAFTLSPGYVHSPFHHLTVRPQHGVQVL  512



>gb|KCW82725.1| hypothetical protein EUGRSUZ_C04102 [Eucalyptus grandis]
Length=508

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/487 (54%), Positives = 371/487 (76%), Gaps = 3/487 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+++ M SQGI GPPY   +GNT +I   ++++  +P+ ++SH IF R+QPH+
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTLEILQFKNETSSRPL-NLSHDIFPRVQPHI  80

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
              TW   YG  +L+W+G  P L +TEPELIKEVL NK+ A+PK ++D+F KKLLG+ L+T 
Sbjct  81    STWTGTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVTA  140

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
             EGEKW K RKLAN+ FH +SLK M+P M+ SV +ML+RWK L G E++V+++F +LT+E+
Sbjct  141   EGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEI  200

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS++EG++IF+M+  LT I  +N + ++ PGIS L +++DE+E+EKLE GI+ 
Sbjct  201   ISRTAFGSSYVEGRNIFEMLRKLTLIASRNAFKIRLPGISKLWKTNDELESEKLENGIRD  260

Query  837   AILELVRKR-EKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
             A+LE++RKR EK   G +++ GND+LG L+K  +   D S+ I++  ++DE K  Y AGH
Sbjct  261   AMLEIIRKREEKVKAGELDDLGNDFLGLLVK-ASHSDDESRRITITDLVDECKTFYIAGH  319

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYP  1193
              T+ ++L W +FLLA+H EWQ++AR+E+L +FG+++P  DGIA+L+TM MI+NE +RLYP
Sbjct  320   ETSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPYPDGIAKLKTMGMIINESLRLYP  379

Query  1194  PVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakat  1373
             PV+ + RKV  + +LG L +PA++ +++P L LHH+PQIWG D  +F P RF++GVAKAT
Sbjct  380   PVVGLIRKVATKTRLGKLVLPANMGLYIPNLKLHHNPQIWGDDAQLFKPERFSEGVAKAT  439

Query  1374  nnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKN  1553
             NNN AAFFPFG+GPRTCVG NF T EAKIALSMILQRY F+LSP YVH P  +   +P++
Sbjct  440   NNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFSLSPAYVHSPTQLLTTSPQH  499

Query  1554  GVQVILQ  1574
             G+QVI  
Sbjct  500   GLQVIFH  506



>ref|XP_006484252.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=520

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/514 (53%), Positives = 373/514 (73%), Gaps = 9/514 (2%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             L++  + F L F + I      +RL ++ WW P R + VM SQG+ GP Y   +GNTK+I
Sbjct  7     LYAATSCFCLVFFLFI------IRLFNKLWWIPNRTQAVMGSQGVRGPAYRLVYGNTKEI  60

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
              ++R+Q    PM  +SH I  RI PH+ +W + YG  FLTW+G++  L IT+PELIKE+L
Sbjct  61    LSLRNQIWISPM-GLSHDILPRILPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEIL  119

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVE  575
             +N +G YPK+    F +K+LG+ L+T  GE W + RKLA   F+AESL+ M+P M+ASVE
Sbjct  120   SNSDGTYPKVQAPGFLRKILGDGLVTAGGENWHRQRKLATLAFYAESLRDMIPAMVASVE  179

Query  576   VMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYN  755
             +ML+RW+  EGKE++V +DF +LT+E+ISRTAFGSS+LEG+ IF  ++N++ I  +N Y 
Sbjct  180   IMLKRWRHNEGKEIEVSQDFTLLTSEIISRTAFGSSYLEGESIFNKLTNMSFIASRNAYK  239

Query  756   VKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKIT  932
             +K P I    ++SD++EA+KLE+GI+ +I+++++ RE+++  G  E YGNDY G L+K  
Sbjct  240   IKIPLIGDFVKTSDDVEADKLEQGIRDSIIKMMKTREEKAMKGESEGYGNDYFGLLLK-A  298

Query  933   TGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFG  1112
                 D++K ISLD +IDE K  Y AGH TTT LL W I LLA HT+WQEK R E+LELFG
Sbjct  299   YHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFG  358

Query  1113  HENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILAL  1292
              +NPT DGI +L+TM+M++NE +RLYPP + ++R VEREV+LG   +PA++ + +PILA+
Sbjct  359   QQNPTPDGIGKLKTMSMVINESLRLYPPAVNISRNVEREVRLGKYILPANMELVIPILAI  418

Query  1293  HHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSM  1472
             HHDPQIWG+DV +F P RFA+GVAKA+NN  AAF PF  GPR CVGLNF   EAKIALSM
Sbjct  419   HHDPQIWGEDVDLFKPERFAEGVAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSM  478

Query  1473  ILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             ILQRY+F LSP+YVH P  +  L P++G+QVI Q
Sbjct  479   ILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQ  512



>gb|KCW86463.1| hypothetical protein EUGRSUZ_B03131 [Eucalyptus grandis]
Length=512

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/493 (55%), Positives = 362/493 (73%), Gaps = 3/493 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L  + WW P R+++++  QGI GPPY F HG++K+   M +Q    PM ++SH IF +
Sbjct  19    AKLWYKLWWKPHRIQRILNEQGIRGPPYKFVHGSSKESFKMITQVRDIPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             IQP +HTW   YG  +L+WHGT+  L ITEPELIKEVL N++  YPK    DF KKLLG+
Sbjct  79    IQPEIHTWTNTYGRNYLSWHGTQAQLVITEPELIKEVLVNRDKTYPKTPATDFVKKLLGD  138

Query  462   AL-ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L  TN  EKWAK RKLANH FH ESLK MVP M+ ++ VML RWK  EGKE+DVF+DF 
Sbjct  139   GLATTNNEEKWAKQRKLANHAFHGESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT EVIS+TAFGSS++EG++IF+M++ L  +  KN+++V+FPG+S   +++DEIEAEKL
Sbjct  199   LLTCEVISKTAFGSSYIEGRNIFQMLTRLGVLLTKNLHHVRFPGLSKFWKTADEIEAEKL  258

Query  819   ERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             ++GI  AIL +V+KRE K   G   + GND+LGQL+K  + G D SK I++D ++DE K 
Sbjct  259   QKGIYDAILGIVKKREEKVKTGEAADVGNDFLGQLVK-ASRGMDNSKKITIDDLVDECKT  317

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  TT +L+ W +FLLA H  WQEKAR+E+L +FG+ +P SDGIA+L+TM+MI+NE
Sbjct  318   FYLAGQETTNALMTWVVFLLAAHPNWQEKARKEVLHVFGNNDPDSDGIAKLKTMSMIINE  377

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPVI ++R+VE++++LG L +P +I I +  L LHHDP+IWG+DV +F P RFA+
Sbjct  378   TLRLYPPVIGMSRQVEQQLRLGKLLLPTNIHIIIGNLKLHHDPKIWGEDVLLFKPERFAE  437

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+A+ATNNN   F PF  GPR C G+NF T+E KI LSMILQRY F LSP YVH P  + 
Sbjct  438   GIARATNNNPVVFIPFSFGPRICAGMNFATHEVKIILSMILQRYAFKLSPAYVHCPVQVL  497

Query  1536  ILTPKNGVQVILQ  1574
              + PK+G+QVI Q
Sbjct  498   TIGPKHGLQVIFQ  510



>ref|XP_009356202.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/494 (53%), Positives = 372/494 (75%), Gaps = 3/494 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             +++  + WW+P RL+ ++  QGI GP Y F HGNTK+IS+M+ ++M +P   +SH IF+R
Sbjct  24    IKIFHKLWWSPIRLQNLVAMQGIKGPSYRFVHGNTKEISSMQEEAMSRPK-SLSHDIFSR  82

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+H W + YG  FL W+G++  L ITEPEL KE+L NK+ AYPK +   F ++LLG+
Sbjct  83    VQPHIHLWTKTYGANFLQWYGSQAQLVITEPELCKEILTNKDRAYPKSEPKSFLRRLLGD  142

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
              L+ ++GEKWAK+RKLAN+ FH E LK M P +IAS E MLE WKE +G+E+DVF++F +
Sbjct  143   GLVVSDGEKWAKMRKLANYAFHGEILKGMAPTVIASAETMLETWKEHDGQEIDVFEEFRL  202

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
              T+EVIS+TAFGSS+LEGK+IF+++  L  ++ KN + ++FPGISM  +S+DEIE+ KLE
Sbjct  203   YTSEVISKTAFGSSYLEGKNIFEILDKLGHLSFKNAFKLRFPGISMFIKSNDEIESAKLE  262

Query  822   RGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             + I+ +I+E+++ RE K   G  +++GND+LG L+K     +D  K IS+D+++DE K  
Sbjct  263   KSIRDSIMEMIKNRENKAMAGEEDSFGNDFLGVLLK-AHQDTDERKRISIDEIVDECKTF  321

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
             Y AG  TT S L W +FLLA+HT+WQE AR+E++++FG +NP  DGIA+L+TM+MI NE 
Sbjct  322   YFAGQETTNSALAWTVFLLAIHTDWQEDARKEVIQIFGKQNPNLDGIAKLKTMSMIFNES  381

Query  1179  MRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQG  1358
             +RLYPPV+T+ RK+ REVKLG   +PA++ I +P LAL H+PQIWG+DV +F P RF++G
Sbjct  382   LRLYPPVVTIERKIGREVKLGKHVLPANVEITIPCLALQHEPQIWGEDVLLFKPERFSEG  441

Query  1359  VakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             VAKAT NN AAF P+G+GPR+CVG NF   E KI LSMILQR+ FTLSP Y+H P  +  
Sbjct  442   VAKATKNNIAAFLPWGLGPRSCVGSNFAAIETKIVLSMILQRFSFTLSPAYIHSPYRLLT  501

Query  1539  LTPKNGVQVILQNV  1580
             + P++GVQV+L ++
Sbjct  502   VRPQHGVQVMLHSL  515



>ref|XP_009607163.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana tomentosiformis]
Length=507

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 381/512 (74%), Gaps = 8/512 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             II + FL  S+ I L W    +  + WW+P R++ +MRSQGI GPPY F +GNTK+I  M
Sbjct  4     IILSSFLFISLLIILFW----IFKKLWWSPIRVQFLMRSQGIQGPPYKFLYGNTKEIVEM  59

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             +  S+ K M  +SH IF RI PHV +WK +YG +FL W+G +P L +TEPEL+KE+L+N+
Sbjct  60    KKDSISKSMDHLSHDIFPRILPHVFSWKNLYGESFLYWYGLQPELVVTEPELLKEILSNR  119

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
                +PK+DL+ ++KKLLG+ + +++GEKW K+RKLANH FH ESLK MVP MI S E ML
Sbjct  120   NNNFPKIDLEGYSKKLLGDGVSSSKGEKWTKMRKLANHVFHGESLKSMVPMMIMSCETML  179

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             E+WK  E KE++VF++F +LT+E+ISRTAFGSS+LEGK+IF+M+  L  +  K+   +KF
Sbjct  180   EKWKIYEEKEIEVFEEFRILTSEIISRTAFGSSYLEGKNIFQMLMKLALLVSKDALKIKF  239

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGS  944
             PGIS + +S DEIE+EKLE+GI+ +I  +++KRE+E  G   N+G+D+LG+L++      
Sbjct  240   PGISQIWKSRDEIESEKLEQGIRDSITRIIKKREEEKIGEEHNFGSDFLGKLLE----AY  295

Query  945   DISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
                  IS+++++DE K +Y AGH TTTSLLGW I LLA +  WQEKAR+E+LE FG + P
Sbjct  296   QEDYRISVEEIVDECKTIYLAGHETTTSLLGWTILLLATNKNWQEKARKEVLESFGQKVP  355

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
             T+DG++RL+ MNMI+ E +RLYPPV    RKV ++V+LG LT+P  + +++  LA+ HDP
Sbjct  356   TADGLSRLKIMNMIVEESLRLYPPVPFTKRKVNKKVQLGKLTLPPQMQLYISPLAVQHDP  415

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
             +IWG+DVH+F P RFA+GV KATNNN  AF PFG GPRTC+GLNF   EAK+ LSMILQR
Sbjct  416   KIWGEDVHIFKPERFAEGVVKATNNNPVAFLPFGYGPRTCLGLNFAMIEAKVTLSMILQR  475

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             Y FT+SP+YVH P  +F+L P++GV+VIL  +
Sbjct  476   YMFTVSPSYVHSPVQLFMLRPEHGVKVILHKI  507



>ref|XP_007223262.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
 gb|EMJ24461.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
Length=508

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/514 (53%), Positives = 376/514 (73%), Gaps = 16/514 (3%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             +I + FL     +++L  L++ + + WWTPR ++ +M  QGI GP Y   HGNTK+I NM
Sbjct  9     VIVSSFLC----LFVLLALIKALHKVWWTPRHIQNLMALQGIKGPSYRLIHGNTKEIFNM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             + ++MG P  ++S  + + +QPH+ +W +IYG  +L WHG++  L I EP+L KE+L+NK
Sbjct  65    KMETMGSPR-NLSDDVLSAVQPHIRSWTKIYGKNYLQWHGSQAQLVIMEPQLCKEILSNK  123

Query  405   EGAYPKMDLDDFAKKLLGEAL-ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             +GAYPK + + + KKL+G+++  TN+ +KW+KVRKLAN  FH ESLK M+P MIAS E M
Sbjct  124   DGAYPKREPEGYVKKLVGDSMGTTNQADKWSKVRKLANQAFHGESLKSMIPAMIASAETM  183

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L+ WK  EGKE++V++ F + T+EVISRTAF SS+LEGK  F  +  L+ + VKN + V+
Sbjct  184   LDGWKNHEGKEIEVYEQFRLFTSEVISRTAFSSSYLEGKSFFDNLMKLSFLLVKNSFKVR  243

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMKITTG  938
             FPGIS + +SSD+IE+EKL++ ++  I+ +V+KREK +    EN +GNDYLG L+K    
Sbjct  244   FPGISKIFKSSDDIESEKLDKAMRDFIIAIVKKREKAATTGEENKFGNDYLGLLLK----  299

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
                   ++  + ++DE K  Y AG  T+  LL W IFLLALHT+WQE+AR+E+L+LFG +
Sbjct  300   -----AHLDTNDLVDECKTFYFAGQETSNGLLAWIIFLLALHTDWQEEARKEVLQLFGKQ  354

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             NPT D I++L+TM+MI+NE +RLYP V+++ RKV REVKLG L +PA++ + +  LALHH
Sbjct  355   NPTHDDISKLKTMSMIINESLRLYPSVLSIDRKVTREVKLGRLVVPANVELLISCLALHH  414

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             +P+ WG DVH+F P RF++GVAKATNNN AAF PFGMGPRTCVG NF T EAKIALSMIL
Sbjct  415   EPEFWGDDVHLFKPDRFSEGVAKATNNNIAAFLPFGMGPRTCVGFNFATIEAKIALSMIL  474

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY+FTLSP YVH P D   + P++GVQV+L  +
Sbjct  475   QRYQFTLSPGYVHSPVDYLTIRPQHGVQVMLHKL  508



>ref|XP_002316010.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
 gb|EEF02181.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
Length=515

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/504 (52%), Positives = 378/504 (75%), Gaps = 3/504 (1%)
 Frame = +3

Query  72    SVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM  251
             S+ IYL++ LV+++ + WWTP R++  M  QGI GP Y F HG+TK++  M+ ++M KPM
Sbjct  14    SLCIYLIFTLVKVLHKLWWTPIRIQNFMAFQGIRGPSYRFIHGSTKEVLIMKKEAMAKPM  73

Query  252   FDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL  431
               +SH+IF ++ P ++TW   YG  +L+W+G K +  ++EPEL+KE+L NK+ +YPK D+
Sbjct  74    -TLSHNIFPKVLPQIYTWINTYGRNYLSWYGPKAHFVVSEPELVKEILNNKDRSYPKGDI  132

Query  432   DDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
               + + LLG  + T+EGEKW K RKL+ + F+AE+LK M+PEMIASVE++LERWK+ EG+
Sbjct  133   PAYFRLLLGNGVTTSEGEKWTKHRKLSTYAFNAENLKGMIPEMIASVEMLLERWKQNEGR  192

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++V+++  +LT+E+ISRTAFGSS++EGK IF M++ L+ I  +N+Y ++ PGIS   R+
Sbjct  193   EIEVYQELRLLTSEIISRTAFGSSYVEGKSIFDMLTKLSLIIHRNIYKLRLPGISKFWRT  252

Query  792   SDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISL  968
              DEIE+EKL +GI  +++E+++KRE K   G  + +GND+LG L+  +   +D  K IS+
Sbjct  253   QDEIESEKLVKGIHNSVMEIIKKREEKVKTGEADGFGNDFLGVLLN-SYHDADEKKRISI  311

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             + ++DE K  Y AG  +T SLL W I LL +HT+WQE+AR+E+  +FG + P  DGIA+L
Sbjct  312   EDLVDECKTFYIAGQESTNSLLSWTILLLGIHTDWQEEARKEVFNIFGQQKPNLDGIAKL  371

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             + + MI+NE +RLYPPV+ + RKVEREV++G LT+PA++ +++   ALHHDP+IWG+DVH
Sbjct  372   KILTMIINETLRLYPPVLGLMRKVEREVQIGQLTLPANMNLYIANAALHHDPEIWGEDVH  431

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RF+ GVAKATNN  AAFFPFG+GPRTCVGLNF T EAKI LSMILQ+Y FTLSP 
Sbjct  432   LFKPERFSGGVAKATNNIPAAFFPFGLGPRTCVGLNFATTEAKITLSMILQKYLFTLSPT  491

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             Y H P +   L P+NGVQVIL ++
Sbjct  492   YTHSPYEAVTLCPRNGVQVILHSL  515



>ref|XP_002316008.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
 gb|EEF02179.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
Length=513

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 376/511 (74%), Gaps = 4/511 (1%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
             AF+++  + +  L  LV+ +   WW P R++ +MRSQGI GP Y F HGNTK+I NMR  
Sbjct  5     AFYISCCMCLAFLSILVKFLKEVWWKPIRIQSMMRSQGIRGPSYKFIHGNTKEIINMRKS  64

Query  234   SMGKPMFDISHH-IFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEG  410
                 PM ++SHH +   +QPH+H W ++YG TF+ WHG++  L +TEP+LIKE+  NK G
Sbjct  65    VQSTPM-ELSHHELLPIVQPHIHAWIKLYGMTFMYWHGSQAQLVVTEPDLIKEIFNNKNG  123

Query  411   AYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLER  590
             A+PK +L  + KKLLG+ ++   GEKW K+RKL+NH FHAE LK M+P MIASVEVML+R
Sbjct  124   AFPKRNLPVYMKKLLGDGIVAANGEKWFKLRKLSNHAFHAECLKSMIPAMIASVEVMLKR  183

Query  591   WKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG  770
             W++ +GKE+DVF++F +LT+E+ISRTAFGSS+LEG+H+F M++ +  I V+N Y +  PG
Sbjct  184   WRQHDGKEIDVFQEFKLLTSEIISRTAFGSSYLEGQHVFDMLTRMGDIIVRNHYKITIPG  243

Query  771   ISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSD  947
             I    +  D+IE++KLE+ I+   + +++ REK +  G   ++G+D+LG L+ +    +D
Sbjct  244   IRKFVKMRDDIESDKLEQEIRNCFINMIKNREKAAMEGKWGDFGSDFLGILL-LAHHETD  302

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
              +K IS++ +IDE K  Y AGH TT + L W + LLA HT+WQ+KARRE+LELFG +NP 
Sbjct  303   KAKRISVEDIIDECKTFYFAGHETTRTSLTWIVLLLAFHTDWQDKARREVLELFGMQNPN  362

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
              +GI +L+T++MI+NE +RLY P I + R V +EV+LG L IPA+  I++P++ +HH+P+
Sbjct  363   PEGITKLKTVSMIINETLRLYSPAIHIPRMVRKEVRLGKLIIPANTEIYIPLVVVHHNPE  422

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
             IWG+D H+F P RFA GVAKATNNN  AF PFG+GPR+CVGLNF+  E KIAL+MILQ Y
Sbjct  423   IWGEDAHLFKPERFADGVAKATNNNMNAFLPFGLGPRSCVGLNFSFTETKIALAMILQHY  482

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             +FTLSP Y+H PA +  ++P++GVQ++L+ +
Sbjct  483   RFTLSPTYIHSPAHLLTMSPQHGVQIMLETL  513



>ref|XP_010044378.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X2 [Eucalyptus 
grandis]
Length=556

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/493 (55%), Positives = 362/493 (73%), Gaps = 3/493 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L  + WW P R+++++  QGI GPPY F HG++K+   M +Q    PM ++SH IF +
Sbjct  63    AKLWYKLWWKPHRIQRILNEQGIRGPPYKFVHGSSKESFKMITQVRDIPMNNLSHDIFPK  122

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             IQP +HTW   YG  +L+WHGT+  L ITEPELIKEVL N++  YPK    DF KKLLG+
Sbjct  123   IQPEIHTWTNTYGRNYLSWHGTQAQLVITEPELIKEVLVNRDKTYPKTPATDFVKKLLGD  182

Query  462   AL-ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L  TN  EKWAK RKLANH FH ESLK MVP M+ ++ VML RWK  EGKE+DVF+DF 
Sbjct  183   GLATTNNEEKWAKQRKLANHAFHGESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDFK  242

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT EVIS+TAFGSS++EG++IF+M++ L  +  KN+++V+FPG+S   +++DEIEAEKL
Sbjct  243   LLTCEVISKTAFGSSYIEGRNIFQMLTRLGVLLTKNLHHVRFPGLSKFWKTADEIEAEKL  302

Query  819   ERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             ++GI  AIL +V+KRE K   G   + GND+LGQL+K  + G D SK I++D ++DE K 
Sbjct  303   QKGIYDAILGIVKKREEKVKTGEAADVGNDFLGQLVK-ASRGMDNSKKITIDDLVDECKT  361

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  TT +L+ W +FLLA H  WQEKAR+E+L +FG+ +P SDGIA+L+TM+MI+NE
Sbjct  362   FYLAGQETTNALMTWVVFLLAAHPNWQEKARKEVLHVFGNNDPDSDGIAKLKTMSMIINE  421

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPVI ++R+VE++++LG L +P +I I +  L LHHDP+IWG+DV +F P RFA+
Sbjct  422   TLRLYPPVIGMSRQVEQQLRLGKLLLPTNIHIIIGNLKLHHDPKIWGEDVLLFKPERFAE  481

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+A+ATNNN   F PF  GPR C G+NF T+E KI LSMILQRY F LSP YVH P  + 
Sbjct  482   GIARATNNNPVVFIPFSFGPRICAGMNFATHEVKIILSMILQRYAFKLSPAYVHCPVQVL  541

Query  1536  ILTPKNGVQVILQ  1574
              + PK+G+QVI Q
Sbjct  542   TIGPKHGLQVIFQ  554



>ref|XP_010091621.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44887.1| Cytochrome P450 734A1 [Morus notabilis]
Length=516

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/493 (54%), Positives = 365/493 (74%), Gaps = 2/493 (0%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             +++ + WW P R+R +M  QGI GP Y F HGNTK+IS M  ++  + +  +SH+IF ++
Sbjct  25    KVLHKLWWIPTRIRHLMAMQGIKGPSYRFIHGNTKEISTMEKEARSRAILGLSHNIFPKV  84

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
             QPH+  W +IYG  +L W G + +L ITEPE IKEVL N+  AYPK D+  F +K+ G  
Sbjct  85    QPHIELWTDIYGKKYLQWLGPQAHLVITEPESIKEVLNNRNRAYPKTDVKGFVRKVFGNG  144

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVL  644
             L+T+EGEKW K+RKLAN+ FH ESL+ M P MI+SVE MLERWK  EGKE++VF++F +L
Sbjct  145   LVTSEGEKWGKMRKLANYAFHGESLRGMNPAMISSVETMLERWKNYEGKEVEVFEEFRLL  204

Query  645   TTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLER  824
             T+EVISRTAFGSS+LEGK IF M+  L  +  +N+Y V F G S   ++ DE+++E LE+
Sbjct  205   TSEVISRTAFGSSYLEGKKIFDMLQKLNLLAFRNLYKVSFSGFSKFFKTKDEVKSEMLEK  264

Query  825   GIKGAILELVRKR-EKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALY  1001
              +   ++EL++KR EK  NG  +++G+D+ G L++     +D  + IS+D M+DE K  Y
Sbjct  265   EMCDCVIELIKKREEKVMNGEEDSFGSDFFGVLIR-AHHDADEKQRISVDDMVDECKTFY  323

Query  1002  GAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECM  1181
              AG  TT  LLGW + LLA+H++WQE+AR+E+L LFG E P  DGI++L+ M+M++NE +
Sbjct  324   VAGQETTNILLGWTVLLLAVHSDWQEEARKEVLNLFGREKPNPDGISKLKIMSMVINESL  383

Query  1182  RLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGV  1361
             RLYPPVIT+TRKV RE+KLG   +PA++ +F+  LALHHDPQIWG+DV+ F P RF++GV
Sbjct  384   RLYPPVITITRKVGREIKLGKHILPANLNLFISNLALHHDPQIWGEDVNQFKPERFSEGV  443

Query  1362  akatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFIL  1541
             + ATNNNAAAFFPFG+G R+CVG+NF   EAKIALSMILQRY FTLSP YVH+P     L
Sbjct  444   STATNNNAAAFFPFGIGARSCVGMNFAITEAKIALSMILQRYSFTLSPAYVHWPFQRPTL  503

Query  1542  TPKNGVQVILQNV  1580
              P++G+QVILQ++
Sbjct  504   HPQHGIQVILQSL  516



>ref|XP_009357376.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/494 (53%), Positives = 372/494 (75%), Gaps = 3/494 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             +++  + WWTP R++ ++  QGI GP Y F HGNTK+IS+M+ ++M +P   +SH IF++
Sbjct  24    IKIFHKLWWTPIRIQNLVALQGIKGPSYRFVHGNTKEISSMQEEAMSRPK-SLSHDIFSQ  82

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+H W + YG  FL W+G +  L ITEPEL KE+L NK+ AYPK +   +A++LLG+
Sbjct  83    VQPHIHLWTKTYGANFLQWYGAQAQLIITEPELCKEILTNKDKAYPKSETKGYARRLLGD  142

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
              L+ ++GEKWAK+RKLAN+ FH E LK M P MIAS E MLE WKE +GKE+DVFK+F +
Sbjct  143   GLVVSDGEKWAKMRKLANYAFHGEILKGMAPTMIASAETMLENWKEHDGKEIDVFKEFRL  202

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
              T+EVISRTAFGSS+LEGK+IF+ +  L  ++ KN +N++FP  S   +S DEIE+EKLE
Sbjct  203   YTSEVISRTAFGSSYLEGKNIFENLEKLAYLSFKNAFNLRFPAFSRFIKSKDEIESEKLE  262

Query  822   RGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             + I+ +I+E++RKRE ++  G   ++G+D+LG L+K     +D ++  S+D+++DE K  
Sbjct  263   KSIRDSIMEMIRKREDKAMVGEEGSFGDDFLGVLIK-AHHDADENQRTSIDEIVDECKTF  321

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
             Y  G  TT+S L W +FLLA+HT+WQE+AR+E++++FG +NP  DGIA+L+ MNMI NE 
Sbjct  322   YLGGQETTSSGLAWTVFLLAIHTDWQEEARKEVIQIFGKQNPNLDGIAKLKIMNMIFNES  381

Query  1179  MRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQG  1358
             +RLYPPV+ + RK+ REV+LG   +PA++ I +P LAL H+PQIWG+DV +F P RF++G
Sbjct  382   LRLYPPVVAMERKIGREVRLGKHVLPANVEITIPCLALQHEPQIWGKDVLLFKPERFSEG  441

Query  1359  VakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             VAKAT NN AAF P+G+GPR+CVG NF T E KIALSMILQR+ FTLSP Y+H P  +  
Sbjct  442   VAKATKNNIAAFLPWGLGPRSCVGSNFATMETKIALSMILQRFSFTLSPAYIHSPYRLLT  501

Query  1539  LTPKNGVQVILQNV  1580
             + P++GVQV+L+++
Sbjct  502   VRPQHGVQVMLRSL  515



>ref|XP_008243892.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=557

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/494 (54%), Positives = 365/494 (74%), Gaps = 3/494 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             V++ ++ WW P R++K+M  QGI GP Y   HGNTK+ISNM+ ++M +P   +SH IF +
Sbjct  66    VKMFEKLWWKPVRVQKLMALQGIKGPSYRLIHGNTKEISNMKKEAMSRPK-SLSHDIFPQ  124

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+  W ++YG  +L WHG+K  L ITEPE+ KE+L NK+GA  K +   + KKLLG+
Sbjct  125   VQPHIQLWTKLYGKNYLQWHGSKAQLVITEPEICKEILNNKDGALQKTETLGYVKKLLGD  184

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
              L  + GEKW+K+RKLANH FH ESLK M+P MIAS E MLER K  EGKE++V+ +F  
Sbjct  185   GLTRSSGEKWSKLRKLANHAFHGESLKSMIPAMIASGETMLERLKNHEGKEIEVYDEFRF  244

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
              T+EVISRTAFGSS+LEGK+IF+M+  L+ +T KN   ++FPGIS + ++ DEIE+ +LE
Sbjct  245   FTSEVISRTAFGSSYLEGKNIFEMLMKLSFLTFKNALKLRFPGISKIFKTRDEIESAELE  304

Query  822   RGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             +GI+ +++E+++KREK++ G  E+ +G+D+LG L+K     ++  + IS+D ++DE K  
Sbjct  305   KGIRDSVMEVIKKREKKAMGGEEDGFGSDFLGLLLKAHHDTNE-KQRISVDDLVDECKTF  363

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
             Y AG  TT SLL W +FLLALH +WQE+AR+E+L+LFG +NP  +GI++L+TM+MI+NE 
Sbjct  364   YFAGQETTNSLLAWTVFLLALHRDWQEEARKEVLQLFGKQNPHPEGISKLKTMSMIINES  423

Query  1179  MRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQG  1358
             +RLYPPVI   RK  REV+LGNL +PA++ + +P LA HHD + WG DVH+F P RF++G
Sbjct  424   LRLYPPVIFFERKAAREVRLGNLIVPANVELQIPNLAFHHDAKFWGADVHLFKPERFSEG  483

Query  1359  VakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             VAKAT +N  AF PFGMGPRTCVG NF T E KIALSMILQ Y FTLSP YVH P     
Sbjct  484   VAKATKDNMVAFLPFGMGPRTCVGFNFATTEVKIALSMILQHYSFTLSPAYVHSPFHFLT  543

Query  1539  LTPKNGVQVILQNV  1580
             + P++GV+V L  V
Sbjct  544   VRPQHGVRVTLHPV  557



>ref|XP_008243895.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1009

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/488 (57%), Positives = 361/488 (74%), Gaps = 5/488 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM-FDISHHIFARIQPH  293
             R WW P RL+K+M SQGI GPPY   HGNTK ISNM  ++M KP     SH + + +QPH
Sbjct  29    RLWWAPARLQKLMASQGIKGPPYRLIHGNTKDISNMIKEAMSKPKSLSSSHDVLSVVQPH  88

Query  294   VHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALIT  473
             VH+W +IYG  +L WHG+K  L ITEPEL KE+L NK+ AYPK + + F KKLLG+ L T
Sbjct  89    VHSWAKIYGKNYLQWHGSKAQLVITEPELCKEILNNKDKAYPKTERESFVKKLLGDGLAT  148

Query  474   N--EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLT  647
                EGEKWAK+RKLA H FH ESLK M+P M+AS E MLERWK  EGKE+++F++F   T
Sbjct  149   TTAEGEKWAKMRKLATHAFHGESLKSMIPAMVASAETMLERWKNYEGKEIEMFEEFRFFT  208

Query  648   TEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERG  827
             +EVISRTAFGSS++EG+HIF+M+  L  +  KN   ++ PGIS L ++ DEIE+EKLE+ 
Sbjct  209   SEVISRTAFGSSYIEGQHIFEMLMKLGFLLSKNALTIRVPGISKLFKTGDEIESEKLEKD  268

Query  828   IKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYG  1004
             ++ +ILE+VRKRE K   G  +++G+D+LG L+K     +D S+ IS+D +ID+ K  Y 
Sbjct  269   VRASILEIVRKREEKVMTGGEDSFGSDFLGLLVKAHHDAND-SQRISVDDLIDDCKTFYV  327

Query  1005  AGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMR  1184
             AG  +T SLL W + LLA HT+WQE+AR+E++++FG + P  DGIA+L+TM+M++NEC+R
Sbjct  328   AGQESTNSLLAWTVLLLAHHTDWQEEARKEVIQMFGKQTPNPDGIAKLKTMSMVINECLR  387

Query  1185  LYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVa  1364
             LY PV T+ RK EREVKLG L +PA++ + M  L+LHHDP IWGQD  +F P RFA+GVA
Sbjct  388   LYSPVGTLLRKAEREVKLGKLIVPANVDLVMSCLSLHHDPLIWGQDAQLFKPERFAEGVA  447

Query  1365  katnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILT  1544
             KA+NNNA AF PFG+GPR CVGLNF T EAKIALSM+LQRY FTLSP YVH P  +    
Sbjct  448   KASNNNAGAFLPFGVGPRACVGLNFATIEAKIALSMVLQRYFFTLSPGYVHLPFQLVTNR  507

Query  1545  PKNGVQVI  1568
             P  GVQV+
Sbjct  508   PLRGVQVM  515


 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/519 (53%), Positives = 372/519 (72%), Gaps = 32/519 (6%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  I+++F     + + L+   ++++ + WWTP R++K+M  QGI GP Y F HGNTK
Sbjct  521   GGLIVILSSF-----LCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIHGNTK  575

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +ISNM+ + MG+P   +SH I + +QPH+H+W +IYG  +L WHG +  L ITEPEL KE
Sbjct  576   EISNMKKEVMGRPQL-LSHDILSVVQPHIHSWTKIYGKNYLQWHGCRAQLVITEPELCKE  634

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +L NK+ AY K +  + AKKLLG+ L+ T E EKWAK+RKLA H FH ESLK M+PEM+A
Sbjct  635   ILNNKDRAYQKREPTNIAKKLLGDGLVVTTEAEKWAKLRKLATHAFHGESLKSMIPEMVA  694

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E MLERW   EGKE++V+++F + T+EVISRTAFGSS++EG+ IF+++  L  +  KN
Sbjct  695   SAESMLERWTVYEGKEIEVYEEFRLFTSEVISRTAFGSSYVEGQDIFEILMKLGFLIFKN  754

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLM  923
                V+ PGIS   ++SDEIE+EKLE+GI  +I+E+V+KREK++  G  +++G+D+LG L+
Sbjct  755   FLKVRVPGISKFFKTSDEIESEKLEKGIHASIIEMVKKREKKTMAGEKDSFGSDFLGLLL  814

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K                          AG  TT +LL W +FLLALHT+WQE+AR+E+L+
Sbjct  815   KAN------------------------AGQETTNTLLAWTVFLLALHTDWQEEARKEVLQ  850

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG + P  DGI +L+TM+MI+NE +RLYPP ++V R VEREV+LG L +P+++ + + I
Sbjct  851   LFGKQTPNLDGIGKLKTMSMIINEALRLYPPAVSVVRNVEREVRLGKLIVPSNLDVVVSI  910

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             +A+HHDPQIWGQDV +F P RF++GVAKATNNN  AF PF MGPRTCVGLNF   EAKIA
Sbjct  911   VAVHHDPQIWGQDVQLFKPQRFSEGVAKATNNNIGAFLPFSMGPRTCVGLNFAITEAKIA  970

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSMILQRY FTLSP YVH P     + P++GVQV+L ++
Sbjct  971   LSMILQRYAFTLSPGYVHLPLHYLTVRPQHGVQVMLHSL  1009



>ref|XP_008367032.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 371/512 (72%), Gaps = 8/512 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             II+A FL     ++ +  +++++ + WWTP R++K M  QGI GPPY   HGNTK+I +M
Sbjct  9     IISASFLC----VFFVLVIIKILHKLWWTPHRIQKQMALQGIKGPPYRLIHGNTKEIFDM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
               ++M KP   +SH IF  +QPH+H+W   YG  +L W G++P L ITE EL +E+L NK
Sbjct  65    IKEAMSKPX-KLSHDIFPIVQPHMHSWTRTYGXNYLQWQGSQPQLVITELELCREILNNK  123

Query  405   EGAYPKMDLDDFAKKLLGEALITNE-GEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             + AYPK +   F +KLLG+ L+T   GEKW K+RKL  H FH ESLK M  EM+AS E +
Sbjct  124   DRAYPKSEPTGFLRKLLGDGLLTTAXGEKWKKMRKLGTHAFHGESLKSMFTEMVASAETI  183

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERWK  EGKE++VF++F + T+EVIS TAFGSS++EG++IF+M++ LT +  K+VY ++
Sbjct  184   LERWKSYEGKEIEVFEEFKLFTSEVISXTAFGSSYIEGQNIFEMLTKLTLLFFKSVYTIR  243

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
              PGIS   +SSDEIEAEKLE+GI  +I E+ +KREK+S     +++G+D+LG L+K    
Sbjct  244   LPGISKFFKSSDEIEAEKLEKGIHASIAEIFKKREKKSLTKGRDSFGSDFLGLLLKAHHD  303

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D ++ IS+D M+DE K+ Y AG  TT +LL W IFLLA HT+WQE+AR+E+++LFG +
Sbjct  304   AND-NQRISVDDMVDECKSFYIAGQETTNTLLAWTIFLLAHHTDWQEEARKEVMDLFGKQ  362

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P  DGIA L+TM+MILNE +RLY PV+   R+V+REVKLG L +PA+  +F+P LALH 
Sbjct  363   TPNPDGIANLKTMSMILNESLRLYSPVVGFVREVKREVKLGKLIVPANCELFVPNLALHR  422

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQIWG+D  +F P RF++ VAKATNNN  AF PFG+GPR+CVGLNF   EAKI LSMIL
Sbjct  423   DPQIWGEDALLFKPERFSEXVAKATNNNVXAFIPFGIGPRSCVGLNFANTEAKIVLSMIL  482

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY FTLSP YVH P     + PK GVQV+L 
Sbjct  483   QRYSFTLSPGYVHLPVQYVTIHPKLGVQVMLH  514



>ref|XP_004297208.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/514 (52%), Positives = 372/514 (72%), Gaps = 4/514 (1%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             ++++F     + ++ L  ++++    WWTP R +K+M  QGI GP Y   HGNTK+I NM
Sbjct  1     MLSSFVCLVFLVLFALILMIKIFLTQWWTPTRFQKLMARQGIKGPCYRLVHGNTKEILNM  60

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             +++++ +P   ++H +F  +QPH  +W + YG  FL W+GT+P L I EPEL KE+L NK
Sbjct  61    KTEAISRPK-PLTHDLFPLVQPHYQSWFKRYGKVFLQWYGTEPQLVILEPELCKEILNNK  119

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             +  Y + D   F KKLLG  L T EGE WAK+RK+ANH FH ESLK M+P++IAS E ML
Sbjct  120   DRVYMQKDPQGFVKKLLGNGLGTAEGEHWAKLRKIANHAFHGESLKNMIPDIIASAENML  179

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
              RWK  EGKE++V+++F +LT+EVISRTAFGSS+LEGK IF M++ L+++  +N Y ++ 
Sbjct  180   HRWKNHEGKEIEVYQEFRLLTSEVISRTAFGSSYLEGKTIFDMLTKLSSLLFRNSYKIRL  239

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES--NGVVENYGNDYLGQLMKITTG  938
             PGIS L +S DEIEA+K+E+ I+ +IL++V+KREKE+  +G  + +G+D+LG L+K    
Sbjct  240   PGISKLFKSRDEIEADKVEKDIRSSILKIVKKREKEAAVSGKGDWFGSDFLGLLLKAHHD  299

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               + SK IS+D +ID+ +A Y AG  TT  LL W +FLLALH +WQEKAR+E+ ++FG +
Sbjct  300   ADERSK-ISVDDIIDQCRAFYFAGQETTNGLLAWTVFLLALHPDWQEKARKEVTQIFGKQ  358

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             NP  DGIA+ +TM+MI+NE +RLYPPVI + RK  REV+LG   +PA+I + +P +A HH
Sbjct  359   NPNPDGIAKQKTMSMIINESLRLYPPVIQLVRKTGREVRLGKFILPANIQVLIPNVAFHH  418

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQIWG +  +F P RF++GVAKAT +N AAF PFGMGPR CVG NF T E KIALSMIL
Sbjct  419   DPQIWGPEAQLFKPERFSEGVAKATRDNMAAFLPFGMGPRICVGFNFATTETKIALSMIL  478

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY FTLSP YVH P     + P++GVQV+L ++
Sbjct  479   QRYTFTLSPGYVHSPLQFLTVRPQHGVQVMLHSL  512



>ref|XP_008364583.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/507 (54%), Positives = 378/507 (75%), Gaps = 5/507 (1%)
 Frame = +3

Query  63    LTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMG  242
             L+  + ++L++ L++++ + WW P R++K+M++QGI GPPY   HGNTK+IS+M+ + M 
Sbjct  11    LSSLLCVFLVFVLIKILHKLWWXPTRIQKMMKAQGIKGPPYRLIHGNTKEISDMKKEVMR  70

Query  243   KPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITE-PELIKEVLANKEGAYP  419
             +P  ++SH I + + PH+H+W +IYG  +L WHG+   L ITE PEL KE+++NK+ AYP
Sbjct  71    RPK-NLSHDIVSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEEPELWKEIMSNKDKAYP  129

Query  420   KMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             K +   F KKLLG+ L+T  EGEKW K+RKLA H FH E LK + P+M+AS E MLERW+
Sbjct  130   KREPTTFVKKLLGDGLVTTTEGEKWGKLRKLATHAFHGECLKSLFPDMVASAETMLERWR  189

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
               E KE++VF++F +LT+EVISRTAFGSS+LEG++IF+M+  L  +  KN   V+ PGIS
Sbjct  190   NYEEKEIEVFEEFRLLTSEVISRTAFGSSYLEGQNIFEMLMKLAFLVSKNALKVRIPGIS  249

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREK-ESNGVVENYGNDYLGQLMKITTGGSDIS  953
                ++SDEIEAEKLE+G+  +I+E+V+KREK  ++G  +++G+D+LG L+K     +D  
Sbjct  250   KFFKTSDEIEAEKLEKGVYASIMEIVKKREKTATSGDEDSFGSDFLGLLLKARHDAND-D  308

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             + IS+D ++DE K  Y AG  TT +LL W +FLLALHT WQE+AR+E++ELFG + P  D
Sbjct  309   QRISVDDLVDECKTFYFAGQETTNTLLXWTVFLLALHTNWQEEARKEVIELFGKQTPNLD  368

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             GI +L+TM+MI NE +RLYPPV    RKVEREV+LGN+ +PA++ + +   + HHDP+IW
Sbjct  369   GITKLKTMSMIFNESLRLYPPVAGFARKVEREVRLGNVIVPANVXLXISXJSFHHDPRIW  428

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             GQD  +F P RFA+GVAKATNNN  AF PFG+GPR+CVGLNF  NEAKIALSMILQRY F
Sbjct  429   GQDAQLFKPERFAEGVAKATNNNIGAFVPFGIGPRSCVGLNFAINEAKIALSMILQRYSF  488

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             TLSP YVH P     + P++GVQV+L 
Sbjct  489   TLSPGYVHLPIQYVTVRPQHGVQVMLH  515



>ref|XP_011008174.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=512

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/510 (51%), Positives = 378/510 (74%), Gaps = 5/510 (1%)
 Frame = +3

Query  54    AFFLTFS--VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMR  227
                + FS  +  +LL  L++ +++ WW P R++  M+SQGI GPPY F +G+T +I N+ 
Sbjct  3     TLLMCFSSCLCFFLLVILLKFLNKVWWAPTRVQSFMKSQGIEGPPYRFLYGSTTEILNII  62

Query  228   SQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKE  407
             +   G    ++SH+ FARI PH ++W ++YG  FL W+G +P+L +TEPE++KE+L+NK+
Sbjct  63    NAMDGGSQ-ELSHNTFARILPHAYSWVKVYGMNFLYWYGPQPHLMVTEPEMVKEILSNKD  121

Query  408   GAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLE  587
             GAY K+ ++   K+LLG+ L+T+ GEKW K+RKL N  FH ESLK M+P+MIASVEVML+
Sbjct  122   GAYKKIPVETHVKRLLGDGLVTSSGEKWFKMRKLGNQAFHGESLKAMIPDMIASVEVMLK  181

Query  588   RWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFP  767
             RW+  EG+E+D F++F VLT+EVISRTAFGSS+LEG+HIF M+ N+  I  +N Y +  P
Sbjct  182   RWRNHEGEEIDAFQEFKVLTSEVISRTAFGSSYLEGQHIFDMIMNMIDIIYRNNYRISIP  241

Query  768   GISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGS  944
              I  + +SSD+IE+E LE+ ++ +I+++++KRE+E+ +G ++ YGND+ G L+K      
Sbjct  242   FIGKIFKSSDDIESENLEKRVRESIIKMMKKREEEATSGQLDGYGNDFFGLLLK-AYHDL  300

Query  945   DISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
             D SK IS+D +IDE K +Y AG  TTTSLL W + LLA++ +WQ++ R+E+LEL G +NP
Sbjct  301   DNSKKISVDDLIDECKTIYVAGQETTTSLLSWTVLLLAIYPDWQDRVRKEVLELIGQQNP  360

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
               D + +L+ M+M++NE +RLY P   + RKV++EV+LGNL +PA++ I+M  LA H++P
Sbjct  361   GPDSMTKLKIMSMVINESLRLYAPSNYLARKVDKEVRLGNLILPANMEIYMSTLAHHYNP  420

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
             +IWG+DVH+F P RFA+GVAKATN + AAF PFGMGPRTC+G N+   E KIALSMILQ 
Sbjct  421   EIWGEDVHLFKPERFAEGVAKATNKSIAAFLPFGMGPRTCLGFNYAIIEGKIALSMILQS  480

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             Y+FTLSP YVH+P  +  + PK G+QVILQ
Sbjct  481   YRFTLSPTYVHHPVHLLTVCPKRGIQVILQ  510



>ref|XP_008219236.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=518

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/502 (52%), Positives = 368/502 (73%), Gaps = 3/502 (1%)
 Frame = +3

Query  72    SVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM  251
              V++ LL  ++++ ++ WW P R+RK+M  QGI GP +   HGNT +ISNM+ ++M +PM
Sbjct  17    CVTLLLLLAMIKMFEKLWWKPTRIRKLMALQGIKGPSFRLIHGNTIEISNMKREAMSRPM  76

Query  252   FDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL  431
               + H  F ++QPH+H W ++YG  +L WHG+KP L ITE  + K++L N +GA  K + 
Sbjct  77    -SLLHDSFPQVQPHIHLWTKLYGKNYLQWHGSKPQLVITEAAICKDILNNNDGAVQKAET  135

Query  432   DDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
               + KKLLG+ L  + GEKW+K++KLANH FH E LK M+P MIAS E MLER K  +G+
Sbjct  136   IGYVKKLLGDGLTRSSGEKWSKMKKLANHAFHGERLKSMIPAMIASGETMLERLKNHQGR  195

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++V+ +F   T+EVISRTAFGSS+LEG++IF+M+  L  +T KN + ++FPGIS + ++
Sbjct  196   EIEVYDEFRFFTSEVISRTAFGSSYLEGENIFEMLMKLAFLTFKNTHKIRFPGISKIFKT  255

Query  792   SDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISL  968
              DEIE+ +LE+GI+ + +EL++KREK++  G  E +G+D+LG L++     ++  + IS+
Sbjct  256   KDEIESAELEKGIRNSAMELIKKREKKAMAGEEEGFGSDFLGLLLEAHHDTNE-KQRISV  314

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             D ++DE K  Y AG  TTTSLL W +F+LALH +WQE+AR+E+L+LFG + P  DGIA+L
Sbjct  315   DDLVDECKTFYLAGQETTTSLLAWTVFILALHRDWQEEARKEVLQLFGKQTPNPDGIAKL  374

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM+MI+NE +RLY P++++ RK EREV+LGNL +PA++ + +P LA HHDP+ WG+DVH
Sbjct  375   KTMSMIINESLRLYSPIVSLERKTEREVRLGNLIVPANVELLLPNLAFHHDPKFWGEDVH  434

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RF++GVAKAT +N  AF PFGMGPRTCVG  F T EAKIALSMILQ + FTLSP 
Sbjct  435   LFKPERFSEGVAKATKDNMVAFLPFGMGPRTCVGFQFVTIEAKIALSMILQNHSFTLSPA  494

Query  1509  YVHYPADIFILTPKNGVQVILQ  1574
             YVH P     L P++GV+V L 
Sbjct  495   YVHSPFQFLTLRPQHGVRVTLH  516



>ref|XP_002512037.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50706.1| cytochrome P450, putative [Ricinus communis]
Length=513

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/506 (52%), Positives = 368/506 (73%), Gaps = 4/506 (1%)
 Frame = +3

Query  63    LTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMG  242
             L     +Y L  L++ + + WW P  ++  MRSQGI GP Y F  GNTK+I+NMRS+ M 
Sbjct  8     LASCFCLYFLLNLIKFLSKVWWNPICVQSSMRSQGIKGPSYRFLLGNTKEITNMRSRIMN  67

Query  243   KPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPK  422
              PM ++SH +  RIQPH++ W ++YG  FL W+G K  L ITEPEL++EVL NKEGA+ K
Sbjct  68    GPM-ELSHEMLPRIQPHIYYWIKLYGTYFLNWYGPKAQLIITEPELVQEVLNNKEGAFGK  126

Query  423   MDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE-  599
               + ++A KLLG  L  ++GEKW K+RKLAN  FH ESLK MVP M+ASVE ML+RW++ 
Sbjct  127   KHIQNYADKLLGNGLFASQGEKWLKMRKLANQAFHGESLKGMVPAMVASVETMLQRWRQN  186

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EGKE++V+++F VLT E+IS+TAFGS++LEGK+ F M++ +  I  +N Y V  PGI  
Sbjct  187   QEGKEIEVYQEFKVLTAEIISKTAFGSNYLEGKNTFDMLARMANIVARNNYRVGIPGIKK  246

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISK  956
               ++ D+  +EKLE+G++ +I+++++KRE+E   G  + YGND+LG L+K     +D +K
Sbjct  247   FLKTRDDTASEKLEQGMRDSIMKIIKKREEEMLMGKNDAYGNDFLGLLLK-AHHDNDKAK  305

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              IS++ +IDE K+ Y AGH TT+S L W + LLA+H  WQEKAR E+LELFG +NP+ DG
Sbjct  306   KISVNDLIDECKSFYVAGHETTSSSLTWTVLLLAIHPIWQEKAREEVLELFGKQNPSPDG  365

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I RL+ M+MI+NE +RLY P  ++TR+V++EVKLG L +P  +++ +P+LA+HH+PQ+WG
Sbjct  366   IRRLKIMSMIVNESLRLYTPAFSITREVQKEVKLGKLVVPEKMSVCLPVLAVHHNPQVWG  425

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             +DVH+F P RF  GVAKAT N+  AF PFG GPR+CVG+NF T E KI LSMILQ  +FT
Sbjct  426   EDVHLFKPERFIDGVAKATENSIGAFLPFGGGPRSCVGMNFATTEMKIVLSMILQHCRFT  485

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH P DI  + P+ G+Q++L+
Sbjct  486   LSPTYVHSPVDILTIRPQYGLQIMLE  511



>gb|KDO70288.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=520

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/514 (52%), Positives = 370/514 (72%), Gaps = 9/514 (2%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             L++  + F L F + I      +RL ++ WW P R + VM SQGI GP Y   +GNTK+I
Sbjct  7     LYAATSCFCLVFFLFI------IRLFNKLWWIPNRTQAVMGSQGIRGPAYRLVYGNTKEI  60

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
              ++R+Q    PM  +SH I  RI PH+ +W + YG  FLTW+G++  L IT+PELIKE+L
Sbjct  61    LSLRNQIWISPM-GLSHDILPRILPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEIL  119

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVE  575
             +N +G YPK+    F +K+LG+ L+T  GE W + RKLA   F+AESL+ M+P M+ASVE
Sbjct  120   SNSDGTYPKVQAPGFLRKILGDGLVTAGGENWHRQRKLATLAFYAESLRDMIPAMVASVE  179

Query  576   VMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYN  755
             +ML+RW+  EGKE++V ++F +LT+E+ISRTAFGSS+LEG+ IF  ++N++ +  +N Y 
Sbjct  180   IMLKRWRHSEGKEIEVSQEFKLLTSEIISRTAFGSSYLEGESIFNKLTNMSFLASRNAYK  239

Query  756   VKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKIT  932
             +K P I    ++SD++E +KLE+GI+ +I+++++ RE+++  G  E YGNDY G L+K  
Sbjct  240   IKIPLIGDFVKTSDDVEGDKLEQGIRDSIIKMMKTREEKALKGESEGYGNDYFGLLLK-A  298

Query  933   TGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFG  1112
                 D++K ISLD +IDE K  Y AGH TTT LL W I LLA HT+WQEK R E+LELFG
Sbjct  299   YHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFG  358

Query  1113  HENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILAL  1292
              +NP  DGI +L+TM+M++NE +RLYPP + ++R VEREV+LG   +PA++ + +PILA+
Sbjct  359   QKNPAPDGIGKLKTMSMVINESLRLYPPAVNISRNVEREVRLGKYILPANMELVIPILAI  418

Query  1293  HHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSM  1472
             HHDPQIWG+DV +F P RFA GVAKA+NN  AAF PF  GPR CVGLNF   EAKIALSM
Sbjct  419   HHDPQIWGEDVDLFKPERFADGVAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSM  478

Query  1473  ILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             ILQRY+F LSP+YVH P  +  L P++G+QVI Q
Sbjct  479   ILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQ  512



>ref|XP_009356448.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/494 (52%), Positives = 371/494 (75%), Gaps = 3/494 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             +++  + WWTP RL+K+M  QGI GPPY   HGNTK+I++M  ++M +P  ++SH +F+ 
Sbjct  25    IKIFHKLWWTPTRLQKLMALQGITGPPYRLIHGNTKEITDMIKEAMSRPK-NLSHDVFSV  83

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+H+W +IYG  +L WHG+K  L +T+PEL KE+L NK+ AYPK++   F KKL G+
Sbjct  84    VQPHIHSWTQIYGKNYLQWHGSKAQLIVTDPELCKEILNNKDRAYPKIETPYFEKKLFGD  143

Query  462   ALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+T  + EKWAK+RKLA H FH ESLK M P M+AS E MLE+WK  EGKE++VF++F 
Sbjct  144   GLLTTTKAEKWAKLRKLATHAFHGESLKSMTPAMVASTETMLEKWKSYEGKEIEVFQEFR  203

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             + ++EVISRTAFGS+++EGK+IF+M++ L  +  KN   ++ P IS   ++SDEIEA+KL
Sbjct  204   LFSSEVISRTAFGSNYIEGKNIFEMLAKLGVLVFKNSLTIRVPVISKFFKTSDEIEADKL  263

Query  819   ERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             E+G++ +I+E+V++RE+++ G   ++G+D+LG L+K     +D  + IS D++ +  K  
Sbjct  264   EKGLRVSIMEIVKRREEKATGGEGSFGSDFLGLLLKAYHDTND-DQRISADELFELCKEF  322

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
             Y     TT +LL W +FLLALHT+WQE+ R+E+++LFG + P +DGIA+L+TM+M++NE 
Sbjct  323   YLVAQETTNALLAWTVFLLALHTDWQEEVRKEVVDLFGKQTPNADGIAKLKTMSMVINES  382

Query  1179  MRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQG  1358
             +RLY PV T+ RK EREV+LG + +P ++ + +P LALHHDPQIWG+D+ +F P RF++G
Sbjct  383   LRLYSPVATIIRKTEREVELGKVIVPPNLELIVPNLALHHDPQIWGEDLQLFKPERFSEG  442

Query  1359  VakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             VAKAT+NN  AF PFGMG R+CVG+NFT  EAKIALSMIL+RY FTLSP YVH P     
Sbjct  443   VAKATDNNVGAFIPFGMGLRSCVGMNFTNIEAKIALSMILRRYSFTLSPGYVHLPFHYLT  502

Query  1539  LTPKNGVQVILQNV  1580
             + PK+G+QV+L ++
Sbjct  503   VRPKHGIQVMLHSL  516



>gb|KDP41351.1| hypothetical protein JCGZ_15758 [Jatropha curcas]
Length=477

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 360/477 (75%), Gaps = 5/477 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             MRSQGI GP Y F HGNTKQI+ MR +++  PM ++SHHI  RIQPH+++W ++YG  FL
Sbjct  1     MRSQGIKGPSYRFLHGNTKQIAKMRKEAIYNPM-ELSHHILPRIQPHIYSWMKLYGMNFL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
              W+G +  L +TEPEL+KE+L NKE  Y K+   D+ K +LG+ L+ + GEKW K+RKLA
Sbjct  60    LWYGARAQLTVTEPELVKEILNNKEETYCKIGFQDYIKMVLGDGLVLSTGEKWLKMRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             N+ FH E+LK MVP M+ASVE+M+ERW+  +GKE++VF++F VLT+E+ISRTAFGSS+LE
Sbjct  120   NYAFHGENLKGMVPAMLASVEMMVERWRHHDGKEIEVFQEFKVLTSEIISRTAFGSSYLE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFP--GISMLTRSSDEIEAEKLERGIKGAILELVRKRE  866
             G+ +F M+  +  I  +N Y V+ P  GI    ++ DE+E +K+++ I+  I+ +++KRE
Sbjct  180   GEEVFDMLKKMIFIVARNHYKVRIPCPGIKRFLKTGDELELDKIQKEIRDTIINMIKKRE  239

Query  867   KESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWC  1043
             K +  G ++ YG+D+LG L+K      D +K IS+D MIDE K  Y AG  TT S L W 
Sbjct  240   KATMMGELDGYGSDFLGLLIK-AYNDPDKNKRISIDDMIDECKTFYVAGQETTASSLTWT  298

Query  1044  IFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVE  1223
             + LLA+HT+WQ++AR+E+LELFG +NPT+DG+ARL+TMN+I+NE +RLYPPV  VTR+V+
Sbjct  299   VLLLAIHTDWQDEARKEVLELFGQQNPTADGVARLKTMNIIINESLRLYPPVFHVTREVQ  358

Query  1224  REVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPF  1403
             REV+LG L IP  I  ++P LALH D +IWG+D ++F P RFA GVAKATNN+ ++F PF
Sbjct  359   REVRLGQLNIPNKIETYIPTLALHTDYKIWGEDAYLFKPERFAGGVAKATNNSVSSFLPF  418

Query  1404  GMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             G+GPRTCVGLNF   E KIALSMILQRYKFTLSP+YVH P  I  + P++GVQVIL+
Sbjct  419   GLGPRTCVGLNFAITEKKIALSMILQRYKFTLSPSYVHSPVQILTMCPQHGVQVILE  475



>ref|XP_008243804.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/504 (53%), Positives = 368/504 (73%), Gaps = 3/504 (1%)
 Frame = +3

Query  72    SVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM  251
             S+ +  L  L+RL  + WWTP R +K M  QG+ GP Y   HGNTK+I +M+ ++M +P 
Sbjct  15    SMLLVFLVALIRLFGKQWWTPNRFQKFMDLQGVKGPSYRLIHGNTKEIMSMKKEAMSRPR  74

Query  252   FDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL  431
               +SH IF+ +QPH H W EI+G  FL WHGT+P L + EPEL KEV+ NK+  + K   
Sbjct  75    -SLSHDIFSAVQPHTHKWSEIFGRNFLQWHGTQPQLVVAEPELSKEVMNNKDKLFRKQKS  133

Query  432   DDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
               + KKLLG+++   EGEKW K+RKLANH FH ESLK M+P+MI S E MLERW   EGK
Sbjct  134   QGYVKKLLGDSISMAEGEKWVKLRKLANHAFHGESLKSMIPDMITSSETMLERWVNHEGK  193

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++V+++F + T+EVISRTAFG+S+L+GK+IF+M+  LT +  KN ++++ P IS   ++
Sbjct  194   EIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRFYKT  253

Query  792   SDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISL  968
             SDEI++EKLE+GI+  I  +VR RE  +  G  + +G D+LG L+K     ++ ++ IS+
Sbjct  254   SDEIKSEKLEKGIRDTIAGIVRTRESMAMTGEADGFGRDFLGVLLKAHHDTNE-NQRISV  312

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             D ++DE K  Y AG  TT SLL W IFLLAL+T+WQE+AR+E+L+LFG ENP  DG+ +L
Sbjct  313   DDIVDECKTFYFAGQETTNSLLAWTIFLLALNTDWQEEARKEVLQLFGKENPNPDGLNKL  372

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM+MILNE +RLYPPV+++ R+ ++EV+LG + +PA++ + +P L+LHHDP+ WG+DV+
Sbjct  373   KTMSMILNESLRLYPPVVSLVRETDKEVRLGKMVVPANVEVHVPNLSLHHDPKYWGEDVN  432

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             VF P RF++GVAKATNNN  AF PFG+GPRTCVG+NF   E+KIAL+MILQRY FTLSP 
Sbjct  433   VFKPERFSEGVAKATNNNMVAFIPFGLGPRTCVGMNFAIVESKIALAMILQRYSFTLSPG  492

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             YVH P     + P+ GV VIL ++
Sbjct  493   YVHSPIQFMTVRPQRGVPVILHSL  516



>ref|XP_004298348.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/502 (55%), Positives = 376/502 (75%), Gaps = 4/502 (1%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
             V + LL  L++   + WWTP RL+ +M  QGI GP Y F +GN  +I+N+R ++M +P+ 
Sbjct  6     VCVLLLLALIKAFHKLWWTPVRLQNMMALQGIRGPSYRFFYGNATEITNLRKEAMSRPI-  64

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
              +SH IF+ +QPH+H W + YG  FL WHG KP L +TEPEL KE+L NKEG Y K +  
Sbjct  65    SLSHDIFSHVQPHIHAWTKSYGKNFLQWHGVKPVLVVTEPELCKEILNNKEGVYQKPEPS  124

Query  435   D-FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
             +   KKLLG+ +   EG+KWAK+RKL+NH FH E LK M P+MI S E M+ERWK  EGK
Sbjct  125   NVIVKKLLGDGVTMTEGDKWAKLRKLSNHAFHGERLKNMFPDMITSAEAMVERWKNNEGK  184

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++VF++F +LT+EVISRTAFGSS++EGK+IF+M+  LT+I  +N+ +++FPG+S L R+
Sbjct  185   EIEVFEEFRLLTSEVISRTAFGSSYIEGKNIFEMLMKLTSIVSRNLLSIRFPGMSKLFRT  244

Query  792   SDEIEAEKLERGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMKITTGGSDISKNISL  968
             SD+IE+EK+E+GI+ +I+E+V+KREKE+    E+ +G D+LG L+K     +D  + IS+
Sbjct  245   SDDIESEKVEKGIRDSIMEIVKKREKEAKAGEEDCFGKDFLGLLLK-AHHATDDKQRISV  303

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             D++++E K  Y AG  TT +LL W   LLALH EWQE+AR+E+L+LFG + PT DG+A+L
Sbjct  304   DELLEECKTFYLAGQGTTNTLLAWTTLLLALHPEWQEEARKEVLQLFGKQPPTYDGMAKL  363

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TMNMI+NE +RLYPP I ++RKV  EV+LGN+ +PA++ + +P LALHH+PQ WG++V 
Sbjct  364   KTMNMIINETLRLYPPAILLSRKVSGEVRLGNILVPANVELLVPTLALHHEPQFWGEEVE  423

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RF++G+AKATN N AAF PFG+GPR CVG NF   EAKIA+SMILQRY FTLSP 
Sbjct  424   LFKPERFSEGIAKATNENMAAFMPFGLGPRKCVGFNFAALEAKIAMSMILQRYSFTLSPG  483

Query  1509  YVHYPADIFILTPKNGVQVILQ  1574
             YVH P    I+ P+NGVQVIL 
Sbjct  484   YVHSPFQYVIVRPQNGVQVILH  505



>ref|XP_008389250.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/487 (53%), Positives = 365/487 (75%), Gaps = 3/487 (1%)
 Frame = +3

Query  123   WWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHT  302
             WW+P RL+ ++  QGI GP Y F HGNTK+IS+M+ ++M +P   +SH IF+R+QPH+H 
Sbjct  31    WWSPIRLQNLVALQGIKGPSYRFVHGNTKEISSMQEEAMSRPK-SLSHDIFSRVQPHIHL  89

Query  303   WKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEG  482
             W + YG  FL W+G++  L ITEPEL KE+L NK+ AYPK +   + ++LLG+ L+ ++G
Sbjct  90    WTKKYGANFLQWYGSQAQLVITEPELCKEILTNKDRAYPKSEPKSYLRRLLGDGLVVSDG  149

Query  483   EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVIS  662
             EKWAK+RKLAN+ FH E LK M P +IAS E MLE WKE +G+E+DVF++F + T+EVIS
Sbjct  150   EKWAKMRKLANYAFHGEILKGMAPTVIASAETMLETWKEHDGQEIDVFEEFRLYTSEVIS  209

Query  663   RTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAI  842
             +TAFGSS+LEGK IF ++  L  ++ KN + ++FPGIS   +S+DEIE+ KLE+ I+ +I
Sbjct  210   KTAFGSSYLEGKXIFDILEKLGYLSFKNAFKLRFPGISKFIKSNDEIESAKLEKSIRDSI  269

Query  843   LELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLT  1019
             +E+++ RE K   G  +++GND+LG L+K     +D  K IS+D+++DE K  Y AG  T
Sbjct  270   MEMIKNRENKAMAGEEDSFGNDFLGVLLK-AHHDTDEKKRISIDEIVDECKTFYFAGQET  328

Query  1020  TTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPV  1199
             T S L W +FLLA+HT+WQE+AR+E++++FG +NP  DGIA+L+TM+MI NE +RLYPPV
Sbjct  329   TNSALAWTVFLLAIHTDWQEEARKEVIQIFGKQNPNLDGIAKLKTMSMIFNESLRLYPPV  388

Query  1200  ITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnn  1379
             +T+ RK+ REVKLG   +PA++   +P LAL H+PQIWG+DV +F P RF++GVAKAT N
Sbjct  389   VTIERKIRREVKLGKHVLPANVEXTIPCLALQHEPQIWGEDVLLFKPERFSEGVAKATKN  448

Query  1380  naaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGV  1559
             N AAF P+G+GPR+CVG NF   E KI LSMILQR+ FTLSP Y+H P  +  + P++GV
Sbjct  449   NIAAFLPWGLGPRSCVGSNFAAIETKIVLSMILQRFSFTLSPAYIHSPYRLLTVRPQHGV  508

Query  1560  QVILQNV  1580
             QV+L ++
Sbjct  509   QVMLHSL  515



>ref|XP_009346500.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 377/506 (75%), Gaps = 4/506 (1%)
 Frame = +3

Query  63    LTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMG  242
             L+  + ++L++ L+ ++ + WWTP R++K+M++QGI GPPY   HGNTK+IS+++ + M 
Sbjct  11    LSSLLCVFLVFVLINILHKVWWTPTRIQKMMKAQGIKGPPYRLIHGNTKEISDLKKEVMR  70

Query  243   KPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPK  422
             +P  ++SH I + + PH+H+W +IYG  +L WHG+   L ITEPEL KE+++NK+ AYPK
Sbjct  71    RPK-NLSHDIVSGVVPHIHSWSQIYGKKYLQWHGSLAQLVITEPELCKEIMSNKDKAYPK  129

Query  423   MDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
              + D FAKKLLG+ L+T  EGEKW K+RKLA H F+ E LK M P+M+AS E MLERW+ 
Sbjct  130   REPDTFAKKLLGDGLVTTTEGEKWGKMRKLATHAFNGECLKSMFPDMVASAETMLERWRN  189

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              E KE++VF++F + T+EVISRTAFGSS+LEG++IF+M+  L  +  KN   V+ PGIS 
Sbjct  190   YEEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQNIFEMMMKLAFLLSKNALTVRIPGISK  249

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISK  956
             + ++SDEIEAEKLE+G+  +I+++ +KREK + +G  +++G+D+ G L+K      D  +
Sbjct  250   IFKTSDEIEAEKLEKGVYASIMDIAKKREKTAMSGDEDSFGSDFFGLLLKARHDAID-GQ  308

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              IS+D ++DE K  Y AG  TT +LL W +FLLALHT WQE+AR+E++ELFG + P  DG
Sbjct  309   RISVDDLVDECKTFYIAGQETTNTLLAWTVFLLALHTNWQEEARKEVMELFGKQTPNLDG  368

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I +L+TM+MI NE + LYPPV    RKVEREV+LG++ +PA++ + +  L+ HHDP+IWG
Sbjct  369   ITKLKTMSMIFNESLWLYPPVAGFVRKVEREVRLGDVIVPANVALVISNLSFHHDPRIWG  428

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             QD  +F P RFA+GVAKAT+NN  AF PFG+GPR+CVGLNF  NEAKIA+SMILQRY FT
Sbjct  429   QDAQLFKPERFAEGVAKATDNNIGAFVPFGIGPRSCVGLNFAINEAKIAVSMILQRYSFT  488

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH P     + P++GVQV+L 
Sbjct  489   LSPGYVHSPIQYVTVRPQHGVQVMLH  514



>ref|XP_008356573.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/519 (52%), Positives = 377/519 (73%), Gaps = 9/519 (2%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G +  I+++F   F V +     L+++V + WWTP R++K+M++QGI GPPY   HGNTK
Sbjct  5     GGIVVILSSFLCVFXVFV-----LIKIVHKLWWTPTRIQKMMKAQGIKGPPYRLIHGNTK  59

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +IS+M+ + M +P  ++SH IF+ + PH+H+W +IYG  +L WHG+   L ITEPEL KE
Sbjct  60    EISDMKKEVMRRPK-NLSHDIFSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEPELCKE  118

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIA  566
             +++NK+ AYPK D   F KKLLG+ L+T  E EKW K+RKLA H FH E LK M P+M+A
Sbjct  119   IMSNKDKAYPKRDPTTFVKKLLGDGLVTTTESEKWGKLRKLATHAFHGECLKIMFPDMVA  178

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             S E MLERW+  E KE+++F++F + T+EVISRTAFGSS+LEG++IF+M+  L  +  KN
Sbjct  179   SAETMLERWRNNEEKEIEMFEEFRLFTSEVISRTAFGSSYLEGQNIFEMLMKLAFLVSKN  238

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLM  923
                V  PGIS   ++SDEIEA+KL +G+  +I+++  KR+K   +G   ++G+D+ G L+
Sbjct  239   ALTVGIPGISKFFKTSDEIEADKLVKGVYASIMDIANKRQKTVISGEEASFGSDFFGLLL  298

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K     SD  + IS+D ++DE K  Y AG  TT + LGW +FLLALHT WQ++AR+E++E
Sbjct  299   KAHHDASD-DQRISVDDLVDECKTFYFAGQETTNTSLGWTVFLLALHTNWQDEARKEVIE  357

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             LFG + P  DGIA+++TM+MILNE +RLYPPV +  RKVEREV+LGN+T+PA++ + +  
Sbjct  358   LFGKQAPNLDGIAKMKTMSMILNESLRLYPPVASFGRKVEREVRLGNVTVPANVELIVSN  417

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             L+ HHDP+IWG+D  +F P RFA+G+AKATNNN   F PFG+GPR+CVGLNF  NEAKI 
Sbjct  418   LSFHHDPRIWGEDTQLFKPERFAEGIAKATNNNIGVFVPFGIGPRSCVGLNFAINEAKIV  477

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSMILQRY FTL P YVH P     + P++GVQV+L ++
Sbjct  478   LSMILQRYSFTLXPGYVHLPTQYVTVRPQHGVQVMLHSL  516



>ref|XP_010044379.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86464.1| hypothetical protein EUGRSUZ_B03132 [Eucalyptus grandis]
Length=515

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 378/512 (74%), Gaps = 3/512 (1%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             I  A  L+      +LW L  L  + WW P R+++ M  QGI GPPY F HG+T++   M
Sbjct  3     ISIAIVLSSLFVFLILWSLTELARQLWWNPLRIQRTMARQGIKGPPYRFLHGSTRETMKM  62

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             R ++   PM D+SH I  ++QPH+ +W   YG  +++W+G +  L ITEPELIKEVL N+
Sbjct  63    RMEARSTPMDDLSHDILPKVQPHIDSWINTYGRNYISWYGAQAQLVITEPELIKEVLINR  122

Query  405   EGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             +  +PK+    FAK LLG+ L++  +G KWAK R+LANHTFH ESLK MVP M+ S  VM
Sbjct  123   DKTFPKIGPRSFAKYLLGDGLVSTIDGVKWAKKRRLANHTFHGESLKNMVPAMVDSAHVM  182

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LE+WK+ EG+E++VF++F +LT+EVISRTAFGSS++EG++IF+M++NL  +  +N   ++
Sbjct  183   LEKWKQQEGEEIEVFEEFKLLTSEVISRTAFGSSYVEGRNIFEMLTNLGLLVSRNALRMR  242

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
             FPGIS + +++DEIEAEKL++GI  AILE+ +KREK+   G  ++YGND+LGQL+K    
Sbjct  243   FPGISKIWKTADEIEAEKLKKGIHVAILEIAKKREKKVMAGEADDYGNDFLGQLVK-AYR  301

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D SK I++D ++DE K  Y AG  TTT++L W IFLLA+H++WQE+AR+E++++FG+E
Sbjct  302   DNDESKKITVDDLVDECKTFYFAGQETTTAMLTWVIFLLAVHSDWQEEARKEVIDVFGNE  361

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             +P SDGIA+LR ++MI+NE +RLYPPV   TRKV+++++L  L +P +  +F+  L +HH
Sbjct  362   DPNSDGIAKLRMISMIMNEALRLYPPVTGFTRKVDQQLRLRKLVLPPNTQVFIANLKIHH  421

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DP+IWG+DVH+F P RF++GV+KATNNNA  F PFG GPR CVG+NF  NEAKI LSMIL
Sbjct  422   DPEIWGEDVHLFRPERFSEGVSKATNNNAVVFLPFGFGPRMCVGMNFAMNEAKIVLSMIL  481

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY F LSP Y+H P  I  + P++G+QVIL 
Sbjct  482   QRYTFILSPGYIHSPVQILTIRPQHGLQVILH  513



>ref|XP_010044377.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X1 [Eucalyptus 
grandis]
Length=565

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/502 (54%), Positives = 362/502 (72%), Gaps = 12/502 (2%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L  + WW P R+++++  QGI GPPY F HG++K+   M +Q    PM ++SH IF +
Sbjct  63    AKLWYKLWWKPHRIQRILNEQGIRGPPYKFVHGSSKESFKMITQVRDIPMNNLSHDIFPK  122

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             IQP +HTW   YG  +L+WHGT+  L ITEPELIKEVL N++  YPK    DF KKLLG+
Sbjct  123   IQPEIHTWTNTYGRNYLSWHGTQAQLVITEPELIKEVLVNRDKTYPKTPATDFVKKLLGD  182

Query  462   AL-ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L  TN  EKWAK RKLANH FH ESLK MVP M+ ++ VML RWK  EGKE+DVF+DF 
Sbjct  183   GLATTNNEEKWAKQRKLANHAFHGESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDFK  242

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGI---------SMLTRS  791
             +LT EVIS+TAFGSS++EG++IF+M++ L  +  KN+++V+FPG+         S   ++
Sbjct  243   LLTCEVISKTAFGSSYIEGRNIFQMLTRLGVLLTKNLHHVRFPGLRGISLGILLSKFWKT  302

Query  792   SDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISL  968
             +DEIEAEKL++GI  AIL +V+KRE K   G   + GND+LGQL+K  + G D SK I++
Sbjct  303   ADEIEAEKLQKGIYDAILGIVKKREEKVKTGEAADVGNDFLGQLVK-ASRGMDNSKKITI  361

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             D ++DE K  Y AG  TT +L+ W +FLLA H  WQEKAR+E+L +FG+ +P SDGIA+L
Sbjct  362   DDLVDECKTFYLAGQETTNALMTWVVFLLAAHPNWQEKARKEVLHVFGNNDPDSDGIAKL  421

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM+MI+NE +RLYPPVI ++R+VE++++LG L +P +I I +  L LHHDP+IWG+DV 
Sbjct  422   KTMSMIINETLRLYPPVIGMSRQVEQQLRLGKLLLPTNIHIIIGNLKLHHDPKIWGEDVL  481

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RFA+G+A+ATNNN   F PF  GPR C G+NF T+E KI LSMILQRY F LSP 
Sbjct  482   LFKPERFAEGIARATNNNPVVFIPFSFGPRICAGMNFATHEVKIILSMILQRYAFKLSPA  541

Query  1509  YVHYPADIFILTPKNGVQVILQ  1574
             YVH P  +  + PK+G+QVI Q
Sbjct  542   YVHCPVQVLTIGPKHGLQVIFQ  563



>ref|XP_009356543.1| PREDICTED: uncharacterized protein LOC103947364 [Pyrus x bretschneideri]
Length=1045

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/538 (52%), Positives = 389/538 (72%), Gaps = 23/538 (4%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+ K+M SQGI GPPY F HGNTKQI+ MR ++M KP  D+SH I + +QPH+
Sbjct  31    KLWWTPTRISKLMASQGIRGPPYRFIHGNTKQIATMRKEAMSKPK-DLSHDILSVVQPHM  89

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPK----------MDLDDFAK  446
             H+W  IYG  +L WHGT+    ITEPEL KE+L NK+ AYPK            +  F +
Sbjct  90    HSWIMIYGKNYLQWHGTRAQFVITEPELCKEILNNKDRAYPKRAXXXXXXXXXAVQGFVR  149

Query  447   KLLGEALIT-NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDV  623
             KLLG+ L++  +GEKW K+RK+ANH FH ESLK M+ EM+AS E MLERWK+ +GKE++V
Sbjct  150   KLLGDGLVSATDGEKWGKLRKIANHAFHGESLKSMLSEMVASAETMLERWKDYDGKEIEV  209

Query  624   FKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEI  803
             F +F + ++EVISRTAFGSS++EGK+IF+M++N+  +  KN   ++ PGIS   ++ DEI
Sbjct  210   FGEFKLFSSEVISRTAFGSSYIEGKNIFEMLNNIGFLIFKNALTIRIPGISKFLKTRDEI  269

Query  804   EAEKLERGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMKITTGGSDISKNISLDQMI  980
             EAEKLE+ +  +I+E+V+KRE+++    E+ +G+D+LG L+K     +D  + IS+D ++
Sbjct  270   EAEKLEKAVHASIVEIVKKREEKAMTRGEDSFGSDFLGLLVKAYHDSND-DQRISVDDLV  328

Query  981   DEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMN  1160
             DE K  Y AG  T  + L W +FLLALHT+WQE+AR+E+++LFG +NP  DGIA+++TM+
Sbjct  329   DECKTFYFAGQETVNTSLTWTVFLLALHTDWQEEARKEVIQLFGKQNPNHDGIAKMKTMS  388

Query  1161  MILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNP  1340
             MI+NE +RLY P +++TRKVEREV+LG   +PA++ + +  +A+HHDPQIWG+DV +F P
Sbjct  389   MIINESLRLYTPPVSITRKVEREVRLGQFIVPANVDLVISTIAIHHDPQIWGKDVQLFKP  448

Query  1341  HRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHY  1520
              RF++GVAKATNNN  AF PFG+GPRTCVGLNF T EAKIALSMILQRY FTLSP Y+H 
Sbjct  449   DRFSEGVAKATNNNVGAFIPFGLGPRTCVGLNFATTEAKIALSMILQRYSFTLSPGYIHS  508

Query  1521  PADIFILTPKNGVQVILQNV*LLS------CPYGLSLLVRNYLK---KEIKVQSLAAA  1667
             P       P++GVQV+L ++ ++S      C + LS+L+    K   K  ++Q L A+
Sbjct  509   PLHYLTCRPQHGVQVMLHSLKIMSSLEGFLCFFILSVLISILHKLWWKPARMQKLMAS  566


 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/525 (51%), Positives = 380/525 (72%), Gaps = 8/525 (2%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             LHS+     L   +  ++L  L+ ++ + WW P R++K+M SQGI GP Y   +GNTK+I
Sbjct  525   LHSLKIMSSLEGFLCFFILSVLISILHKLWWKPARMQKLMASQGIKGPSYKLVYGNTKEI  584

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
             S+M+ ++M  P   +SH I + + PH H W  +YG  FL WHG++P L I +PEL KE+L
Sbjct  585   SSMKKETMSSPK-SLSHDILSHVLPHFHWWTNVYGKYFLQWHGSQPQLVIRDPELCKEIL  643

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASV  572
              NK+ AYPK+ + D+ KKL+G++++T  E EKW K+RKLANH FH E+LK M+P M+AS 
Sbjct  644   QNKDRAYPKLKIKDYPKKLVGDSVLTTPEYEKWTKLRKLANHAFHGENLKGMLPAMVASA  703

Query  573   EVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVY  752
             E MLERWK  EGKE++VF++F ++T+EVIS+TAFGSS+LEGK IF+++  L     KN Y
Sbjct  704   ESMLERWKNYEGKEIEVFEEFKLMTSEVISKTAFGSSYLEGKLIFELLMKLCFFAFKNFY  763

Query  753   NVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES---NGVVENYGNDYLGQLM  923
              V+FPG+S   ++SDE EAEK+E+ +  +++E+++KRE+++   NG  + +G+DYLG L+
Sbjct  764   TVRFPGMSKFYKTSDEREAEKIEKALHNSVMEIIKKREEKAILRNGEEDRFGSDYLGLLL  823

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
             K      D  + IS++ +I+E KA Y AG  TTT LL W + LLA+H +WQEKAR+E+L+
Sbjct  824   KAHHDADD-KQRISVEDLINECKAFYFAGQETTTVLLAWTVLLLAIHADWQEKARKEVLQ  882

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
             +FG   P +DGI++L+TM+MILNE +RLYPPV++++R V++E +LG   +P ++ + +PI
Sbjct  883   IFGERTPNADGISKLKTMSMILNESLRLYPPVVSISRTVKKEARLGKFMVPVNLELVIPI  942

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             LALHH+P+ WG D  +F P RF+ GVAKATNNN  AF PFG+GPRTC G+NF  NEAK+A
Sbjct  943   LALHHEPEFWGPDAQLFKPDRFSDGVAKATNNNMGAFMPFGIGPRTCAGINFVANEAKVA  1002

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV*LLSCP  1598
             LSMILQRY F+LSP Y+H P  +  L P++GVQVIL    L+ CP
Sbjct  1003  LSMILQRYSFSLSPAYIHSPFQLLTLRPRHGVQVILHP--LMDCP  1045



>gb|KDO70287.1| hypothetical protein CISIN_1g039293mg [Citrus sinensis]
Length=512

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/494 (53%), Positives = 372/494 (75%), Gaps = 5/494 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS-MGKPMFDISHHIF  275
             +++L+++ WWTP R++  MRSQGI GP Y F HGN K+I NM+++  M     ++SH IF
Sbjct  20    VIKLLNKIWWTPIRIQSQMRSQGIKGPSYKFFHGNNKEIINMKNEMIMSSSPMELSHQIF  79

Query  276   ARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLL  455
                +PH+++W ++YG  FL WHG++  L + EP+LIKE++ N   ++PK +  ++ K LL
Sbjct  80    PITEPHIYSWIKLYGTNFLMWHGSQAELVVAEPKLIKEIMNNNR-SFPKREPREYLK-LL  137

Query  456   GEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDF  635
             G  L+T  GEKW K RKLA + FHAE+LK M+P+MIASV++MLERW++ EGKE+D +++ 
Sbjct  138   GNGLVTTRGEKWLKKRKLAVNAFHAENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREI  197

Query  636   GVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEK  815
              VLT+E+ISRTAFGS +LEG++IF M++ +  I  K  Y ++ PGI  L +++D+IE++K
Sbjct  198   KVLTSEIISRTAFGSCYLEGENIFNMLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDK  257

Query  816   LERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIK  992
             LE+ I+ +I+++V+KRE     G  E+YGND LG LM+     +D ++ ISLD +IDE K
Sbjct  258   LEQDIRDSIIKVVKKRESNVLTGEAESYGNDLLGILMR-AYHSADETQKISLDDLIDECK  316

Query  993   ALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILN  1172
               Y AG  TT SLL W IFLLA+H++WQ+KAR+E+LEL G +NP++D I+RL+ + MI+N
Sbjct  317   TFYVAGTDTTASLLSWTIFLLAIHSDWQDKARKEVLELLGQQNPSADNISRLKIVGMIIN  376

Query  1173  ECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
             E +RLYPP +   R+V++EVKLG+L +PA++ + +P++A+HHDPQIWG+D H++ P RFA
Sbjct  377   ETLRLYPPFVVFVREVKKEVKLGDLIVPANVDVTIPVIAVHHDPQIWGEDFHLYKPERFA  436

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             QGV KAT+NN AAF PFG+GPRTCVG NFT  EAKIALSMIL+RYKFTLSPNYVH P   
Sbjct  437   QGVPKATSNNMAAFLPFGLGPRTCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVPR  496

Query  1533  FILTPKNGVQVILQ  1574
               L P++G+QV+L+
Sbjct  497   ITLCPQHGIQVMLR  510



>ref|XP_004298350.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/510 (54%), Positives = 371/510 (73%), Gaps = 8/510 (2%)
 Frame = +3

Query  66    TFSVSIYLLWKLVRLV----DRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
             + S++  LL+ LV L+     + WW P RL+  M SQGI GP Y+  HGNTKQ++NM  +
Sbjct  10    SLSITNLLLFSLVILIFNIFRKIWWIPTRLQNFMASQGIKGPSYTLIHGNTKQVANMYRE  69

Query  234   SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGA  413
             +M KPM D SH I   + PHVH W  IYG  FL W GT+  L +TEPEL KE+  NK+GA
Sbjct  70    AMSKPMLDFSHDIVPVVLPHVHAWSNIYGKNFLLWQGTQAQLVVTEPELCKEIFNNKDGA  129

Query  414   YPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERW  593
             YPK    +  K LLG  L   EGEKWAK RKLANHTFH ESLK M+P+MI S E M+ERW
Sbjct  130   YPK-PTSEIPKLLLGNGLPLLEGEKWAKSRKLANHTFHGESLKNMIPQMIVSAETMVERW  188

Query  594   KELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGI  773
             K L G+E++VF++F +LT EVISRTAFGSS+L+G+ IF M+  LT++       +K P I
Sbjct  189   KNL-GQEIEVFQEFRLLTAEVISRTAFGSSYLQGQQIFDMLMKLTSLISTFDLRLKLPII  247

Query  774   SMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDI  950
             S   ++SDEIEAEKL++GI+ +++E+V++RE+++ +G  E++G+D+LG L+K     +D 
Sbjct  248   SKFFKTSDEIEAEKLQKGIRNSVMEIVKEREEKAMSGGEESFGSDFLGSLLKAYHDTND-  306

Query  951   SKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTS  1130
              +  S+D ++DE K+ Y AG  T  +LL W +FLLA HTEWQE+AR+E+LE+FG E P  
Sbjct  307   KQRFSIDDIVDECKSFYFAGQETVNTLLAWTVFLLAHHTEWQEEARKEVLEIFGKETPNP  366

Query  1131  DGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQI  1310
             + +++L+TM+MI+NE +RLY P++ VTR +ER+VKLGNL +PAD+ + +P LA+HHD Q 
Sbjct  367   NDLSKLKTMSMIINEALRLYSPILYVTRNIERKVKLGNLVVPADVELLIPFLAIHHDLQF  426

Query  1311  WGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYK  1490
             WG+D H+F P RF++GVAKATNNN A F PFGMGPR CVGL+F T EAKIALSMILQRY 
Sbjct  427   WGEDAHLFKPERFSEGVAKATNNNMATFLPFGMGPRNCVGLHFGTTEAKIALSMILQRYS  486

Query  1491  FTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             FTLSP YVH P+    L P++GVQV+L ++
Sbjct  487   FTLSPGYVHAPSRQLALRPRHGVQVMLHSL  516



>ref|XP_007224838.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
 gb|EMJ26037.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
Length=501

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/501 (52%), Positives = 367/501 (73%), Gaps = 3/501 (1%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             +  L  L+RL  + WWTP R +K M  QG+ GP Y+  HGNTK+I +M+ ++M +P   +
Sbjct  3     LVFLVALIRLFYKQWWTPNRFQKFMDLQGVKGPSYTLVHGNTKEIMSMKKEAMSRPR-SL  61

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             SH IF+ +QPH H W +++G  FL W+GT+P L + EPEL KEV+ NK+  + K     +
Sbjct  62    SHDIFSAVQPHTHKWSKMFGRNFLQWYGTQPQLVVAEPELSKEVMNNKDRIFRKQKSQGY  121

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELD  620
              KK+LGE++  +EGEKW K+R+LANH FH ESLK M+PEMI S E MLERW   EGKE++
Sbjct  122   TKKILGESISMSEGEKWVKLRRLANHAFHGESLKSMIPEMITSSETMLERWVNHEGKEIE  181

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDE  800
             V+++F + T+EVISRTAFG+S+L+GK+IF+M+  LT +  KN ++++ P IS L +  DE
Sbjct  182   VYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRLYKPRDE  241

Query  801   IEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQM  977
             IE EKLE+G++  I  +VRKRE K   G  + +G D+LG L+K     +D ++ IS+D++
Sbjct  242   IEMEKLEKGVRDTIAGIVRKRESKAMTGDADGFGRDFLGVLLK-AHHDTDENQRISMDEI  300

Query  978   IDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTM  1157
             +DE K  Y AG  TT SLL W IFLLA +T+WQE+AR+E+L+LFG ENP  DG+ +L+TM
Sbjct  301   VDECKTFYFAGQETTNSLLAWTIFLLAQNTDWQEEARKEVLQLFGKENPNPDGLNKLKTM  360

Query  1158  NMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFN  1337
             +MI NE +RLYPPV+++ R+ E+EV+LG + +PA++ + +P L+LHHDP+ WG+DV+VF 
Sbjct  361   SMIFNESLRLYPPVVSLIRETEKEVRLGKMVVPANVEVHVPNLSLHHDPKYWGEDVNVFK  420

Query  1338  PHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVH  1517
             P RF++GVAKATNNN  AF PFG+GPRTCVG+NF   E+KIAL+MILQRY FTLSP YVH
Sbjct  421   PERFSEGVAKATNNNIVAFIPFGLGPRTCVGMNFAIVESKIALAMILQRYSFTLSPGYVH  480

Query  1518  YPADIFILTPKNGVQVILQNV  1580
              P     + P++G+ VIL ++
Sbjct  481   SPIQFMTVRPQHGIPVILHSL  501



>ref|XP_007226407.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
 gb|EMJ27606.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
Length=500

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/499 (52%), Positives = 367/499 (74%), Gaps = 3/499 (1%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             + LL  ++++ ++ WW P  +RK+M  QGI GP Y F HGNT +ISNM+ ++M +PM  +
Sbjct  2     LLLLSAMIKMFEKLWWKPTHIRKLMALQGIKGPSYRFIHGNTIEISNMKREAMSRPM-SL  60

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
              H  F + QPH+H W ++YG  +L WHG+KP L ITE  + K++L N +GA  K +   +
Sbjct  61    FHDSFPQAQPHIHLWTKLYGKNYLQWHGSKPQLVITEAAICKDILNNNDGAVQKAETIGY  120

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELD  620
              KKLLG+ L  + GEKW+K++KLANH FH E LK M+P MIAS E MLER K  +G+E++
Sbjct  121   VKKLLGDGLTRSSGEKWSKMKKLANHAFHGERLKSMIPAMIASGETMLERLKNHQGREIE  180

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDE  800
             V+ +F   T+EVISRTAFGSS+LEG++IF+M+  L  +T KN + ++FPGIS + ++ DE
Sbjct  181   VYDEFRFFTSEVISRTAFGSSYLEGENIFEMLMKLAFLTFKNTHKIRFPGISKIFKTRDE  240

Query  801   IEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQM  977
             IE+ +LE+GI+ +++EL++KREK++  G  + +G+D+LG L++     ++  + IS+D +
Sbjct  241   IESAELEKGIRNSVMELIKKREKKAMAGEEDGFGSDFLGLLLEARHDTNE-KQRISVDNL  299

Query  978   IDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTM  1157
             +DE K  Y AG  TTTSLL W +FLLALH +WQE+AR+E+L+LFG + P  DGIA+L+TM
Sbjct  300   VDECKTFYLAGQETTTSLLAWTVFLLALHRDWQEEARKEVLQLFGKQTPNPDGIAKLKTM  359

Query  1158  NMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFN  1337
             +MI+NE +RLY P++++ RK EREV+LGNLT+PA++ + +P LA H DP+ WG+DVH+F 
Sbjct  360   SMIINESLRLYSPIVSLERKTEREVRLGNLTVPANVELLLPNLAFHLDPKFWGEDVHLFK  419

Query  1338  PHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVH  1517
             P RF++GVAKAT +N  AF PFGMGPRTCVG +F T EAKIALSMILQ + FTLSP YVH
Sbjct  420   PERFSEGVAKATKDNMVAFLPFGMGPRTCVGFHFVTIEAKIALSMILQNHSFTLSPAYVH  479

Query  1518  YPADIFILTPKNGVQVILQ  1574
              P     L P++GV+V L 
Sbjct  480   SPFQFLTLRPQHGVRVTLH  498



>ref|XP_008346697.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/507 (54%), Positives = 377/507 (74%), Gaps = 5/507 (1%)
 Frame = +3

Query  63    LTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMG  242
             L+  + ++L++ L++++ + WWTP R++K+M++QGI GPPY   HGNTK+IS+M+ + M 
Sbjct  11    LSSLLCVFLVFVLIKILHKLWWTPTRIQKMMKAQGIKGPPYRLIHGNTKEISDMKKEVMR  70

Query  243   KPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITE-PELIKEVLANKEGAYP  419
             +P  ++SH I + + PH+H+W +IYG  +L WHG+   L ITE PEL K +L+NK+ +YP
Sbjct  71    RPK-NLSHDIVSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEEPELCKVILSNKDKSYP  129

Query  420   KMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             K +     KKLLG+ L+T  E EKW K+RKLA H F+ E LK M P+M+AS E MLERW+
Sbjct  130   KREPTTLEKKLLGDGLVTTPEAEKWGKLRKLATHAFNGECLKSMFPDMVASAETMLERWR  189

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
               E KE++VF++F + T+EVISRTAFGSS+LEG+ IF+M+  L  +  KN   V+ PGIS
Sbjct  190   NYEEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQXIFEMLMKLAFLVSKNALXVRIPGIS  249

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREK-ESNGVVENYGNDYLGQLMKITTGGSDIS  953
              + ++SDEIEAEKLE+G+  +I+++ +KREK  ++G  +++G+D+LG L+K     +D  
Sbjct  250   KVFKTSDEIEAEKLEKGVYASIMDIAKKREKTATSGDEDSFGSDFLGLLLKARHDAND-D  308

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             + IS+D ++DE K  Y AG  TT +LLGW +FLLALHT WQE+AR+E++ELFG + P  D
Sbjct  309   QRISVDDLVDECKTFYFAGQETTNTLLGWTVFLLALHTNWQEEARKEVIELFGKQTPNLD  368

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             GI +L+TM+MI NE +RLYPPV    RKVEREV+LGN+ +PA++ +F+  L+ HHDP+IW
Sbjct  369   GITKLKTMSMIFNESLRLYPPVAGFARKVEREVRLGNVIVPANVVLFISKLSFHHDPRIW  428

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             GQD  +F P RFA+GVAKATNNN  AF PFG+GPR+CVGLNF  NEAKIALSMILQRY F
Sbjct  429   GQDAQLFKPERFAEGVAKATNNNIGAFVPFGIGPRSCVGLNFAINEAKIALSMILQRYSF  488

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             TLSP YVH P     + P++GVQV+L 
Sbjct  489   TLSPGYVHLPIQYVTVRPQHGVQVMLH  515



>ref|XP_007222983.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
 gb|EMJ24182.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
Length=516

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/504 (53%), Positives = 367/504 (73%), Gaps = 3/504 (1%)
 Frame = +3

Query  72    SVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM  251
             S+ +  L  L+RL  + WWTP R +K M  QG+ GP Y   HGNTK+I +M+ ++M +P 
Sbjct  15    SMLLVFLVALIRLFYKQWWTPNRFQKFMDLQGVKGPSYRLIHGNTKEIMSMKKEAMSRPR  74

Query  252   FDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL  431
               +SH IF+ +QPH H W +I+G  FL WHGT+P L I EPEL KE++ NK+  + K   
Sbjct  75    -SLSHDIFSAVQPHTHKWSKIFGRNFLQWHGTQPQLVIAEPELSKEIMNNKDKLFRKQKS  133

Query  432   DDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
               + KKLLG+++   EGEKW K+RKLANH FH ESLK M+PEMI S E MLERW   EGK
Sbjct  134   QGYVKKLLGDSISMAEGEKWVKLRKLANHAFHGESLKGMIPEMITSSETMLERWVNHEGK  193

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++V+++F + T+EVISRTAFG+S+L+GK+IF+M+  LT +  KN ++++ P IS   ++
Sbjct  194   EIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRFYKT  253

Query  792   SDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISL  968
             SDEI++EKLE+GI+  I  +VRKRE  +  G  + +G D+LG L+K     ++ ++ IS+
Sbjct  254   SDEIKSEKLEKGIRNTIAGIVRKRESMAMTGEADGFGRDFLGVLLKAHHDTNE-NQRISV  312

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             D ++DE K  Y AG  TT SLL W IFLLAL T+WQE+AR+E+L+LFG ENP  DG+ +L
Sbjct  313   DDIVDECKTFYFAGQETTNSLLAWTIFLLALDTDWQEEARKEVLQLFGKENPNPDGLNKL  372

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM+MILNE +RLYPPV+++ R+ ++EV+LG + +PA++ + +P L+LHHDP+ WG+DV+
Sbjct  373   KTMSMILNESLRLYPPVVSLVRETDKEVRLGKMVVPANVEVHVPNLSLHHDPKYWGEDVN  432

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             VF P RF++GVAKATNNN  AF PFG+G RTCVG+NF   E+KIAL+MILQRY FTLSP 
Sbjct  433   VFKPERFSEGVAKATNNNMVAFIPFGLGSRTCVGMNFAIVESKIALAMILQRYSFTLSPG  492

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             YVH P     + P+ GV VIL ++
Sbjct  493   YVHSPIQFMTVRPQRGVPVILHSL  516



>gb|KCW86467.1| hypothetical protein EUGRSUZ_B03135 [Eucalyptus grandis]
Length=515

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/512 (53%), Positives = 376/512 (73%), Gaps = 3/512 (1%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             I  A  L+      +LW L  L  + WW P R+++ M  QGI GPPY F HG+T++   M
Sbjct  3     ISIAIVLSSLFVFLILWSLTELARQLWWNPLRIQRTMARQGIKGPPYRFLHGSTRETMKM  62

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             R ++   PM D+SH I  ++QPH+ +W   YG  ++ W+G +  L ITEPELIKEVL N+
Sbjct  63    RMEARSTPMDDLSHDILPKVQPHIDSWINTYGRNYINWYGAQAQLVITEPELIKEVLINR  122

Query  405   EGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             +  +PK     FAK LLG+ L++  +G KWAK R+LANHTFH ESLK MVP M+ S  VM
Sbjct  123   DKTFPKTVPRSFAKYLLGDGLVSTIDGVKWAKKRRLANHTFHGESLKNMVPAMVDSAHVM  182

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LE+WK+ EG+E++VF++F +LT+EVISRTAFGSS++EG++IF+M++NL  +  +N   ++
Sbjct  183   LEKWKQREGEEIEVFEEFKLLTSEVISRTAFGSSYVEGRNIFEMMTNLGLLVSRNALRMR  242

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
             FPGIS + ++ DEIEAEKL++GI  AILE+ +KREK+   G  ++YGND+LGQL+K    
Sbjct  243   FPGISKIWKTVDEIEAEKLKKGIHVAILEIAKKREKKVMAGEADDYGNDFLGQLVK-AYH  301

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D SK I++D ++DE K  Y AG  TTT++L W IFLLA+H++WQE+AR+E+L++FG+E
Sbjct  302   DNDESKKITIDDLVDECKTFYFAGQETTTAMLTWVIFLLAVHSDWQEEARKEVLDVFGNE  361

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             +P  DGIA+LR ++MI+NE +RLYPPVI  +RKV+++++LG L +P +  +F+  L +HH
Sbjct  362   DPDFDGIAKLRMISMIMNEALRLYPPVIGFSRKVDQQLRLGKLVLPPNTQVFIANLKIHH  421

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DP+IWG+DVH+F P RF++GV+KATNNNA  F PFG GPR CVG+NF  NEAKI LSMIL
Sbjct  422   DPEIWGEDVHLFRPERFSEGVSKATNNNAVVFLPFGFGPRMCVGMNFAMNEAKIVLSMIL  481

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY F LSP Y+H P  I  + P++G+QVIL 
Sbjct  482   QRYTFILSPGYIHSPVQILTIRPQHGLQVILH  513



>ref|XP_004297210.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/497 (54%), Positives = 367/497 (74%), Gaps = 6/497 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             +++  + WWTP R++K+M  +GI GPPY   +GN K+I NM+ ++   P  ++SH IF R
Sbjct  18    IKVFHKLWWTPIRIQKLMSLRGIKGPPYRLLYGNGKEIINMQKEAALMPR-NLSHDIFPR  76

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             + PH+H+W + YG  FL W+G +P L +TEPE  KE+  NK+GA+PK    D  KKL G+
Sbjct  77    LHPHIHSWSKRYGKNFLMWYGVQPVLVVTEPESCKEIFNNKDGAFPKPKPSDIVKKLFGD  136

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
             +L   E EKWA +RKLANH FH ESLK M P+M AS E M+ERWK  EGKE DVF++F +
Sbjct  137   SLAMTEDEKWANLRKLANHAFHGESLKAMFPDMTASAEAMIERWKNHEGKETDVFEEFRL  196

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK--FPGISM-LTRSSDEIEAE  812
             LT+EVI+RTAFGSS+LEG++IF+M+ NL+ I  KN+Y  K  FPGIS  + R+S EIEA+
Sbjct  197   LTSEVIARTAFGSSYLEGQNIFEMLKNLSIIVFKNLYKYKTRFPGISSKVYRTSGEIEAD  256

Query  813   KLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEI  989
             KLE+ I+ +++E+V+KRE K S+G  E++G+D+LG L+K     +D  K  S+D +++E 
Sbjct  257   KLEKEIQDSVMEIVKKREQKASSGEGESFGSDFLGLLLKSHHDINDDQK-FSIDNVVEEC  315

Query  990   KALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMIL  1169
             KALY  G  TT++LL W +FLLA H EWQE+AR+E+L+LFG E P SDGI++L+TM+MI+
Sbjct  316   KALYFVGQETTSTLLSWTVFLLAQHPEWQEEARKEVLQLFGKETPNSDGISKLKTMSMII  375

Query  1170  NECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRF  1349
             NE +RLYPPV  + R V REVKLG + +PA++ + +P +ALHHD QIWGQ+  +F P RF
Sbjct  376   NETLRLYPPVNLIGRIVPREVKLGAVQVPANVELLIPTVALHHDSQIWGQEAALFKPERF  435

Query  1350  AQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPAD  1529
             ++GVAKATN+N  +F PFGMGPR C G+NF +NEAKIALSMILQ Y FTLSP YVH P  
Sbjct  436   SEGVAKATNDNMGSFSPFGMGPRMCAGINFASNEAKIALSMILQHYSFTLSPAYVHSPFQ  495

Query  1530  IFILTPKNGVQVILQNV  1580
                + P++GVQVIL ++
Sbjct  496   FLTVRPQHGVQVILHSL  512



>ref|XP_002325505.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
 gb|EEE99886.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
Length=567

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/506 (52%), Positives = 375/506 (74%), Gaps = 5/506 (1%)
 Frame = +3

Query  54    AFFLTFS--VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMR  227
                + FS  +  +LL  L++ +++ WW P R++ +M+SQGI GPPY F +G+T +I N+ 
Sbjct  3     TLLMCFSSCLCFFLLVILLKFLNKVWWAPIRVQSLMKSQGIEGPPYRFLYGSTTEILNII  62

Query  228   SQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKE  407
             +   G    ++SH+ FARI PH ++W ++YG  FL W+G +P+L +TEPEL+KE+L+NK+
Sbjct  63    NAMDGSSQ-ELSHNTFARILPHAYSWVKVYGMNFLYWYGPQPHLMVTEPELVKEILSNKD  121

Query  408   GAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLE  587
             G Y K+ ++   K+LLG+ L+T+ GEKW K+RKL N  FH ESLK M+P+MIASVEVML+
Sbjct  122   GDYKKIPVETHVKRLLGDGLVTSSGEKWFKMRKLGNQAFHGESLKGMIPDMIASVEVMLK  181

Query  588   RWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFP  767
             RW+  EGKE+D F++F VLT+EVISRTAFGSS+LEG+HIF M+ N+  I  +N Y +  P
Sbjct  182   RWRNHEGKEIDTFQEFKVLTSEVISRTAFGSSYLEGQHIFDMIMNMIDIIYRNNYRISIP  241

Query  768   GISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGS  944
              I  + +SSD+IE+E LE+ ++ +I+++++KRE+E+ +G ++ YGND+ G L+K      
Sbjct  242   FIGKIFKSSDDIESENLEKRVRESIIKMMKKREEEATSGHLDGYGNDFFGLLLK-AYHDP  300

Query  945   DISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
             D SK IS+D +IDE K +Y AG  TTTSLL W + LLA+  +WQ+K R+E+LEL G +NP
Sbjct  301   DNSKKISVDDLIDECKTIYVAGQETTTSLLSWTVLLLAICPDWQDKVRKEVLELIGQQNP  360

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
             + D + +L+ M+M++NE +RLY P   + RKV++EV+LGNL +PA++ I+M  LA H++P
Sbjct  361   SPDRMTKLKIMSMVINESLRLYAPSNYLARKVDKEVRLGNLILPANMEIYMSTLAHHYNP  420

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
             +IWG+DVH+F P RFA+GVAKATN + A FFPFGMGPRTC+G N+   E KIALSMILQR
Sbjct  421   EIWGEDVHLFKPERFAEGVAKATNKSIATFFPFGMGPRTCLGFNYAIIEGKIALSMILQR  480

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQ  1562
             Y+FTLSP YVH+P  +  + PK G+Q
Sbjct  481   YRFTLSPTYVHHPVHLLTVCPKRGIQ  506



>ref|XP_010049897.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82724.1| hypothetical protein EUGRSUZ_C04101 [Eucalyptus grandis]
Length=514

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/490 (53%), Positives = 361/490 (74%), Gaps = 3/490 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+ + WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMKIRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             IQP V+TW + YG  +L WHG +  L ITEP+LIKEVL N+E  YPK    DFAKKLLG+
Sbjct  79    IQPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKTGTKDFAKKLLGD  138

Query  462   ALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+ TN+G+KWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF +F 
Sbjct  139   GLVSTNDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EG++IF+M++ L  +T KN +N++ PGI  L +++DE+EAEKL
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRLPGIRKLWKTADEVEAEKL  258

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+ +IL+++++REK+   G  + +G+D+LGQL+K     +D SK  ++D ++DE K 
Sbjct  259   EKGIRNSILQMIKRREKKVMAGEEDGFGDDFLGQLVK-ALHDTDKSKKFTVDNLVDECKT  317

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  T  S++ W +FLLA + EWQE+ARRE+L +FG+ +P SDG+ +L+ ++MI+NE
Sbjct  318   FYIAGQETANSMMTWMLFLLATNLEWQEEARREVLNVFGNRDPDSDGLGKLKKISMIMNE  377

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV+ +TRKV ++++LG L +PA   IF+P L LHHDP+IWG+D H F P RF++
Sbjct  378   TLRLYPPVVGLTRKVGKKLRLGRLVLPAKSQIFIPTLKLHHDPKIWGEDAHEFKPERFSE  437

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AKATNNNA  F PFG GPR+CVG++F   EAKI LSMILQRY F LSP Y+H P  + 
Sbjct  438   GIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKILLSMILQRYTFELSPTYIHCPGQLL  497

Query  1536  ILTPKNGVQV  1565
                P++G+Q+
Sbjct  498   TTRPQHGLQI  507



>ref|XP_007224155.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
 gb|EMJ25354.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
Length=493

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/495 (54%), Positives = 362/495 (73%), Gaps = 3/495 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             L+RL  + WWTP R +K M  QG+ GP Y   HGNTK+I +++ ++M +P   +SH IF 
Sbjct  1     LIRLFYKQWWTPNRFQKFMDLQGVKGPFYRLIHGNTKEIMSLKKEAMSRPR-SLSHDIFP  59

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
              +QPH H W +I+G  FL WHGT+P L I EPEL KEV+ NK+  + K     + KKLLG
Sbjct  60    AVQPHTHKWSKIFGTNFLQWHGTQPQLVIAEPELSKEVMNNKDKLFRKQKSQGYVKKLLG  119

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
             +++   EGEKW K+RKLANH FH ESLK M+PEMI S E MLERW   EGKE++V+++F 
Sbjct  120   DSISMAEGEKWVKLRKLANHAFHGESLKSMIPEMITSSETMLERWVNHEGKEIEVYEEFR  179

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             + T+EVISRTAFG+S+L+GK+IF+M+  LT +  KN ++++ P IS   ++SDEI++EKL
Sbjct  180   LFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRFYKTSDEIKSEKL  239

Query  819   ERGIKGAILELVRKREK-ESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+  I  +VRKRE     G  + +G+D+LG L+K     ++ ++ IS+D ++DE K 
Sbjct  240   EKGIRDIIAGIVRKRESMAKTGDADGFGHDFLGVLLKAHHDTNE-NQRISVDDIVDECKT  298

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  TT SLL W IFLLAL T+WQE+AR+E+L+LFG ENP  DG+ +L+TM+MILNE
Sbjct  299   FYFAGQETTNSLLAWTIFLLALDTDWQEEARKEVLQLFGKENPNPDGLNKLKTMSMILNE  358

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV+++ R+ ++EV+LG + +PA++ + +P L+LHHDP  WG+DV+VF P RF++
Sbjct  359   SLRLYPPVVSLVRETDKEVRLGKMVVPANVEVHVPNLSLHHDPTYWGEDVNVFKPERFSE  418

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             GVAKATNNN  AF PFG+GPRTCVG+NF   EAKIAL+MILQRY FTLSP YVH P    
Sbjct  419   GVAKATNNNIVAFIPFGLGPRTCVGMNFAIVEAKIALAMILQRYSFTLSPGYVHSPIQFM  478

Query  1536  ILTPKNGVQVILQNV  1580
              + P+ GV VIL ++
Sbjct  479   TVRPQRGVPVILHSL  493



>ref|XP_009346501.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=517

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/507 (53%), Positives = 378/507 (75%), Gaps = 5/507 (1%)
 Frame = +3

Query  63    LTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMG  242
             L+  + ++L++ L++++ + WWTP R++K+M++QGI GPPY   HGNTK+IS+++ + M 
Sbjct  11    LSSLLCVFLVFVLIKILHKLWWTPTRIQKMMKAQGIKGPPYRLIHGNTKEISDLKKEVMR  70

Query  243   KPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITE-PELIKEVLANKEGAYP  419
             +P  ++SH I + + PH+H+W +IYG  +L WHG+   L ITE PEL KE+++NK+ AYP
Sbjct  71    RPK-NLSHDIVSGVVPHIHSWSQIYGKKYLQWHGSLAQLVITEEPELCKEIMSNKDKAYP  129

Query  420   KMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             K + D F KKLLG+ L+T  EGEKW K+RKLA H F+ E LK M P+M+AS E MLERW+
Sbjct  130   KREPDTFVKKLLGDGLVTTTEGEKWGKMRKLATHAFNGECLKSMFPDMVASAETMLERWR  189

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
               E KE++VF++F + T+EVISRTAFGSS+LEG++IF+M+  L  +  KN   V+ PGIS
Sbjct  190   NYEEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQNIFEMLMKLAFLLSKNALTVRIPGIS  249

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDIS  953
              + ++SDEIEAEKL++G+  +I+++ +KREK + +G  + +G+D+ G L+K     +D  
Sbjct  250   KIFKTSDEIEAEKLKKGVYASIMDIAKKREKTAMSGDEDGFGSDFFGLLLKARHAAND-G  308

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             + IS+D ++DE K  Y AG  TT +LL W +FLLALHT WQE+AR+E++ELFG + P  D
Sbjct  309   QRISVDDLVDECKTFYFAGQETTNTLLAWTVFLLALHTNWQEEARKEVIELFGKQTPNLD  368

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             GI +L+TM+MI NE +RLYPPV    RKVEREV+LG++ +PA++ + +  L+ HHDP+IW
Sbjct  369   GITKLKTMSMIFNESLRLYPPVAGFGRKVEREVRLGDVIVPANVALVISNLSFHHDPRIW  428

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             GQD  +F P RFA+GVAKAT+NN  AF PFG+GPR+CVGLNF  NEAKIA+SMILQRY F
Sbjct  429   GQDAQLFKPERFAEGVAKATDNNIGAFVPFGIGPRSCVGLNFAINEAKIAVSMILQRYSF  488

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             TLSP YVH P     + P++GVQV+L 
Sbjct  489   TLSPGYVHSPIQYVTVRPQHGVQVMLH  515



>ref|XP_010044380.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=545

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/518 (52%), Positives = 378/518 (73%), Gaps = 3/518 (1%)
 Frame = +3

Query  27    SGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNT  206
             S  +  I  A  L+      +LW L  L  + WW P R+++ M  QGI GPPY F HG+T
Sbjct  27    SWKIMEISIAIVLSSLFVFLILWSLTELARQLWWNPLRIQRTMARQGIKGPPYRFLHGST  86

Query  207   KQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIK  386
             ++   MR ++   PM D+SH I  ++QPH+ +W   YG  ++ W+G +  L ITEPELIK
Sbjct  87    RETMKMRMEARSTPMDDLSHDILPKVQPHIDSWINTYGRNYINWYGAQAQLVITEPELIK  146

Query  387   EVLANKEGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMI  563
             EVL N++  +PK     FAK LLG+ L++  +G KWAK R+LANHTFH ESLK MVP M+
Sbjct  147   EVLINRDKTFPKTVPRSFAKYLLGDGLVSTIDGVKWAKKRRLANHTFHGESLKNMVPAMV  206

Query  564   ASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVK  743
              S  VMLE+WK+ EG+E++VF++F +LT+EVISRTAFGSS++EG++IF+M++NL  +  +
Sbjct  207   DSAHVMLEKWKQREGEEIEVFEEFKLLTSEVISRTAFGSSYVEGRNIFEMMTNLGLLVSR  266

Query  744   NVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQL  920
             N   ++FPGIS + ++ DEIEAEKL++GI  AILE+ +KREK+   G  ++YGND+LGQL
Sbjct  267   NALRMRFPGISKIWKTVDEIEAEKLKKGIHVAILEIAKKREKKVMAGEADDYGNDFLGQL  326

Query  921   MKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREIL  1100
             +K     +D SK I++D ++DE K  Y AG  TTT++L W IFLLA+H++WQE+AR+E+L
Sbjct  327   VK-AYHDNDESKKITIDDLVDECKTFYFAGQETTTAMLTWVIFLLAVHSDWQEEARKEVL  385

Query  1101  ELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMP  1280
             ++FG+E+P  DGIA+LR ++MI+NE +RLYPPVI  +RKV+++++LG L +P +  +F+ 
Sbjct  386   DVFGNEDPDFDGIAKLRMISMIMNEALRLYPPVIGFSRKVDQQLRLGKLVLPPNTQVFIA  445

Query  1281  ILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKI  1460
              L +HHDP+IWG+DVH+F P RF++GV+KATNNNA  F PFG GPR CVG+NF  NEAKI
Sbjct  446   NLKIHHDPEIWGEDVHLFRPERFSEGVSKATNNNAVVFLPFGFGPRMCVGMNFAMNEAKI  505

Query  1461  ALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              LSMILQRY F LSP Y+H P  I  + P++G+QVIL 
Sbjct  506   VLSMILQRYTFILSPGYIHSPVQILTIRPQHGLQVILH  543



>ref|XP_010049895.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82719.1| hypothetical protein EUGRSUZ_C04097 [Eucalyptus grandis]
Length=514

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/490 (52%), Positives = 364/490 (74%), Gaps = 3/490 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+ + WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             I P V+TW + YG  +L WHG +  L ITEP+LIKEVL N+E  YPK+   DFAKKL+G+
Sbjct  79    IHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKIGTKDFAKKLVGD  138

Query  462   ALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+ T +G+KWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF++F 
Sbjct  139   GLVGTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFREFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EG++IF+M++ L  +T KN +N++ PGI  L +++DE+EAEKL
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRLPGIRRLWKTADEVEAEKL  258

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+ +IL+++++REK+   G  + +G+D+LGQL+K     +D SK  ++D ++DE K 
Sbjct  259   EKGIRNSILQMIKRREKKVMAGEEDGFGDDFLGQLVK-ALHDTDKSKKFTIDNLVDECKT  317

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  T  S++ W +FLLA++ EWQE+ARRE+L +FG+E+P SDG+ +L+ ++MI+NE
Sbjct  318   FYIAGQETANSMMTWMLFLLAINPEWQEEARREVLNVFGNEDPDSDGLGKLKKISMIMNE  377

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV+ +TRKV ++++LG L +PA+  IF+P L LHHDP+IWG+D H F P RF++
Sbjct  378   TLRLYPPVVGLTRKVGKKLRLGRLVLPANSQIFIPTLKLHHDPEIWGEDAHEFKPERFSE  437

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AKATNNNA  F PFG GPR+CVG++F   EAKI LSMILQRY F LSP Y+H P  + 
Sbjct  438   GIAKATNNNAVVFIPFGFGPRSCVGMSFVVAEAKILLSMILQRYTFELSPTYIHCPGQLL  497

Query  1536  ILTPKNGVQV  1565
                P++G+Q+
Sbjct  498   TTRPQHGLQI  507



>ref|XP_008351041.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=1032

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/500 (53%), Positives = 374/500 (75%), Gaps = 4/500 (1%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
             + + +L  L++   + WWTP R++K M  QGI GP Y F HGNTK+I +M+ ++M +P  
Sbjct  14    LCLSILLALIKAFHKLWWTPTRIQKRMAFQGIKGPSYRFFHGNTKEIMSMKMETMXRPG-  72

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
             D+S ++F+ +QPH+HTW +IYG  +L WHG++  L + EP+L KE+L N +GAYPK  L 
Sbjct  73    DLSVNVFSAVQPHIHTWTKIYGKIYLQWHGSQAQLVVMEPQLCKEILNNXDGAYPKRKLQ  132

Query  435   DFAKKLLGEAL--ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEG  608
              F KKL+G+++   T EG KW K++KLANH FH ESLK M+P MIAS E++LE WK  EG
Sbjct  133   GFVKKLVGDSMGTSTTEGGKWGKLKKLANHAFHGESLKSMIPAMIASAEMILEEWKNHEG  192

Query  609   KELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTR  788
             KE++V++ F + T+EVISRTAFGSS++EGK+ F  +  L+++ VKN   V+FPGIS + +
Sbjct  193   KEIEVYEQFRLFTSEVISRTAFGSSYIEGKNFFDNLMKLSSLLVKNSLTVRFPGISKIFK  252

Query  789   SSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISL  968
             + DEIE+EKL++ ++ +I E+++KREK++    +N+G+DYLG L+K     +D S+ IS+
Sbjct  253   TGDEIESEKLDKAMRDSITEIIKKREKKAMAGEKNFGSDYLGLLVKAHLDTND-SQKISV  311

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             D +++E K  Y AG  TT  +L W +FLLALHT+WQ KAR+E+L+LFG +NPT D IA+L
Sbjct  312   DDLVNECKTFYFAGQETTNGVLAWIVFLLALHTDWQVKARKEVLQLFGKQNPTXDDIAKL  371

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM+MI+NE +RLYPPV+ + R+V+REVKLG   +PA++ + +P LALHH+ + WGQD  
Sbjct  372   KTMSMIINEALRLYPPVLNIDRRVKREVKLGKYMVPANVELIIPCLALHHETEFWGQDAQ  431

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P+RF+ GVAKAT +N AAF PFGMGPR+CVGLNF  NEAKI LSMILQRY+FTLSP 
Sbjct  432   LFKPNRFSAGVAKATTDNIAAFLPFGMGPRSCVGLNFAANEAKIVLSMILQRYRFTLSPG  491

Query  1509  YVHYPADIFILTPKNGVQVI  1568
             YVH P D   + P++G+QVI
Sbjct  492   YVHSPCDYLSIRPQHGIQVI  511


 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/516 (54%), Positives = 369/516 (72%), Gaps = 9/516 (2%)
 Frame = +3

Query  33    ALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQ  212
             +L +I  +F   F V +     L++++ + WWTP R++K M  QGI GPPY   HGNTK+
Sbjct  522   SLMTISASFLCVFXVLV-----LIKILHKLWWTPHRIQKQMALQGIKGPPYRLIHGNTKE  576

Query  213   ISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEV  392
             IS+M  ++M KP   +SH IF  +QP++HTW +IYG  +L W G++P L ITE EL +E+
Sbjct  577   ISDMIKEAMSKPK-TLSHDIFPTVQPNMHTWTQIYGKNYLQWQGSQPQLVITELELCREI  635

Query  393   LANKEGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIAS  569
             L NK+ AYPK +  DF +KLLG+ ++T  EGEKW KVRKL  H FH ESLK M  EM+AS
Sbjct  636   LNNKDRAYPKSEPTDFLRKLLGDGIVTTAEGEKWKKVRKLGTHAFHGESLKSMFTEMVAS  695

Query  570   VEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNV  749
              E MLE WK  EGKE++VF++F + T+EVISRTAFGSS++EG++IF M++ LT +  K+ 
Sbjct  696   AETMLEXWKSYEGKEIEVFEEFRLFTSEVISRTAFGSSYIEGQNIFGMLTKLTPLVFKSF  755

Query  750   YNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMK  926
             Y ++ PGIS   +SSDEIEAEKLE+GI  +I ++++KREK+S G   + +G D+LG L+ 
Sbjct  756   YTIRLPGISQFFKSSDEIEAEKLEKGIHASITZIIKKREKKSMGEGRDXFGCDFLGLLLN  815

Query  927   ITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILEL  1106
                  +D ++ IS+D ++DE K  Y AG  TT + L W IFLLA HT+WQE+AR+E++EL
Sbjct  816   AHHDAND-NQRISVDDLVDECKTFYFAGQETTNTSLAWTIFLLAHHTDWQEEARKEVMEL  874

Query  1107  FGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPIL  1286
             FG + P  DGIA+L+ +NMI NE +RLY PV+   RKV+REVKLG L +PA+  +F+P L
Sbjct  875   FGKQTPNPDGIAKLKKINMIFNESLRLYSPVVGFVRKVKREVKLGKLIVPANFELFVPNL  934

Query  1287  ALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIAL  1466
             ALH DPQIWG+D H+F P RFA+GVAKATNNN  AF PFG+GPR+C+GLNF   E KI L
Sbjct  935   ALHRDPQIWGEDAHLFKPERFAEGVAKATNNNVGAFIPFGIGPRSCLGLNFANTEVKIVL  994

Query  1467  SMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             SMILQRY FTLSP YVH P     + P  GVQ +L 
Sbjct  995   SMILQRYSFTLSPGYVHLPYPYVTIHPXLGVQXMLH  1030



>ref|XP_011009686.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=512

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/506 (53%), Positives = 376/506 (74%), Gaps = 3/506 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             F+  S+ ++ +  L++   + WW P R++  MRSQG+ GPPY F HGNTK+I NMR++ M
Sbjct  7     FILSSLCVFFILHLIKFFIKVWWDPIRIQSAMRSQGMKGPPYRFLHGNTKEIYNMRNEIM  66

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
               PM ++SH + ARIQPHV++W ++YG  FL W+G +  L ITEPELIKEVL+NK+GAYP
Sbjct  67    SSPM-ELSHQMLARIQPHVYSWIKLYGMNFLNWYGPQAQLVITEPELIKEVLSNKDGAYP  125

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K  + ++A+KLLG+ L+ ++G+KW K+RKLA H FHAESLK  +P MI SVE ML+RW+ 
Sbjct  126   KFVIQNYAEKLLGDGLVLSQGKKWLKMRKLAIHAFHAESLKGTIPAMIVSVETMLDRWRR  185

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
                KE++V+++F VLT+E+ISR AF SS+LEGK+IF M++ +  I  +N Y V   GI  
Sbjct  186   EGIKEIEVYQEFKVLTSEIISRAAFRSSYLEGKNIFDMLTRMALIVGRNNYKVGISGIKN  245

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKESNGV-VENYGNDYLGQLMKITTGGSDISK  956
               ++ D+IE+EKL+RGI+ ++L+++++RE+   G   + YG+D+LG L+K     +D +K
Sbjct  246   FFKTRDDIESEKLDRGIRDSMLKVIKRREEVLMGTEPDGYGSDFLGLLLK-AYHENDKTK  304

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              IS+D +IDE K  Y AGH TTTS L W +  LA+HT+WQ +AR E+L++FG +NP  D 
Sbjct  305   KISIDDLIDECKTFYVAGHETTTSSLTWTLLFLAIHTDWQNRAREEVLQIFGQQNPCPDS  364

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I RL+TM MI+NE +RLYPPV  +TR+V+REVKLG L +PA +T+ + ILALH++PQIWG
Sbjct  365   IGRLKTMTMIINESLRLYPPVFNLTREVQREVKLGKLIVPAKMTLSLSILALHNNPQIWG  424

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             +D H+F P RFA GVA+AT NNA +F PFG+GPR+CVGLNF  +E KIALSMILQ Y+FT
Sbjct  425   EDAHLFKPERFAGGVAEATRNNATSFLPFGLGPRSCVGLNFALSEIKIALSMILQHYRFT  484

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH P  I  ++P+ G+Q++ +
Sbjct  485   LSPTYVHSPEHILTISPRYGLQILFE  510



>ref|XP_007222124.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
 gb|EMJ23323.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
Length=498

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/512 (53%), Positives = 368/512 (72%), Gaps = 26/512 (5%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             II + FL     + L+   ++++ + WWTP R++K+M  QGI GP Y F +GNTK+ISNM
Sbjct  9     IIPSSFL----CLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIYGNTKEISNM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             + + MG+P   +SH IF+ +QPHVH+W  IYG  +L WHG++  L ITEPEL KE+L NK
Sbjct  65    KKEVMGRPHI-LSHDIFSVVQPHVHSWTNIYGKNYLQWHGSRAQLVITEPELCKEILNNK  123

Query  405   EGAYPKMDLDDFAKKLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
               AYPK +  + +KKL G+ L+ TN+ EKWAK+RKLA H FH ESLK M+P+M+AS + M
Sbjct  124   GRAYPKREPPNISKKLFGDGLVATNKAEKWAKLRKLATHAFHGESLKSMIPDMVASAQKM  183

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             +ERWK  EGKE++VF++F + T+EVISRTAFGSS+ EG+ IF+M+  L  +  KN+  V+
Sbjct  184   VERWKVYEGKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFEMLRKLGFLIFKNILKVR  243

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
              P IS L ++SDEIE+EKLE+GI  +I+E+V+KREK+   G  +++G D +         
Sbjct  244   VPVISKLFKTSDEIESEKLEKGIHASIIEMVKKREKKKMTGENDSFGKDLV---------  294

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
                        ++IDE K  Y AG  TT +LL W +FLLALHT+WQE+AR+E+L+LFG +
Sbjct  295   ----------QEIIDECKTFYFAGQETTNTLLCWTVFLLALHTDWQEEARKEVLQLFGKQ  344

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P  DGI +L TM+MI+NE +RLYPP + V R+VERE++LG L +P+++ + + I+ALHH
Sbjct  345   TPNLDGIGKLTTMSMIINETLRLYPPAVHVVRRVEREIRLGKLIVPSNLELDVSIVALHH  404

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQIWG+DV +F P RF++GVAKATNN+  AF PF MGPRTCVGLNF   E KIALSMIL
Sbjct  405   DPQIWGEDVQLFKPERFSEGVAKATNNHVGAFIPFSMGPRTCVGLNFAITEVKIALSMIL  464

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY FTLSP YVH P  +  + P++GVQV LQ
Sbjct  465   QRYTFTLSPGYVHSPLHLLTVRPQHGVQVRLQ  496



>gb|KCW44246.1| hypothetical protein EUGRSUZ_L02324 [Eucalyptus grandis]
Length=514

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/490 (53%), Positives = 363/490 (74%), Gaps = 3/490 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+   WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHNLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             I P V+TW + YG  +L WHG +  L ITEP+LIKEVL N+E  YPK    DFAKKLLG+
Sbjct  79    IHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKTGTKDFAKKLLGD  138

Query  462   ALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+ T +G+KWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF +F 
Sbjct  139   GLVSTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EG++IF+M++ L  +T KN +N++FPGI  L +++DE+EAEKL
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRFPGIRKLWKTADEVEAEKL  258

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+ +IL+++++REK+   G  + +G+D+LGQL+K     +D SK  ++D ++DE K 
Sbjct  259   EKGIRNSILQMIKRREKKVMAGEEDGFGDDFLGQLVK-ALHDTDKSKKFTVDNLVDECKT  317

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  T  S++ W +FLLA++ EWQE+ARRE+L +FG+++P SDG+ +L+ ++MI+NE
Sbjct  318   FYIAGQETVNSMMTWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKISMIMNE  377

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV+ +TRKV ++++LG L +PA+  IF+P L LHHDP+IWG+DVH F P RF++
Sbjct  378   TLRLYPPVVGLTRKVGKKLRLGRLVLPANSQIFIPTLKLHHDPEIWGEDVHEFKPERFSE  437

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AKATNNNA  F PFG GPR+CVG++F   EAKI LSMILQRY F LSP Y+H P  + 
Sbjct  438   GIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKILLSMILQRYTFKLSPTYIHCPGQLA  497

Query  1536  ILTPKNGVQV  1565
                P++G+Q+
Sbjct  498   TTRPQHGLQI  507



>ref|XP_004298349.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=506

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/501 (54%), Positives = 372/501 (74%), Gaps = 3/501 (1%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
             V + LL  L+    + WWTP RL+ +M  QGI GP Y   +GN  +I+NM+ ++M +P+ 
Sbjct  6     VCVLLLLALINAFHKLWWTPVRLQNMMALQGIKGPSYRLLYGNATEITNMKKEAMSRPI-  64

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
              +SH IF+ +QPH+H W + YG  FL W+G KP L +TEPEL KE+L NK+G Y K    
Sbjct  65    SLSHDIFSHVQPHIHAWTKSYGKNFLQWYGVKPVLVVTEPELCKEILNNKDGVYVKPKPS  124

Query  435   DFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKE  614
                KKL G+++   EGEKWAK+RKL+NH FH ESL+ M P+MIAS E M+ERWK  EG E
Sbjct  125   IVVKKLFGDSVAMTEGEKWAKLRKLSNHAFHGESLRNMFPDMIASAEAMVERWKHHEGNE  184

Query  615   LDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSS  794
             ++VF++F +LT+EVISRTAFGSS+LEGK IF+M+  L++I V+N++ ++FPG+S L R+S
Sbjct  185   IEVFEEFRLLTSEVISRTAFGSSYLEGKKIFEMLMRLSSIIVRNLFGIRFPGMSKLFRTS  244

Query  795   DEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLD  971
             D+IE+EK+E+GI+ +I+E+V+KREKE+  G  +++G D+LG L+K     +D  + IS+D
Sbjct  245   DDIESEKVEKGIRNSIMEIVKKREKEAKAGEEDSFGKDFLGLLLKAHHATND-KQMISVD  303

Query  972   QMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLR  1151
             ++++E K  Y AG  TT +LL W   LLALH EWQE+AR E+L+ FG E PT DGIA+L+
Sbjct  304   ELLEECKTFYFAGQETTNTLLAWTTLLLALHPEWQEEARNEVLQFFGKEPPTYDGIAKLK  363

Query  1152  TMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHV  1331
             TM+MI+NE +RLYPP I + RKV REV+LG + +PA++ + +P LALHH+PQ+WG++V +
Sbjct  364   TMSMIINETLRLYPPAILLARKVSREVRLGKILVPANVELLVPTLALHHEPQLWGEEVEL  423

Query  1332  FNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNY  1511
             F P RF++G+AKATN+N AAF PFG+GPR CVG NF   EAKIA+SMILQRY FTLSP Y
Sbjct  424   FKPERFSEGIAKATNDNMAAFMPFGLGPRICVGFNFAALEAKIAMSMILQRYSFTLSPGY  483

Query  1512  VHYPADIFILTPKNGVQVILQ  1574
             VH P     + P+NGVQVIL 
Sbjct  484   VHSPFQYVTVRPQNGVQVILH  504



>ref|XP_008243887.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103342098 
[Prunus mume]
Length=1035

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 370/513 (72%), Gaps = 5/513 (1%)
 Frame = +3

Query  51    TAFFLTFSVSIYL--LWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             + F ++ SV ++L  L  L+R+  + WW P R++K M  QGI GP Y   HG+TK+I +M
Sbjct  525   SMFTVSSSVCVFLVILLALIRIFRKVWWVPNRIQKFMGLQGIHGPAYRLVHGSTKEIMSM  584

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             + ++M +P  ++SH IF  +QPH H W +IYG  FL W GT+P L I EPEL KE+L NK
Sbjct  585   KKEAMSRPR-NMSHDIFPTVQPHTHQWTKIYGKNFLQWQGTQPQLLIAEPELSKEILNNK  643

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             +  + K     + KKL GE++   EGEKW K+RKLANH FH ESLK MVP+MI S E ML
Sbjct  644   DRLFRKQKSQGYVKKLFGESISMAEGEKWVKLRKLANHAFHGESLKGMVPDMITSTETML  703

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             +RWK  EGKE++VF++F +LT+EVISR+AFGSS+LEGK IF M+  LT++  +N    +F
Sbjct  704   QRWKNHEGKEIEVFEEFRLLTSEVISRSAFGSSYLEGKRIFDMLMELTSVIFQNALKPRF  763

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGG  941
             PGISM  ++S EI A+KLE+GI+  I E+V+KRE K  NG  + +G+D+LG L+K     
Sbjct  764   PGISMFYKTSAEIRADKLEKGIRDTIAEIVKKRENKAMNGEADEFGSDFLGVLLKAHHDT  823

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN  1121
             ++ ++ IS D ++DE K  Y AG  TT +LL W +FLLALH +WQE+AR+E+L+LFG + 
Sbjct  824   NE-NQRISFDDIVDECKTFYFAGQETTNALLAWTVFLLALHPDWQEEARKEVLQLFGQQT  882

Query  1122  PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHD  1301
             PT DGI++L+TM+MI+NE +RLYPPV+++ R+VE+ VKLG L IPA+  + +P LA HHD
Sbjct  883   PTLDGISKLKTMSMIINESLRLYPPVVSLNRQVEKNVKLGGLVIPANAELHVPNLAFHHD  942

Query  1302  PQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQ  1481
             P+ WG+DV++F P RF++GVAKAT NN  AF PFG+GPRTCVG+NF   E KIAL+MILQ
Sbjct  943   PKFWGEDVNLFKPERFSEGVAKATKNNTVAFLPFGLGPRTCVGMNFANAEVKIALAMILQ  1002

Query  1482  RYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             RY FTLSP YVH P     + P  GVQVIL ++
Sbjct  1003  RYSFTLSPGYVHSPIQYMTVRPHRGVQVILHSL  1035


 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/517 (53%), Positives = 377/517 (73%), Gaps = 13/517 (3%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  I+++F   F     LL   + +  + WW P R++K+M  QGI GP Y   HGNTK
Sbjct  5     GGLVIILSSFLCVF----LLLLSFLNIFYKLWWAPTRIQKLMALQGIKGPSYRPIHGNTK  60

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +I NM+ + +G+PM  +SH I + ++PHVH+W +IYG  FL W+G++  L I EPEL KE
Sbjct  61    EILNMKREIIGRPM-SLSHDIVSAVRPHVHSWTKIYGMNFLQWYGSQAQLVIMEPELCKE  119

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIAS  569
             +L NK+GA+ K     + KKLLG+ L T +GEKW K+RKLANH FHAESLK MVPEM+AS
Sbjct  120   ILNNKDGAFAKRKPQSYVKKLLGDGLGTTDGEKWGKLRKLANHAFHAESLKSMVPEMVAS  179

Query  570   VEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNV  749
              E MLE WK  EGKE++VF+ F + T+EVISRTAFGSS+LEG++ F+ +  L+ +  KN 
Sbjct  180   AETMLEGWKNSEGKEIEVFEPFRMFTSEVISRTAFGSSYLEGQNFFENLMKLSFLIFKNA  239

Query  750   YNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKI  929
               V+FPGIS   ++SDEIE+EKLE+G+  +I+E+V KRE+++    +++G+D+LG L+K 
Sbjct  240   LTVRFPGISKFFKTSDEIESEKLEKGMHDSIIEIVEKREQKAMDGEDSFGSDFLGLLLKA  299

Query  930   TTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELF  1109
                 +D S+ IS+D ++DE K  Y AG  TT S+L W +FLLAL+T+WQE+AR+E+L+LF
Sbjct  300   HHDTND-SQRISVDDLVDECKTFYFAGQETTNSMLAWTVFLLALNTDWQEEARKEVLQLF  358

Query  1110  GHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILA  1289
             G +NP  DG+++L+TM+MI+NE +RLYPPV++V RKV REVKLG L +PA++ + +PILA
Sbjct  359   GRQNPNPDGLSKLKTMSMIINESLRLYPPVVSVERKVRREVKLGKLIVPANVELIIPILA  418

Query  1290  LHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALS  1469
             +HH+P+ WG+DV +F P RFA+GVAKATNNN AAF PFGMGPRTCVG NF   EAKI+LS
Sbjct  419   IHHEPEFWGEDVQLFKPERFAEGVAKATNNNIAAFLPFGMGPRTCVGFNFAITEAKISLS  478

Query  1470  MILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             MILQRY         H P +   + P++GVQV+L ++
Sbjct  479   MILQRYT-------XHSPYEYLTVRPQHGVQVVLHSL  508



>ref|XP_008243805.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/501 (52%), Positives = 368/501 (73%), Gaps = 3/501 (1%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             +  L  L+RL  + WWTP R +K M  QG+ GP Y+  HGNTK+I +M+  +M +P   +
Sbjct  18    LVFLVALIRLFYKQWWTPNRFQKFMDLQGVKGPSYTLVHGNTKEIMSMKKGAMSRPR-SL  76

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             SH IF+ +QPH H W +I+G  FL W+GT+P L + EPEL KEV+ NK+  + K     +
Sbjct  77    SHDIFSAVQPHTHKWSKIFGRNFLQWYGTQPQLVVAEPELSKEVMINKDRIFRKQKSQGY  136

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELD  620
              KK+LGE++  +EGEKW K+R+L+NH FH ESLK M+PEMI S E MLERW   EGKE++
Sbjct  137   TKKILGESISMSEGEKWVKLRRLSNHAFHGESLKSMIPEMITSSETMLERWVNHEGKEIE  196

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDE  800
             V+++F + T+EVISRTAFG+S+L+GK+IF+M+  LT +  KN ++++ P IS   ++SDE
Sbjct  197   VYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRFYKTSDE  256

Query  801   IEAEKLERGIKGAILELVRKREK-ESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQM  977
             I++EKLE+GI+  I  +VRKRE     G  + +G+D+LG L+K     ++ ++ IS+D +
Sbjct  257   IKSEKLEKGIRDIIAGIVRKRESMAKTGEADGFGHDFLGVLLKAHHDTNE-NQRISVDDI  315

Query  978   IDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTM  1157
             +DE K  Y AG  TT SLL W IFLLAL+T+WQE+AR+E+L+LFG ENP  DG+ +L+TM
Sbjct  316   VDECKTFYFAGQETTNSLLAWTIFLLALNTDWQEEARKEVLQLFGKENPNPDGLNKLKTM  375

Query  1158  NMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFN  1337
             +MI NE +RLYPPV+++ R+ E+EV+LG + +PA++ + +P L+LHHDP+ WG+DV+VF 
Sbjct  376   SMIFNESLRLYPPVVSLIRETEKEVRLGKMVVPANVEVHVPNLSLHHDPKYWGEDVNVFK  435

Query  1338  PHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVH  1517
             P RF++GVAKATNNN  AF PFG+GPRTCVG+NF   E+KIAL+MILQRY FTLSP YVH
Sbjct  436   PERFSEGVAKATNNNMVAFIPFGLGPRTCVGMNFAIVESKIALAMILQRYSFTLSPGYVH  495

Query  1518  YPADIFILTPKNGVQVILQNV  1580
              P     + P++G+ VIL ++
Sbjct  496   SPIQFMTVRPQHGIPVILHSL  516



>ref|XP_007045778.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01610.1| Cytochrome P450 [Theobroma cacao]
Length=516

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/503 (52%), Positives = 359/503 (71%), Gaps = 2/503 (0%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
               ++ L  L+R   R WW P R++  M  QGI GPPY F HGN K  + MR ++  KPM 
Sbjct  15    CCLFFLIALLRFFHRYWWIPFRIQYTMSLQGIKGPPYEFIHGNNKASTYMRMEAYRKPMA  74

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
              ++H I  R+ P +++W  IYG  +LTW G +P L ITE EL+KEVL N EGA+ K   +
Sbjct  75    ALTHDIVPRVMPQIYSWINIYGKNYLTWQGIRPQLVITEVELVKEVLRNSEGAFRKKKAE  134

Query  435   DFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKE  614
             DF  K++G+ L+  EGEKWA+ RKLANH FH ESLK M P +IASVE MLE+WK  EGKE
Sbjct  135   DFIHKIIGDGLVATEGEKWARQRKLANHAFHGESLKSMTPAVIASVEAMLEKWKGREGKE  194

Query  615   LDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSS  794
             ++VF++F +LT+EVISRTAFGSS+LEG+ IF+ +  L+ I  +N +  + PGIS + + +
Sbjct  195   IEVFEEFRLLTSEVISRTAFGSSYLEGEKIFEKLMKLSIIANRNFHKARIPGISKIWKPA  254

Query  795   DEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLD  971
             DEIE+EKL +GI   ++++V+KRE++   G  +++G D+LG L+K      D    +S++
Sbjct  255   DEIESEKLAKGIHDCVMDMVKKREEKVLTGEADSFGTDFLGLLVK-AYHDEDERNRLSVE  313

Query  972   QMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLR  1151
              ++DE K  Y AG  TT SLL W + +LA+HT+WQEKARRE++E+FG++NP S+GIA L+
Sbjct  314   DLVDECKTFYFAGQETTNSLLAWTVLVLAIHTDWQEKARREVIEVFGNKNPHSEGIANLK  373

Query  1152  TMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHV  1331
             TMN+I+NE +RLYPPV+   R+V +EV LG L +P +I + +P +ALHHDP +WG DVH+
Sbjct  374   TMNLIINETLRLYPPVVATVREVGKEVHLGKLVLPDNIEVLIPNMALHHDPDLWGDDVHL  433

Query  1332  FNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNY  1511
             F P RFA+G AKAT  NAAAF PF +GPR+CVG++F T E K ALSMILQRY  TLSP Y
Sbjct  434   FKPDRFAEGTAKATKYNAAAFIPFSLGPRSCVGMSFATTETKTALSMILQRYTLTLSPAY  493

Query  1512  VHYPADIFILTPKNGVQVILQNV  1580
             VH P  I +L P++G+QV+L ++
Sbjct  494   VHSPFTILMLQPQHGIQVMLHSL  516



>ref|XP_007045779.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY01611.1| Cytochrome P450, putative [Theobroma cacao]
Length=517

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/513 (53%), Positives = 376/513 (73%), Gaps = 8/513 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             I+++FF      + LL  L R + R WWTP  ++ ++ SQGI GP Y+F HGNTK I  M
Sbjct  10    ILSSFF-----CLCLLIVLFRFLHRLWWTPFYIQYLLGSQGIKGPSYNFIHGNTKDILKM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             R++++ KPM  +SH IF R+QP  ++W   YG  +L W+G +P L ITE  LIKEVL N+
Sbjct  65    RNEALSKPM-ALSHDIFPRVQPQAYSWINKYGKNYLNWNGAQPQLVITETALIKEVLNNR  123

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             + AYPK+ L  +  KL+G+ L T+EGEKWAK RKL N+ F  ESLK M+PEMI SVE ML
Sbjct  124   DRAYPKVGLPFYVMKLMGDGLATSEGEKWAKHRKLLNYVFQGESLKNMIPEMIVSVEKML  183

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             E WK  EGK ++VF +F +LT+EVISRTAFGSS+LEGK+IF M+ N + I+ +N + V+F
Sbjct  184   ETWKHHEGKGIEVFDEFRLLTSEVISRTAFGSSYLEGKNIFDMLINYSVISRRNAFKVRF  243

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGG  941
             PGIS + +++D+IEA+KL R +  +++E++++RE++  NG V+++G D+LG L+      
Sbjct  244   PGISKIWKTADQIEADKLLRVMHNSVMEIIKRREEKIKNGDVDSFGTDFLGLLLNAYHDV  303

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN  1121
             ++ +K + ++ +IDE K  Y AG  T+ SLL W + LLA+HT+WQ+KAR E++ELFG +N
Sbjct  304   NE-NKRLHVEDLIDECKTFYIAGQETSNSLLSWTVLLLAIHTDWQQKARAEVIELFGDQN  362

Query  1122  PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHD  1301
             P  DG+++L+T+ MI+NE +RLYPP I   RK EREV+LG L +PA++ +F+  LA+HHD
Sbjct  363   PHPDGLSKLKTITMIINEALRLYPPAIGFIRKCEREVRLGKLILPANLNLFITNLAVHHD  422

Query  1302  PQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQ  1481
             PQIWG D HVFNP RF++GVAKATNNN AA+FPFG+GPRTCVG NF T   K+AL+MILQ
Sbjct  423   PQIWGDDSHVFNPERFSEGVAKATNNNVAAYFPFGIGPRTCVGFNFATVGTKVALAMILQ  482

Query  1482  RYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              + FTLSP YVH P   F L P++G+QVIL ++
Sbjct  483   HHTFTLSPAYVHSPVFHFTLVPQHGIQVILHSL  515



>ref|XP_009356542.1| PREDICTED: uncharacterized protein LOC103947363 [Pyrus x bretschneideri]
Length=1066

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/512 (54%), Positives = 374/512 (73%), Gaps = 8/512 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             +I+A FL     ++ +  +++++ R WWTP R++K M  QGI GPPY   HGNTK+IS+M
Sbjct  9     VISASFL----CVFFVLVIIKILHRLWWTPHRIQKQMALQGIKGPPYRLIHGNTKEISDM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
               ++M KP   +SH IF  +QP++HTW +IYG  +L W G++P L ITE EL +E+L NK
Sbjct  65    IKEAMSKPK-TLSHDIFPIVQPNMHTWTQIYGRNYLQWQGSQPQLVITELELCREILNNK  123

Query  405   EGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             + AYPK +  DF +KLLG+ L+T  EGEKW KVRKL  H FH ESLK M  EM+AS E M
Sbjct  124   DRAYPKSEPTDFLRKLLGDGLVTTAEGEKWKKVRKLGTHAFHGESLKSMFTEMVASAETM  183

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERWK  EGKE++VF++F + T+EVISRTAFGSS++EG++IF+M++ LT +  K+ Y ++
Sbjct  184   LERWKSYEGKEIEVFEEFRLFTSEVISRTAFGSSYVEGQNIFEMLTKLTLLIFKSFYTIR  243

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
              PGIS   +SSDEIEAEKLE+GI  +I E+++KREK+S +   +++G D+LG L+K    
Sbjct  244   LPGISQFFKSSDEIEAEKLEKGIHASITEIIKKREKKSMSEGQDSFGCDFLGLLLKAHHD  303

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D ++ IS+D ++DE K  Y AG  TT + L W IFLLA HT+WQE+AR+E++ELFG +
Sbjct  304   AND-NQRISVDDLVDECKTFYFAGQETTNTSLAWTIFLLAHHTDWQEEARKEVMELFGKQ  362

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P  DGIA+L+ +NMI NE +RLY PV+   RKV+REVKLG L +PA+  +F+P LALH 
Sbjct  363   TPNPDGIAKLKKINMIFNESLRLYSPVVGFVRKVKREVKLGKLIVPANFELFVPNLALHR  422

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQIWG+D H+F P RF++GVAKATNNN  AF PFG+GPR+C+GLNF   E KI LSMIL
Sbjct  423   DPQIWGEDAHLFKPERFSEGVAKATNNNVGAFIPFGIGPRSCLGLNFANTEVKIVLSMIL  482

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY FTLS  YVH P     + P+ GVQV+L 
Sbjct  483   QRYSFTLSQGYVHLPYPYVTIHPQLGVQVMLH  514


 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 371/512 (72%), Gaps = 8/512 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             II+A FL     ++ +  L++++ + WWTP R++K M  QGI G PY   HGNTK+I +M
Sbjct  559   IISASFL----CVFFVLVLIKILHKLWWTPHRIQKQMALQGIKGTPYRLIHGNTKEIFDM  614

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
               ++M KP  ++SH IF+ +QPH+H+W   YG  +L W G++P L ITE EL +E+L NK
Sbjct  615   IKEAMSKPK-NLSHDIFSIVQPHMHSWTRTYGKNYLQWQGSQPQLVITELELCREILNNK  673

Query  405   EGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             + AYPK +  DF +KLLG+ L+T  EGEKW K+RKL  H FH ESLK M  EM+ S + M
Sbjct  674   DRAYPKSEPTDFLRKLLGDGLLTTAEGEKWKKMRKLGTHAFHGESLKSMFTEMVVSAQTM  733

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERWK  EGKE++VF++F + T+EVISRTAFGSS++EG++IF+M++ LT +  K+ Y ++
Sbjct  734   LERWKSYEGKEIEVFEEFRLFTSEVISRTAFGSSYIEGQNIFEMLTKLTLLFFKSYYTIR  793

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
              PGIS   +SSDEIEAEKLE+GI  +I E+++KREK+S     +++G+D+LG L+K    
Sbjct  794   LPGISKFFKSSDEIEAEKLEKGIHASITEILKKREKKSMTKGRDSFGSDFLGLLLKAHHD  853

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D ++ IS+D M+ E K+ Y AG  TT +LL W IFLLA HT WQE+AR+E+++LFG +
Sbjct  854   AND-NQRISVDDMVYECKSFYFAGQETTNTLLAWTIFLLAHHTNWQEEARKEVMDLFGKQ  912

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P  DGIA L+ M+MIL+E +RLY PV+   R V+REVKLG L IPA+  +F+P LALH 
Sbjct  913   TPNPDGIANLKMMSMILSESLRLYSPVVGFVRDVKREVKLGKLIIPANCELFVPNLALHR  972

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQIWG+D  +F P RF++GVAKATNNN  AF PFG+GPR+CVGLNF   EAKI LSMIL
Sbjct  973   DPQIWGEDALLFKPERFSEGVAKATNNNVGAFIPFGIGPRSCVGLNFANTEAKIVLSMIL  1032

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY FTLSP YVH P     + PK GVQV+L 
Sbjct  1033  QRYSFTLSPGYVHLPVQYVTIHPKLGVQVMLH  1064



>ref|XP_002512038.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50707.1| cytochrome P450, putative [Ricinus communis]
Length=516

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/506 (54%), Positives = 367/506 (73%), Gaps = 5/506 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             FL F  S +LL  L + + + WWTP R++ +MRSQGI GP Y F HGNTK I+NMR ++M
Sbjct  13    FLGFLCSYFLLI-LSKFLYKEWWTPVRIQSLMRSQGIKGPSYRFIHGNTKDITNMRKETM  71

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
               PM ++SH I  RIQPH+++W ++YG  FL W+G +  L +TEPEL +E+L +KE  + 
Sbjct  72    ENPM-ELSHLILPRIQPHIYSWIKLYGTNFLLWYGGRAQLVVTEPELAQEILNSKEVTFY  130

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K+   ++  KLLG+ L+   GEKW K+RKLA+  FH+E+LK MVP MIAS EVMLE W+ 
Sbjct  131   KVGFQEYITKLLGDGLVLASGEKWIKMRKLASRAFHSENLKGMVPAMIASSEVMLEGWRS  190

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
               GKE+D F++F VLT+E+ISRTAFGSS+LEG+ IF+M+    +I   N Y V+ PGI  
Sbjct  191   HPGKEIDAFQEFKVLTSEIISRTAFGSSYLEGEKIFEMLKKTISIIAGNHYKVRIPGIKF  250

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISK  956
                + D +E +KL++ I+  I+E+V+KRE+ +     +++G+D+LG L+K      D +K
Sbjct  251   FKTTYD-VELDKLQQDIRDTIMEMVKKREEAAKISEQDSFGHDFLGSLIK-AYKDEDKNK  308

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              IS++ MIDE K  Y AG  TT S L W I LLA+H +WQEKAR+E+LELFG +NPT+DG
Sbjct  309   KISIEDMIDECKNFYVAGQETTASSLSWTILLLAIHRDWQEKARKEVLELFGQQNPTADG  368

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I RL+TM+MI+NE +RLYPPV+ V R+V+REVKLG L IPA +   +P+LALH D +IWG
Sbjct  369   ITRLKTMSMIINESLRLYPPVLHVNREVKREVKLGKLLIPAKMETNVPVLALHTDNKIWG  428

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             +D H++ P RFA+GVAKATNNN +++ PFG+GPRTCVGLNF   E KIALSMILQRY+FT
Sbjct  429   EDAHLYRPERFAEGVAKATNNNISSYIPFGLGPRTCVGLNFAITEKKIALSMILQRYRFT  488

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH P  I  + P+ GV +IL+
Sbjct  489   LSPTYVHSPVHILTMCPQYGVPIILE  514



>ref|XP_008389384.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/494 (52%), Positives = 366/494 (74%), Gaps = 3/494 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             +++  + WWTP RL+K+M  QGI GPPY   HGNTK+I++M  ++M +P  ++SH +F+ 
Sbjct  25    IKIFHKLWWTPTRLQKLMALQGITGPPYRLIHGNTKEITDMIKEAMSRPK-NLSHDVFSV  83

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+H+W +IYG  +L WHG+K  L +T+PEL KE+L NK+ AYPK++   F KKL G+
Sbjct  84    VQPHIHSWTQIYGKNYLQWHGSKAQLIVTDPELCKEILNNKDRAYPKIETPYFDKKLFGD  143

Query  462   ALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+T  + E WAK+RKLA H FH ESLK M P M+AS E MLE+WK  EGKE++VF++F 
Sbjct  144   GLLTTTKPEXWAKLRKLATHAFHGESLKSMTPAMVASTETMLEKWKSYEGKEIEVFQEFR  203

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             + ++EVISRTAFGS+++EGK IF+ ++ L  +  KN   ++ P  S   ++SDEIEA+KL
Sbjct  204   LFSSEVISRTAFGSNYIEGKXIFETLAKLGVLVFKNSLTIRVPVFSKFFKTSDEIEADKL  263

Query  819   ERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             E+G++ +I+E+V++RE+++ G   ++G+D+LG L+K     +D  + IS D++ +  K  
Sbjct  264   EKGLRVSIMEIVKRREEKATGGEGSFGSDFLGLLLKAYHDTND-DQRISADELFELCKEF  322

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
             Y     TT +LL W +FLLALHT+WQE+ R+E+++LFG   P +DGIA+L+TM+M++NE 
Sbjct  323   YLVAQETTNALLAWTVFLLALHTDWQEEVRKEVVDLFGKHTPNADGIAKLKTMSMVINES  382

Query  1179  MRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQG  1358
             +RLY PV T+ RK EREV+LG + +PA++ + +P LALHHDPQIWG+D+ +F P RF++G
Sbjct  383   LRLYSPVATIIRKTEREVELGKVIVPANLELIVPNLALHHDPQIWGEDLQLFKPERFSEG  442

Query  1359  VakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             VAKAT+NN  AF PFG+G R+CVG+NFT  EAKIALSMILQRY FTLSP YVH P     
Sbjct  443   VAKATDNNVGAFIPFGLGLRSCVGMNFTNIEAKIALSMILQRYSFTLSPGYVHLPFHYLT  502

Query  1539  LTPKNGVQVILQNV  1580
             + PK G+QV+L ++
Sbjct  503   VRPKRGIQVMLHSL  516



>ref|XP_002316007.2| hypothetical protein POPTR_0010s14910g [Populus trichocarpa]
 gb|EEF02178.2| hypothetical protein POPTR_0010s14910g [Populus trichocarpa]
Length=512

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/506 (53%), Positives = 375/506 (74%), Gaps = 3/506 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             F+   + +  +  L++   + WW P R++  MRSQG+ GPPY F HGNTK+I NMR++ M
Sbjct  7     FILSCLCVLFILHLIKFFIKVWWDPIRIQSAMRSQGMKGPPYRFLHGNTKEIYNMRNEIM  66

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
               PM ++SH + ARIQPHV++W ++YG  FL W+G +  L ITEP+LIKEVL+NK+GAYP
Sbjct  67    SSPM-ELSHQMLARIQPHVYSWIKLYGMNFLNWYGPQAQLVITEPKLIKEVLSNKDGAYP  125

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K+ + ++A+KLLG+ L+ ++G+KW K+RKLA H FHAESLK  +P MI SVE ML+RW+ 
Sbjct  126   KLVIQNYAEKLLGDGLVLSQGKKWLKMRKLAIHAFHAESLKGTIPAMIVSVETMLDRWRR  185

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
                KE++VF++F VLT+E+ISR AF SS+LEGK+IF M++ +  I  +N Y V   GI  
Sbjct  186   EGIKEIEVFQEFKVLTSEIISRAAFRSSYLEGKNIFDMLTRMALIVGRNNYKVGISGIKR  245

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKESNGV-VENYGNDYLGQLMKITTGGSDISK  956
               ++ D+IE+EKL+RGI+ ++L+++++RE+   G   + YG+D+LG L+K     +D +K
Sbjct  246   FFKTRDDIESEKLDRGIRDSMLKVIKRREEVMMGTEPDGYGSDFLGLLLK-AYHENDKTK  304

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              IS+D +IDE K  Y AGH TTTS L W +  LA+HT+WQ +AR E+L++FG +NP  D 
Sbjct  305   KISIDDLIDECKTFYVAGHETTTSSLTWTLLFLAIHTDWQNRAREEVLQIFGQQNPCPDS  364

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I RL+TM MI+NE +RLYPPV  +TR+V+REVKLG L +PA +T+ + +LALH++PQIWG
Sbjct  365   IGRLKTMTMIVNESLRLYPPVFNLTREVQREVKLGKLIVPAKMTLSLSVLALHNNPQIWG  424

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             +D H+F P RFA GVA+AT NNA AF PFG+GPR+CVGLNF  +E KIALSMILQ Y+FT
Sbjct  425   EDAHLFKPERFAGGVAEATKNNATAFLPFGLGPRSCVGLNFALSEIKIALSMILQHYRFT  484

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH P  I  ++P+ G+Q++ +
Sbjct  485   LSPTYVHSPEHILTISPRYGLQILFE  510



>ref|XP_006437871.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51111.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=546

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/540 (50%), Positives = 373/540 (69%), Gaps = 35/540 (6%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             L++  + F L F + I      +RL ++ WW P R + VM SQG+ GP Y   +GNTK+I
Sbjct  7     LYAATSCFCLVFFLFI------IRLFNKLWWIPNRTQAVMGSQGVRGPAYRLVYGNTKEI  60

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
              ++R+Q    PM  +SH I  RI PH+ +W + YG  FLTW+G++  L IT+PELIKE+L
Sbjct  61    LSLRNQIWISPM-GLSHDILPRILPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEIL  119

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLK-----------  542
             +N +G YPK+    F +K+LG+ L+T  GE W + RKLA   F+AESL+           
Sbjct  120   SNSDGTYPKVQAPGFLRKILGDGLVTAGGENWHRQRKLATLAFYAESLRVTKSNCLMFKL  179

Query  543   ---------------RMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFG  677
                             M+P M+ASVE+ML+RW+  EGKE++V +DF +LT+E+ISRTAFG
Sbjct  180   KSIIVMLFNVFVPMQDMIPAMVASVEIMLKRWRHNEGKEIEVSQDFTLLTSEIISRTAFG  239

Query  678   SSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVR  857
             SS+LEG+ IF  ++N++ I  +N Y +K P I    ++SD++EA+KLE+GI+ +I+++++
Sbjct  240   SSYLEGESIFNKLTNMSFIASRNAYKIKIPLIGDFVKTSDDVEADKLEQGIRDSIIKMMK  299

Query  858   KREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLL  1034
              RE+++  G  E YGNDY G L+K      D++K ISLD +IDE K  Y AGH TTT LL
Sbjct  300   TREEKAMKGESEGYGNDYFGLLLK-AYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLL  358

Query  1035  GWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTR  1214
              W I LLA HT+WQEK R E+LELFG +NPT DGI +L+TM+M++NE +RLYPP + ++R
Sbjct  359   TWTILLLATHTDWQEKLREEVLELFGQQNPTPDGIGKLKTMSMVINESLRLYPPAVNISR  418

Query  1215  KVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaF  1394
              VEREV+LG   +PA++ + +PILA+HHDPQIWG+DV +F P RFA+GVAKA+NN  AAF
Sbjct  419   NVEREVRLGKYILPANMELVIPILAIHHDPQIWGEDVDIFKPERFAEGVAKASNNTPAAF  478

Query  1395  FPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              PF  GPR CVGLNF   EAKIALSMILQRY+F LSP+YVH P  +  L P++G+QVI Q
Sbjct  479   LPFSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQ  538



>ref|XP_007034363.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY05289.1| Cytochrome P450 [Theobroma cacao]
Length=559

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 370/510 (73%), Gaps = 3/510 (1%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
             A  LT S  +YLL  LV+++ + WW P R++ ++ SQGI GPPY F HGN K++++ R +
Sbjct  48    AILLTSSFCLYLLVALVKVLHQYWWVPLRIQHLLSSQGIKGPPYRFIHGNNKEVNHFRKE  107

Query  234   SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGA  413
             ++ K M  ++H IF ++ PHV++W  IYG  +L W G +  + ITEPEL+KEVL N E A
Sbjct  108   ALSKHM-ALTHDIFPKVLPHVYSWINIYGKNYLFWDGIQAQVAITEPELVKEVLKNSEKA  166

Query  414   YPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERW  593
             +PK     +  +LLG+ L T EG+KWAK RKLANH FH ESLK M P +IASVE MLE+W
Sbjct  167   FPKQKPPIYFSRLLGDGLATTEGKKWAKQRKLANHAFHGESLKNMTPAVIASVERMLEQW  226

Query  594   KELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGI  773
             K  EGKE++VF++F +LT+EVISRTAFGSS+LEGK IF M+  L+ I  ++++  + PGI
Sbjct  227   KGQEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGKKIFDMLMELSIIVSRSLFKARIPGI  286

Query  774   SMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDI  950
             S   ++ D+IE+EKL +GI  +++E+V+KRE K  +G  +++G+D+LG L+  +    D 
Sbjct  287   SKFWKTDDDIESEKLAKGIHDSVMEIVKKREDKVVSGEADSFGSDFLG-LLIASYHDLDD  345

Query  951   SKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTS  1130
                +S++ ++DE K  Y AG  TT SLL W +FLLA+H +WQEKARRE++E+FG++NP S
Sbjct  346   KNRLSVEDLVDECKTFYFAGQETTNSLLAWTVFLLAVHRDWQEKARREVIEIFGNQNPHS  405

Query  1131  DGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQI  1310
             +G+A+L+T+ MI+ E +RLY PV  + RKV REV+LG L +PA I   +P +ALHHDPQ+
Sbjct  406   EGLAKLKTITMIMYETLRLYAPVNGLGRKVGREVQLGKLVLPAGIEFMIPNMALHHDPQL  465

Query  1311  WGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYK  1490
             WG DVH+F P RFA+G+AKAT  NAAAF PFG+GPR+CVG++F T E K ALSMILQRY 
Sbjct  466   WGDDVHLFKPERFAEGIAKATKYNAAAFIPFGLGPRSCVGMSFATTETKTALSMILQRYT  525

Query  1491  FTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
               LSP YVH P     L P++G+QVILQ++
Sbjct  526   IALSPAYVHSPVSNLTLRPQHGIQVILQSL  555



>ref|XP_006484251.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=512

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/494 (52%), Positives = 369/494 (75%), Gaps = 5/494 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS-MGKPMFDISHHIF  275
             +++L+++ WWTP R++  MRSQ I GP Y F  GN K+I NM+++  M      +SH IF
Sbjct  20    VIKLLNKIWWTPIRIQSQMRSQDIKGPSYKFFQGNNKEIMNMKNEMIMSSSPMQLSHQIF  79

Query  276   ARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLL  455
                +PH+++W ++YG  FL WHG++  L + EP+LIKE++ N   ++PK +  ++ K LL
Sbjct  80    PITEPHIYSWIKLYGTNFLMWHGSQAELVVAEPKLIKEIMNNNR-SFPKREPREYLK-LL  137

Query  456   GEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDF  635
             G  L+T  GEKW K RKLA + FHAE+LK M+P+MIASV++MLERW++ EGKE+D +++ 
Sbjct  138   GNGLVTTRGEKWLKKRKLAVNAFHAENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREI  197

Query  636   GVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEK  815
              VLT+E+ISRTAFGS +LEG++IF M++ +  I  K  Y ++ PGI  L +++D+IE++K
Sbjct  198   KVLTSEIISRTAFGSCYLEGENIFNMLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDK  257

Query  816   LERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIK  992
             LE+ I+ +I+++V+KRE     G  E+YGND LG LM+     +D ++ ISLD +IDE K
Sbjct  258   LEQDIRDSIIKVVKKRESNVLTGEAESYGNDLLGILMR-AYHSADETQKISLDDLIDECK  316

Query  993   ALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILN  1172
               Y AG  TT SLL W IFLLA+H++WQ+KAR+E+LEL G +NP++D I+RL+ + MI+N
Sbjct  317   TFYVAGTDTTASLLSWTIFLLAIHSDWQDKARKEVLELLGQQNPSADNISRLKIVGMIIN  376

Query  1173  ECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
             E +RLYPP +   R+V++EVKLG+L +PA++ + +P++A+HHDPQIWG+D H++ P RFA
Sbjct  377   ETLRLYPPFVVFVREVKKEVKLGDLIVPANVDVTIPVIAVHHDPQIWGEDFHLYKPERFA  436

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             QGV KAT+NN AAF PFG+GPRTCVG NFT  EAKIALSMIL+RYKFTLSPNYVH P   
Sbjct  437   QGVPKATSNNMAAFLPFGLGPRTCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVPR  496

Query  1533  FILTPKNGVQVILQ  1574
               L P++G+QV+L+
Sbjct  497   ITLCPQHGIQVMLR  510



>gb|KCW73229.1| hypothetical protein EUGRSUZ_E01694 [Eucalyptus grandis]
Length=514

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/493 (53%), Positives = 361/493 (73%), Gaps = 3/493 (1%)
 Frame = +3

Query  93    WKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHI  272
             W L +L+ + WW P R++++M  QGI GPPY F HG+TK+   M  ++   PM ++SH I
Sbjct  17    WSLAKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPMSNLSHDI  76

Query  273   FARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKL  452
             F +IQP ++TW   YG  +L+W G +  L ITEPEL+KEVL N++  YPK     F KKL
Sbjct  77    FPKIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKL  136

Query  453   LGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFK  629
             LG+ L  T  GEKWAK RKLAN  FH ESLK M P M+ SV  MLE+WK  EGKE++VF+
Sbjct  137   LGDGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFR  196

Query  630   DFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEA  809
             DF VLT+EVISRTAFGSS++EG++IF+M++ L  +T +N + ++ PG+S L ++ DE+EA
Sbjct  197   DFKVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEA  256

Query  810   EKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDE  986
             EKLE+GI  +I++++++REK+   G V+ +GND+LGQL+K     +D SK I++D ++DE
Sbjct  257   EKLEKGICDSIVQMIKRREKKVMAGEVDGFGNDFLGQLVK-ALHDADKSKKITIDNLVDE  315

Query  987   IKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMI  1166
              K  Y AGH T  SL+ W +FLLA++ EWQE+AR E+L +FG+++P  DG+ +L+ ++MI
Sbjct  316   CKTFYVAGHETANSLMTWMLFLLAIYPEWQEEARMEVLNVFGNKDPIFDGLGKLKKISMI  375

Query  1167  LNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHR  1346
             +NE +RLYPPV  +TRKV ++ +LG L +PAD  IF+PI  LH DP+IWG+DVH F P R
Sbjct  376   INETLRLYPPVNGLTRKVGKKQRLGRLALPADTQIFVPIPKLHSDPEIWGEDVHQFKPER  435

Query  1347  FAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPA  1526
             F++GVAKATNNNA  F PFG GPR+CVG++F   EAK+ALSMILQRY F LSP Y+H P 
Sbjct  436   FSEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRYTFELSPAYIHCPV  495

Query  1527  DIFILTPKNGVQV  1565
              I I  P++G+Q+
Sbjct  496   HIIINQPQHGLQI  508



>gb|KCW82720.1| hypothetical protein EUGRSUZ_C04097 [Eucalyptus grandis]
Length=513

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/490 (52%), Positives = 364/490 (74%), Gaps = 4/490 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+ + WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             I P V+TW + YG  +L WHG +  L ITEP+LIKEVL N+E  YPK+   DFAKKL+G+
Sbjct  79    IHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKIGTKDFAKKLVGD  138

Query  462   ALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+ T +G+KWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF++F 
Sbjct  139   GLVGTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFREFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EG++IF+M++ L  +T KN +N++ PGI  L +++DE+EAEKL
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRLPGIR-LWKTADEVEAEKL  257

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+ +IL+++++REK+   G  + +G+D+LGQL+K     +D SK  ++D ++DE K 
Sbjct  258   EKGIRNSILQMIKRREKKVMAGEEDGFGDDFLGQLVK-ALHDTDKSKKFTIDNLVDECKT  316

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  T  S++ W +FLLA++ EWQE+ARRE+L +FG+E+P SDG+ +L+ ++MI+NE
Sbjct  317   FYIAGQETANSMMTWMLFLLAINPEWQEEARREVLNVFGNEDPDSDGLGKLKKISMIMNE  376

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV+ +TRKV ++++LG L +PA+  IF+P L LHHDP+IWG+D H F P RF++
Sbjct  377   TLRLYPPVVGLTRKVGKKLRLGRLVLPANSQIFIPTLKLHHDPEIWGEDAHEFKPERFSE  436

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AKATNNNA  F PFG GPR+CVG++F   EAKI LSMILQRY F LSP Y+H P  + 
Sbjct  437   GIAKATNNNAVVFIPFGFGPRSCVGMSFVVAEAKILLSMILQRYTFELSPTYIHCPGQLL  496

Query  1536  ILTPKNGVQV  1565
                P++G+Q+
Sbjct  497   TTRPQHGLQI  506



>ref|XP_008374265.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=527

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/503 (53%), Positives = 372/503 (74%), Gaps = 5/503 (1%)
 Frame = +3

Query  63    LTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMG  242
             L+  + ++L++ L++++ + WW P R++K+M++QGI GPPY   HGNTK+IS+M+ + M 
Sbjct  11    LSSLLCVFLVFVLIKILHKLWWXPTRIQKMMKAQGIKGPPYRLIHGNTKEISDMKKEVMR  70

Query  243   KPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITE-PELIKEVLANKEGAYP  419
             +P  ++SH I + + PH+H+W +IYG  +L WHG+   L ITE PEL KE+++NK+ AYP
Sbjct  71    RPK-NLSHDIVSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEEPELXKEIMSNKDKAYP  129

Query  420   KMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             K +   F KKLLG+ L+T  EGEKW K+RKLA H FH E LK + P+M+AS E MLERW+
Sbjct  130   KREPTTFVKKLLGDGLVTTTEGEKWGKLRKLATHAFHGECLKSLFPDMVASAETMLERWR  189

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
               E KE++VF++F +LT+EVISRTAFGSS+LEG++IF+M+  L  +  KN   V+ PGIS
Sbjct  190   NYEEKEIEVFEEFRLLTSEVISRTAFGSSYLEGQNIFEMLMKLAFLVSKNALKVRIPGIS  249

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREK-ESNGVVENYGNDYLGQLMKITTGGSDIS  953
                ++SDEIEAEKLE+G+  +I+ + +KREK  ++G  +++G+D+LG L+K     +D  
Sbjct  250   KFFKTSDEIEAEKLEKGVYASIMXIXKKREKTATSGDEDSFGSDFLGLLLKARHDAND-D  308

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             + IS+D ++DE K  Y AG  TT +LL W +FLLALHT WQE+AR+E++ELFG + P  D
Sbjct  309   QRISVDDLVDECKTFYFAGQETTNTLLXWTVFLLALHTNWQEEARKEVIELFGKQTPNLD  368

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             GI +L+TM+MI NE +RLYPPV    RKVEREV+LGN+ +PA++ + +   + HH+ +IW
Sbjct  369   GITKLKTMSMIFNESLRLYPPVAGFXRKVEREVRLGNVIVPANVXLXISXJSFHHBXRIW  428

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             GQD  +F P RFA+GVAKATNNN  AF PFG+GPR+CVGLNF  NEAKIALSMILQRY F
Sbjct  429   GQDAQLFKPERFAEGVAKATNNNIGAFVPFGIGPRSCVGLNFAINEAKIALSMILQRYSF  488

Query  1494  TLSPNYVHYPADIFILTPKNGVQ  1562
             TLSP YVH P     + P++GVQ
Sbjct  489   TLSPGYVHLPIQYVTVRPQHGVQ  511



>ref|XP_010044376.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86462.1| hypothetical protein EUGRSUZ_B03130 [Eucalyptus grandis]
Length=514

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/490 (52%), Positives = 358/490 (73%), Gaps = 3/490 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+ + WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEVRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             I P V+TW + YG  +L WHG +  L ITEPELIKEVL N+E  YPK    DFAKKLLG+
Sbjct  79    IHPQVNTWIDTYGRNYLNWHGPQAQLVITEPELIKEVLLNREKTYPKTGTKDFAKKLLGD  138

Query  462   ALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+ T + +KWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF +F 
Sbjct  139   GLVSTVDDKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EG++IF+M++ L  +T KN +N++ PGI  L +++DE+EAEKL
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTGLATLTSKNAFNIRLPGIRKLWKTADEVEAEKL  258

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+ +IL+++++REK+   G  +  G+D+LGQL+K     +D SK  ++D ++DE K 
Sbjct  259   EKGIRNSILQMIKRREKKVMAGEEDGIGDDFLGQLVK-ALHDTDKSKKFTVDNLVDECKT  317

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y  G  T  S++ W +FLLA++ EWQE+ARRE+L +FG+++P SDG+ +L+ ++MI+NE
Sbjct  318   FYIGGQETANSMMAWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKISMIMNE  377

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV+ + RKV ++++LG   +PA+  IF+P L LHHDP+IWG+DVH F P RF++
Sbjct  378   TLRLYPPVVNLIRKVGKKLRLGKFVLPANSQIFIPTLKLHHDPEIWGEDVHEFKPERFSE  437

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AKATNNNA  F PFG GPR+CVG++F   EAKI LSMILQRY F LSP Y+H P  + 
Sbjct  438   GIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKITLSMILQRYTFELSPTYIHCPGQLL  497

Query  1536  ILTPKNGVQV  1565
                P++G+Q+
Sbjct  498   TTRPQHGLQI  507



>ref|XP_007034362.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY05288.1| Cytochrome P450 [Theobroma cacao]
Length=596

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/510 (52%), Positives = 370/510 (73%), Gaps = 3/510 (1%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
             A  LT S  +YLL  LV+++ + WW P R++ ++ SQGI GPPY F HGN K++++ R +
Sbjct  85    AILLTSSFCLYLLIALVKVLYQYWWVPLRIQHLLSSQGIKGPPYRFIHGNNKEVNHFRKE  144

Query  234   SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGA  413
             ++ K M  ++H IF ++ PHV++W  IYG  +L W G +  + ITEPEL+KEVL N E A
Sbjct  145   ALSKHM-ALTHDIFPKVLPHVYSWINIYGKNYLFWDGIQAQVAITEPELVKEVLKNSEKA  203

Query  414   YPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERW  593
             +PK     +  +LLG+ L+T EGEKWAK RKLAN+ FH ESLK M P +IASVE MLE+W
Sbjct  204   FPKQKPPIYVSRLLGDGLVTTEGEKWAKQRKLANYVFHGESLKNMTPAVIASVERMLEQW  263

Query  594   KELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGI  773
             K  EGKE++VF++F +LT+EVISRTAFGSS+LEGK IF M+  L+ I  ++++  + PGI
Sbjct  264   KGQEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGKKIFDMLMELSIIVSRSLFKARIPGI  323

Query  774   SMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDI  950
             S   ++ D+IE+EKL +GI  +++E+V+KRE K  +G  +++G+D+LG L+  +    D 
Sbjct  324   SKFWKTDDDIESEKLAKGIHDSVMEIVKKREDKVVSGEADSFGSDFLGLLIA-SYHDLDD  382

Query  951   SKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTS  1130
                +S++ ++DE K  Y AG  TT SLL W + LLA+H +WQEKARRE++E+FG++NP S
Sbjct  383   KNRLSVEDLVDECKTFYFAGQETTNSLLAWTVLLLAVHRDWQEKARREVIEIFGNQNPHS  442

Query  1131  DGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQI  1310
             +G+A+L+T+ MI+ E +RLY PV  + RKV RE++LG L +PA I   +P +ALHHDP++
Sbjct  443   EGLAKLKTITMIMYETLRLYAPVNGLVRKVGREIQLGKLVLPAGIEFMIPNMALHHDPEL  502

Query  1311  WGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYK  1490
             WG DVH+F P RFA+G+AKAT  NAAAF PFG+GPR+CVG++F T E K ALSMILQRY 
Sbjct  503   WGDDVHLFKPERFAEGIAKATKYNAAAFIPFGLGPRSCVGMSFATTETKTALSMILQRYT  562

Query  1491  FTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
               LSP YVH P     L P++G+QVILQ++
Sbjct  563   IALSPAYVHSPVSNLTLRPQHGIQVILQSL  592



>ref|XP_010320842.1| PREDICTED: cytochrome P450 CYP749A22 [Solanum lycopersicum]
Length=501

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/497 (54%), Positives = 366/497 (74%), Gaps = 7/497 (1%)
 Frame = +3

Query  90    LWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHH  269
             L+ LV +V +  WTP  ++ +MR QGI GP Y F +GN K+I  M+ +S  K M  +SH 
Sbjct  12    LFILVGIVKKLLWTPFHVQFMMRYQGIQGPCYKFLYGNFKEIDEMKKESTNKAMDHLSHD  71

Query  270   IFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKK  449
             IF RI PH+ +WK++YG  FL WHG +P L +TEPEL+KE+L+N+   YPKMDL+ F KK
Sbjct  72    IFPRILPHIFSWKKLYGPNFLYWHGLQPELVVTEPELLKEILSNRNNNYPKMDLEGFPKK  131

Query  450   LLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFK  629
             L G+ + +++GEKW K+RKLANH FH  SL+ M+P MI S E MLERWK  E K+++VF+
Sbjct  132   LFGDGVASSKGEKWVKMRKLANHVFHGVSLRSMIPMMIMSCETMLERWKNYEDKKIEVFE  191

Query  630   DFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEA  809
             +F +LT+E+ISRTAFGSS+ EGK+IF+M+  L ++   N   V+FPGIS + +S DEIE+
Sbjct  192   EFRLLTSEIISRTAFGSSYSEGKNIFQMLMKLASLVSGNANKVRFPGISQIWKSCDEIES  251

Query  810   EKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEI  989
             EKLE+GI   I  +++KRE+E      N+G+D+LG+L++           IS++ ++DE 
Sbjct  252   EKLEKGIHDCITRIIKKREEEEED--HNFGSDFLGKLLEAYQ-----DNRISIEDIVDEC  304

Query  990   KALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMIL  1169
             K  Y AGH TTT LLGW +FLLA + +WQEKAR+E++E FGH  P +DG++RL+TMNMIL
Sbjct  305   KTFYFAGHETTTILLGWTMFLLATNKKWQEKARKEVVESFGHNVPNADGLSRLKTMNMIL  364

Query  1170  NECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRF  1349
             +E +RLYPPV  + RKV+ +V+LG LT+P ++  ++  LALHHD +IWG+DVHVF P RF
Sbjct  365   DESLRLYPPVPFIKRKVDNKVELGKLTLPGEMHFYISPLALHHDRKIWGEDVHVFRPDRF  424

Query  1350  AQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPAD  1529
             A+GV KATNNN  A+ PFG GPRTC+GLNF   EAKIALSMILQRY FT+SP YVH PA 
Sbjct  425   AEGVVKATNNNPVAYLPFGYGPRTCLGLNFAMTEAKIALSMILQRYMFTMSPTYVHSPAQ  484

Query  1530  IFILTPKNGVQVILQNV  1580
             +F+L P++GV+VIL  +
Sbjct  485   LFMLRPQHGVEVILHKI  501



>ref|XP_010056458.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW73208.1| hypothetical protein EUGRSUZ_E01670 [Eucalyptus grandis]
Length=514

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/493 (52%), Positives = 360/493 (73%), Gaps = 3/493 (1%)
 Frame = +3

Query  93    WKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHI  272
             W L +L+ + WW P R++++M  QGI GPPY F HG+TK+   M  ++   PM ++SH I
Sbjct  17    WSLAKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPMSNLSHDI  76

Query  273   FARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKL  452
             F +IQP ++ W   YG  +L+W G +  L ITEPEL+KEVL N++  YPK    DFAKK+
Sbjct  77    FPKIQPQINKWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGSKDFAKKI  136

Query  453   LGEALIT-NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFK  629
             +G+ L +   GEKWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF 
Sbjct  137   VGDGLASVPGGEKWATKRKLANHAFHGESLKNMAPAMVDSVHTMLGKWKNQEGKEIEVFG  196

Query  630   DFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEA  809
             +F VL  EVISRTAFGSS++EG++IF+M++ L  +T +N + ++ PG+S L ++ DE+EA
Sbjct  197   EFKVLAAEVISRTAFGSSYIEGRNIFQMLTRLALLTSRNTFTIRLPGLSKLWKTVDEVEA  256

Query  810   EKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDE  986
             EKLE+GI  +I++++++REK+   G V+ +G+D+LGQL+K     +D SK I++D ++DE
Sbjct  257   EKLEKGICDSIVQMIKRREKKVMAGEVDCFGDDFLGQLVK-ALHDADKSKKITVDNLVDE  315

Query  987   IKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMI  1166
              K  Y AGH T  SL+ W +FLLA++ EWQE+AR E+L +FG+++P  DG+ +L+ ++MI
Sbjct  316   CKTFYVAGHETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLKKISMI  375

Query  1167  LNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHR  1346
             LNE +RLYPPV+ +TRKV ++ +LG L +PADI IF+PI  LH DP+IWG+DVH F P R
Sbjct  376   LNETLRLYPPVVGLTRKVGKKQRLGRLLLPADIQIFVPIPKLHSDPEIWGEDVHQFKPER  435

Query  1347  FAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPA  1526
             F++GVAKATNN A  F PFG GPR+CVG++F   EAK+ALSMILQRY F LSP Y+H PA
Sbjct  436   FSEGVAKATNNKAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRYSFELSPAYIHSPA  495

Query  1527  DIFILTPKNGVQV  1565
              I +  P++G+Q+
Sbjct  496   HIVMNRPQHGLQI  508



>ref|XP_010056464.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=581

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/493 (53%), Positives = 361/493 (73%), Gaps = 3/493 (1%)
 Frame = +3

Query  93    WKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHI  272
             W L +L+ + WW P R++++M  QGI GPPY F HG+TK+   M  ++   PM ++SH I
Sbjct  84    WSLAKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPMSNLSHDI  143

Query  273   FARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKL  452
             F +IQP ++TW   YG  +L+W G +  L ITEPEL+KEVL N++  YPK     F KKL
Sbjct  144   FPKIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKL  203

Query  453   LGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFK  629
             LG+ L  T  GEKWAK RKLAN  FH ESLK M P M+ SV  MLE+WK  EGKE++VF+
Sbjct  204   LGDGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFR  263

Query  630   DFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEA  809
             DF VLT+EVISRTAFGSS++EG++IF+M++ L  +T +N + ++ PG+S L ++ DE+EA
Sbjct  264   DFKVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEA  323

Query  810   EKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDE  986
             EKLE+GI  +I++++++REK+   G V+ +GND+LGQL+K     +D SK I++D ++DE
Sbjct  324   EKLEKGICDSIVQMIKRREKKVMAGEVDGFGNDFLGQLVK-ALHDADKSKKITIDNLVDE  382

Query  987   IKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMI  1166
              K  Y AGH T  SL+ W +FLLA++ EWQE+AR E+L +FG+++P  DG+ +L+ ++MI
Sbjct  383   CKTFYVAGHETANSLMTWMLFLLAIYPEWQEEARMEVLNVFGNKDPIFDGLGKLKKISMI  442

Query  1167  LNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHR  1346
             +NE +RLYPPV  +TRKV ++ +LG L +PAD  IF+PI  LH DP+IWG+DVH F P R
Sbjct  443   INETLRLYPPVNGLTRKVGKKQRLGRLALPADTQIFVPIPKLHSDPEIWGEDVHQFKPER  502

Query  1347  FAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPA  1526
             F++GVAKATNNNA  F PFG GPR+CVG++F   EAK+ALSMILQRY F LSP Y+H P 
Sbjct  503   FSEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRYTFELSPAYIHCPV  562

Query  1527  DIFILTPKNGVQV  1565
              I I  P++G+Q+
Sbjct  563   HIIINQPQHGLQI  575



>ref|XP_007045774.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01606.1| Cytochrome P450 [Theobroma cacao]
Length=524

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/515 (51%), Positives = 374/515 (73%), Gaps = 9/515 (2%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
              LT S+ +YL+  L++++ + WWTP R++  M  QGI GPPY F HGN K+   M+ +++
Sbjct  11    LLTGSLCLYLVIALIKILHKYWWTPLRIQYAMNLQGIKGPPYKFIHGNNKETVKMKHEAL  70

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              KPM  +SH IF R+ P V++    YG  +L+W GT   LFITEPEL+KEVL + E A+P
Sbjct  71    SKPMASLSHDIFPRVNPPVYSRINSYGKNYLSWGGTTAQLFITEPELVKEVLKSSERAFP  130

Query  420   KM-------DLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEV  578
             K        + D+FA  +LG+ L+T+EGEKWA+ RKLAN+ FH +SLK M P +IASVE 
Sbjct  131   KRTSRERKRNEDEFALMILGDGLVTSEGEKWARQRKLANYAFHGDSLKSMTPAVIASVET  190

Query  579   MLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNV  758
             MLERWK+ EGKE+DVF+DF +LT+EVISRTAFGSS+L+GK IF M+  L+ +T +N++  
Sbjct  191   MLERWKQFEGKEIDVFEDFRLLTSEVISRTAFGSSYLDGKKIFDMLLKLSVLTNRNLFKA  250

Query  759   KFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITT  935
             KFP IS   +++DEIE+EKL +GI  +++E+V+KRE++  NG   ++G D+LG L+    
Sbjct  251   KFPVISNFCKTADEIESEKLVKGIHNSVMEIVKKREEKVLNGEANSFGTDFLGLLVS-AY  309

Query  936   GGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH  1115
               +D    +S   ++DE K  Y  G  TT S L W + LLA++ +WQEKARRE++E+FG+
Sbjct  310   HDADKKNRLSGQDLVDECKTFYFTGQETTNSALAWAVLLLAINPDWQEKARREVIEVFGN  369

Query  1116  ENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALH  1295
             +NP S+GI RL+TM MI+NE +RLYPP+ ++ RKVE EV+LG L +PAD+ + +PI+ALH
Sbjct  370   QNPHSEGIGRLKTMTMIINETLRLYPPINSMVRKVENEVQLGKLILPADLHVVVPIVALH  429

Query  1296  HDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMI  1475
             HDPQ+WG D ++F P RF++G++ AT +NAAA+ PFG+GPR+CVG++F   EAK ALSMI
Sbjct  430   HDPQLWGDDANLFKPERFSEGISNATKHNAAAYIPFGLGPRSCVGMSFAMTEAKTALSMI  489

Query  1476  LQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LQRY  +LSP Y H P  + +L P++G+QVIL ++
Sbjct  490   LQRYTISLSPTYSHSPCTLLLLQPQHGIQVILHSL  524



>gb|KDO70289.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=546

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/540 (50%), Positives = 370/540 (69%), Gaps = 35/540 (6%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             L++  + F L F + I      +RL ++ WW P R + VM SQGI GP Y   +GNTK+I
Sbjct  7     LYAATSCFCLVFFLFI------IRLFNKLWWIPNRTQAVMGSQGIRGPAYRLVYGNTKEI  60

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
              ++R+Q    PM  +SH I  RI PH+ +W + YG  FLTW+G++  L IT+PELIKE+L
Sbjct  61    LSLRNQIWISPM-GLSHDILPRILPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEIL  119

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLK-----------  542
             +N +G YPK+    F +K+LG+ L+T  GE W + RKLA   F+AESL+           
Sbjct  120   SNSDGTYPKVQAPGFLRKILGDGLVTAGGENWHRQRKLATLAFYAESLRVTKSNCLMFKL  179

Query  543   ---------------RMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFG  677
                             M+P M+ASVE+ML+RW+  EGKE++V ++F +LT+E+ISRTAFG
Sbjct  180   KSVIVMLFNVFAPMQDMIPAMVASVEIMLKRWRHSEGKEIEVSQEFKLLTSEIISRTAFG  239

Query  678   SSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVR  857
             SS+LEG+ IF  ++N++ +  +N Y +K P I    ++SD++E +KLE+GI+ +I+++++
Sbjct  240   SSYLEGESIFNKLTNMSFLASRNAYKIKIPLIGDFVKTSDDVEGDKLEQGIRDSIIKMMK  299

Query  858   KREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLL  1034
              RE+++  G  E YGNDY G L+K      D++K ISLD +IDE K  Y AGH TTT LL
Sbjct  300   TREEKALKGESEGYGNDYFGLLLK-AYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLL  358

Query  1035  GWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTR  1214
              W I LLA HT+WQEK R E+LELFG +NP  DGI +L+TM+M++NE +RLYPP + ++R
Sbjct  359   TWTILLLATHTDWQEKLREEVLELFGQKNPAPDGIGKLKTMSMVINESLRLYPPAVNISR  418

Query  1215  KVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaF  1394
              VEREV+LG   +PA++ + +PILA+HHDPQIWG+DV +F P RFA GVAKA+NN  AAF
Sbjct  419   NVEREVRLGKYILPANMELVIPILAIHHDPQIWGEDVDLFKPERFADGVAKASNNTPAAF  478

Query  1395  FPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              PF  GPR CVGLNF   EAKIALSMILQRY+F LSP+YVH P  +  L P++G+QVI Q
Sbjct  479   LPFSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQ  538



>ref|XP_007045772.1| Secologanin synthase, putative [Theobroma cacao]
 gb|EOY01604.1| Secologanin synthase, putative [Theobroma cacao]
Length=1045

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/526 (51%), Positives = 380/526 (72%), Gaps = 14/526 (3%)
 Frame = +3

Query  15    LSMMSGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFP  194
             +S M+  L +++T      S+ +YL+  L++++ + WWTP R++  M  QGI GPPY F 
Sbjct  1     MSSMAANLSALLTG-----SLCLYLVIALIKILHKYWWTPLRIQYAMNLQGIKGPPYKFI  55

Query  195   HGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEP  374
             HGN K+   M+ +++ KPM  +SH IF R+ P V++W   YG  +L+W GTK  L ITEP
Sbjct  56    HGNNKETVKMKQEALSKPMASLSHDIFPRVNPPVYSWINSYGKNYLSWAGTKAQLIITEP  115

Query  375   ELIKEVLANKEGAYPKM-------DLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAE  533
             EL+KEVL + E A+PK        + D+FA K+LG+ L+T+EG+KWA+ RKLAN+ FH E
Sbjct  116   ELVKEVLKSSERAFPKRTSRERKRNEDEFAIKILGDGLVTSEGQKWARQRKLANYAFHGE  175

Query  534   SLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKM  713
             SLK M P +IASVE MLE+WK+LEGKE++VF++F +LT+EVISRTAFGSS+L+GK IF M
Sbjct  176   SLKSMTPALIASVETMLEKWKQLEGKEIEVFEEFRLLTSEVISRTAFGSSYLDGKKIFDM  235

Query  714   VSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVE  890
             +  L+ +T +N++  KFP IS   +++DEIE++KL +GI  +++E+V+KRE K  NG   
Sbjct  236   LLKLSVLTNRNMFKTKFPVISNFRKTADEIESDKLVKGIHNSVMEIVKKREEKVVNGEAN  295

Query  891   NYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTE  1070
             ++G D+LG L+      +D     S+  ++DE K  Y AG  TT S L W + LLA++ +
Sbjct  296   SFGTDFLGLLVS-AYHDADKKNRPSVQDLVDECKTFYFAGQETTNSALAWTVLLLAINPD  354

Query  1071  WQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLT  1250
             WQEKARRE++E+FG++NP S+GI RL+TM MI+NE +RLYPPV  + RKVE EV+LG L 
Sbjct  355   WQEKARREVIEVFGNQNPHSEGIGRLKTMTMIINETLRLYPPVSGMARKVENEVQLGKLI  414

Query  1251  IPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVG  1430
             +PAD+ + +PI+ALHHDPQ+WG DV++F P RFA+G+A AT +NAAA+ PFG+GPR+CVG
Sbjct  415   LPADLHLGVPIMALHHDPQLWGDDVNLFKPERFAEGIANATKHNAAAYVPFGLGPRSCVG  474

Query  1431  LNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVI  1568
             ++F   E KI +SMILQRY  +LSP Y H P  + +L P++G+QV+
Sbjct  475   MSFAMTETKIVVSMILQRYTISLSPTYSHSPFTLLLLQPQHGIQVL  520


 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/515 (51%), Positives = 372/515 (72%), Gaps = 9/515 (2%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
              LT S+ +YL+  L++++ + WWTP R++  M  QGI GPPY F HGN K+   M   ++
Sbjct  532   LLTGSLCLYLVMALIKILHKYWWTPLRIQYAMNLQGIKGPPYKFIHGNNKETERMTRDAL  591

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              KPM ++SH I  R+ P V++    YG  +L+W GT+  LFITEPEL+KEVL + E A+P
Sbjct  592   SKPMANLSHDILPRVNPPVYSRINSYGKIYLSWVGTRAQLFITEPELVKEVLKSSERAFP  651

Query  420   KM-------DLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEV  578
             K        + D+FA K+LG+ L+T+EGEKWA+ RKLAN+ FH +SLK M P +IASVE 
Sbjct  652   KRTSRERKWNDDEFALKILGDGLVTSEGEKWARQRKLANYAFHGDSLKSMTPAVIASVET  711

Query  579   MLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNV  758
             MLERWK+ EGKE++ F++F +LT+EVISRTAFGSS+L+GK IF M+  L+ +T +N++  
Sbjct  712   MLERWKQFEGKEIEAFEEFRLLTSEVISRTAFGSSYLDGKKIFDMLLKLSVLTNRNLFKT  771

Query  759   KFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITT  935
             KFP IS   +++DEIE++KL +GI  +++E+V+KRE K  NG   ++G D+LG L+    
Sbjct  772   KFPVISNFCKTADEIESDKLVKGIHNSVMEVVKKREEKVVNGEANSFGTDFLGLLVN-AY  830

Query  936   GGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH  1115
               +D    +S+  ++DE K  Y AG  TT S L W + LLA++ +WQEKARRE++E+FG+
Sbjct  831   HDADKKNRLSVQDLVDECKTFYFAGQETTNSALAWTVLLLAINPDWQEKARREVIEVFGN  890

Query  1116  ENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALH  1295
             +NP S+GI RL+TM MI+NE +RLYPPV  + RKVE EV+LG L +PAD+ + +P +ALH
Sbjct  891   QNPHSEGIGRLKTMTMIINETLRLYPPVSGMARKVENEVQLGKLILPADLQLVVPTVALH  950

Query  1296  HDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMI  1475
             HDPQ+WG DV++F P RFA+G A AT +NAAA+ PFG+GPR+CVG++F   E KIALSMI
Sbjct  951   HDPQLWGDDVNLFKPERFAEGTANATKHNAAAYAPFGLGPRSCVGMSFAMTETKIALSMI  1010

Query  1476  LQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LQRY  +LSP Y H P  + +L P++G+QVIL ++
Sbjct  1011  LQRYNISLSPTYSHSPYTLLLLQPQHGIQVILHSL  1045



>ref|XP_008361867.1| PREDICTED: uncharacterized protein LOC103425555 [Malus domestica]
Length=1316

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/494 (55%), Positives = 365/494 (74%), Gaps = 3/494 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             ++   + WWTP  ++  M +QG+ GP Y F HG+TK+I +M+ ++MG+P   ++H IF+ 
Sbjct  825   IKNFQKLWWTPNHIQNQMAAQGVHGPSYKFIHGSTKEILSMKRETMGRPR-SLTHDIFSA  883

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+H W +I+G  FL W+G +P + I EPEL KEVL NK+  Y K     + KKLLG+
Sbjct  884   VQPHIHAWSKIFGKNFLQWYGVQPQMIIAEPELCKEVLNNKDRNYRKQRSQGYIKKLLGD  943

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
             ++   EGEKW K+RKLA+H FH E LK M+PEMI S E M++RWK  EGKE++V ++F  
Sbjct  944   SISMAEGEKWVKLRKLAHHAFHGEXLKNMIPEMIKSSETMVQRWKTYEGKEIEVNEEFRF  1003

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
              T+EVISRTAFGSSFLEGK+IF M+  LT++  +N + ++FPGISM  ++SDEI++EKLE
Sbjct  1004  FTSEVISRTAFGSSFLEGKNIFXMLRELTSLIFRNTFKLRFPGISMFYKTSDEIKSEKLE  1063

Query  822   RGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             +GI+  I E+VRKREK +  G    +G DYLG L+K     ++  + IS+D ++DE K  
Sbjct  1064  KGIRDIITEIVRKREKTARTGEAGGFGRDYLGILLKAHHDANE-KQRISVDDLVDECKTF  1122

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
             Y AG  TT SLL W +FLLALHT+WQE+AR+E+LELFG ENP +DG+ +L+TM MI+NE 
Sbjct  1123  YFAGQETTNSLLAWTVFLLALHTDWQEEARKEVLELFGKENPNTDGLNKLKTMGMIINEA  1182

Query  1179  MRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQG  1358
             +RLYPPV+++TR+  +EV+LG + +PA++ + +  LALHHDP+ WG+DV +F P RF++G
Sbjct  1183  LRLYPPVVSLTRESLKEVRLGQIVVPANVELHVANLALHHDPKYWGKDVQLFKPERFSEG  1242

Query  1359  VakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             VAKATNNNA AF PFGMGPRTCVG+NF   EAKIALSMILQRY FTLSP YVH P     
Sbjct  1243  VAKATNNNAVAFMPFGMGPRTCVGMNFAIIEAKIALSMILQRYSFTLSPGYVHSPIQFLT  1302

Query  1539  LTPKNGVQVILQNV  1580
             + P++GVQVIL  V
Sbjct  1303  VRPQHGVQVILHPV  1316



>emb|CDP00472.1| unnamed protein product [Coffea canephora]
Length=1133

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/490 (56%), Positives = 354/490 (72%), Gaps = 2/490 (0%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             R+  +  W P  ++ VMR+Q I GPPY F +GNTK+I +M+S+SM  PM DISH IF RI
Sbjct  642   RIFYKICWAPIHMQYVMRAQRIKGPPYKFLYGNTKEILSMKSKSMSCPMVDISHDIFPRI  701

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
             QPH++ W+ +YG  FL W G KP L +TEPELI+++L+NKEGAYPK+  D   KKLLG+ 
Sbjct  702   QPHMYAWRNLYGKNFLVWIGNKPQLVVTEPELIRQILSNKEGAYPKIKADSLVKKLLGDG  761

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVL  644
             L+  EGEKW K+RKLANH FHAESLK MVP MI SVE +LE+W+  +GKE++V+++F  L
Sbjct  762   LVMTEGEKWLKLRKLANHAFHAESLKDMVPAMIESVEAVLEKWRCHDGKEIEVYEEFRHL  821

Query  645   TTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLER  824
             T+EVISRTAFGSS+LEGK+IF+M+  L     KN   ++F     + RS+D+I +EK+E 
Sbjct  822   TSEVISRTAFGSSYLEGKNIFEMLMQLGFFIFKNDAKIRFLKDWKIFRSADDIASEKIEE  881

Query  825   GIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALY  1001
              ++ +I+ +V KRE+    G  ++YGND+LG L++     +D+   I++D ++DE K  Y
Sbjct  882   SLRNSIMSIVNKREEGVKIGKADSYGNDFLGSLLQ-AHHAADVKYRITIDDIVDECKTFY  940

Query  1002  GAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECM  1181
              AGH T +S L W IFLLA+HT+WQEKAR E+ E FGHE P  D IARLR M MI+NE M
Sbjct  941   LAGHETISSALTWTIFLLAIHTDWQEKARNEVFEFFGHEKPKPDFIARLRNMTMIINETM  1000

Query  1182  RLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGV  1361
             RLY P   + R+V REVKLG LT+PAD+ I +   A+H DP+IWG D  +F P RFA+GV
Sbjct  1001  RLYSPATNIVRRVGREVKLGKLTLPADMDINILPCAIHCDPEIWGADALLFKPERFAEGV  1060

Query  1362  akatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFIL  1541
             AKATN N  A+ PFG GPRTCVGLNF  NE KIALSM+LQR+KFTLSPNYVH P  +  L
Sbjct  1061  AKATNYNTMAYLPFGFGPRTCVGLNFAANEVKIALSMMLQRFKFTLSPNYVHSPFTVLTL  1120

Query  1542  TPKNGVQVIL  1571
              P+ GV ++L
Sbjct  1121  RPERGVPIVL  1130


 Score =   515 bits (1326),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 252/510 (49%), Positives = 355/510 (70%), Gaps = 7/510 (1%)
 Frame = +3

Query  51    TAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRS  230
             T      S+   LL  L+  + + WW PRR++ V  SQ I GPP  F HGNT +IS MR 
Sbjct  4     TLIIFVASILFCLLVPLINFLHKVWWMPRRIQHVFFSQSIKGPPPRFLHGNTIEISEMRQ  63

Query  231   QSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEG  410
               M + +  +SH IF  +QPH++ W +IYG  FL W G +  L ++EPELIKE+L + E 
Sbjct  64    NFMNRKL-QLSHDIFRTLQPHIYLWTKIYGKNFLHWPGARAELVVSEPELIKELLYDNEQ  122

Query  411   AYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLER  590
             ++ + D D + KK+LG+ ++T++GEKW K+R+L++  FHAESL+ M+P MI SVE+ML R
Sbjct  123   SFCRSDADRYLKKILGKGILTSDGEKWLKLRQLSSQAFHAESLRHMIPAMIESVELMLGR  182

Query  591   WKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG  770
             WK  EG E+D  ++F +LT E+ISRTAFGSS+LEG+ IF+M+  L  ++ KN +  K P 
Sbjct  183   WKNYEGMEIDASEEFRLLTAEIISRTAFGSSYLEGQDIFQMLRKLVVLSCKNSHKTKLPI  242

Query  771   ISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDI  950
             IS + +   ++EA+KLE+ ++ ++LE+V+KR+ E +     +G D+LG  +K     SD 
Sbjct  243   ISSVFKDRYDLEADKLEKRVRDSVLEMVKKRQTEIS-----FGEDFLGLHLK-AHYASDG  296

Query  951   SKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTS  1130
             +  I++ ++ID+ K  Y AG  TT+ LL W I LLA+HT+WQEKAR E+ ELFG + P  
Sbjct  297   NSRITVQEIIDQCKTFYSAGQTTTSVLLSWTILLLAIHTDWQEKAREEVFELFGQQPPNP  356

Query  1131  DGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQI  1310
             +GI+R++TM+MI+NE +RLYPP + + RK ++  KLG L +P +  + +PILA+HHDP++
Sbjct  357   EGISRMKTMSMIINESLRLYPPSVYIQRKAKKGAKLGKLILPTNTNVHVPILAIHHDPKL  416

Query  1311  WGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYK  1490
             WG+D H+FNP RF+ GVA AT NN AAF PF +GPR CVG NF T EAKI+LSMILQRY 
Sbjct  417   WGKDAHIFNPERFSSGVAAATKNNPAAFLPFSLGPRACVGANFATLEAKISLSMILQRYT  476

Query  1491  FTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             FTLSPNYVH P  I  L P++GVQV++ NV
Sbjct  477   FTLSPNYVHSPVQILSLRPQHGVQVMITNV  506



>gb|KHG03731.1| Secologanin synthase [Gossypium arboreum]
Length=513

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/490 (53%), Positives = 354/490 (72%), Gaps = 3/490 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP +++K +  QGI GPPY F HGN K  S  R +++ KPM  ++H+I  R+ PH+
Sbjct  25    KYWWTPLKIQKALSLQGIKGPPYEFIHGNNKASSRFRFEALSKPMASLTHNIVPRVIPHI  84

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKM-DLDDFAKKLLGEALIT  473
             H+W   YGN +LTW G +  L I+EPE+IKE+L + +G++PK  D   F  K+LG+ L+ 
Sbjct  85    HSWINTYGNIYLTWEGNQAQLVISEPEIIKEILKSNDGSFPKRKDDSSFIYKILGDGLVA  144

Query  474   NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTE  653
              EG KW + RKLANH FH ESLK M P +IASVE MLE+WK  EG+E++VF++F +LT E
Sbjct  145   TEGAKWVRQRKLANHAFHGESLKNMNPAVIASVETMLEKWKGREGEEMEVFEEFRLLTAE  204

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VISRTAFGS++LEGK IF+M++ L+ + + N Y  K PGISM+ +++DEIE+EKL +GI 
Sbjct  205   VISRTAFGSNYLEGKKIFEMLTRLSILVINNYYKTKIPGISMIWKTADEIESEKLAKGIH  264

Query  834   GAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAG  1010
               ++E+V++REK  S G  +N+GND+LG L+      SD     S++ ++DE K  Y AG
Sbjct  265   DRVMEMVKRREKNVSVGESDNFGNDFLGLLIN-AHRDSDEKNRFSVEDLVDECKTFYFAG  323

Query  1011  HLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLY  1190
               TT SLL W + +LA+HTEWQEK RRE+ E FG  NP S+GI++L+ MNM++NE +RLY
Sbjct  324   QETTNSLLAWTVLVLAIHTEWQEKTRREVFEAFGDRNPNSEGISKLKIMNMVINETLRLY  383

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
              PV  V RKV +E +LG L +PA++ + +PI+ALHHDPQ+WG DVH+F P RF +G+A A
Sbjct  384   SPVSAVIRKVGKEAQLGRLVLPANMEVMIPIMALHHDPQLWGDDVHLFKPERFTEGIASA  443

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
             T  N+AAF PF MGPR+CVG++F T E KIALSMILQRY FTLSP YVH P  I  L P+
Sbjct  444   TKYNSAAFIPFSMGPRSCVGMSFATTETKIALSMILQRYAFTLSPAYVHAPFPIITLQPQ  503

Query  1551  NGVQVILQNV  1580
             +G+QV+L  +
Sbjct  504   HGIQVMLNRL  513



>gb|KCW82722.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=491

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/487 (52%), Positives = 362/487 (74%), Gaps = 20/487 (4%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+++ M SQGI GPPY   +GNT++I   ++++  +P+ ++SH IF R+QPH+
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRPL-NLSHDIFPRVQPHI  80

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
              TW   Y                 EPELIKEVL NK+ A+PK ++D+F KKLLG+ L+T 
Sbjct  81    STWTGTY-----------------EPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVTT  123

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
             EGEKW K RKLAN+ FH +SLK M+P M+ SV +ML+RWK L G E++V+++F +LT+E+
Sbjct  124   EGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEI  183

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS++EG++IF+M+  LT I  +N + ++FPGIS L +++DE+E+EKLE GI+ 
Sbjct  184   ISRTAFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRD  243

Query  837   AILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
             A+LE++RKRE K   G +++ GND+LG L+K  +   D S+ I++  ++DE K  Y AG+
Sbjct  244   AMLEIIRKREEKVKAGELDDLGNDFLGLLVK-ASHSDDESRRITITDLVDECKTFYIAGY  302

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYP  1193
              T+ ++L W +FLLA+H EWQ++AR+E+L +FG+++P  DGIA+L+TM MI+NE +RLYP
Sbjct  303   DTSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPDPDGIAKLKTMGMIINESLRLYP  362

Query  1194  PVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakat  1373
             PV+ + RK+  + +LG L +PA++ +++P L LHH+PQIWG D  +F P RF++GVAKA+
Sbjct  363   PVVGLIRKIATKTRLGKLVLPANMGLYIPNLKLHHNPQIWGDDAQLFKPERFSEGVAKAS  422

Query  1374  nnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKN  1553
             NNN AAFFPFG+GPRTCVG NF T EAKIALSMILQRY F+LSP YVH P  +   +P++
Sbjct  423   NNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFSLSPAYVHSPTQLLTTSPQH  482

Query  1554  GVQVILQ  1574
             G+QVI  
Sbjct  483   GLQVIFH  489



>ref|XP_011009712.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=529

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/500 (51%), Positives = 363/500 (73%), Gaps = 14/500 (3%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWT  R++  + SQG+ GP Y F HGN K+I N+R ++M  P  ++ H  F+RIQPHV
Sbjct  32    KVWWTQIRIQSALHSQGVKGPSYRFLHGNLKEIINLRKEAMSGPT-ELCHQSFSRIQPHV  90

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
             + W +++G  F  W G++  L + E E IK VL NK+G Y K ++  + KKL G+ L+T 
Sbjct  91    YLWSKLHGKNFFWWKGSQAQLVVYETEQIKVVLNNKDGNYLKPEVQPYLKKLFGDGLVTT  150

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
              GEKW K+RK+ANH FH ESLK M+PEM++SVE+ML RWK+  GKE++VF+DF VLT+E+
Sbjct  151   RGEKWFKLRKVANHAFHGESLKDMIPEMVSSVEMMLGRWKDHRGKEIEVFQDFKVLTSEI  210

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS+LEG+ IF++++ +  I  KN++ ++ PGI  L ++ D+I++EKL + I+ 
Sbjct  211   ISRTAFGSSYLEGQQIFEILTRMVLIFSKNLFRMRIPGIGKLVKTQDDIQSEKLGQIIRN  270

Query  837   AILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
             +++++++KRE+ +  G ++ YG+D+LGQL+K+    +D++  I++D +IDE K  Y AGH
Sbjct  271   SVIKMIKKREEAAMAGEIDGYGSDFLGQLVKVYR-SADMTSRITIDDLIDECKNFYIAGH  329

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYP  1193
              TTTS L W + +LA H +WQEK R EILELFG +NP  +GI+RL+TM+M++NE +RLYP
Sbjct  330   ETTTSALTWIVLMLATHADWQEKVRNEILELFGQQNPGLEGISRLKTMSMVINESLRLYP  389

Query  1194  PVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakat  1373
             PV+ + R+V++  KLGNL IP  + + +P LALHHDPQIWG DVH+F P RFA+GVAKAT
Sbjct  390   PVVGLLREVKKGTKLGNLIIPEKMEVHVPSLALHHDPQIWGDDVHLFKPDRFAEGVAKAT  449

Query  1374  nnnaaa-----------FFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHY  1520
              NN AA           F PFGMGPR CVG+NF  NE KI LSMILQRY+ TLSPNYVH 
Sbjct  450   KNNIAAFLXXXXXXXXXFLPFGMGPRNCVGMNFAYNEIKITLSMILQRYRITLSPNYVHS  509

Query  1521  PADIFILTPKNGVQVILQNV  1580
             P  +  + P++G+QV+++ V
Sbjct  510   PVLVLAICPQHGLQVMIKAV  529



>gb|KDP41353.1| hypothetical protein JCGZ_15760 [Jatropha curcas]
Length=475

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/475 (53%), Positives = 360/475 (76%), Gaps = 3/475 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             MRS+GI GP Y F HGNTK+I++MR+  M  PM ++SH +  RIQPH+++W ++YG  FL
Sbjct  1     MRSKGIRGPSYVFLHGNTKEITHMRNTIMNGPM-ELSHEMLPRIQPHIYSWIKLYGPNFL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
              W+G +  L +TEPEL++EVL NKEGAY K  + ++A+KL G+ L+ ++GEKW K+RKLA
Sbjct  60    NWYGLQAQLVVTEPELVQEVLNNKEGAYQKKIIQNYAEKLFGDGLVASKGEKWLKMRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             +  FH ESLK MVP M+ASVE ML+RW++ E KE+++F++F +LT+E+IS+TAFGSS+LE
Sbjct  120   HQAFHGESLKGMVPAMVASVETMLDRWRQNEVKEIEMFQEFKILTSEIISKTAFGSSYLE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKE  872
             GK++F M++ +  I  +N + V+ PGI  + ++ D+IE+E+LERG++ +IL +++ RE+ 
Sbjct  180   GKNLFDMLTKMATIIARNNFQVRIPGIKKILKTPDDIESEELERGMRESILMMMKTREEG  239

Query  873   S-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIF  1049
                G +ENYG+D+LG L+K+    +D+S  IS+  +IDE K  Y AGH TT S L W I 
Sbjct  240   VVKGKLENYGSDFLGLLLKVYHA-NDLSNKISVQDLIDECKTFYLAGHETTVSSLTWTIL  298

Query  1050  LLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVERE  1229
             LLA+H  WQ+KAR E+++LFG +NP SDGIARL+ M+MI+NE +RLYPPV  +TR+V+RE
Sbjct  299   LLAIHPIWQDKAREEVIKLFGKQNPGSDGIARLKIMSMIVNESLRLYPPVFNITREVQRE  358

Query  1230  VKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGM  1409
             V+LGN+ IP  + + +PILA+ H+ ++WG+DV++F P RFA GVAKAT NN AAF PFG 
Sbjct  359   VRLGNVIIPEKMAVCLPILAVQHNSKVWGEDVNLFKPERFADGVAKATKNNIAAFLPFGS  418

Query  1410  GPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             G R+CVG NF T E KIALSMILQ Y+FTLSP YVH P  +  + P+ G+Q++L+
Sbjct  419   GARSCVGSNFATAEIKIALSMILQNYRFTLSPTYVHAPIHVLTICPQYGLQILLE  473



>gb|KCW85140.1| hypothetical protein EUGRSUZ_B01983 [Eucalyptus grandis]
Length=514

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/511 (48%), Positives = 372/511 (73%), Gaps = 7/511 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWK---LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRS  230
              L F +SI +L+    L +L+ + WW P R+++ M SQGI GPPY F HG TK+IS ++ 
Sbjct  3     LLCFLLSILVLFLSSILTKLLQKLWWRPIRVQRAMASQGIKGPPYKFIHGCTKEISKLKQ  62

Query  231   Q---SMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
                  M +PM ++SH I   ++PH+H W ++YG  +L W+G + +LFI++ EL+KEVL N
Sbjct  63    DVMMKMNEPMTNVSHEILPIVEPHIHKWNKLYGGIYLHWYGPQAFLFISDTELVKEVLNN  122

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             ++  Y K++     KK+ G+ L+  EG+KWA+ R+LA+  FH ESLK M+P M+ SV  +
Sbjct  123   RDKTYVKLEFPGDIKKIFGDGLVATEGKKWARQRRLAHLAFHGESLKGMIPAMVDSVHAL  182

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L+RW++LE KE+++F++F  +T++VISRTAFGSS++EG+ IF+M+S LT I  +N + ++
Sbjct  183   LDRWQKLEAKEVEIFEEFATITSDVISRTAFGSSYMEGREIFQMLSELTIIVSRNFFKLR  242

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGG  941
              PGI  + ++SDEI++E+LE+ I  A+L +++KRE+++ G +++YGNDYLG L+K     
Sbjct  243   LPGIRKIWKTSDEIKSERLEKAICDALLGIIKKREEKAKGEMDDYGNDYLGSLLK-AYHD  301

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN  1121
              D SK I++D + DE K  + AG  TTTS+L W +FLLA+H +WQE+AR+E+ ++F +E+
Sbjct  302   PDKSKRITMDDLRDECKTFHFAGQETTTSILTWTLFLLAIHKDWQEEARKEVTDVFDNED  361

Query  1122  PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHD  1301
             P  +GI +L+T++MI+NE +RLYPPV++  RKV R+V LGNL +P  I + +PIL +HH 
Sbjct  362   PNHEGIIKLKTVDMIINESLRLYPPVVSAIRKVVRQVTLGNLVLPQGIALHIPILTIHHS  421

Query  1302  PQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQ  1481
             P+IWG DVH+F P RF +G+A A +N+AAAF PFG+GPR CVG NF T EAKI L+MIL+
Sbjct  422   PRIWGDDVHLFKPERFREGIAGAVSNDAAAFLPFGLGPRNCVGSNFATTEAKITLAMILR  481

Query  1482  RYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              Y FT+SP+YVH P   F++ P++G++VIL 
Sbjct  482   HYSFTVSPDYVHLPTQTFMIRPQHGLKVILH  512



>ref|XP_008340298.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103403255 
[Malus domestica]
Length=1026

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/492 (53%), Positives = 368/492 (75%), Gaps = 5/492 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             ++++ R WWTP R++K M  QGI GPPY   HGNTKQ+S+M  + M +P  ++SH IF+R
Sbjct  33    IKILRRLWWTPTRIQKQMALQGIRGPPYRLIHGNTKQVSHMMKEXMNRPK-NLSHDIFSR  91

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+H+W +IYG  +L WHG++  L ITEPEL KE+L NKE AY K +   F KKLLG+
Sbjct  92    VQPHIHSWTQIYGKNYLQWHGSRAQLVITEPELCKEILNNKERAYGKRETPKFLKKLLGD  151

Query  462   ALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+T  E EKWAK+RKLA H FH E+LK M+PEM+AS E ML RW++  GKE++VF++F 
Sbjct  152   GLVTTTEAEKWAKLRKLATHAFHGENLKSMIPEMVASAETMLXRWEDYVGKEIEVFEEFR  211

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             + T+EVISRTAFGSS++EGK+IF+M+  L  +  KN   V+ PGIS L +++DE+E++KL
Sbjct  212   LFTSEVISRTAFGSSYIEGKNIFEMLIKLAFLVFKNSLTVRVPGISKLFKTNDEVESDKL  271

Query  819   ERGIKGAILELVRKREKES--NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIK  992
             E+ + G+I E+V+KREK++   G  E++G+D+LG L+K     ++ ++ +S+D+++DE K
Sbjct  272   EKEVHGSITEIVKKREKKAMMTGQKESFGSDFLGLLLKAHHDANE-NQRVSVDELVDECK  330

Query  993   ALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILN  1172
                 AG  TT +LL W +FLLALHT+WQE+AR+E++++FG + P  D  ++L+TM+MI  
Sbjct  331   TFXFAGQETTNTLLAWTVFLLALHTDWQEEARKEVMDVFGKQTPNPDDFSKLKTMSMIFY  390

Query  1173  ECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
             E  RLYPP+ ++ RKV+REV+LGN+ +P ++ + +  LA  HDP+IWG+D  +F P RFA
Sbjct  391   ESQRLYPPLDSLVRKVDREVRLGNVIVPPNVELILSNLAFQHDPRIWGEDSQLFKPERFA  450

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             +G+AKATNN  +AF PFG+GPR+CVGLNF T EAKIALSMILQRY FTLSP Y+H P   
Sbjct  451   EGIAKATNNTISAFIPFGVGPRSCVGLNFATIEAKIALSMILQRYSFTLSPGYIHLPVHY  510

Query  1533  FILTPKNGVQVI  1568
               + P++G+QV+
Sbjct  511   LTMRPQHGIQVM  522


 Score =   492 bits (1266),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 246/480 (51%), Positives = 334/480 (70%), Gaps = 11/480 (2%)
 Frame = +3

Query  138   RLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIY  317
             +L K      I  PPY   HG TK+I +MR + MG+    +SH  F+ +QPH+H W +IY
Sbjct  545   QLEKKHEKWXIRDPPYRLIHGTTKEIFDMRKEVMGRSHI-LSHDTFSVVQPHMHAWIKIY  603

Query  318   GNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALI-TNEGEKWA  494
             G  +L WHG++  L  TEP+L KE+  NK+ A PK ++ +F  KLLG+ L+ T E  KW 
Sbjct  604   GKNYLQWHGSQAQLVXTEPDLCKEIPNNKDRAXPKREIANFVNKLLGDGLVATTEAXKWG  663

Query  495   KVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAF  674
             K+RKLA H FH E+L  M+P+M AS E MLE WK+ EG+E++V+++F + T+EVISRTAF
Sbjct  664   KLRKLATHXFHGETLXSMIPKMXASAETMLEXWKDFEGQEIEVYEEFRLFTSEVISRTAF  723

Query  675   GSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELV  854
             GSS++EGK+IF M+  + ++  KN   V+ PGIS   ++SDEIE++KLE       +E V
Sbjct  724   GSSYIEGKNIFXMLIKIGSLIXKNSLKVRVPGISKFFKTSDEIESDKLE-------IESV  776

Query  855   RKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSL  1031
             +KREK++     +++G+D+LG L+K     +D +  IS+D++IDE K  Y AG  TT + 
Sbjct  777   KKREKKARPEEKDSFGSDFLGLLLKARHNAND-NHRISVDELIDECKTFYFAGQETTNTS  835

Query  1032  LGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVT  1211
             L W + LLALHT+WQE+AR+E++ LFG + P  DGI+++RT+ MI+NE +RLY P ++  
Sbjct  836   LAWTVLLLALHTDWQEEARKEVIXLFGKQTPNHDGISKMRTVTMIINESLRLYTPXVSXX  895

Query  1212  RKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaa  1391
             RK EREVKLG L IPA++ + +   A H DP+IWGQDVH+F   RF++GV KATNNN  A
Sbjct  896   RKAEREVKLGKLIIPANLELVVSTXAPHQDPKIWGQDVHLFKQDRFSEGVLKATNNNVGA  955

Query  1392  FFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVIL  1571
             F PFG+GPRT VGLNF T EAKIALSMILQRY FTLSP YVH P     + P +GVQVIL
Sbjct  956   FIPFGLGPRTXVGLNFATTEAKIALSMILQRYSFTLSPGYVHXPLHYIXVRPHHGVQVIL  1015



>ref|XP_010041584.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Eucalyptus 
grandis]
Length=919

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/490 (53%), Positives = 363/490 (74%), Gaps = 3/490 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+   WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHNLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             I P V+TW + YG  +L WHG +  L ITEP+LIKEVL N+E  YPK    DFAKKLLG+
Sbjct  79    IHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKTGTKDFAKKLLGD  138

Query  462   ALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+ T +G+KWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF +F 
Sbjct  139   GLVSTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EG++IF+M++ L  +T KN +N++FPGI  L +++DE+EAEKL
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRFPGIRKLWKTADEVEAEKL  258

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+ +IL+++++REK+   G  + +G+D+LGQL+K     +D SK  ++D ++DE K 
Sbjct  259   EKGIRNSILQMIKRREKKVMAGEEDGFGDDFLGQLVK-ALHDTDKSKKFTVDNLVDECKT  317

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  T  S++ W +FLLA++ EWQE+ARRE+L +FG+++P SDG+ +L+ ++MI+NE
Sbjct  318   FYIAGQETVNSMMTWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKISMIMNE  377

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV+ +TRKV ++++LG L +PA+  IF+P L LHHDP+IWG+DVH F P RF++
Sbjct  378   TLRLYPPVVGLTRKVGKKLRLGRLVLPANSQIFIPTLKLHHDPEIWGEDVHEFKPERFSE  437

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AKATNNNA  F PFG GPR+CVG++F   EAKI LSMILQRY F LSP Y+H P  + 
Sbjct  438   GIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKILLSMILQRYTFKLSPTYIHCPGQLA  497

Query  1536  ILTPKNGVQV  1565
                P++G+Q+
Sbjct  498   TTRPQHGLQI  507


 Score =   423 bits (1087),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/403 (49%), Positives = 295/403 (73%), Gaps = 3/403 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             FL  S +++LL        +A   P    + M SQGI GPPY   +GNT++I   ++++ 
Sbjct  519   FLLISEALFLLCSSRHRSPQAMVDPVSHPETMASQGIRGPPYKLFYGNTREILQFKNETS  578

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              +P+ ++SH IF R+QPH+ TW   YG  +L+W+G  P L +TEPELIKEVL NK+ A+P
Sbjct  579   SRPL-NLSHDIFPRVQPHISTWTGTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFP  637

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K ++D+F KKLLG+ L+T EGEKW K RKLAN+ FH +SLK M+P M+ SV +ML+RWK 
Sbjct  638   KPEMDEFVKKLLGDGLVTAEGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKN  697

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
             L G E++V+++F +LT+E+ISRTAFGSS++EG++IF+M+  LT I  +N + ++FPGIS 
Sbjct  698   LHGDEIEVYQEFTILTSEIISRTAFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISK  757

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKR-EKESNGVVENYGNDYLGQLMKITTGGSDISK  956
             L +++DE+E+EKLE GI+ A+LE++RKR EK   G +++ GND+LG L+K  +   D S+
Sbjct  758   LWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGELDDLGNDFLGLLVK-ASHSDDESR  816

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              I++  ++DE K  Y AG+ T+ ++L W +FLLA+H EWQ++AR+E+L +FG+++P  DG
Sbjct  817   RITITDLVDECKTFYIAGYDTSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPYPDG  876

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADI  1265
             IA+L+TM MI+NE +RLYPPV+ + RKV  + +LG L +PA++
Sbjct  877   IAKLKTMGMIINESLRLYPPVVGLIRKVATKTRLGKLVLPANM  919



>ref|XP_010044348.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86439.1| hypothetical protein EUGRSUZ_B03107 [Eucalyptus grandis]
Length=514

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/490 (51%), Positives = 360/490 (73%), Gaps = 3/490 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+ + WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKEAIKMQMKVRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             I P V+TW + YG  +L+WHG +  L ITEPELIKEVL ++E  YPK    DFAKKLLG+
Sbjct  79    IHPQVNTWIDTYGRNYLSWHGPQARLVITEPELIKEVLLDREKTYPKTGTKDFAKKLLGD  138

Query  462   ALIT-NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L++  + +KWA  RKLANH FH ESLK M P M+ SV  MLE+WK  EGKE++VF +F 
Sbjct  139   GLVSIVDDKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLEKWKNQEGKEIEVFGEFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EG++IF+M++ L ++T KN +N++ PGIS L +++DE+EAEKL
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTGLASLTSKNAFNIRLPGISKLWKTADEVEAEKL  258

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+ I+ +IL+++++REK+   G  + +G+D+LGQL+K      D SK  ++D ++DE K 
Sbjct  259   EKDIRNSILQMIKRREKKVMAGEEDGFGDDFLGQLVK-ALHDMDKSKKFTVDNLVDECKT  317

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  TT S++ W +FLLA++ EWQE+ARRE+L ++G+++P SDG+ +L+ ++MI+NE
Sbjct  318   FYLAGQETTNSMMAWMLFLLAINPEWQEEARREVLNVYGNKDPDSDGLGKLKKISMIMNE  377

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLY     +TRKV ++++LG L +PA+   F+P L LHHDP+IWG+DVH F P RF++
Sbjct  378   TLRLYSAGGGLTRKVGKKLRLGKLVLPANSQTFIPTLKLHHDPEIWGEDVHEFKPERFSE  437

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AKATNNNA  F PFG GPR+CVG++F   EAKI  SMILQRY F LSP Y+H P  + 
Sbjct  438   GIAKATNNNAVVFIPFGFGPRSCVGMSFAAAEAKITFSMILQRYTFELSPTYIHCPGHLL  497

Query  1536  ILTPKNGVQV  1565
              + P++G+Q+
Sbjct  498   TIRPQHGLQI  507



>ref|XP_004297212.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/507 (53%), Positives = 370/507 (73%), Gaps = 10/507 (2%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
              +L+  + ++  + WWTP R++K+M SQGI GPPY    GN K+ISNM    M + + D+
Sbjct  16    CFLVAVIFKIFHKIWWTPIRVQKLMASQGIKGPPYRLLAGNAKEISNMGKDVMSRSL-DL  74

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             SH+I   + PHVH W +IYG  +L WHGT P L +TE EL KE+  NK+G Y K     +
Sbjct  75    SHNILPVVLPHVHAWTKIYGKNYLQWHGTLPQLVVTEVELCKEIFTNKDGVYLKPKFRPY  134

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK-ELEGKEL  617
             A+K+ G  L   EGEKW K RKLANH FH ESLK M+P+MIAS E ML+RWK   EGKE+
Sbjct  135   AQKVFGNGLPALEGEKWVKSRKLANHAFHGESLKNMIPDMIASAETMLDRWKGHEEGKEM  194

Query  618   DVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSD  797
             +V+++F +LT+EVISRTAFGSS+ EGK+IF M++  + + +KN + +KF  IS L +++D
Sbjct  195   EVYEEFRLLTSEVISRTAFGSSYAEGKNIFVMLTKFS-LLLKNDFKLKF--ISKLFKTND  251

Query  798   EIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQ  974
             +IE+EKLE+GI+ +I+ +V+KRE+++ +   +++G+D+LG L+K     +DI   IS+D 
Sbjct  252   DIESEKLEKGIRDSIMGIVKKREEKAMSEEQKSFGSDFLGLLLKAHHDSNDIHW-ISVDD  310

Query  975   MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRT  1154
             ++DE K+ Y  G  T+ +LL W +FLLALHT+WQE+AR+E+L+LFG + P  DG+A+L+T
Sbjct  311   LVDECKSFYFVGQETSNTLLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNPDGLAKLKT  370

Query  1155  MNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVF  1334
             M+MI NE +RLY P +TVTR+V+++V+LGNL +PA+  + +P LALHH+P+ WGQDV  F
Sbjct  371   MSMIFNESLRLYSPAVTVTRRVKKDVRLGNLIVPANTELIIPYLALHHEPESWGQDVQHF  430

Query  1335  NPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYV  1514
              P RF++GVAKATNNN A F PFGMG R CVGLNF T EAKIALSMILQRY FTLSP YV
Sbjct  431   KPERFSEGVAKATNNNIALFLPFGMGSRVCVGLNFATMEAKIALSMILQRYSFTLSPAYV  490

Query  1515  HYPADIFILTPKNGVQVILQNV*LLSC  1595
             H P     L P++GVQV+L +   L+C
Sbjct  491   HSPFRSMTLRPQHGVQVMLYS---LNC  514



>ref|XP_002512040.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50709.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/491 (52%), Positives = 366/491 (75%), Gaps = 4/491 (1%)
 Frame = +3

Query  114   DRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHH-IFARIQP  290
             D+ WWTP R + ++RSQGI GP Y   HGNTK+I +M + +   P  ++SH  +   + P
Sbjct  26    DKVWWTPIRTQSMLRSQGIRGPCYKIFHGNTKEIISMVNNASSNPA-ELSHQQLLPTVLP  84

Query  291   HVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALI  470
             H+++W +IYGN FLTWHG + Y  +TEP+LIKE+L  K+G +PK + + + +K+ G+  I
Sbjct  85    HIYSWIKIYGNNFLTWHGRRAYFVVTEPDLIKEILNGKDGVFPKAEPEHYEQKIFGDGTI  144

Query  471   TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTT  650
             T++GEKW K+RKL+NH FHAESLK ++P MIASVE+MLERWK  +GKE++VF++F  LT+
Sbjct  145   TSKGEKWVKMRKLSNHAFHAESLKGLIPVMIASVEIMLERWKYHDGKEVEVFQEFEHLTS  204

Query  651   EVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGI  830
             EVISRTAFGSS+ EGKHIF M++ L  I  KN YN++ PGI  L ++ D+IE++KLE+ I
Sbjct  205   EVISRTAFGSSYWEGKHIFDMLTRLIIILSKNKYNIRIPGIRNLVKTGDDIESDKLEKNI  264

Query  831   KGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGA  1007
               + + ++++RE+E+  G  + +G+ +LG L+K     ++++K IS+D +IDE K  Y A
Sbjct  265   HDSFINMIKRREEEATMGQADGFGSGFLGLLLK-AHHDNNMAKKISVDDLIDECKTFYVA  323

Query  1008  GHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRL  1187
             G  TTTSL+ W +FL A+H +WQ KAR E++E+FG ++P  DG+ RL+ ++MI+NE +RL
Sbjct  324   GRETTTSLITWILFLPAIHPDWQHKAREEVIEIFGSQHPRLDGLTRLKIVSMIINETLRL  383

Query  1188  YPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVak  1367
             YPP +   R V+R+V+LG L +PA+I + +PILA+HH+PQIWG+DV++F P RFA+GVAK
Sbjct  384   YPPAVIFKRYVQRQVRLGKLILPANIVMEIPILAVHHNPQIWGEDVNLFKPERFAEGVAK  443

Query  1368  atnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTP  1547
             AT NNAAA+ PF +GPR CVG NF   E KIALS+ILQRY+F+LSPNYVH P  +  L P
Sbjct  444   ATKNNAAAYLPFSLGPRNCVGYNFAITETKIALSIILQRYRFSLSPNYVHSPIPLIGLCP  503

Query  1548  KNGVQVILQNV  1580
             ++G+Q++L  +
Sbjct  504   QHGLQIMLHKL  514



>ref|XP_011101779.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score =   536 bits (1381),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 252/512 (49%), Positives = 364/512 (71%), Gaps = 7/512 (1%)
 Frame = +3

Query  42    SIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN  221
             S+ + F L+ +++++      RLV + W  P  +++ ++SQG+ GP Y   HGNTK+I +
Sbjct  4     SLFSLFCLSLTLAVF-----SRLVYKLWLGPIHMQQKLQSQGLKGPSYKLLHGNTKEIIS  58

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             MR +++  P     H +F RI PH++TW ++YG  FL W G +P + +TEPEL++E+L +
Sbjct  59    MRKEAIKAPCDLGQHDMFPRILPHLNTWMKLYGKNFLIWIGNQPQIVVTEPELVREILTD  118

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             KEG Y K+    +AKKLLG+ L+  EGEKW+K+RKLANH FH ESLK MV  M+ SV+ M
Sbjct  119   KEGVYRKIKPISYAKKLLGDGLVVAEGEKWSKLRKLANHAFHGESLKDMVSAMVESVDTM  178

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERW+  EGKE++V K+F +LT++VISRTAFGSS++EGK+IF M+  L  +  KN + ++
Sbjct  179   LERWRYHEGKEIEVSKEFKLLTSDVISRTAFGSSYVEGKNIFDMMMKLGVLIAKNTFKIR  238

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTG  938
               G+  + RS D+IE++K+E+ +  +IL LV+KRE K   G  +N+GND+LG L+K+   
Sbjct  239   LFGLKKIWRSKDDIESDKIEQSLHDSILSLVKKREDKVKAGESDNFGNDFLGSLLKVHH-  297

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               D    IS+D ++DE K  Y AGH TT++LL W +FLL++ TEWQEKAR E++++FG E
Sbjct  298   DIDPKSRISVDDIVDECKVFYIAGHETTSTLLSWTVFLLSIFTEWQEKARDEVVQVFGQE  357

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              PT++GIARL+ + MI+ E +RLY PV+++TR+V R +KLG   IPA++ + +P LALH 
Sbjct  358   KPTAEGIARLKILTMIVYEALRLYSPVLSITRRVHRNIKLGKYEIPANVQVNVPTLALHR  417

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             +P+IWG+D H+F P RFA+G+A A N N+ AF PF  GPR+CVG NF  NEAK+ LSMIL
Sbjct  418   NPEIWGKDAHMFKPERFAEGLANAANRNSMAFLPFAAGPRSCVGNNFAVNEAKMTLSMIL  477

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY+  LSPNY+H P     + P++GVQ+IL 
Sbjct  478   QRYRLALSPNYIHAPYQFLTVQPQHGVQIILH  509



>ref|XP_008446466.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=515

 Score =   536 bits (1381),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 246/508 (48%), Positives = 351/508 (69%), Gaps = 3/508 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             +++  +S  LL+ + +L  + WWTP R+++ MRSQGI GP Y F  GNT+ +   R Q+M
Sbjct  8     YISIFLSGCLLFVVFKLFVKLWWTPMRIQRFMRSQGIQGPSYKFIQGNTRDVYMKRMQAM  67

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
               PM D+SH+I  R+ P VH+W  +YG  +L W G    L IT+PE+IKEVL +++ ++P
Sbjct  68    ATPM-DLSHNILPRVMPSVHSWLNLYGRNYLQWAGVDAQLMITDPEMIKEVLHDRQKSFP  126

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K  L     ++ G  L T EG++W   R++AN  FH +SLK M+P MI   E M+E WK 
Sbjct  127   KAKLKGHIDRIFGNGLATAEGQRWVNSRRIANFAFHGDSLKNMIPTMIECGEKMIEGWKN  186

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EGKELD FK+F V T +VIS TAFGSS+ +GK IF M+  L  ++++N Y +K P IS 
Sbjct  187   YEGKELDAFKEFKVFTLDVISHTAFGSSYQQGKKIFHMLQELCDLSIRNGYKIKLPIISK  246

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISK  956
             + +S D+ E E+LE+ +K   +E++++RE++  N    +YGND+LG L+K      + S+
Sbjct  247   ILKSKDDYEGERLEKRLKDCFMEIIKEREEKLRNDEASDYGNDFLGLLIK-AKNDPETSQ  305

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
             +IS++ ++DE K  Y AGH TT  LL W + LLALH EWQEKAR E+ ++FGH +PT +G
Sbjct  306   SISMEDIVDECKTFYFAGHETTNVLLAWTMLLLALHKEWQEKARNEVFDVFGHNHPTLEG  365

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             + +L+ M MI+NEC+RLYPP +T+ R+VE+EV+LGNL +P    + +P +A+HHD + WG
Sbjct  366   LPKLKAMAMIINECLRLYPPAMTIARRVEKEVRLGNLVVPTTTLLAIPTVAVHHDTKFWG  425

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
              D H F P RF++G+ KAT  N+AA+ PFG+GPR CVG+NF TNEAKIA+SMILQRY F+
Sbjct  426   DDAHEFKPERFSEGIGKATEKNSAAYLPFGLGPRNCVGMNFATNEAKIAMSMILQRYSFS  485

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSP Y H PA +  + P+NGVQVIL ++
Sbjct  486   LSPAYAHMPAQLLTICPQNGVQVILNSI  513



>emb|CDP00469.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   533 bits (1372),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 264/445 (59%), Positives = 336/445 (76%), Gaps = 4/445 (1%)
 Frame = +3

Query  249   MFDISHHIFARIQPHVHTWKEIYGN-TFLTWHGTKPYLFITEPELIKEVLANKEGAYPKM  425
             M D+SH IF RI P +++W  IYG  T+L W+G +P L +TEPEL+KE+L NK G YPK+
Sbjct  1     MEDMSHDIFPRILPDIYSWVNIYGRATYLNWYGPQPQLVVTEPELVKEILNNKNGDYPKI  60

Query  426   DLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELE  605
             DL+ +AKKLLG+ L  ++GEKWA++RKLAN  FHA SLK M+P MI S E+MLERWKE E
Sbjct  61    DLEGYAKKLLGDGLSASKGEKWARMRKLANQVFHAGSLKDMLPAMITSTEIMLERWKENE  120

Query  606   GKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLT  785
             GKE++VF++F +LT+EVIS+TAFGSS+LEGK+IF+M+  LT I  +N  N++FPGIS L 
Sbjct  121   GKEVEVFEEFRLLTSEVISKTAFGSSYLEGKNIFEMLMKLTLIVSRNARNIRFPGISHLF  180

Query  786   RSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNIS  965
             +SSDEIE+EKLE+G+K  I  +++KRE E+    E+   D+L +L++   G S   K IS
Sbjct  181   KSSDEIESEKLEQGMKNCIEHIIKKRELENCKENESSKGDFLEKLLEANEGSS---KWIS  237

Query  966   LDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIAR  1145
             +D M+DE K LY AG  TTTSLL W I LLA+H EWQE AR E++E+FG   P +D I R
Sbjct  238   VDDMVDECKTLYFAGQETTTSLLTWSILLLAVHKEWQETAREEVIEIFGQMKPNADAIPR  297

Query  1146  LRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDV  1325
             L+TMNMIL EC+RLYPPV  + RKV ++VKLG LT+PA   + +  LALHHDP+IWG+DV
Sbjct  298   LKTMNMILEECLRLYPPVPALMRKVHKKVKLGRLTLPAHTELLISPLALHHDPKIWGEDV  357

Query  1326  HVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSP  1505
             H F P RFA GV+KATNNN  AF PFG GPRTCVGLNF   EAKIALSMILQ YKF+LS 
Sbjct  358   HHFKPERFAGGVSKATNNNPVAFLPFGFGPRTCVGLNFAMVEAKIALSMILQHYKFSLSR  417

Query  1506  NYVHYPADIFILTPKNGVQVILQNV  1580
             NYVH P  +F++ P +GV++IL  V
Sbjct  418   NYVHSPVQVFMVRPHHGVKIILSRV  442



>ref|XP_011102246.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=506

 Score =   535 bits (1378),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 262/513 (51%), Positives = 376/513 (73%), Gaps = 8/513 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             +I +FFL+    I     L+R++ +  W P R++ ++RSQGI GPPY   HG+TK+   +
Sbjct  1     MIFSFFLSLITLI-----LIRVIHKVLWLPFRIQHMLRSQGITGPPYKIIHGSTKESLRL  55

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             + Q+   PM ++SH IF R+QP  ++W ++YG  FLTW G +P+L ITEPEL+KE+L NK
Sbjct  56    KQQARDGPM-ELSHDIFPRVQPSFYSWMKLYGKNFLTWTGPQPHLVITEPELVKEILTNK  114

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             EG + K+ +   AKKL+G+ L+  EG KW+K+RKLANH F+AESLK M+P MIASVE ML
Sbjct  115   EGIFQKIKVQGPAKKLVGDGLVMTEGAKWSKLRKLANHAFYAESLKGMIPAMIASVENML  174

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             E W+  EGKE++V K+F V ++EVISRTAFGSS+LEGK+IF M+  L  +  KN   V+ 
Sbjct  175   ENWRMYEGKEIEVSKEFMVFSSEVISRTAFGSSYLEGKNIFDMLMKLGFLIFKNADKVRP  234

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGG  941
              GI  + ++ D+IE++K+E+ ++ +++ ++RKRE++   G  +N+G+D+LG L+++    
Sbjct  235   FGIEKIWKTQDDIESDKIEQSLRDSLMVILRKREEKVLTGQADNFGSDFLGSLLRVHHD-  293

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN  1121
             +D    ISLD +IDE K  + AGH TT+SLL W   LLA+HT+WQ+KAR+E+LELFG EN
Sbjct  294   ADKKNRISLDDVIDECKVFFLAGHETTSSLLSWTFLLLAIHTDWQDKARKEVLELFGQEN  353

Query  1122  PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHD  1301
             PT++G+ RL+T +MI+NE +RLY PV ++ R+V R+V++G   +PA++ + +  LALH +
Sbjct  354   PTAEGLPRLKTASMIINEALRLYGPVASLVRRVARKVRVGKYVLPANMELQISPLALHRN  413

Query  1302  PQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQ  1481
             P+IWG+D H+F P RFA+G+A AT NN  AF PFG GPRTCVGLNF  NE KIALSMILQ
Sbjct  414   PEIWGEDAHLFKPERFAEGIATATRNNPMAFLPFGYGPRTCVGLNFANNEVKIALSMILQ  473

Query  1482  RYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             RYKFTLSP+Y+H P  +  + P++GVQ++LQ +
Sbjct  474   RYKFTLSPSYIHSPLSLVTIRPQHGVQIMLQKL  506



>ref|XP_010040838.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=584

 Score =   538 bits (1385),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 254/521 (49%), Positives = 381/521 (73%), Gaps = 8/521 (2%)
 Frame = +3

Query  69    FSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMR---SQSM  239
             F +SI L   L +++ + WW P R+++ M SQG+ GPPY F HG+T++I  +R   ++ M
Sbjct  10    FLLSIILFSALEKVLQKFWWNPIRVQRAMASQGVRGPPYGFAHGSTREIFKLREEVARQM  69

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              K   D+SH I   ++PH++ W +++G  FL W+G    L I++ EL+KEVL N++  Y 
Sbjct  70    NKHTVDVSHDILPIVEPHIYKWSQMFGGIFLYWYGPAALLLISDTELVKEVLNNRDKTYV  129

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K D     KKLLG+ L + +GEKWA+ R+LA+  FH ESLK M+P M+ SV ++L+RW+ 
Sbjct  130   KPDFPGDIKKLLGDGLFSTKGEKWARQRRLAHLAFHGESLKCMIPAMVDSVHMLLKRWQN  189

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
             LE + +++F++F  +T++VISRTAFGSS++EG+++F+M+  LT I  +N++ ++ PG+  
Sbjct  190   LEARVVELFEEFTAITSDVISRTAFGSSYIEGRNMFQMLGELTTIASRNIFKLRLPGVRN  249

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISK  956
             + ++ DEI++E+LE+ I+  +LE++RKRE++ N G + +YGND LG L+K      D SK
Sbjct  250   IWKTIDEIDSERLEKAIRDVVLEIIRKREEKVNTGEMNDYGNDLLGSLLK-AYHDPDESK  308

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
               ++D ++DE K  Y AG  TT S+L W +FLLA+H +WQ++AR+E+ ++FG+E+P  DG
Sbjct  309   RTTIDDVMDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEARKEVTDVFGNEDPNHDG  368

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I +L+T+ MI+NE +RLYPPVI++ RKV+++V LGNL +PADI + +P LA+HHD +IWG
Sbjct  369   IMKLKTVGMIINESLRLYPPVISLLRKVKKQVTLGNLVLPADIVLDIPTLAIHHDRRIWG  428

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
              DVH+F P RF++G+AKATNNNAAAF PFG+GPRTCVG+NF TNEAKIA++MILQRY FT
Sbjct  429   NDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRTCVGINFATNEAKIAIAMILQRYSFT  488

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQNV*LLSCPYGLSLLV  1619
             LSP Y+H PA I  + P++GV+VIL     L C + +S ++
Sbjct  489   LSPGYIHLPAHILTIHPQHGVKVILHP---LQCEHVVSSII  526



>ref|XP_011102247.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score =   534 bits (1376),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 252/512 (49%), Positives = 363/512 (71%), Gaps = 7/512 (1%)
 Frame = +3

Query  42    SIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN  221
             S+ + F L+ +++++      RLV + W  P  +++ ++SQG+ GP Y   HGNTK+I +
Sbjct  4     SLFSLFCLSLTLAVF-----SRLVYKLWLGPIHMQQKLQSQGLKGPSYKLLHGNTKEIIS  58

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             MR +++  P     H +F RI PH++TW ++YG  FL W G +P + +TEPEL++E+L +
Sbjct  59    MRKEAIKAPCDLGQHDMFPRILPHLNTWMKLYGKNFLIWIGNQPQIVVTEPELVREILTD  118

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             KEG Y K+     AKKLLG+ L+  EGEKW+K+RKLANH FH ESLK MV  M+ SV+ M
Sbjct  119   KEGVYRKIKPISHAKKLLGDGLVVAEGEKWSKLRKLANHAFHGESLKDMVSAMVESVDTM  178

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERW+  EGKE++V K+F +LT++VISRTAFGSS++EGK+IF M+  L  +  KN + ++
Sbjct  179   LERWRYHEGKEIEVSKEFKLLTSDVISRTAFGSSYVEGKNIFDMMMKLGVLIAKNTFKIR  238

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTG  938
               G+  + RS D+IE++K+E+ +  +IL LV+KRE K   G  +N+GND+LG L+K+   
Sbjct  239   LFGLKKIWRSKDDIESDKIEQSLHDSILSLVKKREDKVKAGESDNFGNDFLGSLLKVHH-  297

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               D    IS+D ++DE K  Y AGH TT++LL W +FLL++ TEWQEKAR E++++FG E
Sbjct  298   DIDPKSRISVDDIVDECKVFYIAGHETTSTLLSWTVFLLSIFTEWQEKARDEVVQVFGQE  357

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              PT++GIARL+ + MI+ E +RLY PV+++TR+V R +KLG   IPA++ + +P LALH 
Sbjct  358   KPTAEGIARLKILTMIVYEALRLYSPVLSITRRVHRNIKLGKYEIPANVQVNVPTLALHR  417

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             +P+IWG+D H+F P RFA+G+A A N N+ AF PF  GPR+CVG NF  NEAK+ LSMIL
Sbjct  418   NPEIWGKDAHMFKPERFAEGLANAANRNSMAFLPFAAGPRSCVGNNFAVNEAKMTLSMIL  477

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY+  LSPNY+H P     + P++GVQ+IL 
Sbjct  478   QRYRLALSPNYIHAPYQFLTVQPQHGVQIILH  509



>ref|XP_002325324.2| hypothetical protein POPTR_0019s03160g [Populus trichocarpa]
 gb|EEE99705.2| hypothetical protein POPTR_0019s03160g [Populus trichocarpa]
Length=519

 Score =   534 bits (1376),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 250/491 (51%), Positives = 354/491 (72%), Gaps = 3/491 (1%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             +  ++ WWTP R++ +M+SQGI GP Y F HGNTK+IS M  ++   P  ++ HH    +
Sbjct  22    KFFNKVWWTPIRIQSLMKSQGIRGPSYRFLHGNTKEISTMIRKTRSSPQ-ELLHHTLPMV  80

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
              PH ++W ++YG  FL W+G +  L ITEPEL+K++L+NK+ AYPK  +    KKLLG+ 
Sbjct  81    HPHFYSWIKLYGMNFLQWYGPQAQLIITEPELVKQILSNKDRAYPKTKVSSEIKKLLGDG  140

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVL  644
             ++ +EGEKW K+RKLANH FH ES+K MVPEMIAS+E+MLERW+    KE+D+F +F +L
Sbjct  141   IVLSEGEKWVKLRKLANHAFHGESIKGMVPEMIASLEIMLERWRHHHSKEIDIFVEFKIL  200

Query  645   TTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLER  824
             T+EVISRT+FGSS+LEG+H+F M++ +T I  +N Y V+ PGI    ++S +IE E LE 
Sbjct  201   TSEVISRTSFGSSYLEGQHVFDMLTRMTHIISENNYRVRIPGIGKFVKASYDIEFENLEA  260

Query  825   GIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALY  1001
              I+ + + ++++REK++  G ++ YG+D  G L+K     SD +K ISLD +ID+ K  Y
Sbjct  261   KIRKSFMNMMKRREKDATLGELDGYGHDLFGLLLK-AYHDSDETKKISLDDLIDQCKNFY  319

Query  1002  GAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECM  1181
              AG  T+ S L W +FLLA+H++WQ+KAR+E+LELFG + P+ D IA+L+ M +++NE +
Sbjct  320   LAGQETSASALTWIVFLLAVHSDWQDKARKEVLELFGLQIPSQDRIAKLKIMGIVINESL  379

Query  1182  RLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGV  1361
             RLY P   + R+VERE KLG +T+PA+  +++  LA+H +P+IWG+D  +F P RFA GV
Sbjct  380   RLYTPNAILMRRVERETKLGKITVPANTEVYISTLAVHQNPKIWGEDALLFKPERFADGV  439

Query  1362  akatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFIL  1541
              KATNNN AAF PFG+GPR C G+NF   E K+ALSMILQRY FTLSP Y H P ++  +
Sbjct  440   VKATNNNIAAFMPFGLGPRNCAGMNFAITETKLALSMILQRYSFTLSPTYAHCPTEVLTM  499

Query  1542  TPKNGVQVILQ  1574
              P++GVQVILQ
Sbjct  500   CPQHGVQVILQ  510



>ref|XP_008229697.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Prunus mume]
Length=491

 Score =   533 bits (1372),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 262/481 (54%), Positives = 353/481 (73%), Gaps = 5/481 (1%)
 Frame = +3

Query  66    TFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGK  245
             TF     +L    + V + WWTP +++K+M  QGI GP Y   HGN K+ISNM+ ++M +
Sbjct  13    TFVCLFIVLAAFFKTVHKLWWTPTQIQKLMALQGIKGPSYRLIHGNNKEISNMQKEAMAR  72

Query  246   PMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKM  425
             P  ++SH +FA +QPH+H+W +IYG TFL W G +P L IT+PEL KE+L NK  AYPK 
Sbjct  73    PR-NLSHDVFALVQPHLHSWTKIYGKTFLQWDGPQPVLVITDPELCKEILNNKHRAYPKS  131

Query  426   DLDDFAKKLLGEALIT-NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKEL  602
             +   F  KL    L+T  EGEKWAK+RKLANH FH ESLK  +  MIASVE MLERW+  
Sbjct  132   NPVAFVMKLSRNGLVTRKEGEKWAKLRKLANHAFHGESLKSQIHAMIASVETMLERWENH  191

Query  603   EGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISML  782
             EGKE++VF +F ++T+EVISRTAFGSS+LEGK+IF+M+  ++++T K     KFPG+S  
Sbjct  192   EGKEIEVFGEFRLVTSEVISRTAFGSSYLEGKNIFEMLLKISSLTFKTALKPKFPGLSRF  251

Query  783   TRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKN  959
              +++DEIE EKLE+ I+  I+E+V+KRE++   G  E+ G+D+LG L+K     +D ++ 
Sbjct  252   VKTNDEIEMEKLEKRIRETIIEIVKKRERKVMPGEEESLGSDFLGLLLKAYHDTND-NQR  310

Query  960   ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGI  1139
             ISLD ++DE K  Y AGH TT + L W +FLLALHT+WQE+AR+E+L++FG + P   GI
Sbjct  311   ISLDDLVDECKTFYLAGHETTATFLAWTVFLLALHTDWQEEARKEVLQVFGKQTPNPKGI  370

Query  1140  ARLRTMNMILNECMRLYPPVITVT-RKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
              +L+TM+MI+ E +RLYPPV++V  R+VEREVKLG L +PA++ + +PI+A H+D ++WG
Sbjct  371   EKLKTMSMIMYESLRLYPPVVSVIRRRVEREVKLGRLILPANLELAIPIVAFHYDSELWG  430

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             QDV +F P RFA+GV KAT+ N AAF PFGMGPR CVGLNF   EAKIALSMILQR+ FT
Sbjct  431   QDVQLFKPERFAEGVVKATDENIAAFLPFGMGPRICVGLNFAITEAKIALSMILQRHAFT  490

Query  1497  L  1499
             L
Sbjct  491   L  491



>ref|XP_006388777.1| hypothetical protein POPTR_0102s00210g [Populus trichocarpa]
 gb|ERP47691.1| hypothetical protein POPTR_0102s00210g [Populus trichocarpa]
Length=517

 Score =   532 bits (1371),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 249/491 (51%), Positives = 354/491 (72%), Gaps = 3/491 (1%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             +  ++ WWTP R++ +M+SQGI GP Y F HGNTK+IS M  +    P  ++ HH    +
Sbjct  22    KFFNKVWWTPIRIQSLMKSQGIRGPSYRFLHGNTKEISTMIRKIRSSPQ-ELLHHTLPMV  80

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
              PH ++W ++YG  FL W+G +  L ITEPEL+K++L+NK+ AYPK  +    KKLLG+ 
Sbjct  81    HPHFYSWIKLYGMNFLQWYGPQAQLIITEPELVKQILSNKDRAYPKTKVSSEIKKLLGDG  140

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVL  644
             ++ +EGEKW K+RKLANH FH ES+K MVPEMIAS+E+MLERW+    KE+D+F +F +L
Sbjct  141   IVLSEGEKWVKLRKLANHAFHGESIKGMVPEMIASLEIMLERWRHHHSKEIDIFVEFKIL  200

Query  645   TTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLER  824
             T+EVISRT+FGSS+LEG+H+F M++ +T I  +N Y V+ PGI    ++S +IE E LE 
Sbjct  201   TSEVISRTSFGSSYLEGQHVFDMLTRMTHIISENNYRVRIPGIGKFVKASYDIEFENLEA  260

Query  825   GIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALY  1001
              I+ + + ++++REK++ +G ++ YG+D  G L+K     SD ++ ISLD +ID+ K  Y
Sbjct  261   KIRKSFMNMMKRREKDAMSGELDGYGHDLFGLLLK-AYHDSDETRKISLDDLIDQCKNFY  319

Query  1002  GAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECM  1181
              AG  T+ S L W +FLLA+H++WQ+KAR+E+LELFG + P+ D IA+L+ M M++NE +
Sbjct  320   LAGQETSASALTWIVFLLAVHSDWQDKARKEVLELFGLQIPSQDRIAKLKIMGMVINESL  379

Query  1182  RLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGV  1361
             RLY P   + R+VERE KLG +T+PA+  +++  LA+H +P+IWG+D  +F P RFA GV
Sbjct  380   RLYTPNAILMRRVERETKLGKITVPANTEVYISTLAVHQNPEIWGEDALLFKPERFADGV  439

Query  1362  akatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFIL  1541
              KATNNN AAF PFG+GPR C G+NF   E K+ALSMILQR+ FTLSP Y H P ++  +
Sbjct  440   VKATNNNTAAFMPFGLGPRNCAGMNFAITETKLALSMILQRHSFTLSPTYAHCPTEVLTM  499

Query  1542  TPKNGVQVILQ  1574
              P++GVQVILQ
Sbjct  500   CPQHGVQVILQ  510



>gb|EYU22577.1| hypothetical protein MIMGU_mgv1a004830mg [Erythranthe guttata]
Length=508

 Score =   531 bits (1369),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 252/487 (52%), Positives = 351/487 (72%), Gaps = 3/487 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WW P + +  M+SQGI GP Y F HG+TK+I  +++Q+   PM ++SH IF RIQPH+
Sbjct  22    KLWWAPLQFQHQMKSQGIKGPSYKFIHGSTKEIITIKNQTSNTPM-ELSHDIFPRIQPHL  80

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
             ++W ++YGN  L W G +P++ +TE +LIKE+ +NKEG Y K  +  + KKLLG+ ++  
Sbjct  81    YSWTKLYGNNLLYWIGAQPHILVTEADLIKEIFSNKEGTYTKTRITGYLKKLLGDGIVFT  140

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
             EGEKW K+RKLANH FH E LK M+P M+ASVE MLE++K  EGKE++V  +F +LT+EV
Sbjct  141   EGEKWIKLRKLANHAFHGECLKDMLPSMVASVEAMLEKFKCHEGKEIEVCSEFRLLTSEV  200

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS++EG+ IF M++ L  +T +N + ++F  +    R+ DEIEA+K+E+ +  
Sbjct  201   ISRTAFGSSYVEGRKIFDMLTKLGVLTSRNSHKIRFAVLQKFARTKDEIEADKIEKSLHD  260

Query  837   AILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
             +I+E+V +R+ E   G   ++G+D+LG L+K      D    IS  ++IDE K  Y AG 
Sbjct  261   SIMEMVNRRQDEVKTGKSNDFGSDFLGSLLK-AHHSIDKKNRISALEIIDECKTFYFAGQ  319

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYP  1193
              TT SLL W + LLA++T+WQE+AR E+LELFG ENP S+GI+RL+TM+MI+ E +RLY 
Sbjct  320   ETTYSLLSWAVLLLAINTDWQERARTEVLELFGRENPVSEGISRLKTMSMIIYETLRLYS  379

Query  1194  PVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakat  1373
             PV  +TR+ + +V LG    PA++ + +P L+LH +P IWGQD  +FNP RFA+G+AKAT
Sbjct  380   PVTAITRRTDSKVGLGKYEFPANVNLVIPPLSLHRNPDIWGQDCQLFNPDRFAEGLAKAT  439

Query  1374  nnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKN  1553
               NA AF  FG GPR CVGLNF +NEAKIALSMILQRYKFTLSPNYVH P  +    P++
Sbjct  440   GGNATAFLGFGYGPRICVGLNFASNEAKIALSMILQRYKFTLSPNYVHSPYIVLTTQPQH  499

Query  1554  GVQVILQ  1574
             GV+++LQ
Sbjct  500   GVKILLQ  506



>ref|XP_010091618.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44884.1| Cytochrome P450 734A1 [Morus notabilis]
Length=554

 Score =   532 bits (1371),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 257/479 (54%), Positives = 356/479 (74%), Gaps = 7/479 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             L+++ ++ WW+P RL+ +MR +GI GP Y F HG+TK+I  M+ ++M +PM  +SH IF 
Sbjct  16    LIKISNKLWWSPTRLQHLMRLRGIKGPSYRFIHGSTKEILTMQKEAMARPMPCLSHDIFP  75

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
             ++QPH+H W  +YG  FL W G +  L ITE ELIKEVL +++G Y K     F KKLLG
Sbjct  76    KLQPHIHYWTNLYGKNFLQWDGPQAQLVITEAELIKEVLNDRDGVYSKGKGKAFFKKLLG  135

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
             + L+ ++GEKWAKVRKLANH FHAESLKRM+P MI  VE MLERWK LEGKE++V+++F 
Sbjct  136   DGLVISQGEKWAKVRKLANHAFHAESLKRMIPAMIEGVESMLERWKHLEGKEIEVYEEFR  195

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
              L +EVISRTAFGSS+LEGK+IF+M+  L  +  +N Y   FP IS + ++ D+IE+E+L
Sbjct  196   FLMSEVISRTAFGSSYLEGKNIFEMLMKLALLASRNFYEQTFPVISTVFKTEDQIESERL  255

Query  819   ERGIKGAILELVRKREKES--NGVVENYGNDYLGQLMKITTGGSDISKN--ISLDQMIDE  986
             E+ ++ +I+ L++KRE++   +G  +N+G+D+LG L+K      D+++N   S+D ++DE
Sbjct  256   EKRLRESIVGLIKKREEKVVISGEEDNFGSDFLGLLVK---ARHDVNENQRFSVDDVVDE  312

Query  987   IKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMI  1166
              K  Y  G  TT SLL W + LLA+HTEWQE+AR+E+  L G +NP  D + +L+T+++I
Sbjct  313   CKTFYFTGQETTNSLLAWTVLLLAIHTEWQEEARKEVNNLLGKQNPKPDDLIQLKTVSLI  372

Query  1167  LNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHR  1346
             +NE +RLYPPV++++RKVEREV+LG L +PA++++F+  LA+HHDPQIWG+DVH+F P R
Sbjct  373   INESLRLYPPVVSMSRKVEREVRLGELNLPANMSLFISNLAVHHDPQIWGEDVHLFKPER  432

Query  1347  FAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYP  1523
             F+ GV KAT NN AAF PFG GPR CVG NF   +AKIAL+MILQRY  TLSP YVH P
Sbjct  433   FSPGVFKATKNNIAAFVPFGFGPRNCVGSNFAIMQAKIALAMILQRYTVTLSPAYVHSP  491



>gb|AJD25260.1| cytochrome P450 CYP749A38 [Salvia miltiorrhiza]
Length=508

 Score =   530 bits (1366),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 254/493 (52%), Positives = 357/493 (72%), Gaps = 5/493 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             L+R + +A W P  ++++M++QGI GP Y   HG TK+ + +R +++  PM ++SH IF 
Sbjct  16    LIRFIYKAIWIPFHVQRMMKAQGITGPSYRIVHGTTKESTILREEALKGPM-ELSHDIFP  74

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
             +IQP  + W ++YG  FLTW G +P++ ITEPE+ KE+L NKEG + K       KKLLG
Sbjct  75    KIQPQFYQWMKLYGKNFLTWAGPQPHVVITEPEIAKEILTNKEGIFLKPKSRGNVKKLLG  134

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
             + L+  EG KW K+RKLANH F+AESLK M+P MIASVE ML++W++ +G+E+DV ++  
Sbjct  135   DGLVMAEGAKWFKLRKLANHAFYAESLKEMIPSMIASVETMLQKWRQYQGREMDVCEELK  194

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             V+++EVI+RTAFGSS+LEGK+IF M++ L  +  KN+  ++  G  M+ ++ D++E++++
Sbjct  195   VMSSEVIARTAFGSSYLEGKNIFDMLTKLGFLLFKNIDKIRPFG--MIWKTRDDVESDEI  252

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+ ++   + +VRKRE+    G  E+YG D+LG L+K     SD    IS+D +IDE K 
Sbjct  253   EQSLRDTAMSIVRKREERVVAGEAEDYGTDFLGALLK-AHHDSDKKSRISIDDVIDECKV  311

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              + AGH TT+SLL W IFLLA+HT+WQEKAR+E+LELFG +NPT++G+ RL+T +MI+NE
Sbjct  312   FFLAGHETTSSLLSWTIFLLAIHTDWQEKARQEVLELFGDQNPTAEGLPRLKTASMIMNE  371

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLY PV ++ R+  R V++G    PA +   +P LALH + +IWG+DVH+F P RFA+
Sbjct  372   TLRLYSPVASLVRRGTRRVRIGRYEFPAKMEFHIPTLALHRNQEIWGKDVHLFKPERFAE  431

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             GVA AT NN  AF PFG GPRTCVGLNF TNEAKIALSMILQRY FTLS NY H+P +I 
Sbjct  432   GVATATRNNPMAFLPFGYGPRTCVGLNFATNEAKIALSMILQRYSFTLSKNYAHFPINII  491

Query  1536  ILTPKNGVQVILQ  1574
                P+ GVQ+ILQ
Sbjct  492   TTRPQCGVQIILQ  504



>ref|XP_004295657.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=477

 Score =   529 bits (1362),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 266/481 (55%), Positives = 348/481 (72%), Gaps = 9/481 (2%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             M  QGI GP Y   +GN K+I NM+ ++M KP   +SH IF  +QP  H+W +IYG  FL
Sbjct  1     MCLQGIRGPSYRLVNGNAKEILNMKKEAMSKPK-GLSHDIFPVVQPQYHSWLKIYGKIFL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
              W GT+  L + EPEL KE+L NK+  Y +   +   KKL+G +L T+EGE+W K RKLA
Sbjct  60    QWLGTEAQLVVMEPELCKEILINKDRVYMQKKQEGLGKKLIGNSLGTSEGEQWLKHRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             NH  H +SLK M+PEMIA+ E ML+RWK  EGKE++++++F + T EVISRTAFGSS+LE
Sbjct  120   NHALHGQSLKNMIPEMIATAEKMLQRWKNSEGKEIELYQEFRLFTAEVISRTAFGSSYLE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKE  872
             GK+IF M++ +  +  KN Y ++ PGI    ++SDEIEAEKLE+ ++  ILE+V+KRE  
Sbjct  180   GKNIFDMLTKICLLVFKNSYKIRLPGIRKFFKTSDEIEAEKLEKDLRYTILEIVKKRE--  237

Query  873   SNGVV-----ENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLG  1037
              N VV      N+G+D LG L+K     S+    +++D +ID+ KALY AG  TT  LL 
Sbjct  238   -NKVVVKQDENNFGDDLLGLLLKAHHEDSNDRYRVTIDDIIDQCKALYFAGQETTNGLLA  296

Query  1038  WCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRK  1217
             W + LLALH +WQE+AR+E+L+LFG +NP+SDGI+RL+TMNMI+NE +RLYPPVI + +K
Sbjct  297   WTVLLLALHQDWQEEARKEVLQLFGKQNPSSDGISRLKTMNMIINESLRLYPPVIELVKK  356

Query  1218  VEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFF  1397
              EREV+LG L +PA+I + +PI+AL+HD QIWGQD  +F P RF++GVAKAT +N AAF 
Sbjct  357   AEREVRLGKLIVPANIDLVIPIVALYHDTQIWGQDAGLFKPDRFSEGVAKATKDNMAAFI  416

Query  1398  PFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQN  1577
             PFGMGPRTCVGLNF T E KIALSMILQRY FTLSP YVH P     L P+NGVQV L +
Sbjct  417   PFGMGPRTCVGLNFATTETKIALSMILQRYAFTLSPGYVHLPLHFITLRPQNGVQVTLHS  476

Query  1578  V  1580
             +
Sbjct  477   L  477



>ref|XP_007045776.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01608.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   530 bits (1365),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 255/504 (51%), Positives = 362/504 (72%), Gaps = 3/504 (1%)
 Frame = +3

Query  72    SVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM  251
             S  +Y L  L+++  +  W P R++ ++RSQGI GPPY F HGN K +  +  ++  KPM
Sbjct  14    SFCLYFLRALLKVFYKYLWIPHRIQNILRSQGIKGPPYEFIHGNNKAVVEIGREASSKPM  73

Query  252   FDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL  431
               ++H IF R+ PH ++W   YG   L+W+G +  L ITEP+LIKEVL N E A+ K  +
Sbjct  74    -ALTHDIFPRVLPHTYSWINAYGKIHLSWNGVQALLVITEPDLIKEVLKNSEKAFLKGKV  132

Query  432   DDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
               F  K+LG+ L T E EKWA+ RKLAN+ FH ESLK M P +IASVE ML++WK  EGK
Sbjct  133   TYFVSKILGDGLATTEREKWARHRKLANYAFHGESLKNMTPAVIASVETMLQKWKGREGK  192

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++VF++F +LT+EVISRTAFGSS+LEG+ IF+ +  L+ I ++N+Y  + PGIS + + 
Sbjct  193   EIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFETLMKLSVIAIRNLYKARIPGISYVWKH  252

Query  792   SDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISL  968
             +DEIE+EKL + I  ++L++V+KRE K   G  E++G+D+LG L+       D    +S+
Sbjct  253   ADEIESEKLAKEIHDSVLKIVKKREEKVVAGEAESFGSDFLGLLLN-AHHDLDEKNRLSV  311

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             + ++DE K  Y  G  TT SLL W + LLA+HT+WQEKARRE++E FG+++P  +GIA+L
Sbjct  312   EDLVDECKTFYFTGQETTNSLLAWTVLLLAIHTDWQEKARREMIEEFGNQDPHPEGIAKL  371

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM MI+NE +RLYPP+  + R+V REV+LG L +PAD+ + +PI+ALHHDPQ+WG DV+
Sbjct  372   KTMTMIINETLRLYPPLNRIVRRVGREVQLGKLILPADLHLVVPIMALHHDPQLWGDDVN  431

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RFA+G+A AT +NAAA+ PFG+GPR+CVG++F   E KIALSMILQRY  +LSP 
Sbjct  432   LFKPERFAEGIANATKHNAAAYVPFGLGPRSCVGMSFAITETKIALSMILQRYTISLSPA  491

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             Y H P  + +L P++G+QVIL ++
Sbjct  492   YSHSPYYLPLLQPQHGIQVILHSL  515



>gb|AJD25262.1| cytochrome P450 CYP749A40 [Salvia miltiorrhiza]
Length=509

 Score =   530 bits (1364),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 252/508 (50%), Positives = 360/508 (71%), Gaps = 4/508 (1%)
 Frame = +3

Query  63    LTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMG  242
             +TF   I +L  L RL+ + WW P +++K++RSQGI GP Y   HGNTK I  MR +++ 
Sbjct  2     ITFFFIISILVVLARLIHKLWWKPLQIQKILRSQGIKGPSYKLIHGNTKDILKMRKEAIS  61

Query  243   KPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPK  422
                   SH +F RI PH++TW ++YG+ FL W G +P + +TEPEL +E+L NK+G Y K
Sbjct  62    SCDDLCSHDVFPRILPHLNTWIKLYGSNFLIWMGDQPQIIVTEPELAREILTNKDGIYKK  121

Query  423   MDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKEL  602
                 ++ K+LLG+ L+  EGEKW+K+RKL+N+ FH +SLK MVP M+ SV+ MLER++  
Sbjct  122   CKPLNYVKRLLGDGLVVAEGEKWSKLRKLSNYAFHGDSLKDMVPAMVESVDTMLERFEGN  181

Query  603   EGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISML  782
              GKE+++ K+F +LT+++IS+TAFGS+++EG+ IF M+  L  +  +N + ++  G+  +
Sbjct  182   VGKEIEISKEFKLLTSDIISKTAFGSTYVEGQDIFDMLMKLVVLITRNAFKIRPFGLKRI  241

Query  783   TRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISKN  959
              RSSDEIEA+++E+ ++ +I+ LVRKRE     G +E++GND+LG LMK+     D    
Sbjct  242   WRSSDEIEADRVEKSLRDSIVSLVRKREDMVRTGQLEDFGNDFLGALMKVNH-EVDPKIR  300

Query  960   ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGI  1139
             ISLD ++DE K  + AGH TT+SLL W   LL++H EWQE+AR E+L LFG + PT+ G+
Sbjct  301   ISLDDIVDECKVFFIAGHETTSSLLSWTALLLSIHEEWQERARDEVLHLFGMDKPTAQGL  360

Query  1140  ARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQ  1319
             +RL+ + MILNE +RLY PV+ +TRKV +E +LG   IPAD+ +++P LALH + +IWG+
Sbjct  361   SRLKILTMILNEALRLYSPVLALTRKVGQETRLGRYKIPADVEVYIPPLALHRNHEIWGR  420

Query  1320  DVHVFNPHRFAQGVakatnn--naaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             D H+F P RF  GVAKA N    A AF PFG GPR CVGLNF  +EAK+AL MILQRYK 
Sbjct  421   DAHLFKPERFGDGVAKAANGNPTALAFLPFGAGPRACVGLNFAGDEAKVALIMILQRYKL  480

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQN  1577
             TLSPNYVH P  +  + P++G+Q+ILQ+
Sbjct  481   TLSPNYVHAPFQLLTVNPQHGIQIILQS  508



>ref|XP_004135431.1| PREDICTED: cytochrome P450 734A1-like [Cucumis sativus]
Length=520

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 249/504 (49%), Positives = 351/504 (70%), Gaps = 5/504 (1%)
 Frame = +3

Query  78    SIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFD  257
              + L+  +++LV + WWTP R++++MRSQGI GP Y F  GN + +   R Q+M  PM +
Sbjct  17    CVILMSNIMKLVSKFWWTPMRIQRIMRSQGINGPSYKFIQGNMRDMYTKRMQAMATPM-E  75

Query  258   ISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD  437
             +SH+I  R+ PHVH+W   YG +FL W+G +  L IT+PE+IKEVL +K+  YPK  L  
Sbjct  76    LSHNILPRVIPHVHSWLNDYGRSFLQWYGIEAQLIITDPEMIKEVLNDKQKNYPKAKLGR  135

Query  438   FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKEL  617
                ++ G+ L+T+EG++WAK RK+AN  FH +SLK M+P MI   E M+E WK  EGKEL
Sbjct  136   DLLRIFGDGLVTSEGQRWAKSRKIANFAFHGDSLKNMIPTMIECGEKMIEGWKNHEGKEL  195

Query  618   DVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSD  797
             DV+K+  V T +VISRTAFGSS+ +G +IF M+  LT ++++N Y +K P IS + RS D
Sbjct  196   DVYKELKVYTLDVISRTAFGSSYQQGLNIFHMLQQLTDLSIRNGYKIKLPIISKILRSKD  255

Query  798   EIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQ  974
             ++E E+LE+ +K    E++R RE  S NG  E YGND+LG L+K    G   S+ I++D 
Sbjct  256   DVEGERLEKRMKECFTEIIRGREDRSKNGGGEGYGNDFLGMLVKAKNEGEK-SERITMDV  314

Query  975   MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH-ENPTSDGIARLR  1151
             ++ E K  Y AGH TT  L+ W +FLLALH +WQE+AR E+  +FGH  NPT + +++L+
Sbjct  315   IVAECKTFYFAGHETTNVLIAWIMFLLALHKQWQEQARDEVFRIFGHSSNPTYEALSKLK  374

Query  1152  TMNMILNECMRLYPPVITVTRK-VEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
              M MI+NE +RLYPP +TV+R+ VE+EVKLG+L +P  + + +P +A+HHD + WG+DVH
Sbjct  375   IMTMIINETLRLYPPAMTVSRQVVEKEVKLGSLVLPTSLQLMIPTIAVHHDKEFWGEDVH  434

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
              F P RFA+GV+K    N+A + PFG+GPR CVG+NF  NEAKIA+SMILQ+Y FTLSP 
Sbjct  435   EFKPERFAEGVSKTIEGNSAGYLPFGLGPRNCVGMNFAINEAKIAMSMILQKYSFTLSPA  494

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             Y H P       P+ G+QVIL+++
Sbjct  495   YAHTPVQFLTTCPQQGLQVILRSI  518



>gb|EYU22581.1| hypothetical protein MIMGU_mgv1a004745mg [Erythranthe guttata]
Length=512

 Score =   528 bits (1361),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 258/509 (51%), Positives = 357/509 (70%), Gaps = 7/509 (1%)
 Frame = +3

Query  60    FLTFSVSI-YLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS  236
             FL F ++I Y    L + + R WW P R +  M  QGI GP Y F  GNT +IS+M+S S
Sbjct  5     FLVFGLAILYFFSLLAKFLHRVWWAPLRTQYAMELQGIKGPSYKFVRGNTVEISSMKSNS  64

Query  237   MGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAY  416
             M   M +++H IF+R  PH +TW  IYG  F  W+G K  L ITEPEL+KEVL NK  +Y
Sbjct  65    MRGNM-ELNHDIFSRTMPHFYTWINIYGKVFYFWNGEKAELVITEPELVKEVL-NKSESY  122

Query  417   PKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
              + D D + +K++G+ ++ +EGEKW K+RKLAN  FHAE+LK MVP M+ SVE+M+++W+
Sbjct  123   SRTDPDKYMRKIIGDGIVASEGEKWVKLRKLANQAFHAENLKNMVPAMVESVEMMMKKWR  182

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
             E + +E+D+ K+F  +T+E+IS+TAFGSS+ +G+ +F M+  L+ IT +N Y  K P IS
Sbjct  183   EEKTREVDISKEFTFMTSEMISKTAFGSSYSQGEKVFNMLRQLSIITGRNAYKTKIPVIS  242

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVEN---YGNDYLGQLMKITTGGSD  947
              L ++SD+ E++K+E+ I+   L ++ +R+KE+         +G+DYLG L++      +
Sbjct  243   DLFKNSDDRESDKMEKEIQDFFLRILDQRKKETTREAHEKHGFGDDYLGSLLRANHDPVE  302

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
               K IS+ ++IDE K  Y AGH TT++LL W   LLA+ +EWQEKAR+E+LE+FG  NP 
Sbjct  303   -KKRISVQEIIDECKTFYSAGHATTSTLLSWTALLLAIDSEWQEKARQEVLEVFGPHNPN  361

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
             S+G+++L+TM+MI+NE +RLYPPV    RK  +  KLGNL IP +  I MPILALHHDP 
Sbjct  362   SEGLSKLKTMSMIINESLRLYPPVPINERKTTKTSKLGNLIIPPNTKINMPILALHHDPA  421

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
             IWG D H+F P RF++G+A+AT N  AAF PFG+GPRTCVG++F TNEAKIAL MILQRY
Sbjct  422   IWGDDAHLFKPERFSKGIAEATKNIPAAFSPFGLGPRTCVGMSFATNEAKIALCMILQRY  481

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
               TLSPNYVH P  I  L P++GV+V+L 
Sbjct  482   TITLSPNYVHSPVQIMSLRPQHGVKVVLH  510



>ref|XP_004295655.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=478

 Score =   527 bits (1357),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 256/479 (53%), Positives = 343/479 (72%), Gaps = 4/479 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             M  QGI GP Y   HGN K+I NM+ ++M +    +SH IF  +QP  H+W + YG  FL
Sbjct  1     MGLQGIKGPSYRLVHGNAKEILNMKKEAMSRSK-GLSHDIFPVLQPQYHSWLKKYGKIFL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
              W GT+  L + EPEL KE+L NK+  Y ++ ++ F KKLLG  +  +EGE+W K+RKLA
Sbjct  60    QWLGTEAQLVVMEPELCKEILINKDEVYLQLKMNGFGKKLLGNGIGNSEGERWLKLRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             NH  H E+LK MVPE+IAS E ML+RW+  EGKE++++++F + T EVISRTAFGSS+LE
Sbjct  120   NHALHGETLKNMVPEIIASAEKMLQRWQNSEGKEIELYQEFRLFTAEVISRTAFGSSYLE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKE  872
             GK+IF  ++ ++ +  KN Y ++ P I  L ++SDE+EAEKLE+ I+  ILE+V+KRE +
Sbjct  180   GKNIFDRLTKISLLLFKNSYKIRLPVIRELFKTSDEVEAEKLEKEIRETILEIVKKRENK  239

Query  873   SNGVVE--NYGNDYLGQLMKITTG-GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWC  1043
             +    +  N+G D+LG L+K      S+    I++D +ID+ KALY AG  TT   L W 
Sbjct  240   AVAQQDEHNFGGDFLGLLLKAHHHVDSNDRYRITIDDIIDQCKALYFAGQETTNGSLAWT  299

Query  1044  IFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVE  1223
             +FLLALH +WQE+AR+E+L+LFG +NP  DGI+RL+TMNMI+NE +RLYPPVI + ++ E
Sbjct  300   VFLLALHQDWQEEARKEVLQLFGKQNPNIDGISRLKTMNMIINESLRLYPPVIQLVKRTE  359

Query  1224  REVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPF  1403
             REV+LG   +PA+I + +PI+ALHHDP+IWGQD  +F P RF++G+AKAT  N AAF PF
Sbjct  360   REVRLGKFIVPANIDLVIPIVALHHDPEIWGQDAKLFRPERFSEGIAKATKKNMAAFIPF  419

Query  1404  GMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             GMGPR CVG NF T E KIALSMILQRY FTLS  YVH P  +  L P NGVQVIL ++
Sbjct  420   GMGPRICVGFNFATIETKIALSMILQRYAFTLSTGYVHSPLQVLTLRPHNGVQVILHSL  478



>gb|KDO36840.1| hypothetical protein CISIN_1g012962mg [Citrus sinensis]
Length=452

 Score =   525 bits (1351),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 251/452 (56%), Positives = 341/452 (75%), Gaps = 3/452 (1%)
 Frame = +3

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             M++++M  PM ++SH I+ R+ PHV++W ++YG  FL W+G +  L +TEP+LIKE+L++
Sbjct  1     MKNETMRSPM-ELSHQIYPRVSPHVYSWIKLYGKNFLMWYGLEAQLVVTEPQLIKEILSD  59

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             K  AYPK +  ++ KKLLG  L+T +GEKW K RKLANH FHAE+LK M+P+MIAS E+M
Sbjct  60    KHRAYPKREPREYTKKLLGNGLVTAQGEKWFKQRKLANHAFHAETLKSMIPDMIASAEMM  119

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L+RW++ EG+E+DV+++F +LT E ISRTAFGSS+LEG++IF M++ LT    KN Y V+
Sbjct  120   LDRWRDNEGQEIDVYQEFKILTLEAISRTAFGSSYLEGENIFNMLTKLTFFISKNEYRVR  179

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
              P I  L ++ D+IE++K E  I+ +I+++++KRE     G VE+ GND LG LM+    
Sbjct  180   IPVIGKLVKTHDDIESDKTEEDIRDSIIKIIKKRESNVMTGEVESDGNDLLGVLMQ-AYH  238

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               D +  ISLD +IDE K  Y AGH TT SLL W + LLA+H +WQ+KAR E+L+LFG +
Sbjct  239   NVDETLKISLDDLIDECKTFYIAGHETTASLLTWTVLLLAIHNDWQDKARNEVLQLFGQQ  298

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             +P +D I+RL+ M+MI+NE +RLYPPV+ + RKV++EVKLG   IPAD+ I +P LA+HH
Sbjct  299   SPNADNISRLKIMSMIINESLRLYPPVVLILRKVKKEVKLGKFVIPADVDITIPTLAVHH  358

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQIWG++ H+F P RFA GVA ATNNN AAF PFG+GPRTCVG N+   EAKIALSMIL
Sbjct  359   DPQIWGEEFHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMIL  418

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             Q+YKFTLSP YVH PA I  L P++G+QV+L 
Sbjct  419   QQYKFTLSPTYVHSPASIITLRPQHGLQVLLH  450



>gb|EYU22578.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22579.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22580.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
Length=506

 Score =   526 bits (1355),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 250/487 (51%), Positives = 350/487 (72%), Gaps = 3/487 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WW P R++++M SQGI GP Y F HG+TK+I  + +Q+   PM ++SH IF RIQPH 
Sbjct  20    KLWWAPLRVQQLMESQGIKGPSYKFIHGSTKEIITINNQTSDTPM-ELSHDIFPRIQPHF  78

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
             ++W ++YGN  L W G +P++ +TE +LIKE+L NKEG + K     + KKLLG+ ++  
Sbjct  79    YSWTKLYGNNLLYWIGAQPHILVTEADLIKEILWNKEGTFTKTRTTGYLKKLLGDGIVLT  138

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
             EGEKW K+RKLANH FH E LK M P M+ASVE MLE++K  EGKE++V  +F +LT+EV
Sbjct  139   EGEKWIKLRKLANHAFHGECLKDMFPSMVASVEAMLEKFKCHEGKEIEVCSEFRLLTSEV  198

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS++EG+ IF M++ L  +  +N +N++   +    R+ DEIEA+K+E+ +  
Sbjct  199   ISRTAFGSSYVEGRKIFDMLTKLGVLASRNSHNIRLAVLQKFARTKDEIEADKIEKSLHD  258

Query  837   AILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
             +I+E+V +R+ E   G  +++G+D+LG L+K      D    +S  ++IDE K  Y AG 
Sbjct  259   SIVEMVNRRQDEVKIGKSKDFGSDFLGSLLK-AHHNIDKKNQLSALEIIDECKTFYFAGQ  317

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYP  1193
              TT SLL W + LLA++T+WQE+AR E+LELFG +NP S+GI+RL+TM+MI+ E +RLY 
Sbjct  318   ETTYSLLSWAVLLLAINTDWQERARNEVLELFGRQNPVSEGISRLKTMSMIVYETLRLYS  377

Query  1194  PVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakat  1373
             PVI +TR+ + +V LG    PA++ + +P L+LH +P IWGQD  +FNP RFA+G+AKAT
Sbjct  378   PVIAITRRTDSKVGLGKYEFPANVNLVIPPLSLHRNPDIWGQDCQLFNPDRFAEGLAKAT  437

Query  1374  nnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKN  1553
               NA AF  FG GPR C+GLNF +NEAKIALSMILQRYKFTLSPNYVH P  +    P++
Sbjct  438   GGNATAFLGFGYGPRICLGLNFASNEAKIALSMILQRYKFTLSPNYVHSPYIVLTAQPQH  497

Query  1554  GVQVILQ  1574
             GV+++LQ
Sbjct  498   GVKILLQ  504



>gb|AEM42984.1| cytochrome P450 [Siraitia grosvenorii]
Length=519

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 243/493 (49%), Positives = 349/493 (71%), Gaps = 4/493 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             ++LV R W +P R++K MRSQGI GPPY F  GNTK++   R Q+   PM D+SH+I  R
Sbjct  22    MKLVVRLWMSPIRIQKTMRSQGIRGPPYQFIQGNTKEMYTKRMQATATPM-DLSHNILPR  80

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             + PHVH+W   YG  FL W GT+    +T+PE+IKE+L  ++  +PK  L  + +K+ G+
Sbjct  81    VLPHVHSWLNHYGKNFLQWLGTEAQFVVTDPEMIKEMLHVRQRNFPKAKLHGYIQKIFGD  140

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
               +T EGE+WAK+RK+AN +F+ +SLK M+P M    E M+ERWK  EGKE+DVF+   +
Sbjct  141   GTVTAEGERWAKLRKIANFSFNGDSLKSMIPAMTGCAEAMIERWKHYEGKEIDVFEQMKI  200

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
              T++VIS TAFGSS+ +GKHIF  +  ++ + ++N Y V FP IS + +  D IE E+L+
Sbjct  201   YTSDVISHTAFGSSYEQGKHIFYTLQQISELYIRNAYKVSFPVISRIFKHKDHIEGERLQ  260

Query  822   RGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             + +K   +++++ RE K  +G  + YGND+LG L+K      +IS+ IS+D+++DE K  
Sbjct  261   KRMKECFMKVIKTREAKFLSGEADGYGNDFLGLLVK-AKNDPEISQRISVDEIVDECKTF  319

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH-ENPTSDGIARLRTMNMILNE  1175
             Y AGH TT+ LL W +FLLALH EWQE+AR+E   +FG  +NPT++G+A+L+TM MI+NE
Sbjct  320   YFAGHETTSMLLTWTMFLLALHQEWQEEARKEAFRIFGDSDNPTAEGLAKLKTMTMIINE  379

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
             C+RLYPP +TV+R VE+EV+LG L +P  IT+ +P +A+H D + WG+D HVF P RF++
Sbjct  380   CLRLYPPAMTVSRTVEKEVRLGRLVLPKTITVAVPTIAVHQDTEYWGEDAHVFKPERFSE  439

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             G+AK   +N+A + PFG+GPR CVG+NF  NEAKI +SMIL+RY FTLSP Y H P  + 
Sbjct  440   GIAKVIESNSAGYLPFGLGPRICVGMNFALNEAKIVISMILRRYSFTLSPAYSHSPIQLV  499

Query  1536  ILTPKNGVQVILQ  1574
              + P++G+QVIL 
Sbjct  500   TVCPQHGLQVILH  512



>ref|XP_004297193.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=519

 Score =   526 bits (1354),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 261/502 (52%), Positives = 357/502 (71%), Gaps = 10/502 (2%)
 Frame = +3

Query  87    LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISH  266
             LL  L+++  + WW P R++K +  QG+ GPPY   HGNTK+I+ M  ++M +P   +SH
Sbjct  20    LLVALIKIFYKQWWIPTRIKKKLNLQGVTGPPYRLIHGNTKEIAGMIKEAMSRPK-RLSH  78

Query  267   HIFARIQPHVHTWKEIYG-NTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFA  443
              I   I PH+H+W + YG   +L W+G++  L + + EL KE+L  K+  Y K   + FA
Sbjct  79    DIRTLIYPHIHSWSKKYGGKAYLQWYGSQAQLIVMDTELCKEILNEKDRVYRKPKKEGFA  138

Query  444   KKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELE-GKELD  620
              +L G  L   EGEKWAKVRK++ H FH ESLK M+P MIAS E ML+RW   E GKE++
Sbjct  139   LRLQGNGLPGIEGEKWAKVRKISMHAFHGESLKTMIPSMIASTETMLKRWITFEEGKEIE  198

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDE  800
             VF++F +LT+EVISRTAFGSS+LEG+ IF+M+  L +  VKN Y ++ PGIS   ++ DE
Sbjct  199   VFEEFRLLTSEVISRTAFGSSYLEGQDIFEMLMKLASFLVKNTYRLRIPGISRFIKNKDE  258

Query  801   IEAEKLERGIKGAILELVRKREKESNGVVEN---YGNDYLGQLMKITTGGSDISKNISLD  971
             IE+EKL   I  +ILE+V+KRE+++  + +    +G D++G L+K      D + NI++D
Sbjct  259   IESEKLVERIHDSILEIVKKREEQAMTMSDEEDRFGGDFIGLLLK---ARHDPNVNITVD  315

Query  972   QMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN-PTSDGIARL  1148
              +IDE K  Y AG  TT +LL W I LLALH EWQE+ARRE+L+LFG +  P SDGIA+L
Sbjct  316   DVIDECKTFYFAGQETTNTLLAWTILLLALHPEWQEEARREVLQLFGKQTTPNSDGIAKL  375

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM+MILNE +RLYPPV+++ R+V+++V+LG + +PA++ + +P LA HHDPQ+WG DVH
Sbjct  376   KTMSMILNETLRLYPPVVSIIRRVKKDVRLGKIIVPANVELQVPNLAFHHDPQLWGDDVH  435

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RF++GVAKATNNN  A+ PFGMGPR C+G NF T EAKIALSMILQRY FTLSP 
Sbjct  436   LFKPERFSEGVAKATNNNMVAYLPFGMGPRNCIGFNFATTEAKIALSMILQRYSFTLSPG  495

Query  1509  YVHYPADIFILTPKNGVQVILQ  1574
             YVH P     + P++GVQV+L 
Sbjct  496   YVHSPFRYITVRPQHGVQVMLH  517



>ref|XP_004297207.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=526

 Score =   525 bits (1353),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/520 (50%), Positives = 370/520 (71%), Gaps = 12/520 (2%)
 Frame = +3

Query  51    TAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRS  230
             +       V + LL  + +++ R WWTP R +K+M SQGI GP Y   HGNTK+I+NM+ 
Sbjct  9     STILCCVGVHVLLLALIFKVLHRLWWTPTRFQKLMASQGIRGPSYKLIHGNTKEINNMKI  68

Query  231   QSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEG  410
             Q+M +P  ++SH I + + PH+H+W  IYG  +L WHGT+  L ITEPEL +E+L +KE 
Sbjct  69    QAMSRPR-NLSHDIVSAVHPHIHSWTNIYGKNYLQWHGTQAQLVITEPELCREILNDKEK  127

Query  411   AYPKMDLDDFAKKLLGEAL--ITNEGEKWAKVRKLANHTFHAES-LKRMVPEMIASVEVM  581
             AYPKM+   F KKL GE L   T   EKWA++R+++NH+F  ES LK  +P  I S   M
Sbjct  128   AYPKMEPIPFIKKLFGEGLGTRTKSDEKWAQLRRISNHSFLGESSLKNKIPATIDSAGTM  187

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L+RWK  EGKE++V+++F +LT EVISRTAFGSS+LEG+HIF M+     +  KN++ ++
Sbjct  188   LQRWKNHEGKEIEVYEEFRLLTAEVISRTAFGSSYLEGQHIFDMLMKFYFLISKNLFTIR  247

Query  762   FPG-ISMLTRSSDEIEAEKLERGIKGAILELVRKREKES--NGVVENYGNDYLGQLMKIT  932
              P  IS + ++ DE EAEKL++GI+ +IL+++++RE ++   G   N+G D+LG L+K  
Sbjct  248   LPTFISKVYKTKDETEAEKLDQGIRDSILKIIKEREAKAMKTGEEGNFGQDFLGMLLK-A  306

Query  933   TGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFG  1112
                +D+++ I+++++IDE K LY AG  +T SLL W I LLALHT+WQ++A++E+L++FG
Sbjct  307   HHDADVNQRITVEELIDECKTLYFAGQDSTASLLAWTILLLALHTDWQDEAQKEVLQVFG  366

Query  1113  HEN-PTSDGIARLRTMNMILNECMRLYPPVITVT-RKVEREVKLGNLTI--PADITIFMP  1280
              +N P  DGIA+L+T++MI+NE +RLYPP++TV+ R  +REV++G LTI   A++ + + 
Sbjct  367   KQNQPNHDGIAKLKTLSMIINESLRLYPPLVTVSGRTADREVRVGKLTIDPAANLELLIK  426

Query  1281  ILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKI  1460
              L+LHHDP  WGQDVH+F P RFA GVAKATNNN A F PFG G R CVG +F   EAK+
Sbjct  427   PLSLHHDPDFWGQDVHLFKPERFADGVAKATNNNLAGFLPFGTGRRMCVGSDFAVTEAKV  486

Query  1461  ALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              LSMILQRY FTLSP YVH P +   L P++GVQV+L ++
Sbjct  487   VLSMILQRYSFTLSPTYVHSPYEALTLCPQHGVQVMLHSL  526



>ref|XP_010046611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104435586 
[Eucalyptus grandis]
Length=1036

 Score =   542 bits (1397),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 262/507 (52%), Positives = 368/507 (73%), Gaps = 16/507 (3%)
 Frame = +3

Query  57    FFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS  236
             F L FS     L KL       WWTP R+++ M SQGI GPPY   +GNT++I   ++++
Sbjct  9     FLLPFSALAIALHKL-------WWTPCRIQRTMASQGIRGPPYKLFYGNTREILQFKNEA  61

Query  237   MGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAY  416
               +PM ++SH IF R+QPH+ TW   YG  +L W+G  P        LIKEV+ NK+ A+
Sbjct  62    SSRPM-NLSHDIFPRVQPHISTWTGTYGANYLRWYGLLPL------XLIKEVVNNKDKAF  114

Query  417   PKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             PK +++ F KKLLG+  +T EGEKWAK RKLAN+ FH +SLK M+P M+ SV +ML+RWK
Sbjct  115   PKPEIEGFVKKLLGDGPVTTEGEKWAKQRKLANYAFHGDSLKSMLPAMVDSVHMMLDRWK  174

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
              L G E++V+++F +LT+E+ISRTAFGSS++EG++IF+M+  L +I  +N + ++FPGIS
Sbjct  175   NLHGDEIEVYQEFTMLTSEIISRTAFGSSYVEGRNIFEMLRKLASIASRNAFKIRFPGIS  234

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDIS  953
              L +++DE+E+EKLE GI+ A+LE++RKRE K   G +++ GND+LG L+K  +   D S
Sbjct  235   KLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGELDDLGNDFLGLLVK-ASHSDDES  293

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             + I++  ++DE K  Y AG  T+ ++L W +FLLA+H +WQ++AR+E+L +FG+++P  D
Sbjct  294   RRITITDLVDECKTFYIAGQDTSNTMLTWTVFLLAIHPDWQDEARKEVLNVFGNQDPDPD  353

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             GIA+L+TM MI+NE +RLYPPV+ + RKV  + +LG L +PA+I +++P L LHHDPQIW
Sbjct  354   GIAKLKTMGMIINESLRLYPPVVGLIRKVGTKTRLGKLVLPANIGLYIPNLKLHHDPQIW  413

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G D  +F P RF++GVAKATNNN AAFFPFG+GPRTCVG NF T EAKIALSMILQRY F
Sbjct  414   GDDAQLFKPERFSEGVAKATNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTF  473

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             +L P YVH    +   +P++GVQVI  
Sbjct  474   SLFPAYVHSHTQLLTTSPQHGVQVIFH  500


 Score =   535 bits (1377),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 259/510 (51%), Positives = 363/510 (71%), Gaps = 15/510 (3%)
 Frame = +3

Query  87    LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISH  266
             +L  L +L+ + WW P R+++VM  QGI GPPY F HG+TK+   M  ++   PM ++SH
Sbjct  525   VLCSLAKLLHKLWWNPLRIQRVMAQQGITGPPYRFLHGSTKETIKMNMEARNTPMSNLSH  584

Query  267   HIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAK  446
              IF +IQP ++TW   YG  +L+W G +  L ITEPEL+KEVL N++  YPK    DF+K
Sbjct  585   DIFPKIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNKDFSK  644

Query  447   KLLGEALI-TNEGEKWAKVRKLANHTFHAESLK------------RMVPEMIASVEVMLE  587
             KLLG+ L  T  GEKWAK RKLAN  FH +SLK             M P M+ASV  ML 
Sbjct  645   KLLGDGLASTPGGEKWAKKRKLANRAFHGKSLKVVGLDGKRELCENMAPAMVASVHTMLG  704

Query  588   RWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFP  767
             +WK  EGKE++VF +F VLT+EVISRTAFGSSF+EG++IF+M++ L+ +T +N + ++ P
Sbjct  705   KWKNREGKEIEVFGEFKVLTSEVISRTAFGSSFVEGRNIFQMLTGLSLLTSRNAFTIRLP  764

Query  768   GISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGS  944
             G+S L ++ DE+EAEKLE+GI+ +I +++++REK+   G V  +G+D+LGQL+K      
Sbjct  765   GLSKLWKTVDEVEAEKLEKGIRNSIEQMIKRREKKVMAGEVNGFGDDFLGQLVK-ALHDV  823

Query  945   DISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
             D SK I+++ ++DE K  Y AG  T  SL+ W +FLLA++ EWQE+AR E+L +FG+++P
Sbjct  824   DKSKKITVNNLVDECKTFYVAGQETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDP  883

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
               DG+ +L+ +NMI+NE +RLYPP++ + RKV ++ +LG L +PADI IF+PI  LH DP
Sbjct  884   DFDGLGKLKKINMIINETLRLYPPLVGLNRKVGKKQRLGRLVLPADIQIFVPIPKLHSDP  943

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
             +IWG+DVH F P RF++GVAKATNNNA  F PFG GPR+CVG++F   EAK+ALSMILQR
Sbjct  944   EIWGEDVHQFKPERFSEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQR  1003

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             + F LSP Y+H P   F+  P++G+Q+I  
Sbjct  1004  FTFELSPAYIHCPVYNFMNRPQHGLQIIFH  1033



>ref|XP_007045775.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01607.1| Cytochrome P450 [Theobroma cacao]
Length=519

 Score =   525 bits (1352),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 250/504 (50%), Positives = 356/504 (71%), Gaps = 3/504 (1%)
 Frame = +3

Query  72    SVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM  251
             S  +Y L  L++     WW P R++ ++RSQGI GPPY F HGN K +     ++  KPM
Sbjct  14    SFFLYFLRALLKAFYNYWWIPHRIQNILRSQGIKGPPYEFIHGNNKAVVESIREASSKPM  73

Query  252   FDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL  431
               ++H IF R+ PH+++    YG  +L+W+G +  L ITEP+LIKEVL N E A+PK  +
Sbjct  74    -ALTHDIFPRVLPHIYSCINTYGKIYLSWNGVRALLVITEPDLIKEVLKNSEKAFPKRKV  132

Query  432   DDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK  611
               F  K+LG+ L T   EKWA+ RKLAN+ FH ESLK M P +IASVE ML++WK  EGK
Sbjct  133   TYFLSKILGDGLATTVREKWARQRKLANYAFHGESLKNMTPAVIASVETMLQKWKGQEGK  192

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++VF++F +LT+EVISRTAFGSS+LEG+ IF+ +  L+ I  +N+Y  + PGIS + + 
Sbjct  193   EIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFETLMKLSVIASRNLYKARIPGISYVWKH  252

Query  792   SDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISL  968
             +DEIE+EKL + I  +++++V++RE K   G  E++G+D+LG L+       D    +S+
Sbjct  253   ADEIESEKLAKEIHDSVMKIVKQREEKVVAGEAESFGSDFLGLLLN-AYHDLDEKNRLSV  311

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARL  1148
             + ++DE K  Y AG  TT SLL W + LLA+HT+WQEKARRE++E+FG+++P  +GIA+L
Sbjct  312   EDLVDECKTFYFAGQETTNSLLAWTVLLLAIHTDWQEKARREVIEVFGNQDPHPEGIAKL  371

Query  1149  RTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
             +TM MI+NE +RLYPPV  + R+V REV+LG L +P +I   +P +ALHHDP++WG DVH
Sbjct  372   KTMTMIINETLRLYPPVNGIARRVGREVQLGKLMLPTNIEFSIPNMALHHDPELWGDDVH  431

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPN  1508
             +F P RFA+G+AKAT +NA AF PFGMGPR+CVG++F   E K+A+ MILQRY   LSP 
Sbjct  432   LFKPERFAEGIAKATKHNAGAFIPFGMGPRSCVGMSFAITETKMAIFMILQRYNIALSPA  491

Query  1509  YVHYPADIFILTPKNGVQVILQNV  1580
             YVH P  +  L P++G+Q++  ++
Sbjct  492   YVHAPLALLTLRPQHGIQLLFHSL  515



>ref|XP_008339765.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   525 bits (1351),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 261/496 (53%), Positives = 358/496 (72%), Gaps = 4/496 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             V+  D+ WWTP R++K M SQGI GP Y   +GN K+I++M  ++M +PM   SH I + 
Sbjct  22    VKFFDKLWWTPTRIQKRMASQGIKGPSYKLIYGNGKEITSMTKETMSRPMSTSSHDISSY  81

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             + PH H W  IYG +FL W+G +P+L I EPE  K +L+NK+    K     F KKL G+
Sbjct  82    VLPHDHLWTNIYGKSFLQWYGPQPHLTIGEPESCKAILSNKDRICRKPKPPYFVKKLFGD  141

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
              L+  EGEKW K+RKLA H F+ ESLK M+PEMI S EVMLERWK  EG+E++V ++F +
Sbjct  142   GLLMAEGEKWVKLRKLATHAFNGESLKSMIPEMITSTEVMLERWKNHEGEEIEVNEEFKL  201

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
             LT+EVISRTAFGSS+LEGK+IF+M++ L ++  KN Y  + PGIS   + SDEI+++KLE
Sbjct  202   LTSEVISRTAFGSSYLEGKNIFEMLTELASLLFKNTYTFRLPGISKFYKPSDEIKSDKLE  261

Query  822   RGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             +GI+ +I  +  KREK++  G  + +G+DYLG L+K        ++ IS+D+++DE K  
Sbjct  262   KGIRDSIAGMASKREKKAMTGEGDGFGSDYLGLLLKAHHNAIG-NERISMDELVDECKTF  320

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIA--RLRTMNMILN  1172
             Y AG  T TS+L W +FLLALHT+WQE+AR+E+L+LFG + P  DGIA  +L+TM+MI+N
Sbjct  321   YLAGQETATSMLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNPDGIAKLKLKTMSMIVN  380

Query  1173  ECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
             E +RLYPPVI + R+ E+EV+L  L +PA++ + +  LA HH+P+ WGQD  +F P RF+
Sbjct  381   ESLRLYPPVIHLIRETEKEVRLEELNVPANVQLRVSNLAFHHEPEFWGQDAQLFKPERFS  440

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             +GV+KATNNN  AF PFGMGPRTCVG+NF   EAKIALSMILQRY F LSP Y+H P + 
Sbjct  441   KGVSKATNNNMVAFIPFGMGPRTCVGMNFAIIEAKIALSMILQRYSFXLSPXYMHSPING  500

Query  1533  FILTPKNGVQVILQNV  1580
               ++P++GVQVIL ++
Sbjct  501   LAVSPQHGVQVILHSL  516



>ref|XP_008352941.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   525 bits (1351),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 261/496 (53%), Positives = 358/496 (72%), Gaps = 4/496 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             V+  D+ WWTP R++K M SQGI GP Y   +GN K+I++M  ++M +PM   SH I + 
Sbjct  22    VKFFDKLWWTPTRIQKRMASQGIKGPSYKLIYGNGKEITSMTKETMSRPMSTSSHDISSY  81

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             + PH H W  IYG +FL W+G +P+L I EPE  K +L+NK+    K     F KKL G+
Sbjct  82    VLPHDHLWTNIYGKSFLQWYGPQPHLTIGEPESCKAILSNKDRICRKPKPPYFVKKLFGD  141

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
              L+  EGEKW K+RKLA H F+ ESLK M+PEMI S EVMLERWK  EG+E++V ++F +
Sbjct  142   GLLMAEGEKWVKLRKLATHAFNGESLKSMIPEMITSTEVMLERWKNHEGEEIEVNEEFKL  201

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
             LT+EVISRTAFGSS+LEGK+IF+M++ L ++  KN Y  + PGIS   + SDEI+++KLE
Sbjct  202   LTSEVISRTAFGSSYLEGKNIFEMLTELASLLFKNTYTFRLPGISKFYKPSDEIKSDKLE  261

Query  822   RGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             +GI+ +I  +  KREK++  G  + +G+DYLG L+K        ++ IS+D+++DE K  
Sbjct  262   KGIRDSIAGMASKREKKAMTGEGDGFGSDYLGLLLKAHHNAIG-NERISMDELVDECKTF  320

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIA--RLRTMNMILN  1172
             Y AG  T TS+L W +FLLALHT+WQE+AR+E+L+LFG + P  DGIA  +L+TM+MI+N
Sbjct  321   YLAGQETATSMLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNPDGIAKLKLKTMSMIVN  380

Query  1173  ECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
             E +RLYPPVI + R+ E+EV+L  L +PA++ + +  LA HH+P+ WGQD  +F P RF+
Sbjct  381   ESLRLYPPVIHLIRETEKEVRLEELNVPANVQLRVSNLAFHHEPEFWGQDAQLFKPERFS  440

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             +GV+KATNNN  AF PFGMGPRTCVG+NF   EAKIALSMILQRY F LSP Y+H P + 
Sbjct  441   KGVSKATNNNMVAFIPFGMGPRTCVGMNFAIIEAKIALSMILQRYSFXLSPXYMHSPING  500

Query  1533  FILTPKNGVQVILQNV  1580
               ++P++GVQVIL ++
Sbjct  501   LAVSPQHGVQVILHSL  516



>ref|XP_010091620.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44886.1| Cytochrome P450 734A1 [Morus notabilis]
Length=475

 Score =   522 bits (1345),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 263/476 (55%), Positives = 343/476 (72%), Gaps = 5/476 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM-FDISHHIFARIQPHVHTWKEIYGNTF  329
             M SQGI GP Y F  GN K++ NM+ ++M KPM     H+IF ++QP+   W +IYG  +
Sbjct  1     MASQGIRGPSYRFIQGNAKEMWNMKKEAMSKPMSLSQGHNIFHKLQPNQEYWAKIYGKNY  60

Query  330   LTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKL  509
             L W GT+P L ITE ELIKEVL NK+  Y K     F KKL G+ L   EGEKW K+RKL
Sbjct  61    LQWLGTQPQLVITELELIKEVLNNKDRVYLKSGAQRFVKKLFGDGLAVTEGEKWDKLRKL  120

Query  510   ANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFL  689
             ANH FHAE+LK MVP M++SVE+MLERWK  EGKE++VF++F VLT++VIS+TAFGSS+L
Sbjct  121   ANHFFHAENLKGMVPAMMSSVEMMLERWKNYEGKEIEVFEEFRVLTSDVISKTAFGSSYL  180

Query  690   EGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-  866
             EGK IF M+  LT I       +K P IS  T+  DEIE++ L+R I  +I+E+V+KRE 
Sbjct  181   EGKKIFDMLRRLTFIVTMGFLKIKLPIISKFTK--DEIESDMLDREISNSIMEMVKKRED  238

Query  867   KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCI  1046
             K ++G  +NYG+D LG L+K     +D  K IS++ +I E+++ Y AG  TT SLL W +
Sbjct  239   KVTSGDEDNYGSDLLGGLIK-AHHDADEMKQISMEDLITEVRSFYFAGQETTNSLLAWTV  297

Query  1047  FLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVER  1226
              LLA+HT+WQE+AR+E + LFG  NP +DGIARL+ ++ I+NE  RLYPPV+  +R   +
Sbjct  298   LLLAIHTDWQEEARKEAVNLFGQHNPIADGIARLKVISQIINESTRLYPPVVAFSRHAAK  357

Query  1227  EVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFG  1406
             EV+LGNL +PA + + +  L LH DPQIWG+DV+ F P RF++GV KATNNN+AA+FPFG
Sbjct  358   EVRLGNLNLPAKMELVISNLPLHLDPQIWGEDVYEFKPERFSEGVVKATNNNSAAYFPFG  417

Query  1407  MGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             MGPRTCVG+NF   EAKIALSMIL+RY FTLSP YVH P     L P++G+QV+LQ
Sbjct  418   MGPRTCVGMNFALTEAKIALSMILRRYSFTLSPAYVHSPYAFITLQPQHGIQVVLQ  473



>gb|KHG06141.1| Cytochrome P450 protein [Gossypium arboreum]
 gb|KHG27970.1| Cytochrome P450 protein [Gossypium arboreum]
Length=522

 Score =   522 bits (1344),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 248/501 (50%), Positives = 352/501 (70%), Gaps = 8/501 (2%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             L++++ + WW P R++++M  QGI GPPY F HGN K+   M+ +++  PM  +SH    
Sbjct  23    LIKVLHKYWWKPLRIQRLMSRQGINGPPYRFIHGNNKETIKMKQEALRNPMPSLSHDTLP  82

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDL------DDF  440
             R+ P + +  ++YG  +L+W G++  L ITEPELIKE+L N E A+PK         DDF
Sbjct  83    RVHPQIWSRIKLYGKNYLSWTGSRAMLVITEPELIKELLKNSERAFPKRTSRERKKEDDF  142

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELD  620
               K+LG+ L+T+EGEKWAK RKLANH FH E+LK M P +IASVE MLERWK  EGKE++
Sbjct  143   VLKILGDGLVTSEGEKWAKKRKLANHAFHGETLKSMSPAVIASVETMLERWKLFEGKEIE  202

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDE  800
             VF +F +LT+EVISR AFGSS+L+G+ IF M+  L+ IT +N++  K P IS   +S+D+
Sbjct  203   VFGEFRLLTSEVISRIAFGSSYLDGEKIFDMLMKLSVITNRNMFKAKLPVISKFWKSADQ  262

Query  801   IEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQM  977
             IEA+KLE+ I   ++++V+KRE K +NG   + G D+LG L+      +D   +IS   +
Sbjct  263   IEADKLEKEIHNCVMKIVKKREEKVANGGANSSGTDFLGLLLN-AYHDTDKKNSISQQDL  321

Query  978   IDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTM  1157
             +DE K  Y AG  TT S L W + LLA+H EWQEKAR+E++++FG++NP  +GI +L+ M
Sbjct  322   VDECKTFYFAGQETTNSSLAWTVLLLAVHPEWQEKARQEVIKIFGNQNPNPEGIGKLKIM  381

Query  1158  NMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFN  1337
              MI+NE +RLYPPV +  RKV  +V+LG L +PAD+ + +P L LHHDP +WG D++VF 
Sbjct  382   TMIINETLRLYPPVSSRVRKVASDVQLGKLILPADLELLVPNLVLHHDPHLWGDDINVFK  441

Query  1338  PHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVH  1517
             P RFA+G+A AT +N+AAF PFG+GPR+CVG++F   E K+ALSMILQR+   LSP Y H
Sbjct  442   PERFAEGIANATKHNSAAFIPFGLGPRSCVGMSFALMEMKMALSMILQRFTILLSPTYSH  501

Query  1518  YPADIFILTPKNGVQVILQNV  1580
              P  + +L P+ G+QV+L ++
Sbjct  502   SPFTLLLLQPQQGIQVMLHSL  522



>gb|KCW86460.1| hypothetical protein EUGRSUZ_B03128 [Eucalyptus grandis]
Length=485

 Score =   520 bits (1339),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 254/507 (50%), Positives = 358/507 (71%), Gaps = 33/507 (7%)
 Frame = +3

Query  57    FFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS  236
             F L FS     L KL       WWTP R+++ M SQGI GPPY   +GNT++I   ++++
Sbjct  9     FLLPFSALAIALHKL-------WWTPCRIQRTMASQGIRGPPYKLFYGNTREILQFKNEA  61

Query  237   MGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAY  416
               +PM ++SH IF R+QPH+ TW   Y                       EV+ NK+ A+
Sbjct  62    SSRPM-NLSHDIFPRVQPHISTWTGTY-----------------------EVVNNKDKAF  97

Query  417   PKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             PK +++ F KKLLG+  +T EGEKWAK RKLAN+ FH +SLK M+P M+ SV +ML+RWK
Sbjct  98    PKPEIEGFVKKLLGDGPVTTEGEKWAKQRKLANYAFHGDSLKSMLPAMVDSVHMMLDRWK  157

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
              L G E++V+++F +LT+E+ISRTAFGSS++EG++IF+M+  L +I  +N + ++FPGIS
Sbjct  158   NLHGDEIEVYQEFTMLTSEIISRTAFGSSYVEGRNIFEMLRKLASIASRNAFKIRFPGIS  217

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDIS  953
              L +++DE+E+EKLE GI+ A+LE++RKRE K   G +++ GND+LG L+K  +   D S
Sbjct  218   KLWKTNDELESEKLENGIRDAMLEIIRKREEKVKAGELDDLGNDFLGLLVK-ASHSDDES  276

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
             + I++  ++DE K  Y AG  T+ ++L W +FLLA+H +WQ++AR+E+L +FG+++P  D
Sbjct  277   RRITITDLVDECKTFYIAGQDTSNTMLTWTVFLLAIHPDWQDEARKEVLNVFGNQDPDPD  336

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             GIA+L+TM MI+NE +RLYPPV+ + RKV  + +LG L +PA+I +++P L LHHDPQIW
Sbjct  337   GIAKLKTMGMIINESLRLYPPVVGLIRKVGTKTRLGKLVLPANIGLYIPNLKLHHDPQIW  396

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G D  +F P RF++GVAKATNNN AAFFPFG+GPRTCVG NF T EAKIALSMILQRY F
Sbjct  397   GDDAQLFKPERFSEGVAKATNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTF  456

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             +L P YVH    +   +P++GVQVI  
Sbjct  457   SLFPAYVHSHTQLLTTSPQHGVQVIFH  483



>gb|KHG18356.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 245/497 (49%), Positives = 351/497 (71%), Gaps = 3/497 (1%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             IY L  L++++   WW P R++  + SQG+ GPPY F HG  KQI+ MRS+++ KPM  +
Sbjct  17    IYSLIVLLKVLYDYWWVPLRIQHFLNSQGLRGPPYKFIHGCNKQINKMRSEALSKPM-GL  75

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             +H I  R+ PH ++W  +YG  +L+W G +  +  T+PELIKEVL N E  +PK +   +
Sbjct  76    THDILPRVFPHYYSWINLYGKNYLSWDGAQAQVVTTDPELIKEVLKNSEQTFPKREPPIY  135

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELD  620
               +L+G+ L+T EGEKWAK RKLAN+ FH ESLK M P +IASVE ML++WK+ EG+E +
Sbjct  136   ISRLVGDGLVTTEGEKWAKQRKLANYVFHGESLKNMTPAVIASVETMLDKWKDKEGEETE  195

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDE  800
             VF++F +LT+EVISRTAFGSS+LEG+ IF M+  L  I  +N    + P +S   ++ D+
Sbjct  196   VFQEFRMLTSEVISRTAFGSSYLEGEKIFYMLKKLADIVSRNSNKSRIPILSKFWKTDDD  255

Query  801   IEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQM  977
             + +EKL R IK  ++E+V+KRE K ++G  E++G+D+LG L+K      D    IS++ +
Sbjct  256   VGSEKLAREIKDLVIEIVKKRENKVASGEAESFGSDFLGLLVK-AFNNPDEKNKISMEDL  314

Query  978   IDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTM  1157
             +DE K  Y AG  T  +LL W + +LA+H++WQ+KARRE++E+FG +NP S+G+A+L+ M
Sbjct  315   VDECKTFYFAGQETVNALLAWAVLVLAIHSDWQDKARREVMEIFGSQNPHSEGLAKLKIM  374

Query  1158  NMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFN  1337
             +MI+NE +RLY P+  + R+  R+V++G L +PA + +++P +ALHHDPQ+WG D HVF 
Sbjct  375   SMIINETLRLYAPINGLVRRARRQVQVGKLVLPAKVDVWIPNMALHHDPQLWGDDAHVFK  434

Query  1338  PHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVH  1517
             P RF +G+AKAT  NAAAF PFGMGPR CVG+ F  NE K ALSMILQRY  +LSP YVH
Sbjct  435   PERFKEGIAKATKYNAAAFIPFGMGPRACVGMTFAINETKTALSMILQRYTISLSPAYVH  494

Query  1518  YPADIFILTPKNGVQVI  1568
              P     + P++G+QVI
Sbjct  495   SPTPRITVQPQHGIQVI  511



>ref|XP_008446465.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=498

 Score =   518 bits (1335),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 243/496 (49%), Positives = 344/496 (69%), Gaps = 5/496 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             +++LV++ WWTP R++++MRSQGI GP Y F  GN + +   R Q+M  PM ++SH+I  
Sbjct  4     IMKLVNKFWWTPMRIQRIMRSQGINGPSYKFIQGNMRDMYTKRMQAMATPM-ELSHNILP  62

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
             R+ PHVH+W   YG +FL W+G +  L IT+PE+IKEVL +K   YPK  L     ++ G
Sbjct  63    RVIPHVHSWLNDYGRSFLQWYGMEAQLIITDPEMIKEVLNDKRKNYPKAKLGSDLFRIFG  122

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
               L+T+EG++WAK RK+AN  FH +SLK M+P MI   E M+E WK  EGKELDVFK+  
Sbjct  123   NGLVTSEGQRWAKSRKIANFAFHGDSLKNMIPTMIECGEKMIEGWKNYEGKELDVFKELK  182

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             V T +VIS TAFGSS+ +G +IF M+  LT ++++N Y +K P IS + +S D+IE E+L
Sbjct  183   VYTLDVISHTAFGSSYQQGSNIFHMLQQLTDLSIRNGYKIKLPIISKILKSKDDIEGERL  242

Query  819   ERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             E+ +     E++R RE++S    E YGND+LG L+K    G   S+ I++D ++ E K  
Sbjct  243   EKRMNECFAEIIRGREEKSKK-GEGYGNDFLGMLVKAKNEGEK-SERITMDVIVAECKTF  300

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH-ENPTSDGIARLRTMNMILNE  1175
             Y AGH TT  L+ W IFLLA+H EWQE+AR E+  +FGH  NPT + +++L+ M MI+NE
Sbjct  301   YFAGHETTNVLITWIIFLLAIHKEWQEQARNEVFRIFGHNNNPTYEALSKLKIMTMIINE  360

Query  1176  CMRLYPPVITVTRK-VEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
              +RLYPP +TV+R+ VE+EVKLG+L +P  + + +P +A+HHD + WG+DVH F P RF+
Sbjct  361   TLRLYPPAMTVSRQVVEKEVKLGSLVLPTSLQLTIPTIAVHHDKEFWGEDVHEFKPERFS  420

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             +GV+K    N+A + PFG+GPR CVG+NF  NEAK+A+S+ILQ+Y FTLSP Y H P   
Sbjct  421   EGVSKTIERNSAGYLPFGLGPRNCVGMNFAINEAKVAMSIILQKYSFTLSPAYAHTPVQF  480

Query  1533  FILTPKNGVQVILQNV  1580
                 P+ G+QVIL ++
Sbjct  481   LTTCPQQGLQVILHSI  496



>ref|XP_009356544.1| PREDICTED: uncharacterized protein LOC103947365 [Pyrus x bretschneideri]
Length=1141

 Score =   536 bits (1382),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 262/510 (51%), Positives = 366/510 (72%), Gaps = 17/510 (3%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             ++  + WWTP R++K M  QGI GPPY   HGNTK+I  M+ Q++G P   +SH I   +
Sbjct  21    KIFHKLWWTPTRIQKFMALQGIKGPPYRLVHGNTKEILRMQKQNLGSPK-KLSHDILCAV  79

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
             QPHVHTW  IYG  +L WH ++  L I EPEL KE+L NK+ AYPK +  +F KK++G+ 
Sbjct  80    QPHVHTWSNIYGKIYLQWHNSQAQLVIMEPELCKEILNNKDRAYPKKEFGNFEKKIVGDG  139

Query  465   LITNEG-EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
             + T     KW K+RK+ANH FH ESLK M+P M+A  E MLERWK  EGKE++VF++  +
Sbjct  140   MATALNVAKWMKLRKIANHAFHGESLKSMIPTMVACTETMLERWKNHEGKEIEVFEELRL  199

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGI-SMLTRSSDEIEAEKL  818
              T+EVI++TAFGS+  EG++IF+M+  L  I +KN++ ++ PG+ S L ++SDE EAE++
Sbjct  200   FTSEVIAKTAFGSNHGEGQNIFEMLMKLFFIALKNIFTIRPPGMMSKLYKTSDEAEAERI  259

Query  819   ERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+ +  ++ E++++RE K ++G  + +G+DYLG L+K     ++  + IS+D MIDE K 
Sbjct  260   EKRMHKSLFEIIKRREEKATSGNNDGFGSDYLGLLLKAHHDANE-KERISVDDMIDECKT  318

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  TT   L W +FLLA+HT+WQE+AR+E+LELFG +NP+ +G+A+L+TM+MI+NE
Sbjct  319   FYFAGQETTNIELAWIVFLLAVHTDWQEEARKEVLELFGKQNPSPEGVAKLKTMSMIINE  378

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPP +++ RKV+REV+LGN  IPA++ + +PILA+HH+P+ WGQD  +F P RFA+
Sbjct  379   SLRLYPPAVSIERKVDREVRLGNFIIPANVELVIPILAIHHEPEFWGQDAQLFKPERFAR  438

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT---------LSPN  1508
             GVAKATNNN A + PFGMGPRTCVG++F   E KIALSMILQRY FT         LSP 
Sbjct  439   GVAKATNNNIATYIPFGMGPRTCVGMDFAIIEVKIALSMILQRYSFTLSXXXXXXXLSPA  498

Query  1509  YVHYPADIFILTPKNGVQVILQNV*LLSCP  1598
             YVH     FIL P++GVQ+IL    L++CP
Sbjct  499   YVHSHVR-FILRPQHGVQIILHP--LVNCP  525


 Score =   515 bits (1327),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 260/494 (53%), Positives = 359/494 (73%), Gaps = 5/494 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             +++  + WW P R++  M SQGI GP Y F HGN K++++MR ++M +P   +SH +F+ 
Sbjct  648   IKVFYKLWWIPIRVQNRMTSQGIKGPSYRFIHGNNKEVASMRKEAMSRPK-SLSHDVFSI  706

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             + P +H+W +IYG  FL W+G +P L +TE EL KE+L NK GAY K  L    KKLLG+
Sbjct  707   VLPLMHSWTKIYGKNFLYWYGHQPRLVVTETELCKEILMNKNGAYQKSKLLGGVKKLLGD  766

Query  462   AL-ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L  TN+GEKW+K+RKLANH F+ ESLK M  EMIAS E MLERWK  EG+E++VF++F 
Sbjct  767   GLATTNDGEKWSKLRKLANHAFNGESLKSMHSEMIASTETMLERWKIHEGEEVEVFEEFR  826

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +LT+EVISRTAFGSS++EGK+IF M+   +A+T  + +   FPGIS   +SS EIE +KL
Sbjct  827   LLTSEVISRTAFGSSYVEGKNIFDMLLKSSALTFSSSFKPGFPGISKFVKSSSEIEFQKL  886

Query  819   ERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+GI+ +++E+VR+RE+   N     +G+D+LGQL++     +D ++ IS++ ++DE K 
Sbjct  887   EKGIRDSLMEIVRRRERNPINREANKFGSDFLGQLLRAHHDTND-NQRISMEDLVDECKT  945

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AGH +T ++L W +FLLALH EWQEKAR+E+ + FG   P  +GI+ L+TM MI+NE
Sbjct  946   FYLAGHESTGTMLAWTVFLLALHPEWQEKARKEVQQFFGKRTPDPNGISNLKTMTMIVNE  1005

Query  1176  CMRLYPPVIT-VTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFA  1352
              +RLYPPV++ V RKV++E +LG L +PA + + +PI  LH+DPQ+WGQDV +F P RF+
Sbjct  1006  SLRLYPPVLSVVNRKVDKETRLGRLVLPAKLHLVIPISPLHYDPQLWGQDVQLFKPERFS  1065

Query  1353  QGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADI  1532
             +GVAKATN+N AAF PFGMGPR C G NF T EAKIALSMILQRY F LSP Y H P+  
Sbjct  1066  EGVAKATNDNIAAFLPFGMGPRVCAGSNFATTEAKIALSMILQRYTFXLSPTYTHSPSAF  1125

Query  1533  FILTPKNGVQVILQ  1574
               + P++GVQ++L 
Sbjct  1126  LTVRPQHGVQIMLH  1139



>ref|XP_006388779.1| hypothetical protein POPTR_0102s00240g [Populus trichocarpa]
 gb|ERP47693.1| hypothetical protein POPTR_0102s00240g [Populus trichocarpa]
Length=563

 Score =   517 bits (1332),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/535 (47%), Positives = 356/535 (67%), Gaps = 47/535 (9%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             +  ++ WWTP R++ +M+SQGI GP Y F HGNTK+IS M  ++   P  ++ HH    +
Sbjct  22    KFFNKVWWTPIRIQSLMKSQGIRGPSYRFLHGNTKEISTMIRKTRSSPQ-ELLHHTLPMV  80

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
              PH ++W ++YG  FL W+G +  L ITEPEL+K++L+NK+ AYPK  + +  KKLLG+ 
Sbjct  81    HPHFYSWIKLYGMNFLQWYGPQAQLIITEPELVKQILSNKDRAYPKTKVSNEIKKLLGDG  140

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVL  644
             ++ +EGEKW K+RKLANH FH ES+K MVPEMIAS+E+MLERW+    KE+D+F +F +L
Sbjct  141   IVLSEGEKWVKLRKLANHAFHGESIKGMVPEMIASLEIMLERWRHHHSKEIDIFVEFKIL  200

Query  645   TTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLER  824
             T+EVISRT+FGSS+LEG+H+F M++ +T I  +N Y V+ PGI    ++S +IE E LE 
Sbjct  201   TSEVISRTSFGSSYLEGQHVFDMLTRMTHIISENNYRVRIPGIGKFVKASYDIEFENLEA  260

Query  825   GIKGAILELVRKREK----------------------------ESNGV------------  884
              I+ + ++++++ EK                            +SNG             
Sbjct  261   KIRKSFMKMMKRTEKDATLGELLKYGMRLGKEICNLQGRMNKRQSNGAMLEMMTSKMTID  320

Query  885   -----VENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIF  1049
                  ++ +G+D  G L+K     SD +K ISLD +ID+ K  Y AG  T+ S L W +F
Sbjct  321   LNVLKLDGFGHDLFGLLLK-AYHDSDETKKISLDDLIDQCKNFYLAGQETSASALTWIVF  379

Query  1050  LLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVERE  1229
             LLA+H++WQ+KAR+E+LELFG + P+ D IA+L+ M M++NE +RLY P   + R+VERE
Sbjct  380   LLAVHSDWQDKARKEVLELFGLQIPSQDRIAKLKIMGMVINESLRLYTPNAILMRRVERE  439

Query  1230  VKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGM  1409
              KLG +T+PA+  +++  LA+H +P+IWG+D  +F P RFA GV KATNNN AAF PFG+
Sbjct  440   TKLGKITVPANTEVYISTLAVHQNPEIWGEDALLFKPERFADGVVKATNNNIAAFMPFGL  499

Query  1410  GPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             GPR C G+NF   E K+ALSMILQRY FTLSP Y H P ++  + P++GVQVILQ
Sbjct  500   GPRNCAGMNFAITETKLALSMILQRYSFTLSPTYAHCPTEVLTMCPQHGVQVILQ  554



>gb|KHG11625.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   516 bits (1328),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/521 (49%), Positives = 360/521 (69%), Gaps = 11/521 (2%)
 Frame = +3

Query  24    MSGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGN  203
             MSG +  +I      F V+      LV+ +    W P R+++++ SQGI GPPY F HGN
Sbjct  1     MSGLMKLVILVPCSLFFVA------LVKFLYDYLWRPLRIQQMLNSQGIRGPPYRFIHGN  54

Query  204   TKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELI  383
              K+++ MR +++ KPM  + H IF R+QPH++TW   YG  +L+W G +  L I+EPELI
Sbjct  55    NKEVAKMRQEALSKPM-ALRHDIFPRVQPHIYTWINKYGKNYLSWDGVRAELVISEPELI  113

Query  384   KEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMI  563
             KEVL N E A+PK     F  KL+   L + EGEKW K RKL NH FH ESLK M P +I
Sbjct  114   KEVLNNSEKAFPKRKPTVFISKLVANGLFSVEGEKWVKQRKLGNHAFHGESLKNMTPAVI  173

Query  564   ASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVK  743
             ASVE MLE+WK   GKE+++F++F +LT+EVISRTAFGSS+LEG+ IF M+S L  I  +
Sbjct  174   ASVETMLEKWKGYVGKEIELFEEFRLLTSEVISRTAFGSSYLEGQKIFDMLSKLAIIMHR  233

Query  744   NVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQL  920
             N++  + P IS L + +D +E+E+L   I+G ++++++KRE +  NG  +++GND+LG L
Sbjct  234   NLFKTRIPWISKLWKPADILESEELSNEIQGCVMKMIKKREDRVVNGEADSFGNDFLGLL  293

Query  921   MKITTGGSDISKN-ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREI  1097
             +       D  KN +SL  ++DE K  Y AG  T  SLL W +FLLA+H +WQEKARRE+
Sbjct  294   VNAYHDLDD--KNMLSLGDLVDECKTFYLAGQDTVNSLLTWTVFLLAIHGDWQEKARREV  351

Query  1098  LELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFM  1277
             +++FG++NP  +GI +L+ M MI+NE  RLY P   + RK  REV++G L +PA+I +++
Sbjct  352   IDIFGNQNPNPEGIVKLKIMTMIINETSRLYGPANGLMRKTGREVQIGKLVLPANIDLYI  411

Query  1278  PILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAK  1457
               +   HDPQ+WG DVH+F P RFA+G+AKATN NAAAF PFG+GPR+CVG++F T E K
Sbjct  412   ANVVPQHDPQLWGDDVHLFKPERFAEGIAKATNYNAAAFCPFGIGPRSCVGMSFATTEIK  471

Query  1458  IALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             IALSMILQRY  +LSP YVH P  +  + P++G+QVIL+++
Sbjct  472   IALSMILQRYTISLSPAYVHSPISVITIQPQHGIQVILKSL  512



>gb|KHG26927.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score =   513 bits (1321),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 243/506 (48%), Positives = 344/506 (68%), Gaps = 28/506 (6%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             FL  S++++LL    + + + WW P ++++ +  QGI GPPY F HGN K  +  R +++
Sbjct  10    FLAGSLTLFLL----KFLHKYWWIPFKIQRALSLQGIKGPPYEFIHGNNKASTRFRYEAL  65

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              KPM  ++H+I  R+ P +H+W   YG  +LTW G +                       
Sbjct  66    SKPMASLTHNIVPRVIPQIHSWINTYGQNYLTWEGNRA----------------------  103

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             ++D      K++GE L+T+EG KWAK RKLANH FH ESLK M P +IASVE MLE+WK 
Sbjct  104   QLDDSSIIHKIVGEGLVTSEGAKWAKQRKLANHAFHGESLKNMNPAVIASVETMLEKWKG  163

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EG+E++VF +F +LT+EVISRTAFGS++LEGKHIF M++ L  +  +N +    PGIS 
Sbjct  164   REGEEIEVFNEFRLLTSEVISRTAFGSNYLEGKHIFDMLTKLAILFSRNYFKTPIPGISK  223

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISK  956
             + +++ EIE+EKL  GI   ++E+V++REK+   G  + +GND+LG L+      SD   
Sbjct  224   IWKTAVEIESEKLANGIHDCVMEMVKRREKKVETGEADGFGNDFLGLLIN-AYRDSDEKN  282

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
               S++ ++DE K  Y AG  TT SLL W I +LA+HT+WQEK R+E+ E+FG +NP S+G
Sbjct  283   RFSIEDLVDECKTFYFAGQETTNSLLAWTILVLAIHTKWQEKTRQEVSEVFGDQNPNSEG  342

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             IA+L+ MNM++NE +RLY PV  V R++++EV+LG L +PA++ I +PI+ALHHDPQ+WG
Sbjct  343   IAKLKIMNMVVNETLRLYSPVAAVIRQIKKEVRLGKLVLPANLEILIPIIALHHDPQLWG  402

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
              DVH+F P RF +G+A AT  N+AAF PF MGPR+CVG++F T E K+ALSMILQRY FT
Sbjct  403   DDVHLFKPERFVEGIASATKYNSAAFIPFSMGPRSCVGMSFATTETKVALSMILQRYAFT  462

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH P  +  L P++G+QV+L 
Sbjct  463   LSPTYVHAPFPVITLQPQHGIQVMLH  488



>gb|AJD25261.1| cytochrome P450 CYP749A39 [Salvia miltiorrhiza]
Length=511

 Score =   513 bits (1322),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 256/507 (50%), Positives = 348/507 (69%), Gaps = 3/507 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
              L   V ++LL     +  +  W P RL+++M SQGI GPPY F HGNT++I  M+ Q+ 
Sbjct  4     LLALCVFLFLLIIPSIIFYKLCWIPLRLQRLMESQGIRGPPYRFLHGNTREIIKMKQQTK  63

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
                  DISH IF  I PH ++W ++YGN FL W GT+P + +TEPEL+KE+L+NK+G + 
Sbjct  64    DAAAMDISHDIFPIILPHWYSWIKLYGNNFLYWIGTEPEIVVTEPELVKEILSNKQGTFR  123

Query  420   KMDLD-DFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK  596
             K+     + KKLLG+ LI  EGEKW K+RKLANH FH ESLK MVPE+ A VE MLE+W+
Sbjct  124   KIVAKRAYWKKLLGDGLIAAEGEKWLKLRKLANHAFHGESLKDMVPEITACVETMLEKWR  183

Query  597   ELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGIS  776
                GKE++V  +F  L++EVISRTAFGS+ LEG+ IF M+S L  +  +N+  ++  G+ 
Sbjct  184   NYHGKEIEVCSEFKHLSSEVISRTAFGSNCLEGRKIFDMLSKLIVLISRNMLKIRPFGLG  243

Query  777   MLTRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDIS  953
                R+ D+ EA+K+E+ +  +I+E+V KR+ E   G  +++GND+LG L+K +   +D  
Sbjct  244   KFIRTQDDKEADKIEQLLHDSIMEIVNKRQDEVQTGKADSFGNDFLGSLLK-SHHDTDPK  302

Query  954   KNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSD  1133
              +IS  ++IDE K  Y  G  TT SLL W  FLLA+HTEWQ++AR E+L+LFG +NP SD
Sbjct  303   SHISAAEIIDECKTFYFGGQETTFSLLSWTTFLLAIHTEWQDRAREEVLQLFGQQNPNSD  362

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             G++RL+T+NMIL E +RLY  V  + R+    +KLG   +PA+I + +P LALH +P+IW
Sbjct  363   GLSRLKTVNMILYETLRLYGAVTNIVRRTGSRMKLGKYELPANIRVSIPPLALHRNPEIW  422

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             GQD H+F P RFAQG+AKATN    AF  FG GPRTCVGLNF  +EAKI  SMILQRYKF
Sbjct  423   GQDAHLFKPERFAQGMAKATNGIPTAFLGFGFGPRTCVGLNFAISEAKITFSMILQRYKF  482

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQ  1574
             TLS +YVH P  +    P+ GV ++LQ
Sbjct  483   TLSSDYVHSPFILLTAQPQRGVGILLQ  509



>ref|XP_006437868.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
 gb|ESR51108.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
Length=477

 Score =   511 bits (1316),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 347/508 (68%), Gaps = 38/508 (7%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             +L+    +  L  L+R +++ WW P   +  MRSQGI GP Y F HGNTK+I NM ++ M
Sbjct  7     YLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIM  66

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
               PM +++H IF R+ PHV++W ++YG  FL W+G +P L + EP+LIKE+L +K+ A+P
Sbjct  67    SSPM-ELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAHP  125

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K +  +F KK LG+ L+T +GEKW K RKLANH FH E+LK M+P+MIASVE+MLERW++
Sbjct  126   KREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKSMIPDMIASVEMMLERWRD  185

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EGKE+D +K+F VLT+E+ISRTAFGSS+LEG++IF M++ L     KN Y V+ P I  
Sbjct  186   YEGKEIDAYKEFKVLTSEIISRTAFGSSYLEGENIFNMLTKLAFFISKNEYKVRIPLIGK  245

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISK  956
             L ++ D+ E++K+E+ I+ +++++V  REK    G V +YG+D LG LM           
Sbjct  246   LVKTRDDTESDKVEQDIRDSVIKIVENREKNVITGEVASYGDDLLGALMMAYHD------  299

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
                    +DE          TT S+L W + LLA H +WQ+KAR+E+ ELFG ++P +D 
Sbjct  300   -------VDE----------TTASVLSWTVLLLATHNDWQDKARKEVQELFGQQSPNADN  342

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             I+             RLYPP   + RKV++EVKLG   +P ++ I +P++A+HHDPQIWG
Sbjct  343   IS-------------RLYPPAFHILRKVQKEVKLGKFIVPGNLDITIPVIAVHHDPQIWG  389

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             +D H+F P RFA+GVAKATNNN AAF PFG+GPRTCVGLN+   EAKIALSMILQRYKFT
Sbjct  390   EDAHLFKPERFAEGVAKATNNNVAAFIPFGLGPRTCVGLNYAITEAKIALSMILQRYKFT  449

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQNV  1580
              SP YVH P  I  + P++G+QV++  +
Sbjct  450   PSPTYVHSPVAIITINPQHGLQVLVHRL  477



>gb|KCW86459.1| hypothetical protein EUGRSUZ_B03127 [Eucalyptus grandis]
Length=495

 Score =   512 bits (1318),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 252/497 (51%), Positives = 348/497 (70%), Gaps = 24/497 (5%)
 Frame = +3

Query  87    LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISH  266
             +L  L +L+ + WW P R+++VM  QGI GPPY F HG+TK+   M  ++   PM ++SH
Sbjct  17    VLCSLAKLLHKLWWNPLRIQRVMAQQGITGPPYRFLHGSTKETIKMNMEARNTPMSNLSH  76

Query  267   HIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAK  446
              IF +IQP ++TW   YG  +L+W G +  L ITEPEL+KEVL N++  YPK    DF+K
Sbjct  77    DIFPKIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNKDFSK  136

Query  447   KLLGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDV  623
             KLLG+ L  T  GEKWAK RKLAN  FH +SLK M P M+ASV  ML +WK  EGKE++V
Sbjct  137   KLLGDGLASTPGGEKWAKKRKLANRAFHGKSLKNMAPAMVASVHTMLGKWKNREGKEIEV  196

Query  624   FKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEI  803
             F +F VLT+EVISRTAFGSSF+EG++IF++                      L ++ DE+
Sbjct  197   FGEFKVLTSEVISRTAFGSSFVEGRNIFQI---------------------KLWKTVDEV  235

Query  804   EAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMI  980
             EAEKLE+GI+ +I +++++REK+   G V  +G+D+LGQL+K      D SK I+++ ++
Sbjct  236   EAEKLEKGIRNSIEQMIKRREKKVMAGEVNGFGDDFLGQLVK-ALHDVDKSKKITVNNLV  294

Query  981   DEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMN  1160
             DE K  Y AG  T  SL+ W +FLLA++ EWQE+AR E+L +FG+++P  DG+ +L+ +N
Sbjct  295   DECKTFYVAGQETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPDFDGLGKLKKIN  354

Query  1161  MILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNP  1340
             MI+NE +RLYPP++ + RKV ++ +LG L +PADI IF+PI  LH DP+IWG+DVH F P
Sbjct  355   MIINETLRLYPPLVGLNRKVGKKQRLGRLVLPADIQIFVPIPKLHSDPEIWGEDVHQFKP  414

Query  1341  HRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHY  1520
              RF++GVAKATNNNA  F PFG GPR+CVG++F   EAK+ALSMILQR+ F LSP Y+H 
Sbjct  415   ERFSEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRFTFELSPAYIHC  474

Query  1521  PADIFILTPKNGVQVIL  1571
             P   F+  P++G+Q+I 
Sbjct  475   PVYNFMNRPQHGLQIIF  491



>gb|KHG08051.1| Cytochrome P450 protein [Gossypium arboreum]
 gb|KHG14695.1| Cytochrome P450 protein [Gossypium arboreum]
Length=494

 Score =   511 bits (1317),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/488 (51%), Positives = 346/488 (71%), Gaps = 26/488 (5%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             R WW P R++ +M SQGI GPPY F HGN K+ + MR ++  KPM  ++H IF R+ PHV
Sbjct  29    RYWWIPYRIQLIMNSQGIRGPPYKFIHGNNKETAAMRREAFSKPM-ALTHAIFPRVMPHV  87

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
             ++W   YG ++L+W+G +P L IT+PE++KEVL N E A+PK    +F +K+LGE L+T 
Sbjct  88    YSWINKYGKSYLSWNGFRPQLVITDPEIVKEVLRNSEKAFPKGKPTNFFEKILGEGLVTT  147

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
             E EKWA+ RKLAN+ FH ESLK M+P ++ SVE MLE+WK  EGKE++VF++F +LT+EV
Sbjct  148   ESEKWARQRKLANYAFHGESLKNMIPAVVVSVETMLEKWKGREGKEMEVFQEFKLLTSEV  207

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAF SS+LEG+ IF+M++ L+ I  +NV+  + P IS   +SSDEIE++KL + I  
Sbjct  208   ISRTAFSSSYLEGEKIFEMLTKLSLIASRNVFKTRLPIISRFWKSSDEIESDKLAKMIHD  267

Query  837   AILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHL  1016
             +++++V KRE++ N                           +S+  ++DE K  Y AG  
Sbjct  268   SVMKIVEKREEKVNN-------------------------KLSIQDLVDECKTFYFAGQE  302

Query  1017  TTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPP  1196
             TT SLL   I LLA+HT+WQEKARRE++E+ G  NP S+GIA+L+T+ MI+NE +RLYPP
Sbjct  303   TTNSLLARRILLLAVHTDWQEKARREVIEIIGKGNPNSEGIAKLKTIPMIINETLRLYPP  362

Query  1197  VITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatn  1376
                  RKVEREV+LG L +P D+ + + I+ALHHDP +WG DVH+F P RFA+G++KATN
Sbjct  363   ATGTMRKVEREVRLGKLVLPTDLELNIRIMALHHDPDLWGDDVHLFKPERFAEGISKATN  422

Query  1377  nnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNG  1556
              NAAAFFPFG+GPR+CVG++F   E KIALSMILQRY FTLSP YVH P  +  L P++G
Sbjct  423   YNAAAFFPFGLGPRSCVGMSFAITETKIALSMILQRYTFTLSPAYVHSPLPLITLKPQHG  482

Query  1557  VQVILQNV  1580
             +Q++  ++
Sbjct  483   IQLLFHSL  490



>gb|KHG08441.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score =   511 bits (1315),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 242/506 (48%), Positives = 343/506 (68%), Gaps = 28/506 (6%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
             FL  S++++LL    + + + WW P ++++ +  QGI GPPY F HGN K  +  R +++
Sbjct  10    FLAGSLTLFLL----KFLHKYWWIPFKIQRALSLQGIKGPPYEFIHGNNKASTRFRYEAL  65

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              KPM  ++H+I  R+ P +H+W   YG  +LTW G +                       
Sbjct  66    SKPMASLTHNIVPRVIPQIHSWINTYGQNYLTWEGNRA----------------------  103

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             ++D      K++GE L+T+EG KWAK RKLANH FH ESLK M P +IASVE MLE+WK 
Sbjct  104   QLDDSSIIHKIVGEGLVTSEGAKWAKQRKLANHAFHGESLKNMNPAVIASVETMLEKWKG  163

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EG+E++VF +F +LT+EVISRTAFGS++LEGK IF M++ L  +  +N +    PGIS 
Sbjct  164   REGEEIEVFNEFRLLTSEVISRTAFGSNYLEGKKIFDMLTKLAILVSRNYFKTPIPGISK  223

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISK  956
             + +++ EIE+EKL  GI   ++E+V++REK+   G  + +GND+LG L+      SD   
Sbjct  224   IWKTAVEIESEKLANGIHDCVMEMVKRREKKVETGEADGFGNDFLGLLIN-AYRDSDEKN  282

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
               S++ ++DE K  Y AG  TT SLL W I +LA+HT+WQEK R+E+ E+FG +NP S+G
Sbjct  283   RFSIEDLVDECKTFYFAGQETTNSLLAWTILVLAIHTKWQEKTRQEVSEVFGDQNPNSEG  342

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             IA+L+ MNM++NE +RLY PV  V R++++EV+LG L +PA++ I +PI+ALHHDPQ+WG
Sbjct  343   IAKLKIMNMVVNETLRLYSPVAAVIRQIKKEVRLGKLVLPANLEILIPIIALHHDPQLWG  402

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
              DVH+F P RF +G+A AT  N+AAF PF MGPR+CVG++F T E K+ALSMILQRY FT
Sbjct  403   DDVHLFKPERFVEGIASATKYNSAAFIPFSMGPRSCVGMSFATTETKVALSMILQRYAFT  462

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQ  1574
             LSP YVH P  +  L P++G+QV+L 
Sbjct  463   LSPTYVHAPFPVITLQPQHGIQVMLH  488



>ref|XP_011070904.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score =   511 bits (1317),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 256/488 (52%), Positives = 347/488 (71%), Gaps = 3/488 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ-SMGKPMFDISHHIFARIQPH  293
             + WW P   + +M SQGI GP Y+F H NTK+I  +++Q S   P+    H IF R QP+
Sbjct  23    KLWWAPLHFQSIMESQGIKGPCYNFFHNNTKEIIKIKNQTSYNSPIDLPDHDIFPRFQPY  82

Query  294   VHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALIT  473
              ++  ++YGN FL W+GT+P + +TEPELIKE+L N+ GAYPK   + + KKLLG+ +  
Sbjct  83    WYSCMKLYGNNFLVWNGTQPQVVVTEPELIKEILVNRNGAYPKTKREGYLKKLLGDGITV  142

Query  474   NEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTE  653
              EGEKW K+RKLANH FH E LK MVP M+ASV+ MLE+W+  EGKE++V  DF +L++E
Sbjct  143   AEGEKWLKLRKLANHAFHGECLKDMVPAMVASVQTMLEKWRHYEGKEIEVCGDFRILSSE  202

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VISRTAFGSS++EG  IF M+  L+A+  +N   + F G+    R+  + EA+K+E+ + 
Sbjct  203   VISRTAFGSSYVEGIKIFNMLGKLSALISENANKMNFLGLVKFVRTKADSEADKIEQLLH  262

Query  834   GAILELVRKREKESNGV-VENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAG  1010
              +I+E+VRKR+ E   V  +++G+D+LG L+K    GS+  K IS  ++IDE K  Y AG
Sbjct  263   ESIMEIVRKRQDEVITVRADSFGSDFLGSLLKARHEGSE-KKQISAAEIIDECKTFYFAG  321

Query  1011  HLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLY  1190
              LTT SLL W + LLA+H +WQEKAR E+ +LFG ENP S+GIARL+T+N+I++E +RLY
Sbjct  322   QLTTHSLLSWSVLLLAIHPDWQEKARNEVFQLFGRENPNSEGIARLKTVNLIIHETLRLY  381

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
              PV  +TR+ + +VKLG    PA++ + +P LALH DP IWGQD H+F P RFA+G+AKA
Sbjct  382   SPVTLITRRTQGQVKLGKFKFPANVELAIPPLALHRDPDIWGQDAHLFKPERFAEGLAKA  441

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
             T  N  AF  FG GPR C GLNF ++EAKIALSMILQRYKFTLSPNYVH P     + P+
Sbjct  442   TKGNPMAFLAFGFGPRICPGLNFASHEAKIALSMILQRYKFTLSPNYVHSPFIALTVQPQ  501

Query  1551  NGVQVILQ  1574
             +GVQ++LQ
Sbjct  502   HGVQILLQ  509



>gb|KHG27490.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   509 bits (1311),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 255/521 (49%), Positives = 358/521 (69%), Gaps = 11/521 (2%)
 Frame = +3

Query  24    MSGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGN  203
             MSG +  +I      F V+      LV+ +    W P R+++++ SQGI GPPY F HGN
Sbjct  1     MSGLMKLVILVPCSLFFVA------LVKFLYDYLWRPLRIQQMLNSQGIRGPPYRFIHGN  54

Query  204   TKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELI  383
              K+++ MR +++ KPM  + H IF R+QPH++TW   YG  +L+W G +  L I+EPELI
Sbjct  55    NKEVAKMRQEALSKPM-ALGHDIFPRMQPHIYTWINKYGKNYLSWDGVRAELVISEPELI  113

Query  384   KEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMI  563
             KEVL N E A+PK     F  KL+   L + EGEKW K RKL NH FH ESLK M P +I
Sbjct  114   KEVLNNSEKAFPKRKPTVFISKLVANGLFSVEGEKWVKQRKLGNHAFHGESLKNMTPAVI  173

Query  564   ASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVK  743
             ASVE MLE+WK   GKE+++F++F +LT+EVISRTAFGSS+LEG+ IF M+S L  I  +
Sbjct  174   ASVETMLEKWKGYVGKEIELFEEFRLLTSEVISRTAFGSSYLEGQKIFDMLSKLAIIMHR  233

Query  744   NVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQL  920
             N++  + P IS L + +D +E+E+L   I+G ++++++KRE +  NG  +++ ND+LG L
Sbjct  234   NLFKTRIPWISKLWKPADILESEELSNEIQGCVMKMIKKREDRVVNGEADSFDNDFLGLL  293

Query  921   MKITTGGSDISKN-ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREI  1097
             +       D  KN +SL  ++DE K  Y AG  T  SLL W +FLLA+H +WQEKARRE+
Sbjct  294   VNAYHDLDD--KNMLSLGDLVDECKTFYLAGQDTVNSLLTWTVFLLAIHGDWQEKARREV  351

Query  1098  LELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFM  1277
             +++FG++NP  + I +L+ M MI+NE  RLY P   + RK  REV++G L +PA+I +++
Sbjct  352   IDIFGNQNPHPESIVKLKIMTMIINETSRLYGPANGLMRKTGREVQIGKLVLPANIDLYI  411

Query  1278  PILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAK  1457
               +   HDPQ+WG DVH+F P RFA+G+AKATN NAAAF PFG+GPR+CVG++F T E K
Sbjct  412   ANVVPQHDPQLWGDDVHLFKPERFAEGIAKATNYNAAAFCPFGIGPRSCVGMSFATTEIK  471

Query  1458  IALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             IALSMILQRY  +LSP YVH P  +  + P++G+QVIL+++
Sbjct  472   IALSMILQRYTISLSPAYVHSPISVITIQPQHGIQVILKSL  512



>gb|KHG07569.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score =   509 bits (1311),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 255/521 (49%), Positives = 358/521 (69%), Gaps = 11/521 (2%)
 Frame = +3

Query  24    MSGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGN  203
             MSG +  +I      F V+      LV+ +    W P R+++++ SQGI GPPY F HGN
Sbjct  1     MSGLMKLVILVPCSLFFVA------LVKFLYDYLWRPLRIQQMLNSQGIRGPPYRFIHGN  54

Query  204   TKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELI  383
              K+++ MR +++ KPM  + H IF R+QPH++TW   YG  +L+W G +  L I+EPELI
Sbjct  55    NKEVAKMRQEALSKPM-ALGHDIFPRMQPHIYTWINKYGKNYLSWDGVRAELVISEPELI  113

Query  384   KEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMI  563
             KEVL N E A+PK     F  KL+   L + EGEKW K RKL NH FH ESLK M P +I
Sbjct  114   KEVLNNSEKAFPKRKPTVFISKLVANGLFSVEGEKWVKQRKLGNHAFHGESLKNMTPAVI  173

Query  564   ASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVK  743
             ASVE MLE+WK   GKE+++F++F +LT+EVISRTAFGSS+LEG+ IF M+S L  I  +
Sbjct  174   ASVETMLEKWKGYVGKEIELFEEFRLLTSEVISRTAFGSSYLEGQKIFDMLSKLAIIMHR  233

Query  744   NVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQL  920
             N++  + P IS L + +D +E+E+L   I+G ++++++KRE +  NG  +++GND+LG L
Sbjct  234   NLFKTRIPWISKLWKPADILESEELSNEIQGCVMKMIKKREDRVVNGEADSFGNDFLGLL  293

Query  921   MKITTGGSDISKN-ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREI  1097
             +       D  KN +SL  ++DE K  Y AG  T  SLL W +FLLA+H +WQEKARRE+
Sbjct  294   VNAYHDLDD--KNMLSLGDLVDECKTFYLAGQDTANSLLAWTVFLLAIHGDWQEKARREV  351

Query  1098  LELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFM  1277
             +++FG++NP  +GI +L+ M MI+NE +RLY P   + RKV REV++G L + A+I +F+
Sbjct  352   IDIFGNQNPNPEGIVKLKIMTMIINETLRLYSPANGLMRKVGREVQIGKLVLHANIDLFI  411

Query  1278  PILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAK  1457
               +   HDPQ+WG DVH+F   RFA+G+AKATN NAAAF PFG+GPR+CVG++F   E K
Sbjct  412   ASVVPQHDPQLWGDDVHLFKSERFAEGIAKATNYNAAAFCPFGIGPRSCVGMSFAAIEIK  471

Query  1458  IALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             IALSM LQRY  +LSP YVH P  +  + P++G+QVIL+++
Sbjct  472   IALSMTLQRYMISLSPAYVHSPISVITVQPQHGIQVILKSL  512



>ref|XP_002316009.1| hypothetical protein POPTR_0010s14940g [Populus trichocarpa]
 gb|EEF02180.1| hypothetical protein POPTR_0010s14940g [Populus trichocarpa]
Length=555

 Score =   509 bits (1310),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 249/548 (45%), Positives = 361/548 (66%), Gaps = 40/548 (7%)
 Frame = +3

Query  51    TAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRS  230
             T  FL+    +YLL   +   ++ WWTP R++  + SQG+ GP Y F HGN K+I N+R 
Sbjct  10    TIIFLSSCGCLYLLLLFINFFNKVWWTPIRIQSALHSQGVKGPSYRFLHGNLKEIINLRK  69

Query  231   QSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEG  410
             ++M  P  ++ H  F+RIQPHV+ W +++G  F  W G++  L + E E IK VL NK+G
Sbjct  70    EAMSSPT-ELCHQSFSRIQPHVYLWSKLHGKNFFWWKGSQAQLVVYETEQIKVVLNNKDG  128

Query  411   AYPKMDLDDFAKKLLGEALIT----NEGEKWAKVRKLANHTFHAES--------------  536
              Y K ++  + KKL G+ L+T    +E       R       H +               
Sbjct  129   NYLKPEVQPYLKKLFGDGLVTTRVASECPSNIFTRLYIKMYIHMDEERFAPSGLMFEPCG  188

Query  537   --------------------LKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
                                 ++ M+PEM++SVE+ML RWK+  GKE++VF+DF VLT+E+
Sbjct  189   CSYDDHWRLTWSLTSGSVGLVEDMIPEMVSSVEMMLGRWKDHRGKEIEVFQDFKVLTSEI  248

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS+LEG+ IF++++ +  I  KN++ ++ PGI  L ++ D+I++EKL + I+ 
Sbjct  249   ISRTAFGSSYLEGQQIFEILTRMVLIFSKNLFKMRIPGIGKLVKTQDDIQSEKLGQLIRN  308

Query  837   AILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHL  1016
             +++++++KRE    G ++ YG+D+LGQL+K+    +D++  I++D +IDE K  Y AGH 
Sbjct  309   SVIKMIKKREAAMAGEIDGYGSDFLGQLVKVYRS-ADMTSRITIDDLIDECKNFYIAGHE  367

Query  1017  TTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPP  1196
             TTTS L W + +LA H +WQEK R EILELFG +NP+ +GI+RL+TM+M++NE +RLYPP
Sbjct  368   TTTSALTWIVLMLATHADWQEKVRNEILELFGQQNPSLEGISRLKTMSMVINESLRLYPP  427

Query  1197  VITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatn  1376
             V+ + R+V++  KLGNL IP  + + +P LALHHDPQIWG DVH+F P RFA+GVAKAT 
Sbjct  428   VVGLLREVKKGTKLGNLIIPEKMEVHVPSLALHHDPQIWGDDVHLFKPDRFAEGVAKATK  487

Query  1377  nnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNG  1556
             NN +AF PFGMGPR CVG+NF  NE KI LSMILQRY+ TLSPNYVH P  +  + P++G
Sbjct  488   NNISAFLPFGMGPRNCVGMNFAYNEIKITLSMILQRYRITLSPNYVHSPVLVLAICPQHG  547

Query  1557  VQVILQNV  1580
             +QV ++ V
Sbjct  548   LQVTIKAV  555



>gb|KHG21314.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score =   506 bits (1304),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 350/507 (69%), Gaps = 5/507 (1%)
 Frame = +3

Query  78    SIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFD  257
               + L  L + +    W P R++ +M SQGI GPPY F HGN K+++ MR +++ K +  
Sbjct  16    CCFFLVALTKFLYDYLWVPLRIQHMMNSQGIKGPPYRFIHGNNKEVTKMRKEALNKAV-G  74

Query  258   ISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD  437
             ++  +F R+QPH+++W   YG  F+ W+G +  + I+EPELIKE++ N E  + K  L D
Sbjct  75    LTDDLFPRLQPHIYSWINTYGKNFVYWNGVQAEVVISEPELIKEIMTNSEKIFQKRKLTD  134

Query  438   FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKEL  617
                KLLG  L+  EGEKWAK RKLANH FH ESLK M P MI SVE MLERWK  EGKE+
Sbjct  135   VGAKLLGNGLVFIEGEKWAKHRKLANHAFHGESLKNMTPAMIVSVETMLERWKGQEGKEI  194

Query  618   DVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSD  797
             +V+ +F +LT+EVISRTAFGS++LEG+ IF M++ LT +  +N+   K P I+ L +S++
Sbjct  195   EVYNEFRLLTSEVISRTAFGSNYLEGERIFAMLNKLTILVSQNISKTKIPFINKLWKSAE  254

Query  798   EIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQ  974
              +E+EKLE+GI+  ++E+++KRE K  +G  +++GND+LG L+       D ++ ++L  
Sbjct  255   MLESEKLEKGIQDCVMEMIKKREDKVVSGEADSFGNDFLGLLVNAYHDLDDKNR-VALKD  313

Query  975   MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRT  1154
             ++ E K +Y AG  T  SLL W +  LA+H +WQEKARRE++++FG++NP  +GIA+L+ 
Sbjct  314   LVGECKTIYFAGQETVNSLLAWIVLHLAIHGDWQEKARREVIDIFGNQNPHLEGIAKLKI  373

Query  1155  MNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVF  1334
             M MI+NE +RLY P   + R V REV+LG L +PA+I I    + LH DP +WG DVH F
Sbjct  374   MTMIINETLRLYGPSNGLPRTVAREVQLGKLVLPANIDILSLNIGLHRDPHLWGDDVHHF  433

Query  1335  NPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYV  1514
              P RFA+G+AKATN  AAAFFPFG+GPR+CVG+   T E KIALSMILQRY  T+SP YV
Sbjct  434   KPERFAEGIAKATNYTAAAFFPFGLGPRSCVGMTLATIETKIALSMILQRYTITISPTYV  493

Query  1515  HYPADIFILTPKNGVQVILQNV*LLSC  1595
             H P  I  + P++G+Q+IL+   L SC
Sbjct  494   HSPMPILTIRPRHGIQIILEP--LHSC  518



>gb|KHG09815.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   505 bits (1300),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/508 (49%), Positives = 345/508 (68%), Gaps = 3/508 (1%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
              L  +   +    L++L+    W P R++ ++ SQGI GPPY F HGN K+++ M+ +++
Sbjct  7     LLILAPCCFFFIALIKLLYDYLWIPLRIQHMLNSQGIKGPPYRFIHGNNKEVTKMKQKAL  66

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              K +  ++  +F ++QPH++TW   YG  F+ W+G +  L I+EPEL+KEVL N E  + 
Sbjct  67    SKSV-GLTDDLFPKVQPHIYTWTNRYGKNFVYWNGARAELVISEPELVKEVLRNSEQIFQ  125

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K  L D  +K LG  LI  EGEKWAK RKLANHTFH ESLK M P +IASVE MLE+W  
Sbjct  126   KKKLTDIGRKFLGNGLIFIEGEKWAKHRKLANHTFHGESLKNMTPAIIASVETMLEKWNA  185

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EGKE++V+++F +LT+EVISRTAFGS+++EG+ IF M+S L  I  +N    + P IS 
Sbjct  186   QEGKEIEVYQEFRLLTSEVISRTAFGSNYMEGEKIFAMLSKLAVIMSRNFSKTRIPLISK  245

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISK  956
             L +S+D +E+EKL + IK  +L++V+KRE K  NG V ++ +D+LG L+      SD   
Sbjct  246   LWKSADLLESEKLSKEIKDRVLKIVKKREDKVVNGEVNSFRSDFLGLLLN-AYHDSDEKN  304

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              +SL+ ++ E K  Y AG  T  SLL W +  LA+H +WQEKARRE++++FG++NP  +G
Sbjct  305   RLSLEDLVAECKTFYFAGQETVNSLLAWIVLHLAIHGDWQEKARREVIDIFGNQNPHLEG  364

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             IA+L+ M MI+NE +RLY P   + R V RE++LG L +PA+I I    + LH DP IWG
Sbjct  365   IAKLKIMTMIINETLRLYGPTTVLQRTVIREIQLGKLLLPANIDILPLNIGLHRDPHIWG  424

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
              DVH F P RFA+G+AKATN   AAFFPFG+GPR+CVG+ F T E K+ALSMILQRY   
Sbjct  425   DDVHHFKPERFAKGIAKATNYTTAAFFPFGLGPRSCVGMTFATIETKVALSMILQRYTIA  484

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSP YVH P  I  L P++G+QV L+ +
Sbjct  485   LSPAYVHSPIPILTLRPQHGIQVTLKPI  512



>ref|XP_004170856.1| PREDICTED: cytochrome P450 734A1-like [Cucumis sativus]
Length=521

 Score =   505 bits (1300),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 234/495 (47%), Positives = 340/495 (69%), Gaps = 5/495 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             + +L+ R WW P +++++MR+QG+ GP Y+F HGNTK++ + R ++M KPM  +SH I  
Sbjct  23    IFKLLGRLWWNPMKIQRLMRAQGVQGPSYNFIHGNTKEMYSKRIKAMAKPM-QLSHRILP  81

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
             R+ PH+ +W   YG  ++ W G + +L ITEPELIKEVL N+  ++PK  L     K+ G
Sbjct  82    RVLPHILSWLNQYGRNYVQWFGAEAHLVITEPELIKEVLNNQHKSFPKAKLQGHIHKIFG  141

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
               L T EG+KW   RKLA+  FH ++LK M+P M+   E M+E W   E KE+DVFK F 
Sbjct  142   NGLATAEGQKWVNSRKLAHFAFHGDNLKNMIPSMVQCAETMVEEWAHHEDKEIDVFKHFK  201

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             V T +VIS TAFGSS+ +G+++F+M+  L  +++ N Y V+ P IS + +S D+IE + L
Sbjct  202   VYTLDVISHTAFGSSYEQGRNVFQMLQRLCELSITNRYKVRLPVISKILKSKDDIEGQSL  261

Query  819   ERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+ +K   +E+++ RE++ +N    +YGND+LG L+K      D S+ ISL+ ++DE K 
Sbjct  262   EKKMKDCFVEIIKAREEKLNNDEANDYGNDFLGLLVKAKNDPQD-SQRISLEDVVDECKT  320

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AGH TT  LL W +FLLALH EWQEKAR E+ ++FGH NPT + + +L+TM MI++E
Sbjct  321   FYFAGHETTNVLLAWTMFLLALHKEWQEKARNEVFDVFGHSNPTFEALPKLKTMGMIIHE  380

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPP +T+ RKVE+E +LG L +P  + + +P  A+HHD ++WG+ V  F P RF++
Sbjct  381   SLRLYPPAMTLLRKVEKETRLGRLVLPRGVQVVIPTAAIHHDEELWGRSVDDFKPERFSE  440

Query  1356  GVakatnnn--aaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPAD  1529
             G+AKAT  N     + PFG+GPR+CVG+NF  NEAKIA+SMILQR+ FTLSP Y H PA 
Sbjct  441   GIAKATERNPGGGTYLPFGLGPRSCVGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAM  500

Query  1530  IFILTPKNGVQVILQ  1574
             +  + P++G+Q+IL 
Sbjct  501   LLTIAPQHGLQLILH  515



>gb|KCW76384.1| hypothetical protein EUGRSUZ_D00766 [Eucalyptus grandis]
Length=490

 Score =   504 bits (1297),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 241/489 (49%), Positives = 347/489 (71%), Gaps = 3/489 (1%)
 Frame = +3

Query  108   LVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQ  287
             ++ + WW P ++++ M SQGI GP Y F +G+TK++  M+ ++  +PM  +SH IF  +Q
Sbjct  1     MLHKFWWRPIQIQRKMASQGIKGPAYRFFYGSTKEMLQMKREATSRPM-SLSHDIFPYVQ  59

Query  288   PHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEAL  467
             PH H W + YG  FL WHG + +L I++ +++K+VL + +  + K+ L D  KK++GE L
Sbjct  60    PHFHKWTQTYGKNFLVWHGPQAFLVISDLDMVKKVLNDNDHTFSKIFLQDQVKKIVGEGL  119

Query  468   ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLT  647
             +T+EGE+WAK RKLAN  FH ESLK MVP M+    +M++RW + E  E++V+++F + T
Sbjct  120   VTSEGEQWAKHRKLANFAFHGESLKSMVPAMVDCAHMMIQRWSDRECLEINVYEEFKLCT  179

Query  648   TEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERG  827
             ++ IS+TAFGSS +EGK +F+    L     K    ++ PGIS L + + EIEAEKLE+G
Sbjct  180   SDAISKTAFGSSQVEGKTVFENGVKLGLTMAKASSQIRLPGISKLWKPTYEIEAEKLEKG  239

Query  828   IKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYG  1004
             ++ A+L+++++R+++ N G +E+YGND+LG L+K      D +K I+ D +I E K  Y 
Sbjct  240   LREAVLKIIKRRQRKINSGEMESYGNDFLGLLLK-AMHDVDENKKITFDNVIAECKTFYF  298

Query  1005  AGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMR  1184
             AG+ T +SLL W +FLLA+HT+WQ++AR+E+L + G  +P  +GI +L+ M MI+NE +R
Sbjct  299   AGYETLSSLLAWTVFLLAVHTDWQQEARKEVLNVLGDRDPDFNGITKLKKMGMIMNESLR  358

Query  1185  LYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVa  1364
             LYPP + V RKV R+ KLG+L +PADI + +PIL +HHDPQIWG D H+F P RF++GVA
Sbjct  359   LYPPGVGVPRKVTRQAKLGDLILPADIMVHIPILKIHHDPQIWGDDAHLFKPERFSEGVA  418

Query  1365  katnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILT  1544
             KATNNN A F PFG+GPR CVGLNF T EAKI L+MILQRY FTLSP YVH P ++    
Sbjct  419   KATNNNPAMFLPFGLGPRNCVGLNFATVEAKIVLAMILQRYSFTLSPAYVHSPVELHNSR  478

Query  1545  PKNGVQVIL  1571
             P+ GVQVI 
Sbjct  479   PQYGVQVIF  487



>gb|KDP35171.1| hypothetical protein JCGZ_10705 [Jatropha curcas]
Length=478

 Score =   502 bits (1293),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 239/480 (50%), Positives = 348/480 (73%), Gaps = 5/480 (1%)
 Frame = +3

Query  150   VMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTF  329
             +MRSQGI GP Y   +GN K+I +M  ++    M ++SH +F  + PH  +W  +YG  F
Sbjct  1     MMRSQGIKGPSYKLFYGNIKEIIHMTKRASSNSM-ELSHQVFPTVLPHFQSWMNLYGKNF  59

Query  330   LTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD-FAKKLLGEAL-ITNEGEKWAKVR  503
             L W G + +L  +EPELIKE+  NK+GA+ K   D+ + +KLLG+ L +T   EKW K+R
Sbjct  60    LWWEGPRAHLVFSEPELIKEIFNNKDGAFYKPQPDNGYLQKLLGDGLAMTRVSEKWLKLR  119

Query  504   KLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSS  683
             KL+NH FHAESLK M+  M+ SVE+MLERW   EG E+DVFK+F VL +E+I R+AFGSS
Sbjct  120   KLSNHAFHAESLKSMISAMVTSVEMMLERWGHHEGNEIDVFKEFLVLGSEIICRSAFGSS  179

Query  684   FLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR  863
             + EG+  F  +  L  I  +N Y +K PGI  L ++ D++E++ ++ GI+ +I+ +++KR
Sbjct  180   YSEGQRTFDKIIQLILIIDRNKYRIKIPGIRYLMKTRDDVESDNIQNGIRNSIMNMIKKR  239

Query  864   EKESNGVVEN-YGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGW  1040
             E+ +     N YG+D+LG L+K     SD++K ++++++IDE K+ Y AG  TT +LL W
Sbjct  240   EEAAMFSQSNDYGSDFLGLLLK-AHHDSDMTKRLAVEEIIDECKSFYHAGQGTTATLLSW  298

Query  1041  CIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKV  1220
              +FLLA+HT+WQ KAR+E++ELFG +NP+ D ++R++ ++MI+NE +RLY PV+T+ R+V
Sbjct  299   IVFLLAVHTDWQAKARKEVIELFGQKNPSPDSLSRMKIVSMIINEALRLYSPVVTLPREV  358

Query  1221  EREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFP  1400
              R+V+LGNL +PA+I I +P++ALHHDP+IWG+DV++F P RFA+G+AKATNNN  A+ P
Sbjct  359   RRQVRLGNLFLPANIIIEIPVIALHHDPEIWGEDVYLFKPERFAEGLAKATNNNVNAYLP  418

Query  1401  FGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             F +GPR+CVG NF   E KIALSMILQRY+FTLSP YVH P  I  + P++G+Q++L  V
Sbjct  419   FSLGPRSCVGYNFANTETKIALSMILQRYRFTLSPTYVHSPVQILAMCPQHGMQIVLHPV  478



>ref|XP_004135429.1| PREDICTED: cytochrome P450 734A1-like [Cucumis sativus]
Length=521

 Score =   503 bits (1294),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 233/495 (47%), Positives = 339/495 (68%), Gaps = 5/495 (1%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             + +L+ R WW P +++++MR+QG+ GP Y+F HGNTK++ + R ++M KPM  +SH I  
Sbjct  23    IFKLLGRLWWNPMKIQRLMRAQGVQGPSYNFIHGNTKEMYSKRIKAMAKPM-QLSHRILP  81

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
             R+ PH+ +W   YG  ++ W G + +L ITEPELIKEVL N+  ++PK  L     K+ G
Sbjct  82    RVLPHILSWLNQYGRNYVQWFGAEAHLVITEPELIKEVLNNQHKSFPKAKLQGHIHKIFG  141

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
               L T EG+KW   RKLA+  FH ++LK M+P M+   E M+E W   E KE+DVFK F 
Sbjct  142   NGLATAEGQKWVNSRKLAHFAFHGDNLKNMIPSMVQCAETMVEEWAHHEDKEIDVFKHFK  201

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             V T +VIS TAFGSS+ +G+++F+M+  L  +++ N Y V+ P IS + +S D+IE + L
Sbjct  202   VYTLDVISHTAFGSSYEQGRNVFQMLQRLCELSITNRYKVRLPVISKILKSKDDIEGQSL  261

Query  819   ERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+ +K   +E+++ RE++ +N    +YGND+LG L+K      D S+ ISL+ ++DE K 
Sbjct  262   EKKMKDCFVEIIKAREEKLNNDEANDYGNDFLGLLVKAKNDPQD-SQRISLEDVVDECKT  320

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AGH TT  LL W + LLALH EWQEKAR E+ ++FGH NPT + + +L+TM MI++E
Sbjct  321   FYFAGHETTNVLLAWTMLLLALHKEWQEKARNEVFDVFGHSNPTFEALPKLKTMGMIIHE  380

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPP +T+ RKVE+E +LG L +P  + + +P  A+HHD ++WG+ V  F P RF++
Sbjct  381   SLRLYPPAMTLLRKVEKETRLGRLVLPRGVQVVIPTAAIHHDEELWGRSVDDFKPERFSE  440

Query  1356  GVakatnnn--aaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPAD  1529
             G+AKAT  N     + PFG+GPR+CVG+NF  NEAKIA+SMILQR+ FTLSP Y H PA 
Sbjct  441   GIAKATERNPGGGTYLPFGLGPRSCVGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAM  500

Query  1530  IFILTPKNGVQVILQ  1574
             +  + P++G+Q+IL 
Sbjct  501   LLTIAPQHGLQLILH  515



>gb|KHG26170.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score =   502 bits (1292),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 250/514 (49%), Positives = 350/514 (68%), Gaps = 4/514 (1%)
 Frame = +3

Query  42    SIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN  221
             S +  F +    S +LL  L++ +    W P R++ ++ SQGI GP Y F HGN  + + 
Sbjct  2     SGLMKFVILVPCSFFLL-ALIKFLYDYLWIPLRIQHMLNSQGIKGPRYKFIHGNNDEATQ  60

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             M  +++ KPM  ++H IF R+QPH+++    YG  FL W G +P L I+EPELIKEVL N
Sbjct  61    MTKEALSKPM-ALTHDIFPRVQPHIYSCINRYGRNFLYWDGVRPELVISEPELIKEVLKN  119

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
              E  +PK     F  KLLG+ L+T EGEKW K RKLAN+ FH ESLK M P +IASVE M
Sbjct  120   SEKTFPKRKPTIFINKLLGDGLVTVEGEKWVKQRKLANNVFHGESLKDMRPAIIASVETM  179

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L++WK   GKE++VF +F +LT+EVISRTAFGSS+LEG+ IF+M++ L+ +  +N+ N +
Sbjct  180   LKKWKGQVGKEIEVFHEFKLLTSEVISRTAFGSSYLEGEKIFEMLNKLSIVLSRNLSNTR  239

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTG  938
              P    L + +D +EAE+L +GI+  + ++V+ RE K   G  +N+G D+LG L+     
Sbjct  240   IPLFVKLQKPADMLEAEELAKGIQDCVSKIVKTREDKVVKGEADNFGIDFLGLLIN-AYH  298

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D +  +SL+ +++E K  Y AG  T  SLL W + LLA   +WQEKARRE++E+FG++
Sbjct  299   DTDENNKLSLEDLVNECKTFYFAGQDTVNSLLAWMVLLLASQGDWQEKARREVIEIFGNQ  358

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P S+G+++L+ M MI+NE +RLY P + + RK   EV+LGNL +PADI I +   ALHH
Sbjct  359   YPNSEGLSKLKIMTMIINESLRLYGPAVGLLRKGGTEVRLGNLVLPADIDILIANAALHH  418

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQ+WG +VH+F P RFA+G+AKATN N  AF PFG+GPRTCVG  F   E KIA+SMIL
Sbjct  419   DPQLWGDNVHLFKPERFAEGIAKATNYNTTAFCPFGLGPRTCVGTTFAIMEVKIAVSMIL  478

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY  +LSP YVH P  I  + P++G+QVIL+++
Sbjct  479   QRYTISLSPAYVHAPVSIITVKPQHGIQVILESL  512



>ref|XP_002512042.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50711.1| cytochrome P450, putative [Ricinus communis]
Length=452

 Score =   498 bits (1283),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 324/441 (73%), Gaps = 2/441 (0%)
 Frame = +3

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
             ++SH +  R+QPH++ W  ++G  +++W G +P L +TEP L+KEVL+N++  YPK + +
Sbjct  11    ELSHQLLPRVQPHIYFWINLHGKNYVSWLGPRPQLVLTEPNLVKEVLSNRDETYPKPEFE  70

Query  435   DFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKE  614
              + K+L G  L+   GEKW + RKLANH FH E+LK MVP MIASVE+MLERW++ E KE
Sbjct  71    SYVKQLFGNGLVAITGEKWNRQRKLANHAFHGENLKGMVPAMIASVEMMLERWRQNEEKE  130

Query  615   LDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSS  794
             ++V+++F +LT+E+ISRTAFGSS+LEG+HIF M+  L  I  KN Y V+   I  L +  
Sbjct  131   IEVYQEFKLLTSEIISRTAFGSSYLEGQHIFDMLGKLARILNKNSYQVRIRAIEKLWKRK  190

Query  795   DEIEAEKLERGIKGAILELVRKREK-ESNGVVENYGNDYLGQLMKITTGGSDISKNISLD  971
             D+ E+EKLE+GI+ ++L+++ KRE+ E  G V++ G+D+LG L+K     +D SK IS+D
Sbjct  191   DDTESEKLEQGIRDSVLKMINKREEDEKTGEVDSCGSDFLGVLLK-AYQETDESKKISVD  249

Query  972   QMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLR  1151
              +IDE K  Y AGH TT+S L WCIFLLA+HT+WQEKAR+E+LE FG   PTSD I RL+
Sbjct  250   DLIDECKTFYIAGHETTSSALTWCIFLLAIHTDWQEKARQEVLESFGQRIPTSDEITRLK  309

Query  1152  TMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHV  1331
              MNMI+NE +RLY P+  + R+V++  +LG L  P+ I I +P LALH DP+IWG+D ++
Sbjct  310   IMNMIVNETLRLYAPITNLIREVQKGSRLGKLVAPSRIDIIVPPLALHQDPEIWGEDAYL  369

Query  1332  FNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNY  1511
             F P RFA+G+AKAT NN AAF PFG+GPR CVG+NF   E KI+LSMILQRY+FTLSP Y
Sbjct  370   FKPERFAEGIAKATKNNIAAFLPFGLGPRNCVGMNFAMAETKISLSMILQRYRFTLSPTY  429

Query  1512  VHYPADIFILTPKNGVQVILQ  1574
             VH P  +  + P+ G+Q+ LQ
Sbjct  430   VHSPTFLIAVCPQKGLQINLQ  450



>gb|KHG14401.1| Cytochrome P450 protein [Gossypium arboreum]
Length=682

 Score =   504 bits (1298),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 249/514 (48%), Positives = 354/514 (69%), Gaps = 3/514 (1%)
 Frame = +3

Query  42    SIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN  221
             S +T   + F    ++L  LV+L+    W P RL+++M SQGI GPPY+F HGN K+ + 
Sbjct  167   SALTKLAILFPCC-FILIALVKLLYDYLWRPLRLQRMMSSQGIKGPPYTFIHGNNKEATK  225

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             M  +++ KPM  + H IF R+QPHV++    YG  +L W G +P L ITE EL+ EVL +
Sbjct  226   MTMEALSKPMGALRHDIFPRVQPHVYSCVNRYGRIYLAWDGNRPELVITEAELVNEVLKH  285

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
                 +PK     F   L G  L+T  GEKW K RKLAN+ FH ESLK M P +IASVE M
Sbjct  286   SATTFPKRKPTFFLTGLFGNGLVTALGEKWVKQRKLANYAFHGESLKNMTPAVIASVETM  345

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LE+WK   GKE++V+ +F +LT+EVISRTAFGSS+LEG+ IF M+S L+ I  +N++  +
Sbjct  346   LEKWKSYVGKEMEVYHEFRLLTSEVISRTAFGSSYLEGEKIFDMLSKLSIIRSRNLFETR  405

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTG  938
              P I+ L +S+D +++E+L +GI+  ++++V+KRE K  N   +++G D+LG L+K    
Sbjct  406   IPLINKLWKSADMLKSEELSKGIQDCVMKIVKKREDKVENREADSFGYDFLGLLVK-AYH  464

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               D +  +S++ ++DE K  Y AG  T  SLL W +FL+A+H +WQEKARRE++E+FG++
Sbjct  465   DPDKNNRLSMEDLVDECKTFYFAGQDTVNSLLAWMVFLIAIHGDWQEKARREVIEIFGNQ  524

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P S+GI++L+ M MI+ E +RLY P I + R+ EREV+LG L +PA++ + +   A HH
Sbjct  525   IPDSEGISKLKIMTMIIYETLRLYGPSIAMMRRAEREVQLGKLVLPANLDLLVVHSASHH  584

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQ+WG +VH+F P RFA+G+AKATN NA AF PFG+GPR CVG+NF   E KIALSMIL
Sbjct  585   DPQLWGDEVHLFKPERFAEGIAKATNYNAGAFCPFGLGPRNCVGMNFAIIETKIALSMIL  644

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY  +LSP YVH P     + P++G+QVIL+++
Sbjct  645   QRYTISLSPAYVHSPIPYITIQPQHGIQVILESL  678


 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 83/154 (54%), Gaps = 16/154 (10%)
 Frame = +3

Query  132  PRRLRKVMRSQ---GIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHT  302
            P R+ K+  +    GI GPPY F HGN K+++ MR +++ K +  ++  +F R+QPH+++
Sbjct  14   PHRVDKLASADQLAGIKGPPYRFIHGNNKEVTKMRKEALSKAV-GLTDDLFPRLQPHIYS  72

Query  303  WKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALIT---  473
            W   YG  F+ W+G +  + I+EPELIKEV+ N E  + +  L D   KLLG  L +   
Sbjct  73   WINTYGKNFVYWNGVRAEVVISEPELIKEVMKNSEKIFQRRKLTDVGGKLLGNGLCSLRE  132

Query  474  NEGE---------KWAKVRKLANHTFHAESLKRM  548
              G+          W K +  A   F AE  + M
Sbjct  133  KNGQSIESWPIMLSWGKPKAKAPFQFIAERRRNM  166



>gb|KHG27367.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   498 bits (1282),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/502 (48%), Positives = 345/502 (69%), Gaps = 3/502 (1%)
 Frame = +3

Query  78    SIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFD  257
               + +  L+R +    W P RL+ +M SQGI GPPYSF HGN K+ + M  ++  KPM  
Sbjct  13    CCFFIVALIRFLYDYLWRPLRLQHMMSSQGIKGPPYSFIHGNNKEATKMTKEAFSKPM-A  71

Query  258   ISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD  437
             + H IF R+QP++++    YG  +L+W G +P L ITEPEL  EVL +    +PK     
Sbjct  72    LRHDIFPRVQPYIYSCVNKYGRNYLSWDGNRPELVITEPELANEVLKHSVTTFPKRKPTV  131

Query  438   FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKEL  617
             F  ++ G  L+T  GEKW K RKLAN+ FH ESL+ M P +IASV+ MLE+WK   GKE+
Sbjct  132   FVSRIFGNGLVTALGEKWVKQRKLANYAFHGESLQNMTPAVIASVKTMLEKWKGYVGKEM  191

Query  618   DVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSD  797
             +V+ +F +LT+EVISRTAF SS+LEG+ IF M++ L+ I  +N++  + P I+ L +S D
Sbjct  192   EVYHEFRLLTSEVISRTAFSSSYLEGEKIFDMLNKLSIIRSRNLFETRIPLINKLWKSGD  251

Query  798   EIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQ  974
              +E+E+L +GI+  ++++V+KRE E  NG   ++GND+LG L+      SD +  +S + 
Sbjct  252   VLESEELSKGIQDCVMKIVKKREDEVVNGEANSFGNDFLGLLVN-AYHDSDENNRLSTED  310

Query  975   MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRT  1154
             ++DE K  Y AG  T  SLL W +FLLA+H +WQEKARRE++E+FG++ P S+G+++L+T
Sbjct  311   LVDECKTFYFAGQDTVNSLLAWIVFLLAIHGDWQEKARREVIEIFGNQIPDSEGMSKLKT  370

Query  1155  MNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVF  1334
             M MI+ E +RLY P   + R+  REV+LG L +PA+I I +  +ALHH+P +WG DVH+F
Sbjct  371   MTMIIYETLRLYGPPNGLPRRAAREVQLGKLVLPANIDILVQNIALHHNPHLWGDDVHLF  430

Query  1335  NPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYV  1514
              P RFA+G+AKATN NA AF PFG+GPR CVG+NF T E KI +SMILQRY  +LSP YV
Sbjct  431   KPERFAEGIAKATNYNAGAFCPFGLGPRNCVGMNFATTEMKIVVSMILQRYTISLSPTYV  490

Query  1515  HYPADIFILTPKNGVQVILQNV  1580
             H P     + P++G+QVIL+++
Sbjct  491   HSPIPYITVQPQHGIQVILESL  512



>emb|CDP12576.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   496 bits (1278),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 253/524 (48%), Positives = 351/524 (67%), Gaps = 24/524 (5%)
 Frame = +3

Query  57    FFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQS  236
             F+    V IY+L+ L++++   WW P R++ ++ SQGI GPP S  HG+ +++   +  +
Sbjct  6     FYFVGFVLIYILFALIKVLHIIWWKPMRIQHILESQGIKGPPRSILHGSPRELPKKKENT  65

Query  237   MGKPMFDISHHIFARIQPHVHTWKEIY-GNTFLTWH-GTKPYLFITEPELIKEVLANKEG  410
                   ++SH IF  IQPH+++W  IY G  FL W  G    L IT+ +LIKE+L +KE 
Sbjct  66    T-----NLSHDIFPVIQPHIYSWMNIYEGKIFLRWRRGAGAELVITDLDLIKEILNDKEQ  120

Query  411   AYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAE--------------SLKRM  548
              +    L  + KK++G  L  ++GEKW K+RKLAN  FH                + + M
Sbjct  121   FFTIAKLSKYLKKIVGGGLGQSDGEKWVKLRKLANQAFHVRKQADFILLILLLICASRDM  180

Query  549   VPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLT  728
              P M+ SVE+ML RW + +GKE+DV ++F +LT EVISRTAFGSS++EG+ IF M+  L 
Sbjct  181   TPAMVESVEMMLRRWSDYDGKEIDVSEEFMLLTAEVISRTAFGSSYVEGEQIFNMMKRLG  240

Query  729   AITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGV-VENYGND  905
              +T K  Y +K P I    +  D+IE++KLE+GI+ +I+E+V+KREK   G   +++G D
Sbjct  241   ILTGKIAYKLKPPFIRKFFKDGDDIESDKLEKGIQDSIVEIVKKREKGKKGDNKQSFGED  300

Query  906   YLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKA  1085
             +LG L+K     SD + NIS++++IDE K  YGAGH TT+ LL W I LLA++T+WQEKA
Sbjct  301   FLGLLLKAHYDCSD-NDNISIEEIIDECKTFYGAGHGTTSILLSWTILLLAINTDWQEKA  359

Query  1086  RREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADI  1265
             R E+ +LFG ++P S+GI+RL+T++MI+NE +RLYPP I   R  +   KLGN  +PAD+
Sbjct  360   REEVTKLFGQDHPNSEGISRLKTISMIINETLRLYPPAIYARRTTKEGAKLGNYKLPADL  419

Query  1266  TIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnna-aaFFPFGMGPRTCVGLNFT  1442
              I + ILA+HHDPQIWG D H+FNP RF+QGV+ AT  N  AAF PF +GPRTCVG NF 
Sbjct  420   NISIAILAVHHDPQIWGDDAHLFNPERFSQGVSGATKINNPAAFLPFSLGPRTCVGSNFA  479

Query  1443  TNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
               E KIALSMILQRY FTLSP+YVH P  +F L P++GVQV+L 
Sbjct  480   ITEVKIALSMILQRYAFTLSPSYVHAPVQMFALMPQHGVQVVLH  523



>ref|XP_004173451.1| PREDICTED: cytochrome P450 734A1-like, partial [Cucumis sativus]
Length=485

 Score =   494 bits (1272),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/471 (50%), Positives = 330/471 (70%), Gaps = 5/471 (1%)
 Frame = +3

Query  78    SIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFD  257
              + L+  +++LV + WWTP R++++MRSQGI GP Y F  GN + +   R Q+M  PM +
Sbjct  17    CVILMSNIMKLVSKFWWTPMRIQRIMRSQGINGPSYKFIQGNMRDMYTKRMQAMATPM-E  75

Query  258   ISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD  437
             +SH+I  R+ PHVH+W   YG +FL W+G +  L IT+PE+IKEVL +K+  YPK  L  
Sbjct  76    LSHNILPRVIPHVHSWLNDYGRSFLQWYGIEAQLIITDPEMIKEVLNDKQKNYPKAKLGR  135

Query  438   FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKEL  617
                ++ G+ L+T+EG++WAK RK+AN  FH +SLK M+P MI   E M+E WK  EGKEL
Sbjct  136   DLLRIFGDGLVTSEGQRWAKSRKIANFAFHGDSLKNMIPTMIECGEKMIEGWKNHEGKEL  195

Query  618   DVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSD  797
             DV+K+  V T +VISRTAFGSS+ +G +IF M+  LT ++++N Y +K P IS + RS D
Sbjct  196   DVYKELKVYTLDVISRTAFGSSYQQGLNIFHMLQQLTDLSIRNGYKIKLPIISKILRSKD  255

Query  798   EIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQ  974
             ++E E+LE+ +K    E++R RE  S NG  E YGND+LG L+K    G   S+ I++D 
Sbjct  256   DVEGERLEKRMKECFTEIIRGREDRSKNGGGEGYGNDFLGMLVKAKNEGEK-SERITMDV  314

Query  975   MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH-ENPTSDGIARLR  1151
             ++ E K  Y AGH TT  L+ W +FLLALH +WQE+AR E+  +FGH  NPT + +++L+
Sbjct  315   IVAECKTFYFAGHETTNVLIAWIMFLLALHKQWQEQARDEVFRIFGHSSNPTYEALSKLK  374

Query  1152  TMNMILNECMRLYPPVITVTRK-VEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVH  1328
              M MI+NE +RLYPP +TV+R+ VE+EVKLG+L +P  + + +P +A+HHD + WG+DVH
Sbjct  375   IMTMIINETLRLYPPAMTVSRQVVEKEVKLGSLVLPTSLQLMIPTIAVHHDKEFWGEDVH  434

Query  1329  VFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQ  1481
              F P RFA+GV+K    N+A + PFG+GPR CVG+NF  NEAKIA+SMILQ
Sbjct  435   EFKPERFAEGVSKTIEGNSAGYLPFGLGPRNCVGMNFAINEAKIAMSMILQ  485



>gb|KDP35176.1| hypothetical protein JCGZ_10710 [Jatropha curcas]
Length=448

 Score =   491 bits (1265),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 227/449 (51%), Positives = 336/449 (75%), Gaps = 13/449 (3%)
 Frame = +3

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEP-ELIKEVLANKEGAYPKMDL  431
             ++SH +F  + PH H+W ++YG  FL W G + YL  +EP EL+KE+  N++GA+PK + 
Sbjct  2     ELSHQVFPTVLPHFHSWMKLYGKNFLRWQGPQAYLVFSEPNELVKEIFNNRDGAFPKPEP  61

Query  432   DDFAKKLLGEALITNE-GEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEG  608
             D++ KKL+GE + T    EKW K+RKL+NH FHAE LK M+P MI SVE+MLE+W+  EG
Sbjct  62    DNYTKKLIGEGIGTTRIPEKWLKLRKLSNHAFHAECLKSMIPAMITSVEMMLEKWRHNEG  121

Query  609   KELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTR  788
             KE++VF++F VL +E+ISRTAFGSS+LEG+ IF M++ LT I  +N Y ++ PGI  L +
Sbjct  122   KEIEVFQEFKVLASEIISRTAFGSSYLEGQRIFDMINQLTLIIGRNRYRIRIPGIRNLVK  181

Query  789   SSDEIEAEKLERGIKGAILELVRKREK-----ESNGVVENYGNDYLGQLMKI--TTGGSD  947
             + D+IE+EK+++ I+ +I+ +++KRE+     +SNG    +G D+LG L+K        D
Sbjct  182   TWDDIESEKIDQEIRDSIMNMIKKREEAAMMSQSNG----FGTDFLGLLLKAHHDNNDPD  237

Query  948   ISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPT  1127
              +K +S+++MIDE K  Y  GH TT +   W +FLLA+HT+WQ+KAR+E+LELFG ++P+
Sbjct  238   QTKRLSVEEMIDECKTFYVVGHETTATSFTWTVFLLAIHTDWQDKARKEVLELFGQQSPS  297

Query  1128  SDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQ  1307
             SDG+++++ ++MI+NE +RLYPPV+++ + V+R+V+LG L +PA+I I +P++ALHHDP+
Sbjct  298   SDGLSKMKLVSMIINEALRLYPPVLSIPKAVQRQVRLGKLVLPANIVIEIPVIALHHDPE  357

Query  1308  IWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRY  1487
             IWG+DV++F P RFA+G+AKATNNN  A+ PF +GPR+CVG NF   E KIALSMILQ Y
Sbjct  358   IWGEDVYLFKPERFAEGLAKATNNNLNAYLPFSLGPRSCVGYNFAITETKIALSMILQHY  417

Query  1488  KFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             +FTLSP YVH P +   + P++G+Q++L 
Sbjct  418   RFTLSPTYVHSPVNRLTVCPQHGMQIMLH  446



>gb|KDP35170.1| hypothetical protein JCGZ_10704 [Jatropha curcas]
Length=522

 Score =   494 bits (1271),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 237/518 (46%), Positives = 364/518 (70%), Gaps = 5/518 (1%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             + ++   +  + +  + LL  L++  ++ W TP R++ +MRSQGI GP Y   +GNTK+I
Sbjct  1     METLQVTYISSCTACVILLSFLIKFFNKVWGTPMRIQSMMRSQGIKGPSYKLFYGNTKEI  60

Query  216   SNMRSQSMGKPMFDIS-HHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEV  392
               M  +++     ++S H +F  I PH+H+W ++YG  FL W G + +L I+EP LIK++
Sbjct  61    LRMNKKALTDTKKELSSHQVFPTILPHLHSWMKLYGKNFLWWEGAQAFLEISEPNLIKDM  120

Query  393   LANKEGAYPKMDLDDFAKKLLGEAL-ITNEGEKWAKVRKLANHTFHAESLKRMVPEMIAS  569
             + N+ G + K   DD+ +KLLG+ + IT   EKW K+RK++NH FHAE LK M P MI S
Sbjct  121   MENRYGVFHKPIPDDYNRKLLGDGIAITRVPEKWLKLRKISNHAFHAECLKNMFPAMITS  180

Query  570   VEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNV  749
             VE+M+ERWK  EGKE +VF++F +L++E+ISRTAFGSS+LEG+ IF M++ L  I  +N 
Sbjct  181   VEMMIERWKHHEGKEHEVFQEFILLSSEIISRTAFGSSYLEGQRIFDMLTQLIFIIDRNK  240

Query  750   YNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMK  926
             Y ++ PGI  L ++ D+IE++K++ GI  AIL +++KRE+E+     N +G+D+LG L+K
Sbjct  241   YRIRIPGIRYLVKNRDDIESDKIDIGIHNAILNMIKKREEEAMMSQSNGFGSDFLGILLK  300

Query  927   I--TTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREIL  1100
                    SD +  IS++++ID+ K  Y AG  T  + L W ++LL++HT+WQEKAR+E+ 
Sbjct  301   AHHDNNDSDETNRISVEEIIDDCKIFYAAGQGTVATSLTWTLYLLSIHTDWQEKARKEVF  360

Query  1101  ELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMP  1280
             ELFG +NP+ D +++L+ ++MI NE +RLYPP++T+ ++  REVK+GNL +PA+  + +P
Sbjct  361   ELFGQKNPSPDSLSKLKIVSMIYNEALRLYPPILTIAKEALREVKIGNLVVPANTVVEVP  420

Query  1281  ILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKI  1460
             ++A+HHDP+IWG+DV++F P RFA+G+AKATNNN   + PF +GPR CVG  F   EAKI
Sbjct  421   VVAVHHDPEIWGEDVYLFKPERFAEGLAKATNNNVNGYLPFSLGPRHCVGDKFALTEAKI  480

Query  1461  ALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              LSMILQ ++F LSPNYVH P  +  + P++G++++  
Sbjct  481   TLSMILQHFRFNLSPNYVHSPIPLLTIYPEHGMKIMFH  518



>ref|XP_002512039.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50708.1| cytochrome P450, putative [Ricinus communis]
Length=475

 Score =   491 bits (1265),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 240/477 (50%), Positives = 347/477 (73%), Gaps = 2/477 (0%)
 Frame = +3

Query  150   VMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTF  329
             ++RSQGI GP Y F HGN+K+I NM   +   PM   +  +F+ + PH+++W ++YG  F
Sbjct  1     MLRSQGIKGPSYRFYHGNSKEIINMEYNASSNPMKLSNDQLFSTVLPHIYSWSKLYGKNF  60

Query  330   LTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKL  509
             L WHG + ++ + EP ++K++  N++  + K + +D+ KKLLG+ ++T  GEKW K+RK+
Sbjct  61    LYWHGPRAHIVVQEPSMLKDIF-NRDEIFTKGEPEDYVKKLLGDGIVTARGEKWLKLRKI  119

Query  510   ANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFL  689
             +NHTFHAESLK M+P MIASVE+MLERW   +GKE++ +K+F +LT+E+ISRTAFGSS+L
Sbjct  120   SNHTFHAESLKGMIPGMIASVEMMLERWNNHDGKEIEAYKEFKILTSEIISRTAFGSSYL  179

Query  690   EGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREK  869
             EG+HIF M+  L  I ++N Y V+ PGI  L ++ D+ +++KLE+GI  + + +++KRE 
Sbjct  180   EGQHIFDMLIRLAVIVIRNKYKVRIPGIRNLVKTRDDTDSDKLEQGIHNSFIYMIKKREV  239

Query  870   ESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIF  1049
                    ++ ND+LG L+K     ++++K I++  +IDE K  Y AGH TTTSLL W + 
Sbjct  240   AMTDQSGSFRNDFLGSLLK-AYHENNMAKKITVANLIDECKTFYVAGHETTTSLLTWILL  298

Query  1050  LLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVERE  1229
             LLA+H EWQEKAR E+LE+FG +  +SDG+  L+ ++MI+NE +RLYPPV+ V RKV+ E
Sbjct  299   LLAIHPEWQEKAREEVLEIFGSQRLSSDGLTGLKIVSMIINETLRLYPPVVNVIRKVDGE  358

Query  1230  VKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGM  1409
             VKLG L IP +  I +P++A+HH+PQIWG+DV+ F P RFA+GVAKATNNN  A+ PFG+
Sbjct  359   VKLGELIIPENTEIDIPVIAIHHNPQIWGEDVYKFKPERFAEGVAKATNNNITAYLPFGL  418

Query  1410  GPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             GPR CVG +F   E KIALSMILQRY+F+LSP YVH P  I  + P+ G+Q++L  +
Sbjct  419   GPRNCVGSSFAITETKIALSMILQRYRFSLSPTYVHSPIPILTMCPQYGLQMVLHKL  475



>gb|KCW86465.1| hypothetical protein EUGRSUZ_B03133 [Eucalyptus grandis]
Length=511

 Score =   493 bits (1268),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 242/493 (49%), Positives = 344/493 (70%), Gaps = 12/493 (2%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
              +L+ + WW P R++++M  QGI GPPY F HG+TK+   M+ +    PM ++SH IF +
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEVRNTPMNNLSHDIFPK  78

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             I P V+TW + YG  +L+WHG +  L ITEPELIKEVL ++E  YPK    DFAKKLLG+
Sbjct  79    IHPQVNTWIDTYGKNYLSWHGPQAQLVITEPELIKEVLLDREKTYPKTGTKDFAKKLLGD  138

Query  462   ALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
              L+ T + +KWA  RKLANH FH ESLK M P M+ SV  ML +WK  EGKE++VF +F 
Sbjct  139   GLVSTVDDKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEFK  198

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGI---SMLTRSSDEIEA  809
             +LT+EVISRTAFGSS++EG++IF+M++ L  +T KN +N++ PGI   +   R      +
Sbjct  199   LLTSEVISRTAFGSSYVEGRNIFQMLTELATLTSKNAFNIRLPGIRYHAFFLRKF----S  254

Query  810   EKLERGIKGAILELVRKREKESNGVVEN-YGNDYLGQLMKITTGGSDISKNISLDQMIDE  986
             EKLE+GI+ +ILE++++REK+     E+ +G+D+LGQL+K     +D SK  ++D ++DE
Sbjct  255   EKLEKGIRNSILEMIKRREKKVMASEEDGFGDDFLGQLVK-ALHDTDKSKKFTVDNLVDE  313

Query  987   IKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMI  1166
              K  Y AG  T  S++ W +FLLA++ EWQE+ARRE+L +FG+++P SDG+ +L+  +  
Sbjct  314   CKTFYIAGQETANSMMAWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKHDHE  373

Query  1167  LNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHR  1346
              N      PP + +TRKV ++++LG L +PA+  IF+P L LHHDP+IWG+D H F P R
Sbjct  374   RNSA--FVPPAVDLTRKVGKKLRLGKLLLPANSQIFIPTLKLHHDPEIWGEDAHEFKPER  431

Query  1347  FAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPA  1526
             F++G+AKATNNNA  F PFG G R+C+G++F   E KIA SMILQRY F LSP Y+H P 
Sbjct  432   FSEGIAKATNNNAVIFIPFGFGRRSCIGMSFVAAEVKIAFSMILQRYTFELSPTYIHCPG  491

Query  1527  DIFILTPKNGVQV  1565
              +    P++G+Q+
Sbjct  492   QLLTTCPQHGLQI  504



>ref|XP_010052417.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW76383.1| hypothetical protein EUGRSUZ_D00765 [Eucalyptus grandis]
Length=516

 Score =   492 bits (1267),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 242/518 (47%), Positives = 357/518 (69%), Gaps = 9/518 (2%)
 Frame = +3

Query  21    MMSGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHG  200
             + +GAL S     F +  +S++L   +V+++ + WW P ++++ M SQGI GP Y F +G
Sbjct  4     LRNGALFS-----FCSLVLSLFLAL-IVKMLHKFWWRPIQIQRKMASQGIKGPAYRFFYG  57

Query  201   NTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPEL  380
             +TK++  M+ ++  +PM  +SH IF  +QPH H W + YG  FL WHG + +L I++ ++
Sbjct  58    STKEMLQMKREATSRPM-SLSHDIFPYVQPHFHKWTQTYGKNFLVWHGPQAFLVISDLDM  116

Query  381   IKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEM  560
             +K+VL +    + K+ L D  KK++G+ L+T+EGE+ AK RKLAN  FH +SLK MVP M
Sbjct  117   VKKVLNDNGNTFSKIFLQDQVKKIVGDGLVTSEGEQLAKHRKLANLAFHGQSLKSMVPAM  176

Query  561   IASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITV  740
             +    +M++RW + E  E++V+++F + T++ IS+TAFGSS++EGK +F+    L     
Sbjct  177   VDCAHMMIQRWSDRECLEINVYEEFKLCTSDAISKTAFGSSYVEGKTVFENGVKLGLTMA  236

Query  741   KNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQ  917
             +    ++ PGIS L + + EIEA KLE+G++ A+L+++++R+++ N G +E YGND+LG 
Sbjct  237   RASSQIRLPGISKLWKPTYEIEAAKLEKGLREALLKIIKRRQQKINSGEMEGYGNDFLGL  296

Query  918   LMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREI  1097
             L+K      D +K I+ D +I + K  Y AG+ T +SLL W  FLLA+HT+WQ++AR+E+
Sbjct  297   LLK-AMHDVDENKKITFDNVIADCKTFYSAGYETLSSLLAWTAFLLAIHTDWQQEARKEV  355

Query  1098  LELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFM  1277
             L + G  +P  +GI +L+ M MI+NE +RLYPP   VTRKV R+ KLG+L +PA I + +
Sbjct  356   LNVLGDRDPDFNGIMKLKKMGMIINESLRLYPPAGGVTRKVTRQAKLGDLILPAGIMVHI  415

Query  1278  PILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAK  1457
             PIL +HHDPQIW  D H+F P RF++GVAKATNNN A F PFG+G R CVGLNF T EAK
Sbjct  416   PILKIHHDPQIWEDDAHLFKPERFSEGVAKATNNNPAMFLPFGLGTRNCVGLNFATVEAK  475

Query  1458  IALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVIL  1571
             I L+MILQRY FTLSP YVH P ++    P+ GVQVIL
Sbjct  476   IVLAMILQRYSFTLSPAYVHSPVELHNSRPQYGVQVIL  513



>gb|KCW76385.1| hypothetical protein EUGRSUZ_D00767 [Eucalyptus grandis]
Length=473

 Score =   490 bits (1262),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 238/477 (50%), Positives = 330/477 (69%), Gaps = 5/477 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             M +QGI GPPY F HG+TK++  M+ +   +PM ++SH IF  +QPH++ W + YG  FL
Sbjct  1     MAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM-NLSHDIFPYVQPHLYEWTKTYGRNFL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
              W+G + +L I++ E++KEVL N++  Y K  + D  KK +G+ L T  GEKWAK RKLA
Sbjct  60    MWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIGDGLATFRGEKWAKHRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             N  FH E+LK M+P M+ S   ML+RW   EGKE+DV+K+  +  ++VIS+TAFGSS+ E
Sbjct  120   NFAFHRENLKGMIPAMVDSAHTMLKRWSGREGKEIDVYKELRLYASDVISKTAFGSSYTE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR-EK  869
             GK IF+ V+ L  + V    +  FP +  L R + EIE EK+E+G + A+LE+++KR EK
Sbjct  180   GKSIFENVNKLILVMVNA--SSSFPILRKLWRPAYEIEGEKIEKGFREAVLEIIKKRQEK  237

Query  870   ESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIF  1049
              ++G +E+YGND+LG L++  +   D  K I++D ++ E K  Y AGH T TS L W + 
Sbjct  238   VNSGELESYGNDFLGLLLR-ASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAWTVL  296

Query  1050  LLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVERE  1229
             LL++HT+WQE+AR+E   +FG+++P  DGI +L+T+ MI+NE +RLYPP   ++R+V R+
Sbjct  297   LLSIHTDWQEEARKEAFNVFGNQDPDLDGITKLKTIGMIINESLRLYPPATFISREVSRQ  356

Query  1230  VKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGM  1409
              KLGN  +PA I + +P L +HHDPQIWG D H+F P RF  GVAKAT+NN A F PFG+
Sbjct  357   AKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLDGVAKATSNNPATFLPFGL  416

Query  1410  GPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             GPR+CVG NF   EAKI LSMILQRY F LSP YVH PA + I  PK GVQV   ++
Sbjct  417   GPRSCVGSNFVVVEAKIVLSMILQRYAFNLSPAYVHSPAQLLIAYPKYGVQVFFNSI  473



>gb|KHG09429.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score =   491 bits (1265),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 243/517 (47%), Positives = 348/517 (67%), Gaps = 9/517 (2%)
 Frame = +3

Query  24    MSGALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGN  203
             MSG +  +I      F V+      L++ +    W P R++ ++ SQGI GPP+ F HGN
Sbjct  1     MSGLMELVILVPCCFFIVA------LIKFLYDYLWIPLRIQHILNSQGIKGPPFRFIHGN  54

Query  204   TKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELI  383
              K+I+ M+ +++GKP+   +  +F R+QPH+++W   YG  F+ W G +  L I+EPEL+
Sbjct  55    NKEIAKMKQEALGKPV-AWTDDLFPRLQPHIYSWINRYGKNFVYWDGARAELVISEPELV  113

Query  384   KEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMI  563
             KEVL N E  + K+ L + ++KL+G  L   EGEKWAK RKLANHTFH ESLK M P MI
Sbjct  114   KEVLKNSENIFQKVKLPEISRKLMGNGLAFTEGEKWAKYRKLANHTFHGESLKNMTPAMI  173

Query  564   ASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVK  743
             ASVE MLE+WK  EG+E++VF++F +LT+EVIS+TAFGSS+LEG+ IF ++  L  +  +
Sbjct  174   ASVETMLEKWKGQEGQEIEVFQEFRLLTSEVISKTAFGSSYLEGEKIFALLYKLKILVSR  233

Query  744   NVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQL  920
             N+     P I+ L +S+D +E+EKL +GI+  ++++V+KRE +  NG  +++GND+ G L
Sbjct  234   NMSKTTIPFINKLWKSADLLESEKLAKGIQDCVMKIVKKREDQVVNGEADSFGNDFFGLL  293

Query  921   MKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREIL  1100
             +       D    +SL+ ++DE K  Y AG  T  SLL W +  LA+H +WQEK RRE++
Sbjct  294   VN-AYHDLDEKNRLSLEDLVDECKTFYIAGQETVNSLLAWIVLHLAIHGDWQEKTRREVI  352

Query  1101  ELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMP  1280
             ++FG++NP  +GI +L+TM M++NE +RLY P   + R V REV+LG L + A + I   
Sbjct  353   DIFGNQNPHLEGITKLKTMAMVINETLRLYGPSNGLARTVAREVQLGKLFLLAKLDILPL  412

Query  1281  ILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKI  1460
              + +H DP +WG DVH+F P RFA G+AKATN  AAAF PFG+GPR+CVG+ F T E KI
Sbjct  413   NIGVHRDPHLWGDDVHLFKPERFADGIAKATNYTAAAFLPFGLGPRSCVGMTFATIETKI  472

Query  1461  ALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVIL  1571
              LSMILQRY  TLSP YVH P  I  + P++G+Q+ +
Sbjct  473   VLSMILQRYTITLSPAYVHSPILILTVRPQHGIQLTI  509



>gb|KCW85137.1| hypothetical protein EUGRSUZ_B01976 [Eucalyptus grandis]
Length=484

 Score =   489 bits (1259),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 353/511 (69%), Gaps = 37/511 (7%)
 Frame = +3

Query  54    AFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQ  233
              F L  S +++L   L +L+ + WW P R+++ M SQGI GPPY F HG+TK+I  ++  
Sbjct  5     GFLLGIS-ALFLSSILTKLLHKLWWRPIRVQRAMASQGINGPPYKFIHGSTKEIFKLKED  63

Query  234   SMGK---PMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
              M K   PM ++SH I   ++PH+H W +IYG  +L W+G +  L I++ EL+KE L ++
Sbjct  64    VMMKTNGPMKNVSHEILPIVEPHIHQWNKIYGGIYLYWYGPQALLLISDTELVKEALNDR  123

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             +  Y K +     KK+LG+ L++ EG+KW + R+LA+  FH ESLK M+P M+ SV ++L
Sbjct  124   DKTYVKPEFPGDIKKILGDGLVSTEGKKWTRQRRLAHLAFHGESLKGMIPAMVDSVHMLL  183

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             +RW+ LE KE+++F++F  + +EVISRTAFGSS++EG+ IF+M+  LT I  +N++ ++ 
Sbjct  184   KRWQNLEAKEVELFEEFTAILSEVISRTAFGSSYIEGRDIFQMLGELTIIASRNLFKLRL  243

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGG  941
             PGIS + ++SDEI++++LE+ I+ A+L ++ KREK+ N G +++YGND+LG         
Sbjct  244   PGISKIWKTSDEIKSDRLEKAIRDAVLGIIDKREKKLNAGEIDDYGNDFLG---------  294

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN  1121
                 K I+++ ++DE K  Y AG  TT S+L W +FLLA+H  WQE+AR+E+ ++FG E+
Sbjct  295   ----KRITINDLVDECKTFYLAGQETTNSILTWTLFLLAIHKNWQEEARKEVADVFGDED  350

Query  1122  PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHD  1301
             P  +GI +L+T+ MI+NE +RLYPPVI V RKVER+V LGNL +P DI + +PIL +HHD
Sbjct  351   PNHEGIMKLKTVEMIINETLRLYPPVINVIRKVERQVTLGNLLLPPDIILHIPILKIHHD  410

Query  1302  PQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQ  1481
             P+IWG DVH+F P RF++G+AKATNNNAAAF PFG+GPR+C                   
Sbjct  411   PRIWGDDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRSC-------------------  451

Query  1482  RYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             RY FTLSP+Y+H P  I  + P++GV+VIL 
Sbjct  452   RYSFTLSPDYIHLPTQILAMRPQHGVKVILH  482



>ref|XP_010054392.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=476

 Score =   489 bits (1258),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 239/477 (50%), Positives = 330/477 (69%), Gaps = 5/477 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             M +QGI GPPY F HG+TK++  M+ +   +PM ++SH IF  +QPH++ W + YG  FL
Sbjct  1     MAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM-NLSHDIFPYVQPHLYEWTKTYGRNFL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
              W+G + +L I++ E++KEVL N++  Y K  + D  KK +G+ L T  GEKWAK RKLA
Sbjct  60    MWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIGDGLATFRGEKWAKHRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             N  FH E+LK M+P M+ S   ML+RW   EGKE+DV+K+  +  ++VIS+TAFGSS+ E
Sbjct  120   NFAFHRENLKGMIPAMVDSAHTMLKRWSGREGKEIDVYKELRLYASDVISKTAFGSSYTE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR-EK  869
             GK IF+ V+ L  + V    +  FP +  L R + EIE EK+E+G + A+LE+++KR EK
Sbjct  180   GKSIFENVNKLILVMVNA--SSSFPILRKLWRPAYEIEGEKIEKGFREAVLEIIKKRQEK  237

Query  870   ESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIF  1049
              ++G +E+YGND+LG L++  +   D  K I++D ++ E K  Y AGH T TS L W + 
Sbjct  238   VNSGELESYGNDFLGLLLR-ASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAWTVL  296

Query  1050  LLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVERE  1229
             LL++HT+WQE+AR+E   +FG+++P  DGI +L+T+ MI+NE +RLYPP   ++R+V R+
Sbjct  297   LLSIHTDWQEEARKEAFNVFGNQDPDLDGITKLKTIGMIINESLRLYPPATFISREVSRQ  356

Query  1230  VKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGM  1409
              KLGN  +PA I + +P L +HHDPQIWG D H+F P RF  GVAKAT+NN A F PFG+
Sbjct  357   AKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLDGVAKATSNNPATFLPFGL  416

Query  1410  GPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             GPR+CVG NF   EAKI LSMILQRY F LSP YVH PA + I  PK GVQ+   NV
Sbjct  417   GPRSCVGSNFVVVEAKIVLSMILQRYAFNLSPAYVHSPAQLLIAYPKYGVQLHKDNV  473



>gb|KHG20728.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=988

 Score =   505 bits (1301),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 248/511 (49%), Positives = 360/511 (70%), Gaps = 10/511 (2%)
 Frame = +3

Query  150   VMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTF  329
             ++ SQGI GPPY F HGN ++I+ MR ++  KPM  ++H IF ++QPH+++W   YG  +
Sbjct  1     MLNSQGIKGPPYRFIHGNNREIAKMRQEASSKPM-ALTHDIFPKVQPHIYSWINKYGRNY  59

Query  330   LTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKL  509
             L W+G +  L I+EPEL+KE+L N E  +PK     +  KLLG  L+T EGEKWAK RKL
Sbjct  60    LYWNGVRAELVISEPELVKEILKNSEKTFPKRKPTIYLSKLLGNGLVTVEGEKWAKQRKL  119

Query  510   ANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFL  689
             AN+ FH ESLK M P +IASVE ML++WK  EGKE++VF +F +LT+EVISRTAFGSS+L
Sbjct  120   ANYVFHGESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVISRTAFGSSYL  179

Query  690   EGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-  866
             EG+ +F M++ L+ I  +N+YN + P I+ L + +D +E+E+L + I+  ++++V+KRE 
Sbjct  180   EGEKVFAMLNKLSIIMSRNLYNTRIPLINKLWKPADMLESEELAKEIQDCVMKIVKKRED  239

Query  867   KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCI  1046
             K  NG  +++GND+LG L+      SD +  +S++ ++DE K  Y AG  T  +LL W +
Sbjct  240   KVVNGEADSFGNDFLGLLVN-AYHDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWTV  298

Query  1047  FLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVER  1226
              LLA+H +WQ+KARRE++ +FG++NP  +GIA+L+TM MI+NE +RLY     + R+V R
Sbjct  299   LLLAIHGDWQDKARREVIGIFGNQNPQPEGIAKLKTMTMIINETLRLYSSSNGMLRRVGR  358

Query  1227  EVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFG  1406
             +V++  + +PA+I + +    LHHDPQ+WG+DVH+F P RFA+G+AKATN NAAAF PFG
Sbjct  359   DVQMEKVVLPANIDLLIANAVLHHDPQLWGEDVHLFKPDRFAEGIAKATNYNAAAFLPFG  418

Query  1407  MGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQV----ILQ  1574
             +GPRTCVG+ F T E KIALSMILQRY  TLSP YVH P  +  L P++G+Q+    +++
Sbjct  419   LGPRTCVGMTFATTETKIALSMILQRYAITLSPAYVHSPIPVISLQPQHGIQIKMSALVK  478

Query  1575  NV*LLSCPYGLSLLVR---NYLKKEIKVQSL  1658
                LL C   L  L++   +YL   +++Q +
Sbjct  479   LAILLPCSLFLVALIKFLYDYLWIPLRLQHM  509


 Score =   486 bits (1250),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 241/514 (47%), Positives = 346/514 (67%), Gaps = 4/514 (1%)
 Frame = +3

Query  42    SIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN  221
             S +    +    S++L+  L++ +    W P RL+ +M SQGI GPPY+F +GN K+ + 
Sbjct  474   SALVKLAILLPCSLFLV-ALIKFLYDYLWIPLRLQHMMNSQGIKGPPYAFIYGNNKEATK  532

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
               ++++ KPM  + H IF R+QPHV++    YG  +L W G +P L ITEPEL+ EVL +
Sbjct  533   TTNEALSKPM-ALRHDIFPRVQPHVYSCINRYGRNYLAWDGKRPELVITEPELVNEVLKH  591

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
                 +PK     F   + G  L+T  GEKW K RKLAN+ FH ESLK M P +IASVE M
Sbjct  592   SVTTFPKRKPTFFLTGIFGNGLVTALGEKWVKQRKLANYAFHGESLKNMTPAVIASVETM  651

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LE+WK   GKE++V+ +F +LT+EVISRTAFGSS+LEG+ IF M++ L+ I  +N +  +
Sbjct  652   LEKWKGYVGKEIEVYHEFRLLTSEVISRTAFGSSYLEGEKIFDMLNKLSIIRSRNFFETR  711

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTG  938
              P I+   +S D +E+E+L +GI+  ++++V+KRE K  NG V+++GND+LG L+     
Sbjct  712   IPLINKFWKSGDVLESEELSKGIQDCVMKIVKKREDKVVNGEVDSFGNDFLGLLVN-AYH  770

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              SD +  +S + ++DE K  Y AG  T  SL+ W +FLLA+H +WQEKARRE++E+FG++
Sbjct  771   DSDENNRLSTEDLVDECKTFYFAGQDTVNSLIAWIVFLLAIHGDWQEKARREVIEIFGNQ  830

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
              P S+ +++L+ M MI+ E +RLY P   + R+ E +V+LG L +PA++ + +   A HH
Sbjct  831   IPNSEEMSKLKIMTMIIYETLRLYGPSNGMMRRTESDVQLGKLILPANLDLLVIHSAPHH  890

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DPQ+WG DVH+F P RFA+G+AKATN NA  F PFG+GPR CVG NF T E KI LSMIL
Sbjct  891   DPQLWGDDVHLFKPERFAEGIAKATNYNAGVFCPFGLGPRNCVGTNFATMETKIVLSMIL  950

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY   LSP YVH P     + P++G+QVIL+++
Sbjct  951   QRYTIYLSPTYVHSPIPYITVQPQHGIQVILESL  984



>ref|XP_011015642.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=420

 Score =   486 bits (1251),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 226/420 (54%), Positives = 318/420 (76%), Gaps = 2/420 (0%)
 Frame = +3

Query  324   TFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVR  503
             TFL WHG++  L +TEP+LIKE+  NK GA+PK +L  + KKLLG+ ++   GEKW K+R
Sbjct  2     TFLYWHGSQAQLVVTEPDLIKEIFNNKNGAFPKRNLPVYMKKLLGDGIVAANGEKWFKLR  61

Query  504   KLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSS  683
             KL+NH FHAE LK M+P MIASVEVML+RW++ +GKE+DVF++F +LT+E+ISRTAFGSS
Sbjct  62    KLSNHAFHAECLKSMIPAMIASVEVMLKRWRQHDGKEIDVFQEFKLLTSEIISRTAFGSS  121

Query  684   FLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR  863
             +LEG+H+F M++ +  I V+N Y +  PGI    ++ D+IE++KLE+ IK   + +++ R
Sbjct  122   YLEGQHVFDMLTRMGDIIVRNHYKITIPGIGKFVKTRDDIESDKLEQEIKNCFINMIKNR  181

Query  864   EKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGW  1040
             EK +  G   ++G+D+LG L+ +    +D +K IS++ +IDE K  Y AGH TT + L W
Sbjct  182   EKAAMEGKRGDFGSDFLGILL-LAHHEADKAKRISVEDIIDECKTFYFAGHETTRTSLTW  240

Query  1041  CIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKV  1220
              + LLA HT+WQ+KARRE+LELFG +NP  +GI +L T++MI+NE +RLY P + + R V
Sbjct  241   TVLLLAFHTDWQDKARREVLELFGLQNPNPEGITKLNTVSMIMNETLRLYSPAVHIPRMV  300

Query  1221  EREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFP  1400
              REV+LG L IPA+  I++P+L  HH+P+IWG+D H+F P RFA GVAKATNNN +AF P
Sbjct  301   RREVRLGKLIIPANTEIYIPVLVAHHNPEIWGEDAHLFKPERFADGVAKATNNNMSAFLP  360

Query  1401  FGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             FG+GPRTCVGLNF+  E KIAL+MILQ Y+FTLSP Y+H PA +  ++P++GVQ++L+ +
Sbjct  361   FGLGPRTCVGLNFSVTETKIALAMILQHYRFTLSPTYIHSPAHLLAMSPQHGVQIMLETL  420



>gb|KHG14937.1| Cytochrome P450 protein [Gossypium arboreum]
Length=501

 Score =   489 bits (1258),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 242/508 (48%), Positives = 347/508 (68%), Gaps = 18/508 (4%)
 Frame = +3

Query  60    FLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSM  239
              +T     +    L++ +    W P R+++++ SQGI GPPY F HGN ++I+ MR ++ 
Sbjct  7     LVTIVPCCFFFIALIKFLYDYLWIPLRIQRMLNSQGIKGPPYRFIHGNNREIAKMRQEAS  66

Query  240   GKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYP  419
              KPM  ++H IF ++QPH+++W   YG  +L W+G +  L I+EPEL+KE+L N E  +P
Sbjct  67    SKPM-ALTHDIFPKVQPHIYSWINKYGRNYLYWNGVRAELVISEPELVKEILKNSEKTFP  125

Query  420   KMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKE  599
             K     +  KLLG  L+T EGEKWAK RKLAN+ FH ESLK M P +IASVE ML++WK 
Sbjct  126   KRKPTIYLSKLLGNGLVTVEGEKWAKQRKLANYVFHGESLKNMTPAVIASVETMLQKWKG  185

Query  600   LEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISM  779
              EGKE++VF +F +LT+EVISRTAFGSS+LEG+ I+     LT +             S 
Sbjct  186   QEGKEIEVFNEFRLLTSEVISRTAFGSSYLEGEKIW-----LTLVFSS----------SK  230

Query  780   LTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISK  956
             L + +D +E+E+L + I+  ++++V+KRE K  NG  +++GND+LG L+      SD + 
Sbjct  231   LWKPADMLESEELAKEIQDCVMKIVKKREDKVVNGEADSFGNDFLGLLVN-AYHDSDKNN  289

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              +S++ ++DE K  Y AG  T  +LL W + LLA+H +WQ+KARRE++ +FG++NP  +G
Sbjct  290   KLSMEDLVDECKTFYFAGQDTVNALLAWTVLLLAIHGDWQDKARREVIGIFGNQNPQPEG  349

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             IA+L+TM MI+NE +RLY     + R+V R+V++  + +PA+I + +    LHHDPQ+WG
Sbjct  350   IAKLKTMTMIINETLRLYSSSNGMLRRVGRDVQMEKVVLPANIDLLIANAVLHHDPQLWG  409

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             +DVH+F P RFA+G+AKATN NAAAF PFG+GPRTCVG+ F   E KI LSMILQRY  T
Sbjct  410   EDVHLFKPDRFAEGIAKATNYNAAAFLPFGLGPRTCVGMTFAATETKIVLSMILQRYAIT  469

Query  1497  LSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSP YVH P  I  L P++G+QVIL+++
Sbjct  470   LSPAYVHSPIPIISLKPQHGIQVILKSL  497



>ref|XP_006437869.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
 gb|ESR51109.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
Length=421

 Score =   486 bits (1250),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 230/422 (55%), Positives = 322/422 (76%), Gaps = 4/422 (1%)
 Frame = +3

Query  312   IYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKW  491
             +YG  FL WHG++  L + EP+LIKE++ N   ++PK +  ++ K LLG  L+T  GEKW
Sbjct  1     LYGTNFLMWHGSQAELVVAEPKLIKEIMNNNR-SFPKREPREYLK-LLGNGLVTTRGEKW  58

Query  492   AKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTA  671
              K RKLA + FHAE+LK M+P+MIASV++MLERW++ EGKE+D +++  VLT+E+ISRTA
Sbjct  59    LKKRKLAVNAFHAENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREIKVLTSEIISRTA  118

Query  672   FGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILEL  851
             FGS +LEG++IF M++ +  I  K  Y ++ PGI  L +++D+IE++KLE+ I+ +I+++
Sbjct  119   FGSCYLEGENIFNMLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDKLEQDIRDSIIKV  178

Query  852   VRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTS  1028
             V+KRE     G  E+YGND LG LM+     +D ++ ISLD +IDE K  Y AG  TT S
Sbjct  179   VKKRESNVLTGEAESYGNDLLGILMR-AYHSADETQKISLDDLIDECKTFYVAGTDTTAS  237

Query  1029  LLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITV  1208
             LL W IFLLA+H++WQ+KAR+E+LEL G +NP++D I+RL+ + MI+NE +RLYPP +  
Sbjct  238   LLSWTIFLLAIHSDWQDKARKEVLELLGQQNPSADNISRLKIVGMIINETLRLYPPFVVF  297

Query  1209  TRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaa  1388
              R+V++EVKLG+L +PA++ + +P++A+HHDPQIWG+D H++ P RFAQGV KAT+NN A
Sbjct  298   VREVKKEVKLGDLIVPANVDVTIPVIAVHHDPQIWGEDFHLYKPERFAQGVPKATSNNMA  357

Query  1389  aFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVI  1568
             AF PFG+GPRTCVG NFT  EAKIALSMIL+RYKFTLSPNYVH P     L P++G+QV+
Sbjct  358   AFLPFGLGPRTCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVPRITLCPQHGIQVM  417

Query  1569  LQ  1574
             L+
Sbjct  418   LR  419



>gb|KCW85143.1| hypothetical protein EUGRSUZ_B01987 [Eucalyptus grandis]
Length=495

 Score =   488 bits (1257),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 234/513 (46%), Positives = 356/513 (69%), Gaps = 30/513 (6%)
 Frame = +3

Query  60    FLTFSVSIYLLWK---LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMR-  227
              L F +SI +L+    L +L+ + WW P R+++ M SQGI GPP  F HG TK+I  ++ 
Sbjct  3     LLGFLLSILVLFLSSILTKLLQKLWWRPIRVQRAMASQGIKGPPCKFIHGCTKEIYKLKK  62

Query  228   --SQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
               +  M +PM ++SH I   ++PH+H W ++YG  +L W+G + +L I++ EL+KEVL N
Sbjct  63    DITMKMNEPMTNVSHEILPIVEPHIHKWNKLYGGIYLHWYGPQAFLIISDTELVKEVLNN  122

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             ++  Y K++     KK+LG+ L+  EG+KWA+ R+LA+  FH E LK M+P M+ SV  +
Sbjct  123   RDKTYVKLEFPGDIKKILGDGLVATEGKKWARQRRLAHLAFHGECLKGMIPAMVDSVHAL  182

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L+RW++LE KE+++F++F ++T++VISRTAFGSS++EG+ IF++          N++   
Sbjct  183   LDRWQKLEAKEVELFEEFAMITSDVISRTAFGSSYIEGREIFQI----------NIW---  229

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTG  938
                     ++SD+I++E+LE+ I  A+L ++ KREK+ N G +++YGNDYLG L+K    
Sbjct  230   --------KTSDDIKSERLEKAICDALLGIIEKREKKVNVGEMDDYGNDYLGSLLK-AYH  280

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               D SK I++D ++DE +  + +G  TTTS+L W +FLLA+H +WQE+AR+E+ ++FG+E
Sbjct  281   DPDKSKRITIDDLMDECRTFHFSGQETTTSILTWTLFLLAIHKDWQEEARKEVTDVFGNE  340

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             +P  +GI +L+T+ MI+NE +RLYPPV+   RKV R+V LG+L +P  I + +PIL +HH
Sbjct  341   DPNHEGIMKLKTVGMIINESLRLYPPVVNTIRKVVRQVTLGDLVLPQGIALQIPILTIHH  400

Query  1299  DPQIWGQDVHVFNPHRFAQGVa-katnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMI  1475
              P+IWG DVH+F P RF +GVA   +N+ AAAF PFG+GPR CVG NF T E KI L+MI
Sbjct  401   SPRIWGDDVHLFKPERFREGVAGAVSNDAAAAFLPFGLGPRNCVGSNFATTEVKIILAMI  460

Query  1476  LQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             L+ Y FT+SP+YVH P  I  + P++G++VIL 
Sbjct  461   LRHYSFTVSPDYVHLPTQILTIRPQHGLKVILH  493



>gb|KHG16899.1| Secologanin synthase [Gossypium arboreum]
Length=512

 Score =   489 bits (1258),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 246/502 (49%), Positives = 339/502 (68%), Gaps = 3/502 (1%)
 Frame = +3

Query  78    SIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFD  257
               + L  L++ +    W P R++ +M SQGI GPPY F HGN+K+++ +  +++ K +  
Sbjct  9     CCFFLVALIKFLYDYLWVPLRIQHMMNSQGIKGPPYRFIHGNSKEVARLEQEALSKRV-A  67

Query  258   ISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD  437
             ++  IF ++ PH +T    YG  F+ W+G +P L I+EPELIKEVL   E    +  L D
Sbjct  68    LTDDIFPKVLPHFYTSINRYGRNFVYWNGARPELVISEPELIKEVLQTSEKKIQEKKLSD  127

Query  438   FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKEL  617
               ++ LG  L+   GEKWAK RKLANH FH ESLK M P +IASVE MLE+WK  EG+E+
Sbjct  128   IGREFLGNGLLFIAGEKWAKHRKLANHAFHGESLKNMTPAIIASVETMLEKWKGQEGREI  187

Query  618   DVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSD  797
             +V ++F +LT+EVISRTAFGSS+LEG+ IF M+  LT I  +N++  + P IS L +S+D
Sbjct  188   EVLQEFRLLTSEVISRTAFGSSYLEGEKIFAMLQKLTIIMSRNLFKSRIPLISKLWKSAD  247

Query  798   EIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQ  974
              +E+EKL + IK  +L++V+KRE K  NG V ++ +D+LG L+      SD    +SL+ 
Sbjct  248   LLESEKLSKEIKDRVLKIVKKREDKVVNGEVNSFRSDFLGLLLN-AYHDSDEKNRLSLED  306

Query  975   MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRT  1154
             ++ E K  Y AG  T  SLL W +  LA+H +WQEKARRE++++FG++NP  +GIA+L+ 
Sbjct  307   LVAECKTFYFAGQETVNSLLAWIVLHLAIHGDWQEKARREVIDIFGNQNPHLEGIAKLKI  366

Query  1155  MNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVF  1334
             M MI+NE +RLY P   + R V REV+LG L +PA+I I    + LH DP IWG DVH F
Sbjct  367   MTMIINETLRLYGPSNGLPRAVTREVQLGKLLLPANIDILPLNIGLHRDPHIWGDDVHHF  426

Query  1335  NPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYV  1514
              P RFA+G+AKATN   AAFFPFG+GPR+CVG+ F T E K+ALSMILQRY   LSP YV
Sbjct  427   KPERFAKGIAKATNYTTAAFFPFGLGPRSCVGMTFATIETKVALSMILQRYTIALSPAYV  486

Query  1515  HYPADIFILTPKNGVQVILQNV  1580
             H P  I  L P++G+QV L+ +
Sbjct  487   HSPIPILTLRPQHGIQVTLKPI  508



>ref|XP_008446467.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=525

 Score =   487 bits (1254),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 236/492 (48%), Positives = 337/492 (68%), Gaps = 6/492 (1%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             +L+ R WW P +++++MRSQGI GP Y+   GNTK++ + R ++M KPM  +SHHI  R+
Sbjct  26    KLLGRLWWRPMKIQQLMRSQGIQGPSYNLIQGNTKEMYSKRIKAMAKPM-QLSHHILPRV  84

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
              PH+H+W   YG  ++ W G   +L ITEPELIKEVL N+   +PK  L     K+ G  
Sbjct  85    LPHIHSWLNQYGRNYVQWFGADAHLVITEPELIKEVLNNQHKDFPKAKLQGHIHKIFGNG  144

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVL  644
             L T EG++W   RKLA+  FH +SLK M+P M+   E M+E W++ E KE+DVF+ F V 
Sbjct  145   LATAEGQRWVNSRKLAHFAFHGDSLKNMIPSMVQCAETMVEEWEQHEEKEIDVFEHFKVY  204

Query  645   TTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLER  824
             T +VIS TAFGSS+ +G++IF+M+  L  + + N Y V+ P IS + +S D+IE E LE+
Sbjct  205   TLDVISHTAFGSSYEQGRNIFQMLQRLCELYITNRYKVRLPVISKILKSEDDIEGESLEK  264

Query  825   GIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYG  1004
              +K   +E+++ RE +   +  +YGND+LG L+K        S+ ISL+ ++DE K LY 
Sbjct  265   KMKDCFVEIIKAREDQK--MNNDYGNDFLGLLVK-AKNDPQKSQRISLEDVVDECKTLYF  321

Query  1005  AGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMR  1184
             AGH TT+ LL W +FLLALH EWQEKAR E+ +LFGH NPT + + +L+TM+MI++E +R
Sbjct  322   AGHETTSLLLAWTMFLLALHKEWQEKARNEVFDLFGHSNPTFEALPKLKTMSMIIHESLR  381

Query  1185  LYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVa  1364
             LYPPV+T+ RKVE+E +LG L +P+ + + +P  A+HHD ++WG+    F P RF++G+A
Sbjct  382   LYPPVMTLVRKVEKETRLGRLVLPSGVHVVIPTAAIHHDEELWGRSADDFKPERFSEGIA  441

Query  1365  katnnnaa--aFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             KAT  N     + PFG+G R+CVG+NF  NEAKIA+SMILQR+ FTLSP Y H PA    
Sbjct  442   KATERNPVGGTYLPFGLGSRSCVGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAMFLT  501

Query  1539  LTPKNGVQVILQ  1574
             + P++G+Q+IL 
Sbjct  502   IAPQHGLQLILH  513



>ref|XP_007224911.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
 gb|EMJ26110.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
Length=451

 Score =   484 bits (1245),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 320/422 (76%), Gaps = 5/422 (1%)
 Frame = +3

Query  321   NTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKV  500
             + FL W+G++  L I EPEL KE+L NK+GA+ K     + KKLLG+ L T EGEKW K+
Sbjct  33    DEFLQWYGSQAQLVIVEPELCKEILNNKDGAFAKRKPQSYVKKLLGDGLATIEGEKWGKL  92

Query  501   RKLANHTFHAESLKRMVPEMIASVEVML-ERWKELEGKELDVFKDFGVLTTEVISRTAFG  677
             RKLANH FHAESLK MVPEM+AS E ML E WK  EGKE++VF+ F + T+EVISRTAFG
Sbjct  93    RKLANHAFHAESLKSMVPEMVASAETMLLEGWKNNEGKEIEVFEPFRMFTSEVISRTAFG  152

Query  678   SSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVR  857
             SS+LEG+++F+ +  L+ +  KN   V+FPGIS   ++SDEIE+EKL++G+  +I+ +V 
Sbjct  153   SSYLEGQNLFENLMKLSFLIFKNALTVRFPGISKFFKTSDEIESEKLQKGMHNSIIGIVE  212

Query  858   KREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLL  1034
             KREK++ +G  +++G+D+LG L+K     +D S+ IS+D ++DE K  Y AG  TT S+L
Sbjct  213   KREKKAMDGEEDSFGSDFLGLLLKAHHDTND-SQRISVDDLVDECKTFYFAGQETTNSML  271

Query  1035  GWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTR  1214
              W +FLLAL+T+WQE+AR+E+L+LFG +NP  DG+++L+ M  I+NE +RLYPPV++V R
Sbjct  272   AWTVFLLALNTDWQEEARKEVLQLFGRQNPNPDGLSKLKLM--IINESLRLYPPVVSVER  329

Query  1215  KVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaF  1394
             KV REV+LG L +PA++ + +PILA+HHDP+ WG+DV +F P RF +GVAKAT+NN AAF
Sbjct  330   KVRREVRLGKLIVPANVELIIPILAIHHDPEFWGEDVQLFKPERFEEGVAKATHNNIAAF  389

Query  1395  FPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              PFGMGPRTCV  NF   EAKIALSMILQRY FTLSP YVH P +   + P++GVQV L 
Sbjct  390   LPFGMGPRTCVAFNFAITEAKIALSMILQRYTFTLSPAYVHSPYEYLTVRPQHGVQVALH  449

Query  1575  NV  1580
             ++
Sbjct  450   SL  451



>gb|KHG20842.1| Secologanin synthase [Gossypium arboreum]
Length=512

 Score =   484 bits (1246),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 242/500 (48%), Positives = 335/500 (67%), Gaps = 3/500 (1%)
 Frame = +3

Query  78    SIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFD  257
               + L  L++ +    W P R++ +M SQGI GPPY F HGN+K+++ +  +++ K +  
Sbjct  9     CCFFLVALIKFLYDYLWVPLRIQHMMNSQGIKGPPYRFIHGNSKEVARLEQEALSKRV-A  67

Query  258   ISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD  437
             ++  IF ++ PH +T    YG  F+ W+G +P L I+EPELIKEVL   E    +  L D
Sbjct  68    LTDDIFPKVLPHFYTSINRYGRNFVYWNGARPELVISEPELIKEVLQTSEKKIQEKKLSD  127

Query  438   FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKEL  617
               ++ LG  L+   GEKWAK RKLANH FH ESLK M P +IASVE MLE+WK  EG+E+
Sbjct  128   IGREFLGNGLLFIAGEKWAKHRKLANHAFHGESLKNMTPAIIASVETMLEKWKGQEGREI  187

Query  618   DVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSD  797
             +V ++F +LT+EVISRTAFGSS+LEG+ IF M+  LT I  +N++  + P IS L +S+D
Sbjct  188   EVLQEFRLLTSEVISRTAFGSSYLEGEKIFAMLQKLTIIMSRNLFKSRIPLISKLWKSAD  247

Query  798   EIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQ  974
              +E+EKL + IK  ++ +V+KRE E+ NG V ++GND+LG L+      SD     SL+ 
Sbjct  248   LLESEKLSKEIKDRVMNIVKKREDEAVNGEVNSFGNDFLGLLVN-AYHDSDEKNRFSLED  306

Query  975   MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRT  1154
             ++ E K  Y +G  T  SLL W +  LA+H  WQEKARRE++++FG++NP  +G+A+L+ 
Sbjct  307   LLAECKTFYFSGQETVNSLLSWIVLHLAIHGNWQEKARREVIDIFGNQNPHLEGVAKLKI  366

Query  1155  MNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVF  1334
             M MI+NE +RLY P   + R V REV+LG L +PA+I I      +H DP  WG DVH F
Sbjct  367   MTMIINETLRLYGPSNGLARAVTREVQLGKLLLPANIDILPLYTGVHRDPHFWGDDVHHF  426

Query  1335  NPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYV  1514
              P RFA+G+AKATN  AAAF PFG+GPR+CVG+ F   E KI LSMILQRY FTLSP YV
Sbjct  427   KPERFAEGIAKATNYTAAAFLPFGLGPRSCVGMTFAMIETKIVLSMILQRYTFTLSPAYV  486

Query  1515  HYPADIFILTPKNGVQVILQ  1574
             H P  +  + P++ +QVIL+
Sbjct  487   HSPISVLSIRPQHEIQVILE  506



>gb|KHG24669.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score =   483 bits (1244),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 349/500 (70%), Gaps = 3/500 (1%)
 Frame = +3

Query  84    YLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDIS  263
             + L  L++ +    W P R++ ++ SQGI GPPY F HGN  +++ M+ +++ KP+  ++
Sbjct  15    FFLVALIKFLYDYLWVPLRIQHLLNSQGIKGPPYKFIHGNNHEVTKMKKEALSKPL-GLT  73

Query  264   HHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFA  443
               I  R+QPH+++W   YG  +L W+G +P L I+EPEL+KEVL N E  +PK     F 
Sbjct  74    DDILPRVQPHIYSWINRYGRNYLYWNGIRPELVISEPELVKEVLKNSENTFPKKKPSIFF  133

Query  444   KKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDV  623
              KLLG  L+  EGEKW K RKLANH FH E LK M P +IASVE MLE+WK  EGKE++V
Sbjct  134   SKLLGNGLLLLEGEKWVKRRKLANHVFHGERLKNMTPTVIASVETMLEKWKGQEGKEIEV  193

Query  624   FKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEI  803
             F++F +LT+EVISRTAF SS+LEG+ IF M+  L+ I  +N +  + P I+ L +  D +
Sbjct  194   FQEFRLLTSEVISRTAFDSSYLEGEKIFAMLKELSIIMSRNNFKTRIPLINKLWKPVDML  253

Query  804   EAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMI  980
             ++E+L +GI+  ++++V+KRE K  NG  +++GND+LG L+      S+ +  +S++ ++
Sbjct  254   KSEELAKGIQDCVMKIVKKREDKVVNGEADSFGNDFLGLLVN-AYHDSNENNRLSVEDLV  312

Query  981   DEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMN  1160
             DE K  Y AG  T  S+L W +  LA H +WQ+KARRE++++FG+ NP S+GI++L+T+ 
Sbjct  313   DECKTFYFAGQDTVNSILAWVVLHLATHGDWQDKARREVIDIFGNRNPDSEGISKLKTIT  372

Query  1161  MILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNP  1340
             MI+ E +RLY P   + R+V REV+LG L +PA+I I +  +ALH+DP  WG DVH+F P
Sbjct  373   MIIYETLRLYGPSNGLQRRVTREVQLGKLVLPANIDILLQNIALHNDPCQWGDDVHLFKP  432

Query  1341  HRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHY  1520
              RF +G+AK TN NAAAFFPFG+GPR+CVG++F   E K+ALSMILQRY  TLSP YVH 
Sbjct  433   ERFEEGIAKTTNYNAAAFFPFGLGPRSCVGMSFAITETKVALSMILQRYTITLSPAYVHS  492

Query  1521  PADIFILTPKNGVQVILQNV  1580
             P  I  + P++G+QVIL+++
Sbjct  493   PMPILAIRPQHGIQVILKSL  512



>gb|KDP41345.1| hypothetical protein JCGZ_15752 [Jatropha curcas]
Length=435

 Score =   479 bits (1234),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 228/424 (54%), Positives = 319/424 (75%), Gaps = 4/424 (1%)
 Frame = +3

Query  318   GNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEG-EKWA  494
             G  FL W G + +L ITEPE+IKE+L N++GA+PK++ DD+ KKLLG+  +T    EKW 
Sbjct  4     GTNFLYWQGPRAHLVITEPEMIKEILNNRDGAFPKIEPDDYVKKLLGDGTVTARTPEKWF  63

Query  495   KVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAF  674
             ++RKL+NH FHAE LK M+P MIASVE+ML+RWK     E+D F++F VLT+E+ISRTAF
Sbjct  64    RLRKLSNHAFHAECLKGMIPAMIASVEMMLQRWKICGCMEIDAFQEFKVLTSEIISRTAF  123

Query  675   GSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELV  854
             GSS+LEG++IF  +  L  I  +N Y VK PGIS L ++ D+IE+EKLE+GI+ +I+ ++
Sbjct  124   GSSYLEGQNIFDKLMRLGVIISRNKYKVKVPGISNLVKTEDDIESEKLEQGIQNSIISMI  183

Query  855   RKREKES-NGVVENYGNDYLGQLMKITTGGSDI--SKNISLDQMIDEIKALYGAGHLTTT  1025
             +KRE+ +     +++GND+LG L+K      D   +K +S+  +IDE K  Y AGH TTT
Sbjct  184   KKREQATITEKSDSFGNDFLGLLLKAHHDDRDAHKTKRLSVQDIIDECKTFYVAGHETTT  243

Query  1026  SLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVIT  1205
             S L W +FLLA+HT+WQ+KAR EIL+LF  +NP+ DG++R++ ++MI+NE +RLYPPV  
Sbjct  244   SSLSWIVFLLAVHTDWQDKARNEILQLFDLQNPSPDGLSRMKIVSMIINEALRLYPPVAA  303

Query  1206  VTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnna  1385
               R+V+R+V+LG L +PA+I + +PI+A+HH+PQIWG+DVH+F P RFA+G+AKATNNN 
Sbjct  304   FPREVQRQVRLGKLNLPANIEVEIPIIAIHHNPQIWGEDVHLFKPERFAEGLAKATNNNV  363

Query  1386  aaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQV  1565
              A+ PF +GPR+CVG NF+  E KIALSMILQRY FTLSP Y H P ++  + PK G+Q+
Sbjct  364   NAYLPFALGPRSCVGSNFSIMETKIALSMILQRYHFTLSPTYAHSPVNLLTVCPKYGLQI  423

Query  1566  ILQN  1577
             +L +
Sbjct  424   LLSS  427



>gb|KHG17439.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score =   482 bits (1240),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 348/500 (70%), Gaps = 3/500 (1%)
 Frame = +3

Query  84    YLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDIS  263
             + L  L++ +    W P R++ ++ SQGI GPPY F HGN  +++ M+ +++ KP+  ++
Sbjct  15    FFLVALIKFLYDYLWVPLRIQHLLNSQGIKGPPYKFIHGNNHEVTKMKKEALSKPL-GLT  73

Query  264   HHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFA  443
               I  R+QPH+++W   YG  +L W+G +P L I+EPEL+KEVL N E  +PK     F 
Sbjct  74    DDILPRVQPHIYSWINRYGRNYLYWNGIRPELVISEPELVKEVLKNSENTFPKKKPSIFF  133

Query  444   KKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDV  623
              KLLG  L+  EGEKW K RKLANH FH E LK M P +IASVE MLE+WK  EGKE++V
Sbjct  134   SKLLGNGLLLLEGEKWVKRRKLANHVFHGERLKNMTPTVIASVETMLEKWKGQEGKEIEV  193

Query  624   FKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEI  803
             F++F +LT+EVISRTAF SS+LEG+ IF M+  L+ I  +N +  + P I+ L +  D +
Sbjct  194   FQEFRLLTSEVISRTAFDSSYLEGEKIFAMLKELSIIMSRNNFKTRIPLINKLWKPVDML  253

Query  804   EAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMI  980
             ++E+L +GI+  ++++V+KRE K  NG  +++GND+LG L+      S+ +  +S++ ++
Sbjct  254   KSEELAKGIQDCVMKIVKKREDKVVNGEADSFGNDFLGLLVN-AYHDSNENNRLSVEDLV  312

Query  981   DEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMN  1160
             DE K  Y AG  T  S+L W +  LA H +WQ+KARRE++++FG+ NP S+GI++L+T+ 
Sbjct  313   DECKTFYFAGQDTVNSILAWVVLHLATHGDWQDKARREVIDIFGNRNPDSEGISKLKTIT  372

Query  1161  MILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNP  1340
             +I+ E +RLY P   + R V REV+LG L +PA+I I +  +ALHHDP  WG DVH+F P
Sbjct  373   VIIYETLRLYGPSNGLQRSVTREVQLGKLVLPANIDILVQNIALHHDPHQWGDDVHLFKP  432

Query  1341  HRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHY  1520
              RF +G+AKATN NAAAFFPFG+GPR+CVG++F   E K+ALSMILQRY   LSP YVH 
Sbjct  433   ERFEEGIAKATNYNAAAFFPFGLGPRSCVGMSFAITETKVALSMILQRYTINLSPAYVHS  492

Query  1521  PADIFILTPKNGVQVILQNV  1580
             P  I  + P++G+QVIL+++
Sbjct  493   PMPILAIRPQHGIQVILKSL  512



>gb|KCW44611.1| hypothetical protein EUGRSUZ_L01872 [Eucalyptus grandis]
Length=495

 Score =   479 bits (1234),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/495 (48%), Positives = 331/495 (67%), Gaps = 21/495 (4%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             +++++ + WW P R++  M +QGI GPPY F HG+TK++  M+ +   +PM ++SH IF 
Sbjct  21    VIKILHKLWWNPLRIQGKMAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM-NLSHDIFP  79

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
              +QPH++ W + YG  FL W+G + +L I++ E++KEVL N++  Y K  + D  KK +G
Sbjct  80    YVQPHLYEWTKTYGRNFLMWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIG  139

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFG  638
             + L T  GEKWAK RKLAN  FH E+LK MVP M+ S   ML+RW + EGKE+DV+K+  
Sbjct  140   DGLATFRGEKWAKHRKLANFAFHGENLKDMVPAMVDSAHTMLKRWSDREGKEIDVYKELR  199

Query  639   VLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKL  818
             +  ++VIS+TAFGSS+ EGK IF+ V+ L  + V    +  FP +  L RS+ EIE EK+
Sbjct  200   LYASDVISKTAFGSSYTEGKSIFENVNKLILVMVNA--SSSFPILRKLWRSAYEIEGEKI  257

Query  819   ERGIKGAILELVRKR-EKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKA  995
             E+G + A+LE+++KR EK ++G +E+YGND+LG L++  +   D  K I++D ++ E K 
Sbjct  258   EKGFREAVLEIIKKRQEKVNSGELESYGNDFLGLLLR-ASHEVDEKKKITIDNVVSECKT  316

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AGH T TS L W                 E   +FG+++P  DGI +L+T+ MI+NE
Sbjct  317   FYIAGHETATSFLAWT----------------EAFNVFGNQDPDLDGITKLKTIGMIINE  360

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPPV  ++R+V R+ KLGN  +PA I + +P L +HHDPQIWG D H+F P RF  
Sbjct  361   SLRLYPPVTFISREVSRQAKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLD  420

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             GVAKAT+NN A F PFG+GPR+CVG NF   EAKI LSMILQRY FTLSP YVH PA + 
Sbjct  421   GVAKATSNNPATFLPFGLGPRSCVGSNFVVVEAKIVLSMILQRYAFTLSPAYVHSPAQLL  480

Query  1536  ILTPKNGVQVILQNV  1580
             I  PK GVQV   ++
Sbjct  481   IAYPKYGVQVFFNSI  495



>gb|KHG16163.1| Cytochrome P450 protein [Gossypium arboreum]
Length=479

 Score =   478 bits (1231),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 238/477 (50%), Positives = 335/477 (70%), Gaps = 3/477 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             M SQGI GPPY F HGN K+ + M  ++  KPM  ++H IF R+ P V++W   YG T+L
Sbjct  1     MNSQGIRGPPYEFIHGNNKEAAQMLMEASTKPM-ALTHDIFPRVMPQVYSWVNKYGKTYL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
             +W+G +  L IT+P+L+KEVL N + A+       F  KL+G+ L T E EKWA+ RKLA
Sbjct  60    SWNGIRAQLLITDPDLVKEVLKNSDKAFRMPKASYFFDKLVGDGLATTEREKWARQRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             N+ FH ESLK M P ++ASVE MLE+WK  EGKE++VF++F +LT+EVISRTAFGSS+LE
Sbjct  120   NYAFHGESLKNMTPAVVASVETMLEKWKSNEGKEIEVFQEFRLLTSEVISRTAFGSSYLE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKE  872
             G+ IF M+  L+ I  +N+Y  K P IS L +S+DEIEAE++ + I  +++ +V+KRE+ 
Sbjct  180   GEKIFDMLMKLSVIAGRNIYKAKIPIISKLWKSADEIEAERIAKMIHDSVMRIVKKREER  239

Query  873   S-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIF  1049
               NG  +N+G D+LG L+       D    +S+  ++DE K  Y AG  T  SLL W   
Sbjct  240   VVNGEADNFGRDFLGLLVN-AYHEVDEKNRLSIQDLVDECKTFYVAGQETVNSLLAWATL  298

Query  1050  LLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVERE  1229
             LLA+H++WQ+KAR E++E+FG++NP S+G+A+L+T+ MI+ E +RLYPP+     +V RE
Sbjct  299   LLAIHSDWQDKARAEVIEVFGNQNPDSEGMAKLKTITMIIYETLRLYPPISGSIGEVRRE  358

Query  1230  VKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGM  1409
             V+LG L +P  + ++M I+ALHHDP +WG DV++F P RFA+G+AKAT  NAAAF PFG+
Sbjct  359   VRLGKLVLPTHLEVYMRIIALHHDPDLWGDDVNLFKPERFAEGIAKATKYNAAAFMPFGL  418

Query  1410  GPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             GPR+CVG++F   E K  LSMILQRY  T+SP YVH PA    L P++G+Q++  ++
Sbjct  419   GPRSCVGMSFAITEVKTTLSMILQRYTVTVSPTYVHAPAPRITLKPQHGIQLLFHSL  475



>ref|XP_011101783.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=489

 Score =   477 bits (1228),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 236/470 (50%), Positives = 341/470 (73%), Gaps = 8/470 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             +I +FFL+    I     L+R++ +  W P R++ ++RSQGI GPPY   HG+TK+   +
Sbjct  1     MIFSFFLSLITLI-----LIRVIHKVLWLPFRIQHMLRSQGITGPPYKIIHGSTKESLRL  55

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
             + Q+   PM ++SH IF R+QP  ++W ++YG  FLTW G +P+L ITEPEL+KE+L NK
Sbjct  56    KQQARDGPM-ELSHDIFPRVQPSFYSWMKLYGKNFLTWTGPQPHLVITEPELVKEILTNK  114

Query  405   EGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVML  584
             EG + K+ +   AKKL+G+ L+  EG KW+K+RKLANH F+AESLK M+P MIASVE ML
Sbjct  115   EGIFQKIKVQGPAKKLVGDGLVMTEGAKWSKLRKLANHAFYAESLKGMIPAMIASVENML  174

Query  585   ERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKF  764
             E W+  EGKE++V K+F V ++EVISRTAFGSS+LEGK+IF M+  L  +  KN   V+ 
Sbjct  175   ENWRMYEGKEIEVSKEFMVFSSEVISRTAFGSSYLEGKNIFDMLMKLGFLIFKNADKVRP  234

Query  765   PGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGG  941
              GI  + ++ D+IE++K+E+ ++ +++ ++RKRE++   G  +N+G+D+LG L+++    
Sbjct  235   FGIEKIWKTQDDIESDKIEQSLRDSLMVILRKREEKVLTGQADNFGSDFLGSLLRVHH-D  293

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN  1121
             +D    ISLD +IDE K  + AGH TT+SLL W   LLA+HT+WQ+KAR+E+LELFG EN
Sbjct  294   ADKKNRISLDDVIDECKVFFLAGHETTSSLLSWTFLLLAIHTDWQDKARKEVLELFGQEN  353

Query  1122  PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHD  1301
             PT++G+ RL+T +MI+NE +RLY PV ++ R+V R+V++G   +PA++ + +  LALH +
Sbjct  354   PTAEGLPRLKTASMIINEALRLYGPVASLVRRVARKVRVGKYVLPANMELQISPLALHRN  413

Query  1302  PQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNE  1451
             P+IWG+D H+F P RFA+G+A AT NN  AF PFG GPRTCVGLNF  NE
Sbjct  414   PEIWGEDAHLFKPERFAEGIATATRNNPMAFLPFGYGPRTCVGLNFANNE  463



>gb|KDO70290.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=452

 Score =   475 bits (1223),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 314/443 (71%), Gaps = 28/443 (6%)
 Frame = +3

Query  327   FLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRK  506
             FLTW+G++  L IT+PELIKE+L+N +G YPK+    F +K+LG+ L+T  GE W + RK
Sbjct  3     FLTWYGSRAQLVITQPELIKEILSNSDGTYPKVQAPGFLRKILGDGLVTAGGENWHRQRK  62

Query  507   LANHTFHAESLK--------------------------RMVPEMIASVEVMLERWKELEG  608
             LA   F+AESL+                           M+P M+ASVE+ML+RW+  EG
Sbjct  63    LATLAFYAESLRVTKSNCLMFKLKSVIVMLFNVFAPMQDMIPAMVASVEIMLKRWRHSEG  122

Query  609   KELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTR  788
             KE++V ++F +LT+E+ISRTAFGSS+LEG+ IF  ++N++ +  +N Y +K P I    +
Sbjct  123   KEIEVSQEFKLLTSEIISRTAFGSSYLEGESIFNKLTNMSFLASRNAYKIKIPLIGDFVK  182

Query  789   SSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNIS  965
             +SD++E +KLE+GI+ +I+++++ RE+++  G  E YGNDY G L+K      D++K IS
Sbjct  183   TSDDVEGDKLEQGIRDSIIKMMKTREEKALKGESEGYGNDYFGLLLK-AYHDPDMTKRIS  241

Query  966   LDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIAR  1145
             LD +IDE K  Y AGH TTT LL W I LLA HT+WQEK R E+LELFG +NP  DGI +
Sbjct  242   LDVLIDECKTFYIAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFGQKNPAPDGIGK  301

Query  1146  LRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDV  1325
             L+TM+M++NE +RLYPP + ++R VEREV+LG   +PA++ + +PILA+HHDPQIWG+DV
Sbjct  302   LKTMSMVINESLRLYPPAVNISRNVEREVRLGKYILPANMELVIPILAIHHDPQIWGEDV  361

Query  1326  HVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSP  1505
              +F P RFA GVAKA+NN  AAF PF  GPR CVGLNF   EAKIALSMILQRY+F LSP
Sbjct  362   DLFKPERFADGVAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSMILQRYRFNLSP  421

Query  1506  NYVHYPADIFILTPKNGVQVILQ  1574
             +YVH P  +  L P++G+QVI Q
Sbjct  422   SYVHSPVLVVTLRPQHGLQVIFQ  444



>ref|XP_007210003.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
 gb|EMJ11202.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
Length=561

 Score =   467 bits (1201),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 237/494 (48%), Positives = 334/494 (68%), Gaps = 38/494 (8%)
 Frame = +3

Query  105   RLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARI  284
             ++  + WWTP +++K+M  QGI GP Y   HGNT++ISNM+ ++M +P  ++SH +FA +
Sbjct  104   KIFHKLWWTPTQIQKLMALQGIKGPSYRLIHGNTQEISNMQKEAMARPR-NLSHDVFALV  162

Query  285   QPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEA  464
             QPH+H+W +IYG TFL W G +P L I +PEL KE+L NK  AYPK +   F  KLLG  
Sbjct  163   QPHLHSWTKIYGKTFLQWDGPQPVLVIVDPELCKEILNNKHRAYPKSNPVAFVMKLLGNG  222

Query  465   LITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVL  644
             L+ ++               HA         MIAS + MLERW+  E KE++VF++F +L
Sbjct  223   LVMSQ-------------RIHA---------MIASADTMLERWENHEAKEIEVFEEFRLL  260

Query  645   TTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLER  824
             T+EVISRTAFGSS+LEGK IF+M+  ++++T K     KFPG+S   +++DEIE EKLE+
Sbjct  261   TSEVISRTAFGSSYLEGKDIFEMLLKISSLTFKTALKPKFPGLSRFVKTNDEIEMEKLEK  320

Query  825   GIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALY  1001
              I+  I+E+V+KRE++   G   +  +D+LG L+K     +D ++ ISLD +++E K  Y
Sbjct  321   RIRETIIEIVKKRERKVMPGEEGSLRSDFLGLLLKAYLDTND-NQRISLDDLVEECKTFY  379

Query  1002  GAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECM  1181
              AGH +T + L W             +AR+E+L+LFG + P   GIA+L+TM+MI+ E +
Sbjct  380   LAGHESTATFLAWT------------EARKEVLQLFGKQTPNPKGIAKLKTMSMIMYESL  427

Query  1182  RLYPPVITVTRK-VEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQG  1358
             RLYPPV+ V R+ VEREVKLG L +PA++ + +PI+A H+D ++WGQDV +F P RFA+G
Sbjct  428   RLYPPVVLVIRRRVEREVKLGRLILPANLELAIPIVAFHYDSELWGQDVQLFKPERFAEG  487

Query  1359  VakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFI  1538
             V KAT+ N AAF PFGMGPR CVGLNF   EAKIALSMILQR+ FTLSP Y H P+    
Sbjct  488   VVKATDENIAAFLPFGMGPRICVGLNFAITEAKIALSMILQRHAFTLSPAYTHSPSQFLT  547

Query  1539  LTPKNGVQVILQNV  1580
             + P++ VQV+L ++
Sbjct  548   VRPQHEVQVMLHSL  561



>gb|KDP41344.1| hypothetical protein JCGZ_15751 [Jatropha curcas]
Length=430

 Score =   460 bits (1184),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 227/458 (50%), Positives = 319/458 (70%), Gaps = 28/458 (6%)
 Frame = +3

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             MR +S    M ++SH +F R+QPH + W +++G  F+ W G +P L +TEP+L+KE+L N
Sbjct  1     MRDESFNSSM-ELSHQVFPRLQPHYYLWSKLHGKNFINWLGPRPQLIVTEPQLVKEILNN  59

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             K+  YPK +   +  KL G+ L+T +                          MI SVE+M
Sbjct  60    KDELYPKPEFFTYMTKLFGDGLVTTKA-------------------------MITSVEMM  94

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L RW++ E KE+DV+K+F +LT+EVISRTAFGSS+LEG+HIF M+  L  +  KN Y V+
Sbjct  95    LRRWRQNEHKEIDVWKEFKLLTSEVISRTAFGSSYLEGQHIFDMLMELVLLLSKNGYEVR  154

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGG  941
              P I    ++ D+I++EKLE+G++ +IL++++KRE+E++ + ++YG+DYLG L+K     
Sbjct  155   IPIIKKFIKTKDDIKSEKLEQGVRDSILKMIKKREEEASEM-DSYGSDYLGVLIK-ANQD  212

Query  942   SDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN  1121
              D +K IS+D ++DE K  Y AG  TT SLL W IFLLA+HT+WQEKAR+E+LELFG  +
Sbjct  213   PDKTKKISIDDLVDECKTFYIAGQETTLSLLTWTIFLLAIHTDWQEKARKEVLELFGPRS  272

Query  1122  PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHD  1301
             PTSD I +L+ MNMILNE +RLY P+ T+ R+V++  KLG L  PA + + +P L +HHD
Sbjct  273   PTSDEINKLKIMNMILNETLRLYSPITTLIREVQKGSKLGKLLAPARMDLLIPTLGVHHD  332

Query  1302  PQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQ  1481
             P IWG+DVH+F P RFA+GVAKAT NN AAF PFG+GPR+CVG+NF   E KIALSMIL+
Sbjct  333   PDIWGEDVHLFKPERFAEGVAKATKNNIAAFVPFGLGPRSCVGMNFAMAETKIALSMILR  392

Query  1482  RYKFTLSPNYVHYPADIFILTPKNGVQVILQNV*LLSC  1595
             RY+FTLSP Y+H P  +  ++PK G+Q+ILQ +   +C
Sbjct  393   RYRFTLSPTYIHSPIVVIGVSPKKGLQIILQALEDQNC  430



>gb|KHG20729.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=936

 Score =   476 bits (1224),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 237/487 (49%), Positives = 336/487 (69%), Gaps = 18/487 (4%)
 Frame = +3

Query  150   VMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTF  329
             ++ SQGI GPPY F HGN ++I+ MR ++  KPM  ++H IF ++QPH+++W   YG  +
Sbjct  1     MLNSQGIKGPPYRFIHGNNREIAKMRQEASSKPM-ALTHDIFPKVQPHIYSWINKYGRNY  59

Query  330   LTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKL  509
             L W+G +  L I+EPEL+KE+L N E  +PK     +  KLLG  L+T EGEKWAK RKL
Sbjct  60    LYWNGVRAELVISEPELVKEILKNSEKTFPKRKPTIYLSKLLGNGLVTVEGEKWAKQRKL  119

Query  510   ANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFL  689
             AN+ FH ESLK M P +IASVE ML++WK  EGKE++VF +F +LT+EVISRTAFGSS+L
Sbjct  120   ANYVFHGESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVISRTAFGSSYL  179

Query  690   EGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-  866
             EG+ I+     LT +             S L + +D +E+E+L + I+  ++++V+KRE 
Sbjct  180   EGEKIW-----LTLVFSS----------SKLWKPADMLESEELAKEIQDCVMKIVKKRED  224

Query  867   KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCI  1046
             K  NG  +++GND+LG L+      SD +  +S++ ++DE K  Y AG  T  +LL W +
Sbjct  225   KVVNGEADSFGNDFLGLLVN-AYHDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWTV  283

Query  1047  FLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVER  1226
              LLA+H +WQ+KARRE++ +FG++NP  +GIA+L+TM MI+NE +RLY     + R+V R
Sbjct  284   LLLAIHGDWQDKARREVIGIFGNQNPQPEGIAKLKTMTMIINETLRLYSSSNGMLRRVGR  343

Query  1227  EVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFG  1406
             +V++  + +PA+I + +    LHHDPQ+WG+DVH+F P RFA+G+AKATN NAAAF PFG
Sbjct  344   DVQMEKVVLPANIDLLIANAVLHHDPQLWGEDVHLFKPDRFAEGIAKATNYNAAAFLPFG  403

Query  1407  MGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV*L  1586
             +GPRTCVG+ F T E KIALSMILQRY  TLSP YVH P  +  L P++G+Q ++ +  +
Sbjct  404   LGPRTCVGMTFATTETKIALSMILQRYAITLSPAYVHSPIPVISLQPQHGIQHMMNSQGI  463

Query  1587  LSCPYGL  1607
                PY  
Sbjct  464   KGPPYAF  470


 Score =   474 bits (1220),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 233/481 (48%), Positives = 331/481 (69%), Gaps = 3/481 (1%)
 Frame = +3

Query  141   LRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYG  320
             ++ +M SQGI GPPY+F +GN K+ +   ++++ KPM  + H IF R+QPHV++    YG
Sbjct  454   IQHMMNSQGIKGPPYAFIYGNNKEATKTTNEALSKPM-ALRHDIFPRVQPHVYSCINRYG  512

Query  321   NTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKV  500
               +L W G +P L ITEPEL+ EVL +    +PK     F   + G  L+T  GEKW K 
Sbjct  513   RNYLAWDGKRPELVITEPELVNEVLKHSVTTFPKRKPTFFLTGIFGNGLVTALGEKWVKQ  572

Query  501   RKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGS  680
             RKLAN+ FH ESLK M P +IASVE MLE+WK   GKE++V+ +F +LT+EVISRTAFGS
Sbjct  573   RKLANYAFHGESLKNMTPAVIASVETMLEKWKGYVGKEIEVYHEFRLLTSEVISRTAFGS  632

Query  681   SFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRK  860
             S+LEG+ IF M++ L+ I  +N +  + P I+   +S D +E+E+L +GI+  ++++V+K
Sbjct  633   SYLEGEKIFDMLNKLSIIRSRNFFETRIPLINKFWKSGDVLESEELSKGIQDCVMKIVKK  692

Query  861   RE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLG  1037
             RE K  NG V+++GND+LG L+      SD +  +S + ++DE K  Y AG  T  SL+ 
Sbjct  693   REDKVVNGEVDSFGNDFLGLLVN-AYHDSDENNRLSTEDLVDECKTFYFAGQDTVNSLIA  751

Query  1038  WCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRK  1217
             W +FLLA+H +WQEKARRE++E+FG++ P S+ +++L+ M MI+ E +RLY P   + R+
Sbjct  752   WIVFLLAIHGDWQEKARREVIEIFGNQIPNSEEMSKLKIMTMIIYETLRLYGPSNGMMRR  811

Query  1218  VEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFF  1397
              E +V+LG L +PA++ + +   A HHDPQ+WG DVH+F P RFA+G+AKATN NA  F 
Sbjct  812   TESDVQLGKLILPANLDLLVIHSAPHHDPQLWGDDVHLFKPERFAEGIAKATNYNAGVFC  871

Query  1398  PFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQN  1577
             PFG+GPR CVG NF T E KI LSMILQRY   LSP YVH P     + P++G+QVIL++
Sbjct  872   PFGLGPRNCVGTNFATMETKIVLSMILQRYTIYLSPTYVHSPIPYITVQPQHGIQVILES  931

Query  1578  V  1580
             +
Sbjct  932   L  932



>gb|KHG14912.1| Cytochrome P450 protein [Gossypium arboreum]
Length=497

 Score =   461 bits (1186),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 230/503 (46%), Positives = 337/503 (67%), Gaps = 19/503 (4%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
              S++L+  L++ +    W P  ++ ++ SQGI GPPY F HGN K+I  M  ++M KP  
Sbjct  9     CSLFLI-ALIKFLYDYLWVPLSIQHMLNSQGIKGPPYRFIHGNNKEIIKMIKEAMSKPK-  66

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
              ++H +F ++QPH H+W + YG  F+ W+G +  L I+E EL+KEV+ N    +PK    
Sbjct  67    ALTHDMFIKLQPHTHSWIKEYGKNFVYWNGVRAELVISEAELVKEVMKNSLNVFPKAKPS  126

Query  435   DFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKE  614
              +   LLG  L+  EG  + +                M P +IASVE MLE+WK  EGKE
Sbjct  127   VYVSNLLGNGLVMIEGVLFGR---------------NMTPAVIASVETMLEKWKGKEGKE  171

Query  615   LDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSS  794
             ++V+++F +LT+EVISRTAFGSS+LEG+ IF M++ L+ I  +N+++ K P IS L + +
Sbjct  172   IEVYQEFRLLTSEVISRTAFGSSYLEGEKIFAMLNKLSIIMSRNLFSTKIPLISKLWKPA  231

Query  795   DEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLD  971
             D +E+E+L   I+  ++++V+KRE +  NG  +++GND+LG L+       D ++ +S+D
Sbjct  232   DLLESERLANEIQDCVMKIVKKREDRVVNGEADSFGNDFLGLLVNAYHDLDDENR-LSMD  290

Query  972   QMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLR  1151
              ++ E K  Y AG  T   LL W + LL++H +WQEKARRE++E+FG++NP SDGI++L+
Sbjct  291   DLVAECKTFYVAGQETVNGLLAWIVLLLSIHEDWQEKARREVIEVFGNQNPDSDGISKLK  350

Query  1152  TMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHV  1331
              + MI+ E +RLY P   + R+V R+V++G L +PA+I + +   ALHHDPQ+WG DVH+
Sbjct  351   IITMIIYETLRLYGPTTGLPRRVARKVQVGKLVLPANINLLIAKAALHHDPQLWGDDVHL  410

Query  1332  FNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNY  1511
             F P RFA G+AKATN NAAAFFPFG+GPR CVG+ F T E KIALSMILQRY  TLSP Y
Sbjct  411   FKPERFADGIAKATNYNAAAFFPFGLGPRFCVGMTFATTETKIALSMILQRYSVTLSPAY  470

Query  1512  VHYPADIFILTPKNGVQVILQNV  1580
             VH P  I  L P++G+QVI +++
Sbjct  471   VHSPVPIITLKPEHGIQVIFESL  493



>gb|AAZ39644.1| cytochrome P450 monooxygenase [Petunia x hybrida]
Length=504

 Score =   460 bits (1184),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 231/513 (45%), Positives = 348/513 (68%), Gaps = 14/513 (3%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGN-TKQISN  221
             ++TA    F V + L+  L R + ++WW P  L+ +M+SQGI GPPY  P+ N  K + +
Sbjct  1     MMTAICFVFLVGLALV--LARFLYKSWWYPVSLQLLMKSQGIKGPPYKAPNWNYAKGVLD  58

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             M  +S   PM +ISH I  R+ P V++W  +YG  FL W  T+P L +T+  LIKE+L++
Sbjct  59    MEVKSTSAPM-EISHDIIPRLFPQVYSWINLYGKNFLHWIDTQPQLVVTDINLIKEILSD  117

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             KEG++ K+ L+   KK LG  ++  EG+KW+K+RK+ANH FH ++LK  VP M+ASVE +
Sbjct  118   KEGSFDKVQLEGVLKKFLGGGIVFEEGKKWSKLRKVANHAFHGQNLKEKVPAMVASVEEL  177

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L+ WK  EGKE++VFK+F +L+ E+IS++ FGS +L GK ++ M+  +  I  K + + K
Sbjct  178   LKTWKSYEGKEIEVFKEFKLLSLEIISKSVFGSDYLTGKTMYHMLDEIVLICYKIIAD-K  236

Query  762   FPGISMLTRSSDEIE-AEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITT  935
             F      ++SS E++ A+ + +    +++ ++++RE K   G   N+G+D+LG LM+ + 
Sbjct  237   F------SKSSHELKVADHILQAFVDSLVGIMKQREDKVKAGQSNNFGSDFLGSLME-SH  289

Query  936   GGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGH  1115
               +D +K IS+ ++I+E K  Y AGH T  S+L W I LLA+HT+WQ+ AR+E+LE+ G 
Sbjct  290   HNTDQNKRISVVEIIEECKTFYFAGHETVRSVLSWSILLLAVHTDWQDTARKEVLEMLGQ  349

Query  1116  ENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALH  1295
              NP  + I+RL+T+ MILNE +RLYPP++ + RKV+R +KLG L +PA + +++  LA+H
Sbjct  350   GNPNIESISRLKTVGMILNETLRLYPPLVFLHRKVKRNIKLGELRLPAGMEVYIASLAVH  409

Query  1296  HDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMI  1475
             H+ +IWG+D H+F P RFA+GVAKAT +   AF  FG G R CVG NF   E KIAL MI
Sbjct  410   HNSEIWGEDTHLFKPERFAEGVAKATRDQLMAFLSFGFGLRKCVGFNFAQMEVKIALCMI  469

Query  1476  LQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             LQRY+FT+SPNY H+P  +  L PK+G+Q++L 
Sbjct  470   LQRYRFTVSPNYRHFPTLVMGLWPKHGIQIMLH  502



>gb|KHG26580.1| Cytochrome P450 protein [Gossypium arboreum]
Length=497

 Score =   459 bits (1181),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 230/503 (46%), Positives = 337/503 (67%), Gaps = 19/503 (4%)
 Frame = +3

Query  75    VSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMF  254
              S++L+  L++ +    W P  ++ ++ SQGI GPPY F HGN K+I  M  ++M KP  
Sbjct  9     CSLFLI-ALIKFLYDYLWVPLSIQHMLNSQGIKGPPYRFIHGNNKEIIKMIKEAMSKPK-  66

Query  255   DISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLD  434
              ++H +F ++QPH H+W + YG  F+ W+G +  L I+E EL+KEV+ N    +PK    
Sbjct  67    ALTHDMFIKLQPHTHSWIKEYGKNFVYWNGVRAELVISEAELVKEVMKNSLNVFPKAKPS  126

Query  435   DFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKE  614
              +   LLG  L+  EG  + +                M P +IASVE MLE+WK  EGKE
Sbjct  127   VYVSNLLGNGLVMIEGVLFGR---------------NMTPAVIASVETMLEKWKGKEGKE  171

Query  615   LDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSS  794
             ++V+++F +LT+EVISRTAFGSS+LEG+ IF M++ L+ I  +N+++ K P IS L + +
Sbjct  172   IEVYQEFRLLTSEVISRTAFGSSYLEGEKIFAMLNKLSIIMSRNLFSTKIPLISKLWKPA  231

Query  795   DEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLMKITTGGSDISKNISLD  971
             D +E+E+L   I+  ++++V+KRE +  N   +++GND+LG L+       D ++ +S++
Sbjct  232   DLLESERLANEIQDCVMKIVKKREDRVVNAEADSFGNDFLGLLVNAYHDLDDKNR-LSME  290

Query  972   QMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLR  1151
              ++ E K  Y AG  T  +LL W + LLA+H +WQEKARRE++E+FG++NP SDGI++L+
Sbjct  291   DLVAECKTFYVAGQETVNALLAWMVLLLAIHKDWQEKARREVIEVFGNQNPDSDGISKLK  350

Query  1152  TMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHV  1331
              + MI+ E +RLY P   + R+V R+V++G L  PA+I + +   ALHHD Q+WG DVH+
Sbjct  351   IITMIIYETLRLYGPTNGLPRRVARKVQVGKLVFPANINLLIAKAALHHDHQLWGDDVHI  410

Query  1332  FNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNY  1511
             F P RFA G+AKATN NAAAFFPFG+GPR CVG+ F T E KIALSMILQRY FTLSP Y
Sbjct  411   FKPERFADGIAKATNYNAAAFFPFGLGPRFCVGMTFATTETKIALSMILQRYSFTLSPAY  470

Query  1512  VHYPADIFILTPKNGVQVILQNV  1580
             VH P  I  L P++G+QVIL+++
Sbjct  471   VHSPVHIITLQPEHGIQVILESL  493



>ref|XP_010046246.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=462

 Score =   453 bits (1166),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 225/478 (47%), Positives = 332/478 (69%), Gaps = 32/478 (7%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGK---PMFDISHHIFARIQPHVHTWKEIYGN  323
             M SQGI GPPY F HG+TK+I  ++   M K   PM ++SH I   ++ H+H   +  G 
Sbjct  1     MASQGIKGPPYKFIHGSTKEIFKLKEDVMTKTNEPMTNVSHEILPIVENHIHGGIKYMGG  60

Query  324   TFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVR  503
               L W+G +  L I++ EL+KEVL N++  Y K +     KKLLG+ L++ EG+KW + R
Sbjct  61    ICLYWYGPQAQLLISDTELVKEVLNNRDKTYVKPEFPGDIKKLLGDGLVSTEGKKWTRQR  120

Query  504   KLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSS  683
             +LA+  FH ESLK M+P M+ SV ++L+RW+ LE + +++F++F  +T++VISRTAFGSS
Sbjct  121   RLAHLAFHGESLKCMIPAMVDSVHMLLKRWQNLEARVVELFEEFTAITSDVISRTAFGSS  180

Query  684   FLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR  863
             ++EG+++F+M+  LT I  +N++ ++ PG+  + ++ DEI++E+LE+ I+  +LE++RKR
Sbjct  181   YIEGRNMFQMLGELTTIASRNIFKLRLPGVRNIWKTIDEIDSERLEKAIRDVVLEIIRKR  240

Query  864   EKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGW  1040
             E++ N G + +YGND LG L+K      D SK I++D ++DE K  Y AG  TT S+L W
Sbjct  241   EEKVNTGEMNDYGNDLLGSLLK-AYHDPDESKRITIDDVMDECKTFYFAGQETTNSVLTW  299

Query  1041  CIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKV  1220
              +FLLA+H +WQ++AR+E+ ++FG+E+P                           + RKV
Sbjct  300   TLFLLAIHKDWQQEARKEVTDVFGNEDP---------------------------LLRKV  332

Query  1221  EREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFP  1400
             +++V LGNL +PADI + +P LA+HHD +IWG DVH+F P RF++G+AKATNNNAAAF P
Sbjct  333   KKQVTLGNLVLPADIVLDIPTLAIHHDRRIWGNDVHLFKPERFSEGIAKATNNNAAAFLP  392

Query  1401  FGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             FG+GPRTCVG+NF TNEAKIA++MILQRY FTLSP Y+H PA I  + P++GV+VIL 
Sbjct  393   FGLGPRTCVGINFATNEAKIAIAMILQRYSFTLSPGYIHLPAHILTIHPQHGVKVILH  450



>ref|XP_008243893.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Prunus mume]
Length=388

 Score =   449 bits (1154),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 212/387 (55%), Positives = 296/387 (76%), Gaps = 5/387 (1%)
 Frame = +3

Query  426   DLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELE  605
             D   + KKLL + L + EGEKW K+RKLANH FH +SLK M+P M ASVE ML RWK+ E
Sbjct  5     DSQAYVKKLLVDGLASTEGEKWGKLRKLANHAFHGDSLKSMIPTMTASVETMLVRWKKHE  64

Query  606   GKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLT  785
             GKE++VF++F +LT+EV+SRTAFGSS+LEGK++F+M+  L  +  KN++   FPGIS L 
Sbjct  65    GKEIEVFEEFRLLTSEVVSRTAFGSSYLEGKNVFEMLMRLYFLIFKNLFKFSFPGISKLI  124

Query  786   RSSDEIEAEKLERGIKGAILELVRKREKESN--GVVENYGNDYLGQLMKITTGGSDISKN  959
             ++ DE+E++KLE+GI+  I+E+V+KRE+++   G  +++G+D+LG L+K      +  + 
Sbjct  125   KTKDEVESKKLEKGIREGIIEIVKKREEKAIMIGETDSFGSDFLGLLLKAHHDSKE-KQR  183

Query  960   ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGI  1139
             IS+D ++D+ K  Y AG  TT +LL W +FLL LHT+WQE+AR+EIL++FG + P SDG+
Sbjct  184   ISVDDLVDKCKTFYFAGQETTNTLLAWTVFLLVLHTDWQEEARKEILQIFGKQAPNSDGL  243

Query  1140  ARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQ  1319
             A+L+TM MI+NE +RLYPP++++ RKVERE++LG L +PA++ IF+P LA+HH+PQ+WG+
Sbjct  244   AKLKTMGMIINEXLRLYPPIVSIARKVERELRLGKLIVPANVEIFIPSLAIHHEPQLWGE  303

Query  1320  DVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTL  1499
             DVH+F P +F++G+AKAT N  AAF PF MGPR CVG N T  EAKI LSMILQRY FTL
Sbjct  304   DVHLFKPEQFSEGIAKATKNRIAAFLPFVMGPRNCVGFNXT--EAKIVLSMILQRYSFTL  361

Query  1500  SPNYVHYPADIFILTPKNGVQVILQNV  1580
             SP YVH P     + P++GVQVIL ++
Sbjct  362   SPAYVHSPLQYITVRPQHGVQVILHSL  388



>gb|KHG08575.1| Cytochrome P450 protein [Gossypium arboreum]
Length=454

 Score =   450 bits (1157),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 228/452 (50%), Positives = 322/452 (71%), Gaps = 5/452 (1%)
 Frame = +3

Query  231   QSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEG  410
             ++  KPM  ++H IF R+ PHV++W   YG T+L+W+G +  L IT+PEL+KEVL N E 
Sbjct  2     EASTKPM-ALTHDIFPRVMPHVYSWINKYGKTYLSWNGIRARLLITDPELVKEVLKNSEK  60

Query  411   AYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLER  590
             A+PK     F  KL+G+ L + E EKWA+ RKLAN+ FH ESLK M P ++ASVE MLE+
Sbjct  61    AFPKPKRSYFIDKLIGDGLASTESEKWARQRKLANYAFHGESLKNMTPAVVASVETMLEK  120

Query  591   WKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG  770
             WK  EGKE++VF++F +LT+EVISRTAFGSS+LEG+ IF M+  L+ IT +N++  K P 
Sbjct  121   WKSKEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFDMLMKLSVITGRNIFKAKIPI  180

Query  771   ISMLTRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSD  947
             IS   +S+DEIE+E++ + I  +++ +V+KRE+    G  +N+G D+LG L+       +
Sbjct  181   ISKFWKSADEIESERIAKMIHDSVMSIVKKREERVVTGEADNFGCDFLGLLVNAYHEADE  240

Query  948   ISKNISLDQ-MIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENP  1124
               KNI L Q ++DE K  Y  G  T  +LL W   LLA+HT+WQ++AR E++E+FG++NP
Sbjct  241   --KNILLIQDLVDECKTFYFGGQETVNTLLAWATLLLAIHTDWQDRARAEVIEVFGNQNP  298

Query  1125  TSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDP  1304
               +G+A+L+T+ MI+NE +RLYPPV  V RKV +EV+LG L +P  + + M I+ALHHDP
Sbjct  299   NFEGMAKLKTITMIINETLRLYPPVNGVIRKVGKEVRLGKLVLPTHLEVDMRIIALHHDP  358

Query  1305  QIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQR  1484
              +W  DV++F P RFA+G+AKAT  NAAAF PFG+GPR+CVG++F   EAKIALSMILQ 
Sbjct  359   DLWEDDVNLFKPERFAEGIAKATKYNAAAFMPFGLGPRSCVGMSFAITEAKIALSMILQC  418

Query  1485  YKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             Y   +SP YVH PA    L P++G+Q++  ++
Sbjct  419   YTVIVSPTYVHAPAQRLTLKPQHGIQLLFHSL  450



>ref|XP_010046249.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=497

 Score =   449 bits (1155),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 225/493 (46%), Positives = 328/493 (67%), Gaps = 59/493 (12%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQ---SMGKPMFDISHHIFARIQPHVHTWKEIYGN  323
             M SQGI GPPY F HG TK+IS ++      M +PM ++SH I   ++PH+H W ++YG 
Sbjct  1     MASQGIKGPPYKFIHGCTKEISKLKKDVMMKMNEPMTNVSHEILPIVEPHIHKWNKLYGG  60

Query  324   TFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVR  503
              FL WHG +  L I++ EL+KE                                      
Sbjct  61    IFLFWHGPEALLSISDTELVKEC-------------------------------------  83

Query  504   KLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSS  683
                           M+P M+ SV ++L+RW+ LE +E+++F++F  +T++VISRTAFGSS
Sbjct  84    --------------MIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSS  129

Query  684   FLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR  863
             ++EG++IF+M+  LT I  +N++ ++ PG+  + ++SDEI++E+LE+ I  A+LE+++ R
Sbjct  130   YIEGRNIFRMLGELTTIVSRNLFKLRLPGVRKIWKTSDEIDSERLEKAIHDAVLEIIKNR  189

Query  864   EKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGW  1040
             E++ N G + NYGND+LG L+K      D SK I++D +IDE K  Y AG  TT S+L W
Sbjct  190   EEKVNTGEMNNYGNDFLGSLLK-AYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTW  248

Query  1041  CIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKV  1220
              +FLLA+H +WQ++AR+E+  +FG+E+P  DG+ +L+T+ MI+NE +RLYPPVI+V RKV
Sbjct  249   TLFLLAIHKDWQQEARKEVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPVISVFRKV  308

Query  1221  EREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFP  1400
             +++V LG+L +PADI + +P LA+HHD +IWG DVH+F P RF++G+AKATNNNAAAF P
Sbjct  309   KKQVTLGSLVLPADIVLHIPTLAIHHDARIWGNDVHLFKPERFSEGIAKATNNNAAAFLP  368

Query  1401  FGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             FG+GPR CVGLNF  NE KIA++MILQRY FTLSP Y+ +PA    + P+ GV+VIL   
Sbjct  369   FGLGPRNCVGLNFAMNEVKIAVAMILQRYSFTLSPGYIPWPAHFLTIHPQPGVKVILHP-  427

Query  1581  *LLSCPYGLSLLV  1619
               L C + LS ++
Sbjct  428   --LQCEHVLSRII  438



>gb|KCW44878.1| hypothetical protein EUGRSUZ_L01541, partial [Eucalyptus grandis]
Length=397

 Score =   443 bits (1140),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 209/397 (53%), Positives = 306/397 (77%), Gaps = 2/397 (1%)
 Frame = +3

Query  375   ELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVP  554
             EL+KEVL N++  Y K D     KKLLG+ L + +GEKWA+ R+LA+  FH ESLK M+P
Sbjct  2     ELVKEVLNNRDKTYVKPDFPGDIKKLLGDGLFSTKGEKWARQRRLAHLAFHGESLKCMIP  61

Query  555   EMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAI  734
              M+ SV ++L+RW+ LE + +++F++F  +T++VISRTAFGSS++EG+++F+M+  LT I
Sbjct  62    AMVDSVHMLLKRWQNLEARVVELFEEFTAITSDVISRTAFGSSYIEGRNMFQMLGELTTI  121

Query  735   TVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYL  911
               +N++ ++ PG+  + ++ DEI++E+LE+ I+  +LE++RKRE++ N G + +YGND L
Sbjct  122   ASRNIFKLRLPGVRNIWKTIDEIDSERLEKAIRDVVLEIIRKREEKVNTGEMNDYGNDLL  181

Query  912   GQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARR  1091
             G L+K      D SK  ++D ++DE K  Y AG  TT S+L W +FLLA+H +WQ++AR+
Sbjct  182   GSLLK-AYHDPDESKRTTIDDVMDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEARK  240

Query  1092  EILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITI  1271
             E+ ++FG+E+P  DGI +L+T+ MI+NE +RLYPPVI++ RKV+++V LGNL +PADI +
Sbjct  241   EVTDVFGNEDPNHDGIMKLKTVGMIINESLRLYPPVISLLRKVKKQVTLGNLVLPADIVL  300

Query  1272  FMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNE  1451
              +P LA+HHD +IWG DVH+F P RF++G+AKATNNNAAAF PFG+GPRTCVG+NF TNE
Sbjct  301   DIPTLAIHHDRRIWGNDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRTCVGINFATNE  360

Query  1452  AKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQ  1562
             AKIA++MILQRY FTLSP Y+H PA I  + P++GV+
Sbjct  361   AKIAIAMILQRYSFTLSPGYIHLPAHILTIHPQHGVK  397



>gb|KCW44686.1| hypothetical protein EUGRSUZ_L01780, partial [Eucalyptus grandis]
Length=407

 Score =   436 bits (1120),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 207/410 (50%), Positives = 307/410 (75%), Gaps = 5/410 (1%)
 Frame = +3

Query  375   ELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVP  554
             EL+KEVL N++  Y K D  +  KKL G+ L + + EKWA+ R+LA+  FH ESLK M+P
Sbjct  2     ELVKEVLNNRDKTYVKPDFQENIKKLFGDGLFSTKREKWARQRRLAHLAFHGESLKCMIP  61

Query  555   EMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAI  734
              M+ SV ++L+RW+ LE +E+++F++F  +T++VISRTAFGSS++EG++IF+M+  LT I
Sbjct  62    AMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGRNIFRMLGELTTI  121

Query  735   TVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYL  911
               +N + ++ P +  + ++SDEI++E+LE+ I+ A+LE+++KRE++ N G + +YGND+L
Sbjct  122   ASQNHFKLRLPEVRKIWKTSDEIDSERLEKAIRDAVLEIIKKREEKVNTGEMNDYGNDFL  181

Query  912   GQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARR  1091
             G L+K      D SK I++D +IDE K  Y AG  TT S+L W +FLLA+H +WQ++AR+
Sbjct  182   GSLLK-AYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEARK  240

Query  1092  EILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITI  1271
             E+  +FG+E+P  DG+ +L+T+ MI+NE +RLYPP+I++ RKV+++V LG+L +PADI +
Sbjct  241   EVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPLISIFRKVKKQVTLGSLVLPADIVL  300

Query  1272  FMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNE  1451
              +P L +HHD +IWG DVH+F P RF++G+AKATNNN AAF PFG+GPR CVGLNF  NE
Sbjct  301   HIPTLIIHHDRRIWGIDVHLFKPERFSEGIAKATNNNTAAFLPFGLGPRNCVGLNFAMNE  360

Query  1452  AKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV*LLSCPY  1601
              KIA++MILQRY FTLSP Y+  PA    + P++GV+VIL +   L C +
Sbjct  361   VKIAIAMILQRYSFTLSPGYIPLPAHFLTIHPQHGVKVILHS---LQCEH  407



>ref|XP_010041134.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Eucalyptus 
grandis]
Length=430

 Score =   434 bits (1115),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 224/471 (48%), Positives = 302/471 (64%), Gaps = 42/471 (9%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFL  332
             M +QGI GPPY F HG+TK++  M+ +   +PM ++SH IF  +QPH++ W + YG  FL
Sbjct  1     MAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM-NLSHDIFPYVQPHLYEWTKTYGRNFL  59

Query  333   TWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLA  512
              W+G + +L I++ E++KEVL N++  Y K  + D  KK +G+ L T  GEKWAK RKLA
Sbjct  60    MWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIGDGLATFRGEKWAKHRKLA  119

Query  513   NHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLE  692
             N  FH E+LK MVP M+ S   ML+RW + EGKE+DV+K+  +  ++VIS+TAFGSS+ E
Sbjct  120   NFAFHGENLKDMVPAMVDSAHTMLKRWSDREGKEIDVYKELRLYASDVISKTAFGSSYTE  179

Query  693   GKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR-EK  869
             GK IF+ V+ L  + V    +  FP +  L RS+ EIE EK+E+G + A+LE+++KR EK
Sbjct  180   GKSIFENVNKLILVMVNA--SSSFPILRKLWRSAYEIEGEKIEKGFREAVLEIIKKRQEK  237

Query  870   ESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIF  1049
              ++G +E+YGND+LG L++  +   D  K I++D ++ E K  Y AGH T TS L W   
Sbjct  238   VNSGELESYGNDFLGLLLR-ASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAW---  293

Query  1050  LLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVERE  1229
                                               T+ MI+NE +RLYPPV  ++R+V R+
Sbjct  294   ----------------------------------TIGMIINESLRLYPPVTFISREVSRQ  319

Query  1230  VKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGM  1409
              KLGN  +PA I + +P L +HHDPQIWG D H+F P RF  GVAKAT+NN A F PFG+
Sbjct  320   AKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLDGVAKATSNNPATFLPFGL  379

Query  1410  GPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQ  1562
             GPR+CVG NF   EAKI LSMILQRY FTLSP YVH PA + I  PK GVQ
Sbjct  380   GPRSCVGSNFVVVEAKIVLSMILQRYAFTLSPAYVHSPAQLLIAYPKYGVQ  430



>gb|KHG30791.1| Cytochrome P450 protein [Gossypium arboreum]
Length=476

 Score =   435 bits (1119),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 240/519 (46%), Positives = 331/519 (64%), Gaps = 47/519 (9%)
 Frame = +3

Query  30    GALHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTK  209
             G L  + TAF     + I L   L  ++    W P R++ +M SQGI GPPY F HGN K
Sbjct  2     GNLLILFTAF-----LCICLFVALHYVLYEYLWVPHRVQFIMNSQGIRGPPYEFIHGNNK  56

Query  210   QISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKE  389
             +   MR ++  KPM  ++H IF R+ PH ++  + YG  +L+W+G +  L IT+PEL+KE
Sbjct  57    EALQMRKEASSKPM-ALTHDIFPRVMPHDYSCIKKYGKNYLSWNGVRAQLVITDPELVKE  115

Query  390   VLANKEGAYPKMDLDDFAKKLLGEALITNEGEKW-AKVRKLANHTFHAESLKRMVPEMIA  566
             VL   E A+ K     F KKLLG+++ T + EKW A+ RKLANH FH ESLK M+P MIA
Sbjct  116   VLKTSEKAFSKPKPSYFFKKLLGDSISTIKSEKWGARHRKLANHAFHGESLKNMIPAMIA  175

Query  567   SVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKN  746
             SV  MLE+WK+ EGKE++VF++F  LT+E+ISRTAFGSS+LEG+ IF M+ N        
Sbjct  176   SVGTMLEKWKDKEGKEMEVFQEFRFLTSEMISRTAFGSSYLEGEKIFDMLMN--------  227

Query  747   VYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-KESNGVVENYGNDYLGQLM  923
                 KF       +S+DEIE++KLE+ I  ++++++++RE K   G V++ G+D+LG L+
Sbjct  228   ----KF------WKSADEIESDKLEKTIHDSVMKIIKQREEKVMTGEVDSCGHDFLGLLV  277

Query  924   KITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILE  1103
              +    SD      +  ++DE K  Y AG  TT SLL W   LLA+HT+WQ+KAR E+  
Sbjct  278   NVY-HDSDEKNRFLIQDIVDECKTFYFAGQETTNSLLAWITLLLAIHTDWQDKARAEV--  334

Query  1104  LFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPI  1283
                                MI+NE +RLYPP+  V RK  R+V+LG L +P  + + +  
Sbjct  335   ------------------TMIVNETLRLYPPLNGVVRKAVRDVQLGELALPNYLDLNIRF  376

Query  1284  LALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIA  1463
             +ALHHDP +WG DVH+F P RFA+G+AKATNNNAAAF PFG+ PR+CVG++F   E KIA
Sbjct  377   IALHHDPAVWGDDVHLFKPERFAEGIAKATNNNAAAFMPFGLEPRSCVGMSFAITETKIA  436

Query  1464  LSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             LSMILQRY FTLSP YVH P     L P++G+ ++  ++
Sbjct  437   LSMILQRYTFTLSPTYVHAPLPNLSLKPQHGLHLLFHSL  475



>gb|KHG29404.1| Cytochrome P450 protein [Gossypium arboreum]
Length=439

 Score =   429 bits (1104),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 223/454 (49%), Positives = 310/454 (68%), Gaps = 20/454 (4%)
 Frame = +3

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             M  ++  KPM  ++H IF R+ PHV++W   Y                 +PE +KEVL N
Sbjct  1     MLMEASTKPM-ALTHDIFPRVMPHVYSWINKY-----------------DPEWVKEVLKN  42

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
              E A+PK     F  KL+G+ L + E EKWA+ RKLAN+ FH ESLK M P ++ASVE M
Sbjct  43    SEKAFPKPKRSYFIDKLIGDGLASTESEKWARQRKLANYAFHGESLKNMTPAVVASVETM  102

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LE+WK  EGKE++VF++F +LT+EVISRTAFGSS+LEG+ IF M++ L+ IT +N++  K
Sbjct  103   LEKWKSKEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFDMLTKLSVITGRNIFKAK  162

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
              P IS   +S+DEIE+E++ + I  +++ +V KREK    G  +N+G D+LG L+     
Sbjct  163   IPIISKFWKSADEIESERIAKMIHDSVMSIVEKREKRVVTGEADNFGCDFLGLLVN-AYH  221

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               D    +S+   +DE K  Y  G  T  SLL W   LLA+HT+WQ+KAR E++E+FG++
Sbjct  222   EVDEKNRLSIQDFVDECKTFYFVGQETVNSLLAWATLLLAIHTDWQDKARAEVIEVFGNQ  281

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             NP S+G+A+L+T+ MI+NE +RLYPP+  V R+V REV+LG L +P    + M I+ALHH
Sbjct  282   NPDSEGMAKLKTITMIINETLRLYPPLSGVIREVGREVQLGKLVLPTHSEVDMRIIALHH  341

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DP +WG DV++F P RFA+G+AKAT  NAAAF PFG+GPR+CVG++F   EAK ALSMIL
Sbjct  342   DPDLWGDDVNLFKPERFAEGIAKATKYNAAAFMPFGLGPRSCVGISFAITEAKTALSMIL  401

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             QRY FT+SP YVH PA    L P++G+Q++  ++
Sbjct  402   QRYTFTVSPTYVHAPALRLTLKPQHGMQLLFHSL  435



>ref|XP_010041049.1| PREDICTED: cytochrome P450 734A1-like [Eucalyptus grandis]
Length=824

 Score =   439 bits (1129),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 210/422 (50%), Positives = 315/422 (75%), Gaps = 5/422 (1%)
 Frame = +3

Query  357   LFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAES  536
             L I++ EL+KEVL N++  Y K D  +  KKL G+ L + + EKWA+ R+LA+  FH ES
Sbjct  348   LSISDTELVKEVLNNRDKTYVKPDFQENIKKLFGDGLFSTKREKWARQRRLAHLAFHGES  407

Query  537   LKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMV  716
             LK M+P M+ SV ++L+RW+ LE +E+++F++F  +T++VISRTAFGSS++EG++IF+M+
Sbjct  408   LKCMIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGRNIFRML  467

Query  717   SNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVEN  893
               LT I  +N + ++ P +  + ++SDEI++E+LE+ I+ A+LE+++KRE++ N G + +
Sbjct  468   GELTTIASQNHFKLRLPEVRKIWKTSDEIDSERLEKAIRDAVLEIIKKREEKVNTGEMND  527

Query  894   YGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEW  1073
             YGND+LG L+K      D SK I++D +IDE K  Y AG  TT S+L W +FLLA+H +W
Sbjct  528   YGNDFLGSLLK-AYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTLFLLAIHKDW  586

Query  1074  QEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTI  1253
             Q++AR+E+  +FG+E+P  DG+ +L+T+ MI+NE +RLYPP+I++ RKV+++V LG+L +
Sbjct  587   QQEARKEVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPLISIFRKVKKQVTLGSLVL  646

Query  1254  PADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGL  1433
             PADI + +P L +HHD +IWG DVH+F P RF++G+AKATNNN AAF PFG+GPR CVGL
Sbjct  647   PADIVLHIPTLIIHHDRRIWGIDVHLFKPERFSEGIAKATNNNTAAFLPFGLGPRNCVGL  706

Query  1434  NFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV*LLSCPYGLSL  1613
             NF  NE KIA++MILQRY FTLSP Y+  PA    + P++GV+VIL +   L C + +S 
Sbjct  707   NFAMNEVKIAIAMILQRYSFTLSPGYIPLPAHFLTIHPQHGVKVILHS---LQCEHVVSS  763

Query  1614  LV  1619
             ++
Sbjct  764   II  765


 Score =   387 bits (993),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 263/344 (76%), Gaps = 2/344 (1%)
 Frame = +3

Query  546   MVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNL  725
             M+P M+ SV ++L+RW+ LE KE+++F++F  +++EVISRTAFGSS++EG+ IF+M+  L
Sbjct  1     MIPAMVDSVHMLLKRWQNLETKEVELFEEFTAISSEVISRTAFGSSYIEGRDIFQMLGEL  60

Query  726   TAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGN  902
               I  +N++ ++ PGIS + ++SDEI++ +LE+ I+  +L ++ KREK+ N G +++YGN
Sbjct  61    AIIVSRNLFKLRLPGISKIWKTSDEIKSNQLEKAIRDVVLGIIDKREKKLNAGEIDDYGN  120

Query  903   DYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEK  1082
             D+LG L+K      D SK I+++ ++DE K  Y AG  TT S+L W  FLLA+H +WQE+
Sbjct  121   DFLGSLLK-AYHDPDESKRITINDLVDECKTFYLAGQETTNSILTWTFFLLAIHKDWQEE  179

Query  1083  ARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPAD  1262
             AR+E+ ++FG E+P  +GI +L+T+ MI+NE +RLYPPVI V RKVER+V LGNL +P D
Sbjct  180   ARKEVADVFGDEDPNHEGIMKLKTVEMIINETLRLYPPVINVIRKVERQVTLGNLLLPPD  239

Query  1263  ITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFT  1442
             I + +PIL +H DP+IWG DVH+F P RF++G+AKATNNNAAAF PFG+GPR+CVGL F 
Sbjct  240   IILHIPILKIHQDPRIWGDDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRSCVGLYFA  299

Query  1443  TNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              NEAKI ++MILQRY FTLSP+Y+H P  I  + P +GV+VIL 
Sbjct  300   MNEAKITIAMILQRYSFTLSPDYIHLPTQILAMRPHHGVKVILH  343



>gb|KDP41343.1| hypothetical protein JCGZ_15750 [Jatropha curcas]
Length=432

 Score =   425 bits (1093),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/452 (46%), Positives = 303/452 (67%), Gaps = 28/452 (6%)
 Frame = +3

Query  222   MRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLAN  401
             MR +S+   M ++SH +F+RIQPH + W++++G  +++W G +P L +TEP+L+KE+L N
Sbjct  1     MRDESINSSM-ELSHQMFSRIQPHYYLWRKLHGKNYISWLGPRPRLVVTEPQLVKEILNN  59

Query  402   KEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             K+  YPK + + +  KL G+ L+T       KV                   MI  VE+M
Sbjct  60    KDEMYPKPEFESYMIKLFGDGLVT------TKV-------------------MITRVEMM  94

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             L RW++ E KE+DV+K+F  LT++VISRT+FGSS+ E + IF M+  L  +  +N + V+
Sbjct  95    LGRWRQYENKEIDVWKEFKQLTSDVISRTSFGSSYSEAQDIFDMIMELLILASQNSFEVR  154

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTG  938
              P I    ++ D+IE++KLE+ ++ +IL+++RKRE+E+     +++G+D+LG L+K    
Sbjct  155   IPLIKKFIKTKDDIESDKLEQRLRESILKMIRKREEEAKMAEPDSHGSDFLGVLLK-ANQ  213

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
               + S  IS++ ++DE K  Y AG  TT++ L W IFLLA+H +WQEK R+E+LELFG  
Sbjct  214   DPNKSNKISINDIVDEYKTFYIAGQETTSAALNWTIFLLAIHIDWQEKVRKEVLELFGRR  273

Query  1119  NPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHH  1298
             NPT + I +L+ MNM++NE +RLY PV  + R+V +  KLG L  PA + I +P LA+HH
Sbjct  274   NPTLNEINKLKIMNMVVNETLRLYAPVTNLLREVPKGSKLGKLLAPARMDILIPPLAVHH  333

Query  1299  DPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMIL  1478
             DP IWG+DVH+F P RFA+GVAKAT  N  AF PF +GPR CVG+NF   E KIALSMIL
Sbjct  334   DPDIWGEDVHLFKPERFAEGVAKATKGNIGAFVPFSLGPRNCVGMNFAMTETKIALSMIL  393

Query  1479  QRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
             QRY FTLSPNYVH P  +  + PK G+Q+ LQ
Sbjct  394   QRYSFTLSPNYVHSPVVLIGVIPKKGLQITLQ  425



>ref|XP_010091619.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44885.1| Cytochrome P450 734A1 [Morus notabilis]
Length=496

 Score =   426 bits (1095),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 280/405 (69%), Gaps = 5/405 (1%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPM-FDISHHIFARIQPHVHTWKEIYGNTF  329
             M SQGI GP Y F  GN K+I NM  ++M KPM    +H+IF ++QP+   W  +YG  +
Sbjct  1     MASQGIRGPSYRFVLGNAKEIHNMLKEAMSKPMSLSDAHNIFHKVQPNQEYWANMYGKNY  60

Query  330   LTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKL  509
             L W GT+P L ITE ELIKEVL NK   Y K     F K+L G+ L+  EGEKW K+RKL
Sbjct  61    LQWLGTQPQLVITELELIKEVLNNKNRVYLKSGAQRFVKQLFGDGLVVTEGEKWDKLRKL  120

Query  510   ANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFL  689
             ANH FHAE+LK MVP MI+SVE+MLERWK  EGKE++VF++F VLT++VIS+TAFGSS+L
Sbjct  121   ANHFFHAENLKSMVPAMISSVEMMLERWKNYEGKEIEVFEEFRVLTSDVISKTAFGSSYL  180

Query  690   EGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE-  866
             EGK IF M+  LT I   + + +K P IS  T+  DEIE++ LER I  +I+ + +KRE 
Sbjct  181   EGKKIFDMLRRLTFIVTMSFFKIKLPIISKFTK--DEIESDMLEREISNSIMVMAKKRED  238

Query  867   KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCI  1046
             K  +G   NYG D LG LMK     +D  K IS+  +I E+++ Y AG  TT SLL W +
Sbjct  239   KVMSGEEGNYGRDLLGGLMK-AHHDADRKKQISMGDLITEVRSFYFAGQETTNSLLAWTV  297

Query  1047  FLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVER  1226
              LLA+HT+WQE+AR+E +  FG  NPTSDGI+RL+ ++ I+NE  RLYPPV+  +R VE 
Sbjct  298   LLLAIHTDWQEEARKEAVNSFGEHNPTSDGISRLKVISQIINESTRLYPPVVAFSRHVEE  357

Query  1227  EVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGV  1361
             EV+LGNL +PA + + +  L LH DPQIWG+DV  F P RF++GV
Sbjct  358   EVRLGNLNLPAKMGLIISNLPLHLDPQIWGEDVLEFKPERFSEGV  402



>gb|KCW85138.1| hypothetical protein EUGRSUZ_B01978 [Eucalyptus grandis]
Length=424

 Score =   416 bits (1068),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 211/438 (48%), Positives = 301/438 (69%), Gaps = 35/438 (8%)
 Frame = +3

Query  327   FLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRK  506
             FL WHG +  L I++ EL+KEVL N++  Y K D  +  +KL G+ L + + EKWA+ R+
Sbjct  20    FLFWHGPEALLSISDTELVKEVLNNRDKTYVKPDFQENIRKLFGDGLFSTKREKWARQRR  79

Query  507   LANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSF  686
             LA+  FH ESLK M+P M+ SV ++L+RW+ LE +E+++F++F  +T++VISRTAFGSS+
Sbjct  80    LAHLAFHGESLKCMIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSY  139

Query  687   LEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKRE  866
             +EG++IF+M+  LT I  +N++ ++ PG+                            + E
Sbjct  140   IEGRNIFRMLGELTTIVSRNLFKLRLPGV----------------------------REE  171

Query  867   KESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCI  1046
             K + G + NYGND+LG L+K      D SK I++D +IDE K  Y AG  TT S+L W +
Sbjct  172   KVNTGEMNNYGNDFLGSLLK-AYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTL  230

Query  1047  FLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVER  1226
             FLLA+H +WQ++AR+E+  +FG+E+P  DG+ +L+T+ MI+NE +RLYPPVI+V RKV++
Sbjct  231   FLLAIHKDWQQEARKEVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPVISVFRKVKK  290

Query  1227  EVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFG  1406
             +V LG+L +PADI + +P LA+HHD +IWG DVH+F P RF++G+AKATNNNAAAF PFG
Sbjct  291   QVTLGSLVLPADIVLHIPTLAIHHDARIWGNDVHLFKPERFSEGIAKATNNNAAAFLPFG  350

Query  1407  MGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV*L  1586
             +GPR CVGLNF  NE KIA++MILQRY FTLSP Y+ +PA    + P+ GV+VIL     
Sbjct  351   LGPRNCVGLNFAMNEVKIAVAMILQRYSFTLSPGYIPWPAHFLTIHPQPGVKVILHP---  407

Query  1587  LSCPYGLSLLVRNYLKKE  1640
             L C +  + L    LKKE
Sbjct  408   LQCEHVCAQL---DLKKE  422



>ref|XP_010046256.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=382

 Score =   401 bits (1030),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 182/397 (46%), Positives = 279/397 (70%), Gaps = 21/397 (5%)
 Frame = +3

Query  153   MRSQGIIGPPYSFPHGNTKQISNMRSQ---SMGKPMFDISHHIFARIQPHVHTWKEIYGN  323
             M SQGI GPPY F HG TK+IS ++      M +PM ++SH I   ++PH+H W ++Y  
Sbjct  1     MASQGIKGPPYKFIHGCTKEISKLKEDVMMKMNEPMTNVSHEILPIVEPHIHKWNKLY--  58

Query  324   TFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVR  503
                            + EL+KEVL N++  Y K++     KK+ G+ L+  EG+KWA+ R
Sbjct  59    ---------------DTELVKEVLNNRDKTYVKLEFPGDIKKIFGDGLVATEGKKWARQR  103

Query  504   KLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSS  683
             +LA+  FH ESLK M+P M+ SV  +L+RW++LE KE+++F++F  +T++VISRTAFGSS
Sbjct  104   RLAHLAFHGESLKGMIPAMVDSVHALLDRWQKLEAKEVEIFEEFATITSDVISRTAFGSS  163

Query  684   FLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR  863
             ++EG+ IF+M+S LT +  +N + ++ PGI  + ++SDEI++E+LE+ I  A+L +++KR
Sbjct  164   YMEGREIFQMLSELTIVVSRNFFKLRLPGIRKIWKTSDEIKSERLEKAICDALLGIIKKR  223

Query  864   EKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWC  1043
             E+++ G +++YGNDYLG L+K      D SK I++D + DE K  + AG  TTTS+L W 
Sbjct  224   EEKAKGEMDDYGNDYLGSLLK-AYHDPDKSKRITMDDLRDECKTFHFAGQETTTSILTWT  282

Query  1044  IFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVE  1223
             +FLLA+H +WQE+AR+E+ ++FG+E+P  +GI +L+T++MI+NE +RLYPPV++  RKV 
Sbjct  283   LFLLAIHKDWQEEARKEVTDVFGNEDPNHEGIIKLKTVDMIINESLRLYPPVVSAIRKVV  342

Query  1224  REVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVF  1334
             R+V LGNL +P  I + +PIL +HH P+IWG DVH +
Sbjct  343   RQVTLGNLALPQGIALHIPILTIHHSPRIWGDDVHTY  379



>ref|XP_008339617.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=399

 Score =   394 bits (1012),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 265/363 (73%), Gaps = 3/363 (1%)
 Frame = +3

Query  102   VRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFAR  281
             +++  + WWTP R++ ++  QGI GP Y F HGNTK+IS+M+ ++M +P   +SH IF++
Sbjct  24    IKIFHKLWWTPIRIQNLVALQGIKGPSYRFIHGNTKEISSMQEEAMSRPK-SLSHDIFSQ  82

Query  282   IQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGE  461
             +QPH+H W + YG  FL W+G +  L ITEPEL KE+L NK+ AYPK +   +A++LLG+
Sbjct  83    VQPHIHLWTKTYGANFLQWYGAQAQLIITEPELCKEILTNKDKAYPKSETKGYARRLLGD  142

Query  462   ALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGV  641
              L+ ++GEKWAK+RKLAN+ FH E LK M P MI S E +LE WKE +GKE+DVFK+F +
Sbjct  143   GLVVSDGEKWAKMRKLANYAFHGEILKGMAPTMITSAETLLENWKEHDGKEIDVFKEFRL  202

Query  642   LTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLE  821
              T+EVISRTAFGSS+LEGK+IF+ +  L  ++ KN +N++FPGIS   +S DEIE+EKLE
Sbjct  203   YTSEVISRTAFGSSYLEGKNIFENLEKLAYLSFKNAFNLRFPGISKFIKSKDEIESEKLE  262

Query  822   RGIKGAILELVRKREKESN-GVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKAL  998
             + I+G+I+E+++KRE ++  G   ++GND+LG L K     +D ++ IS+D+++DE K  
Sbjct  263   KSIRGSIMEMIKKREDKAMVGEEGSFGNDFLGVLTK-AHHDADENQRISIDEIVDECKTF  321

Query  999   YGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
             Y  G  TT+S L W +FLLA+HT+WQE+AR+E++++FG++NP  DGIA+ +     L   
Sbjct  322   YLGGQETTSSGLAWTVFLLAIHTDWQEEARKEVIQIFGNQNPNLDGIAKTKNYEYDLQRV  381

Query  1179  MRL  1187
              ++
Sbjct  382   AKV  384



>gb|KCW82723.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=393

 Score =   394 bits (1011),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 266/355 (75%), Gaps = 3/355 (1%)
 Frame = +3

Query  117   RAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHV  296
             + WWTP R+++ M SQGI GPPY   +GNT++I   ++++  +P+ ++SH IF R+QPH+
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRPL-NLSHDIFPRVQPHI  80

Query  297   HTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITN  476
              TW   YG  +L+W+G  P L +TEPELIKEVL NK+ A+PK ++D+F KKLLG+ L+T 
Sbjct  81    STWTGTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVTT  140

Query  477   EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEV  656
             EGEKW K RKLAN+ FH +SLK M+P M+ SV +ML+RWK L G E++V+++F +LT+E+
Sbjct  141   EGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEI  200

Query  657   ISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKG  836
             ISRTAFGSS++EG++IF+M+  LT I  +N + ++FPGIS L +++DE+E+EKLE GI+ 
Sbjct  201   ISRTAFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRD  260

Query  837   AILELVRKR-EKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
             A+LE++RKR EK   G +++ GND+LG L+K  +   D S+ I++  ++DE K  Y AG+
Sbjct  261   AMLEIIRKREEKVKAGELDDLGNDFLGLLVK-ASHSDDESRRITITDLVDECKTFYIAGY  319

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNEC  1178
              T+ ++L W +FLLA+H EWQ++AR+E+L +FG+++P  DGIA+L+T     + C
Sbjct  320   DTSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPDPDGIAKLKTAWKACSSC  374



>ref|XP_010254918.1| PREDICTED: cytochrome P450 734A1 [Nelumbo nucifera]
Length=505

 Score =   397 bits (1021),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 205/522 (39%), Positives = 309/522 (59%), Gaps = 24/522 (5%)
 Frame = +3

Query  36    LHSIITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQI  215
             +H ++T  F        LL+ L+R +    W P + +   R+QGI GP Y    GN  +I
Sbjct  1     MHLLVTGVFF------LLLYILLRSIHSLIWVPWKTQLHFRNQGIRGPGYRLIFGNAAEI  54

Query  216   SNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVL  395
               + +++  KPM  +SH I  R+ PH HTW  IYG TFL W G KP L I +P++IKE+L
Sbjct  55    RGLIAEAQAKPMMPVSHEIIHRVMPHYHTWSTIYGKTFLYWFGPKPRLAIADPDMIKEIL  114

Query  396   ANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVE  575
              N  GA+ K+  +  +K+L G+ L+  EGEKWA+ R++ N  F+ E +K  VPE++AS  
Sbjct  115   LNTNGAFGKIGFNPLSKQLFGDGLVGLEGEKWARHRRITNQAFNMERVKEWVPEIVASTL  174

Query  576   VMLERWKELEGK----ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVK  743
              ML++W+E  G+    E++V ++   LT ++ISRTAFGSS+ EGKHIF++      +  +
Sbjct  175   KMLKKWEEKRGERDEIEIEVNRELHNLTADIISRTAFGSSYEEGKHIFQLQEQQMHLVSQ  234

Query  744   NVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLM  923
              + +V  PG   +    +     KLE+ I+ ++  L+     E NG       + LG LM
Sbjct  235   ALRSVYIPGFRFVPTKKNR-RRWKLEKEIRESLRRLI-----EINGETSQNSRNLLGLLM  288

Query  924   KITTGGSDISKN--ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREI  1097
                   S+  K   +S++++IDE K  Y AG  T+ +LL W I LLALH EWQ KAR+E+
Sbjct  289   STNRNQSETEKTEGLSVEEIIDECKTFYFAGKETSANLLTWAILLLALHQEWQSKARQEV  348

Query  1098  LELFGHEN-PTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIF  1274
               + G    PT++ +  L+ ++MI+NE +RLYPP + + R+  + VKLG L IPA+  ++
Sbjct  349   DCVCGDVGLPTAENLNDLKIVSMIINEALRLYPPAVMLMRQTNKGVKLGKLNIPANTQLY  408

Query  1275  MPILALHHDPQIWGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEA  1454
             + + A+HHDP+IWG+D   FNP RF          + A+FFPFG+GPR CVG N    EA
Sbjct  409   LAMTAVHHDPEIWGEDADEFNPLRFNN-----PKKHLASFFPFGLGPRICVGQNLAVVEA  463

Query  1455  KIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             K+ L++I++R+ F  SP+YVH P     + P+ G QV+ + V
Sbjct  464   KVLLTIIIRRFSFVPSPSYVHAPMQFLTIQPQYGAQVVFRKV  505



>gb|ABK25130.1| unknown [Picea sitchensis]
Length=517

 Score =   396 bits (1017),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 202/503 (40%), Positives = 301/503 (60%), Gaps = 17/503 (3%)
 Frame = +3

Query  99    LVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFA  278
             ++R+V   WW P +++K   SQG+ GPPY   +GN   +  M +Q+   P+   SH I  
Sbjct  19    VLRIVTVIWWKPLQVKKCFESQGVRGPPYRLLNGNFADMVRMNTQAKSTPI-PWSHDIVP  77

Query  279   RIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLG  458
             R+ P+ H W + YG  F+ W G+KP L +  PELIKE+L+NK G Y  +  +   ++L+G
Sbjct  78    RVLPYYHHWTKTYGKDFIYWVGSKPRLNVPHPELIKEILSNKFGHYENISSNPLGRQLVG  137

Query  459   EALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKEL---EGKELDVFK  629
             + L+   GEKW + R++ N  FH + LK MVP ++ S   MLE+W +L     +E++V K
Sbjct  138   QGLVGLRGEKWVQHRRIINPAFHLDFLKGMVPTIVESTANMLEKWGKLVLSGAEEVEVLK  197

Query  630   DFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEA  809
             +F  LT +VISRTA GSS+ E KHIF +      +T + V +V  PG   L    +  + 
Sbjct  198   EFCNLTADVISRTALGSSYAEAKHIFNLQDQQMLLTAELVLSVYVPGFRFLPTRKNR-QR  256

Query  810   EKLERGIKGAILELVRKREK----ESNGVVENYGNDYLGQLMKIT---TGGSDISKNISL  968
              KLE+ I+  + +++  RE+    E +G   +YG D LG +M       GG      ++ 
Sbjct  257   WKLEKEIRKCMRQVIEARERTADIEQSG---SYGTDLLGLMMSAKNKRVGGKLQDVRMTT  313

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE-NPTSDGIAR  1145
             +++IDE K  Y AGH TT+ LL W I LL +H +WQ++ R+E+LE+ G    P +D +  
Sbjct  314   EEIIDECKTFYFAGHETTSILLTWTIILLGMHQDWQDRGRKEVLEVCGKNVVPDADSVNH  373

Query  1146  LRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDV  1325
             L+ + MILNE +RLYPP + + R+  + ++LG L+IPA   + +PILA+HHD  +WG D 
Sbjct  374   LKIVGMILNEALRLYPPAVFLQRQAVKPMQLGRLSIPAGTQLLLPILAIHHDQCLWGNDA  433

Query  1326  HVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSP  1505
             + FNP RF++G+      +  AF PFG GPR CVG NF   EAK+ L+MILQR+ F  SP
Sbjct  434   NEFNPARFSEGI-AKAVKHPLAFMPFGFGPRICVGQNFALLEAKVVLAMILQRFSFVTSP  492

Query  1506  NYVHYPADIFILTPKNGVQVILQ  1574
             +Y H P  +  + P++G QVIL 
Sbjct  493   SYAHAPVMVVTVRPQHGAQVILH  515



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   389 bits (998),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 202/510 (40%), Positives = 309/510 (61%), Gaps = 18/510 (4%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             ++L W L R+++ AWW PRRL + +R+QG+ G PY FP+G+ K+I  +R ++  KPM  +
Sbjct  21    LFLAWAL-RVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPM-PL  78

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             +H+I  R+ P  H   + YG    TW G  P + IT+PEL++EVL+NK G + K   +  
Sbjct  79    AHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPL  138

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKE--  614
             ++    + L   EGEKW K R++ N  FHAE LKRM+P   A    +++RW+ + G E  
Sbjct  139   SR-FFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEAC  197

Query  615   --LDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISML-T  785
               LDV+ +    + +VISRTAFGSS+ EG+ IF++ S    + ++ V N+  PG   L T
Sbjct  198   YELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPT  257

Query  786   RSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTG--GSDISK  956
               +  I+A  ++R I+  +  +++KRE++   G      +D LG LM+        D +K
Sbjct  258   PKNKRIKA--IDREIRSILRGIIKKREQDIKTGKAST--DDLLGLLMESNMKHLQEDGNK  313

Query  957   N--ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTS  1130
             N  ++ + +I+E K  Y AG  TT++LL W +  L++H  WQ +AR E+L +FG   P  
Sbjct  314   NAGMTTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDF  373

Query  1131  DGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQI  1310
             DG++ L+ + MIL E +RLYPP I + R+  + +K+G++  P  + + +  + +HHDP +
Sbjct  374   DGLSHLKIVTMILYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNL  433

Query  1311  WGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYK  1490
             WG+D   FNP RFA+GV    +    AFFPFG GPR C+G NF+  EAK+ LSMILQ + 
Sbjct  434   WGKDASEFNPERFAEGV-SKASKEQVAFFPFGGGPRICIGQNFSLLEAKMGLSMILQHFY  492

Query  1491  FTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             F LSP+Y H P  IF L P+ G Q+ L+ +
Sbjct  493   FDLSPSYAHAPRTIFTLFPQRGAQIRLRKL  522



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   389 bits (998),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 201/510 (39%), Positives = 309/510 (61%), Gaps = 18/510 (4%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             ++L W L R+++ AWW PRRL + +R+QG+ G PY FP+G+ K+I  +R ++  KPM  +
Sbjct  21    LFLAWAL-RVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPM-PL  78

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             +H+I  R+ P  H   + YG    TW G  P + IT+PEL++EVL+NK G + K   +  
Sbjct  79    AHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPL  138

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKE--  614
             ++    + L   EGEKW K R++ N  FHAE LKRM+P   A    +++RW+ + G E  
Sbjct  139   SR-FFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEAC  197

Query  615   --LDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISML-T  785
               LDV+ +    + +VISRTAFGSS+ EG+ IF++ S    + ++ V N+  PG   L T
Sbjct  198   YELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPT  257

Query  786   RSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTG--GSDISK  956
               +  I+A  ++R I+  +  +++KRE++   G      +D LG LM+        D +K
Sbjct  258   PKNKRIKA--IDREIRSILRGIIKKREQDIKTGKAST--DDLLGLLMESNMKHLQEDGNK  313

Query  957   N--ISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTS  1130
             N  ++ + +I+E K  Y AG  TT++LL W +  L++H  WQ +AR E+L +FG   P  
Sbjct  314   NAGMTTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVRAREEVLRVFGENKPDF  373

Query  1131  DGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQI  1310
             DG++ L+ + MIL E +RLYPP I + R+  + +K+G++  P  + + +  + +HHDP +
Sbjct  374   DGLSHLKIVTMILYEVLRLYPPFILIRRQTYKTMKIGDVVYPPGVLLLLHAIFVHHDPNL  433

Query  1311  WGQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYK  1490
             WG+D   FNP RFA+GV    +    AFFPFG GPR C+G NF   EAK+ LSMILQ + 
Sbjct  434   WGKDASEFNPERFAEGV-SKASKEQVAFFPFGGGPRICIGQNFALLEAKMGLSMILQHFS  492

Query  1491  FTLSPNYVHYPADIFILTPKNGVQVILQNV  1580
             F LSP+Y H P  +F L P++G Q+ L+ +
Sbjct  493   FDLSPSYAHAPHTVFTLHPQHGAQIRLRKL  522



>ref|XP_008358468.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
 ref|XP_008358469.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=378

 Score =   383 bits (984),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 185/369 (50%), Positives = 265/369 (72%), Gaps = 8/369 (2%)
 Frame = +3

Query  45    IITAFFLTFSVSIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNM  224
             II+A FL     ++ +  +++++ + WWTP R++K M  QGI GPPY   HGNTK+I +M
Sbjct  9     IISASFL----CVFFVLVIIKILHKLWWTPHRIQKQMALQGIKGPPYRLIHGNTKEIFDM  64

Query  225   RSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANK  404
               ++M KP  ++SH IF  +QPH+H+W   YG  +L W G++P L ITE EL +E+L NK
Sbjct  65    IKEAMSKPK-NLSHDIFPIVQPHMHSWTRTYGXNYLQWQGSQPQLVITELELCREILNNK  123

Query  405   EGAYPKMDLDDFAKKLLGEALITN-EGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVM  581
             + AYPK +   F +KLLG+ L+T  +GEKW K+RKL  H FH ESLK M  EM+AS E +
Sbjct  124   DRAYPKSEPTGFLRKLLGDGLLTTADGEKWKKMRKLGTHAFHGESLKSMFTEMVASAETI  183

Query  582   LERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVK  761
             LERWK  EGKE++VF++F + T+EVIS+TAFGSS++EG++IF+M++ LT +  K+VY ++
Sbjct  184   LERWKSYEGKEIEVFEEFKLFTSEVISKTAFGSSYIEGQNIFEMLTKLTLLFFKSVYIIR  243

Query  762   FPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTG  938
              PGIS   +SSDEIEAEKLE+GI  +I E+ +KREK+S     +++G+D+LG L++    
Sbjct  244   LPGISKFFKSSDEIEAEKLEKGIHASIAEIFKKREKKSLTKGRDSFGSDFLGLLLEAHHD  303

Query  939   GSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE  1118
              +D ++ IS+D M+DE K+ Y AG  TT +LL W IFLLA HT+WQE+AR+E+++LFG +
Sbjct  304   AND-NQRISVDDMVDECKSFYIAGQETTNTLLAWTIFLLAHHTDWQEEARKEVMDLFGKQ  362

Query  1119  NPTSDGIAR  1145
              P  DGI R
Sbjct  363   TPNPDGIVR  371



>dbj|BAF56240.1| cytochrome P450 enzyme [Pisum sativum]
Length=523

 Score =   386 bits (992),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/490 (39%), Positives = 298/490 (61%), Gaps = 11/490 (2%)
 Frame = +3

Query  123   WWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHT  302
             WW PR++      QGI GPPY F  GN K++  M  Q+  +PM + SH+I  R+    H 
Sbjct  29    WWRPRKIEGYFSKQGIRGPPYRFFIGNVKELVAMMIQASSQPMPNFSHNILPRVLSFYHH  88

Query  303   WKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEG  482
             WK+IYG TFL W G    L +++P+LI+E+  +K   Y K +     K+L G+ L++ +G
Sbjct  89    WKKIYGGTFLVWFGPTVRLTVSDPDLIREIFTSKSEFYEKNEAPPLVKQLEGDGLLSLKG  148

Query  483   EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK---ELDVFKDFGVLTTE  653
             EKWA  R++ + TFH E+LK ++P M  SV  MLE W E+  K   E++V + F  LT +
Sbjct  149   EKWAHHRRIISPTFHMENLKLLIPVMATSVVEMLENWSEMSHKGEVEIEVSECFQTLTED  208

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VI++TAFGSS+ +GK IF++ +    +       V  PG      +   I++ KL++ IK
Sbjct  209   VITKTAFGSSYQDGKAIFRLQAQQMVLAADAFQKVFIPGYRFFP-TRRNIKSWKLDKQIK  267

Query  834   GAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
              ++++L+ +R + SN  +E    D LG +++ +        N+++D ++ E K+ + AG 
Sbjct  268   KSLVKLIERRRENSNERIEKGPKDLLGLMIQASN-----KTNVTVDDIVGECKSFFFAGK  322

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN-PTSDGIARLRTMNMILNECMRLY  1190
              TT++LL W   LLA+H +WQ +AR E+L++ G  + PT D + +L+T+NMI+NE +RLY
Sbjct  323   QTTSNLLTWTTILLAMHPQWQVQARDEVLKMCGSRDVPTKDHVVKLKTLNMIVNESLRLY  382

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
             PP I   R+ + +V+LG   IP    + +PILA+HHD  IWG DV+ FNP RF++GV   
Sbjct  383   PPTIATIRRAKTDVELGGYKIPRGTELLIPILAVHHDQAIWGNDVNEFNPGRFSEGV-AR  441

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
                +  AF PFG+G RTC+G N    + K+AL MILQR+ F L+P+Y H P  + +L P+
Sbjct  442   AAKHPVAFIPFGLGVRTCIGQNLAVLQTKLALVMILQRFSFRLAPSYQHAPTVLMLLYPQ  501

Query  1551  NGVQVILQNV  1580
              G  +I + +
Sbjct  502   YGAPIIFKQL  511



>emb|CDP07542.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   386 bits (991),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/491 (40%), Positives = 298/491 (61%), Gaps = 17/491 (3%)
 Frame = +3

Query  126   WTPRRLRKVMRSQGIIGPPYSFPHGNTKQISN-MRSQSMGKPMFDISHHIFARIQPHVHT  302
             W P ++++  R QGI GP Y    GNT +I   M +++  +P+  +SH I  R+ PH + 
Sbjct  25    WVPLKIQRHFRKQGIEGPDYHPIFGNTAEIRRRMIAEAEAEPISFVSHEIVHRVMPHYYN  84

Query  303   WKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEG  482
             W  +YG TFL W G KP L + +P++IKE+L N  G+Y K+  +  +K L GE L+   G
Sbjct  85    WSTLYGKTFLYWFGPKPRLAVADPDMIKEILLNNTGSYEKVKFNPLSKLLFGEGLVRLSG  144

Query  483   EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK----ELDVFKDFGVLTT  650
             EKWA  R++ +  F+ E +K  VPEM+ S ++ML+RW++  G+    E+DVFK+   L+ 
Sbjct  145   EKWAVHRRITSQAFNMERIKDWVPEMVDSTKMMLDRWEKERGERDEFEVDVFKELHNLSA  204

Query  651   EVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGI  830
             +++SRTAFGSSF EGK IF++     ++ ++ + +V  PG   L    + +   +LE+  
Sbjct  205   DILSRTAFGSSFEEGKRIFQLQDQQASLVLQAIRSVYIPGFRFLPTKKNRMR-RRLEKET  263

Query  831   KGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAG  1010
             + +I +L+      S  + EN     L  LM      +D  + ++++++ DE K  Y AG
Sbjct  264   RDSIRKLI----GNSTNIQEN-PKALLALLMSPYKNQNDEQERLNVEEITDECKTFYFAG  318

Query  1011  HLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN-PTSDGIARLRTMNMILNECMRL  1187
               TT +LL W   LLALH +WQ +AR E+L   G    P++  +A L+ +NMI+NE +RL
Sbjct  319   KETTANLLTWIFILLALHQDWQNEAREEVLSTCGDNKLPSAGNLADLKIVNMIINETLRL  378

Query  1188  YPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVak  1367
             YPP + + R+  ++VKLG+L IPA+   ++ + ++HHDPQIWG+D + FNP RFA     
Sbjct  379   YPPAVMLMRQTSKDVKLGSLDIPANTQFYLAMTSVHHDPQIWGEDANKFNPLRFAN----  434

Query  1368  atnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTP  1547
              T  + A+FFPFG+GPR CVG N    EAKI L++I+++Y F LSP+YVH P     L P
Sbjct  435   -TRKHIASFFPFGLGPRICVGQNLALVEAKIVLAVIIRQYSFVLSPSYVHAPMQAMTLQP  493

Query  1548  KNGVQVILQNV  1580
             + G Q+I   +
Sbjct  494   QYGAQIIFSRI  504



>gb|KCW73209.1| hypothetical protein EUGRSUZ_E016722, partial [Eucalyptus grandis]
Length=371

 Score =   380 bits (975),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 254/355 (72%), Gaps = 3/355 (1%)
 Frame = +3

Query  93    WKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHI  272
             W L +L+ + WW P R++++M  QGI GPPY F HG+TK+   M  ++   PM ++SH I
Sbjct  17    WSLAKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPMSNLSHDI  76

Query  273   FARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKL  452
             F +IQP ++ W   YG  +L+W G +  L ITEPEL+KEVL N++  YPK     F KKL
Sbjct  77    FPKIQPQINKWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKL  136

Query  453   LGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFK  629
             LG+ L  T  GEKWAK RKLAN  FH ESLK M P M+ SV  MLE+WK  EGKE++VF+
Sbjct  137   LGDGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFR  196

Query  630   DFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEA  809
             DF VLT+EVISRTAFGSS++EG++IF+M++ L  +T +N + ++ PG+S L ++ DE+EA
Sbjct  197   DFKVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEA  256

Query  810   EKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDE  986
             EKLE+GI  +I++++++REK+   G V+ +G+D+LGQL+K     +D SK I++D ++DE
Sbjct  257   EKLEKGICDSIVQMIKRREKKVMAGEVDCFGDDFLGQLVK-ALHDADKSKKITVDNLVDE  315

Query  987   IKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLR  1151
              K  Y AGH T  SL+ W +FLLA++ EWQE+AR E+L +FG+++P  DG+ +L+
Sbjct  316   CKTFYVAGHETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLK  370



>ref|XP_003549781.1| PREDICTED: cytochrome P450 734A1-like [Glycine max]
 gb|KHN15125.1| Cytochrome P450 734A1 [Glycine soja]
Length=517

 Score =   383 bits (983),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 201/489 (41%), Positives = 298/489 (61%), Gaps = 10/489 (2%)
 Frame = +3

Query  123   WWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHT  302
             WW PR++      QGI GPPY F  GN K++  M  ++  +PM   SH+I  R+    H 
Sbjct  29    WWRPRKIEAHFSKQGIRGPPYRFFIGNVKELVGMMLKASSQPM-PFSHNILPRVLSFYHH  87

Query  303   WKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEG  482
             WK+IYG TFL W G    L ++EPELI+E+  +K   Y K +     K+L G+ L++ +G
Sbjct  88    WKKIYGATFLVWFGPTVRLTVSEPELIREIFTSKSEFYEKNEAPPLVKQLEGDGLLSLKG  147

Query  483   EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK---ELDVFKDFGVLTTE  653
             EKWA  RK+ + TFH E+LK ++P M  SV  MLE+W  +  K   E++V + F  LT +
Sbjct  148   EKWAHHRKIISPTFHMENLKLLIPVMATSVVEMLEKWSAMGVKGEVEIEVSEWFQTLTED  207

Query  654   VISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIK  833
             VI+RTAFGSS+ +GK IF++ +    +       V  PG      +   I++ KLE+ IK
Sbjct  208   VITRTAFGSSYEDGKAIFRLQAQQMDLAADAFQKVFIPGYRFFP-TRRNIKSWKLEKEIK  266

Query  834   GAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGH  1013
              ++++L+ +R +E  GV E    D LG +++ +   S  S N+++D +++E K+ + AG 
Sbjct  267   KSLVKLIWRR-RECGGVEEKGPKDLLGLMIQASNMNS--SSNVTVDDIVEECKSFFFAGK  323

Query  1014  LTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN-PTSDGIARLRTMNMILNECMRLY  1190
              TT++LL W   LLA+H  WQ +AR E+L+L G  + PT D +A+LRT++MI+NE +RLY
Sbjct  324   QTTSNLLTWTTILLAMHPHWQVRARDELLKLCGSRDLPTKDHVAKLRTLSMIVNESLRLY  383

Query  1191  PPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVaka  1370
             PP I   R+ + +V LG   IP    + +PILA+HHD  IWG DV+ FNP RF+ GV   
Sbjct  384   PPTIATIRRAKADVDLGGYKIPRGTELLIPILAVHHDQAIWGNDVNEFNPGRFSDGV-AR  442

Query  1371  tnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPK  1550
                +  AF PFG+G RTC+G N    + K+AL++ILQR+ F L+P+Y H P  + +L P+
Sbjct  443   AGKHPLAFIPFGLGVRTCIGQNLAVLQTKLALAIILQRFSFRLAPSYQHAPTVLMLLYPQ  502

Query  1551  NGVQVILQN  1577
              G  +I Q 
Sbjct  503   YGAPIIFQQ  511



>ref|XP_010058553.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=439

 Score =   380 bits (976),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 254/355 (72%), Gaps = 3/355 (1%)
 Frame = +3

Query  93    WKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHI  272
             W L +L+ + WW P R++++M  QGI GPPY F HG+TK+   M  ++   PM ++SH I
Sbjct  84    WSLAKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPMSNLSHDI  143

Query  273   FARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKL  452
             F +IQP ++ W   YG  +L+W G +  L ITEPEL+KEVL N++  YPK     F KKL
Sbjct  144   FPKIQPQINKWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKL  203

Query  453   LGEALI-TNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFK  629
             LG+ L  T  GEKWAK RKLAN  FH ESLK M P M+ SV  MLE+WK  EGKE++VF+
Sbjct  204   LGDGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFR  263

Query  630   DFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEA  809
             DF VLT+EVISRTAFGSS++EG++IF+M++ L  +T +N + ++ PG+S L ++ DE+EA
Sbjct  264   DFKVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEA  323

Query  810   EKLERGIKGAILELVRKREKES-NGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDE  986
             EKLE+GI  +I++++++REK+   G V+ +G+D+LGQL+K     +D SK I++D ++DE
Sbjct  324   EKLEKGICDSIVQMIKRREKKVMAGEVDCFGDDFLGQLVK-ALHDADKSKKITVDNLVDE  382

Query  987   IKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLR  1151
              K  Y AGH T  SL+ W +FLLA++ EWQE+AR E+L +FG+++P  DG+ +L+
Sbjct  383   CKTFYVAGHETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLK  437



>ref|XP_004969234.1| PREDICTED: secologanin synthase-like [Setaria italica]
Length=528

 Score =   383 bits (983),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 197/506 (39%), Positives = 306/506 (60%), Gaps = 16/506 (3%)
 Frame = +3

Query  93    WKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHI  272
             WK+  L+ + WW PRRL + +R+QGI G  Y F  G+ K+   +  ++  KP+    H I
Sbjct  29    WKVGGLLHQMWWRPRRLERALRAQGIRGTSYRFLTGDLKEYGRLAKEAWSKPLPLRCHDI  88

Query  273   FARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKL  452
               R+ P VH   + +G   ++W G  P + I +PEL K+VL+NK G + K+     +K +
Sbjct  89    AHRVTPFVHNIVQEHGKMSMSWFGPNPKVTIVDPELSKDVLSNKFGHFEKLKFPALSK-M  147

Query  453   LGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK----ELD  620
             LG+ + ++EGEKW K R++ N  FH E LKRM+P   A  E ++ RW E  G     ELD
Sbjct  148   LGDGVASHEGEKWVKHRRILNPAFHLEKLKRMLPAFSACCEELVSRWSESLGSDALLELD  207

Query  621   VFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPG-ISMLTRSSD  797
             V+ +   LT +VISRTAF SS+ EG+ IF++ +    + + N+  +  PG +S+ TR++ 
Sbjct  208   VWPELQNLTGDVISRTAFSSSYHEGRRIFQLQAEQAELVMTNIRKIMIPGYMSLPTRNNR  267

Query  798   EI-----EAEKLERGIKGAILELVRKREKESNGVVENYGNDYLGQLMKITTGGSDISKNI  962
             ++     E E + R I G  ++ +    K+     ++     L   M+ T      SK +
Sbjct  268   KMRKNNKEVESILRDIIGKRIQAM----KQGKSTEDDLLGLLLESNMRETEENGQSSKGM  323

Query  963   SLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIA  1142
             +++++I+E K  Y AG  TT+ LL W + +L++H EWQ++AR E+L LFG   P  +G++
Sbjct  324   TIEEVIEECKVFYFAGMETTSVLLTWTMVVLSMHPEWQDRAREEVLGLFGKNKPDYEGLS  383

Query  1143  RLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQD  1322
             RL+T+ MIL E +RLYPP I+  RK  +E+++G +T PA + + +P+L +HHDP IWG+D
Sbjct  384   RLKTVTMILYEVLRLYPPAISFVRKTYKEMEIGGITYPAGVILELPVLFIHHDPDIWGRD  443

Query  1323  VHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLS  1502
             VH F P RF++G+    + +  AF PFG GPR C+G NF   EAK+AL MILQR++F L+
Sbjct  444   VHEFRPDRFSEGI-SKASKDPGAFLPFGWGPRICIGQNFALLEAKLALCMILQRFEFELA  502

Query  1503  PNYVHYPADIFILTPKNGVQVILQNV  1580
             P+Y H P  +  L P +G Q+ L+ +
Sbjct  503   PSYTHAPHTVITLHPMHGAQMKLRAI  528



>gb|KCW44245.1| hypothetical protein EUGRSUZ_L02323 [Eucalyptus grandis]
Length=350

 Score =   376 bits (966),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/338 (51%), Positives = 257/338 (76%), Gaps = 3/338 (1%)
 Frame = +3

Query  147   KVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHTWKEIYGNT  326
             + M SQGI GPPY   +GNT++I   ++++  +P+ ++SH IF R+QPH+ TW   YG  
Sbjct  9     ETMASQGIRGPPYKLFYGNTREILQFKNETSSRPL-NLSHDIFPRVQPHISTWTGTYGAN  67

Query  327   FLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEGEKWAKVRK  506
             +L+W+G  P L +TEPELIKEVL NK+ A+PK ++D+F KKLLG+ L+T EGEKW K RK
Sbjct  68    YLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVTAEGEKWVKQRK  127

Query  507   LANHTFHAESLKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSF  686
             LAN+ FH +SLK M+P M+ SV +ML+RWK L G E++V+++F +LT+E+ISRTAFGSS+
Sbjct  128   LANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRTAFGSSY  187

Query  687   LEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKR-  863
             +EG++IF+M+  LT I  +N + ++FPGIS L +++DE+E+EKLE GI+ A+LE++RKR 
Sbjct  188   VEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLEIIRKRE  247

Query  864   EKESNGVVENYGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWC  1043
             EK   G +++ GND+LG L+K  +   D S+ I++  ++DE K  Y AG+ T+ ++L W 
Sbjct  248   EKVKAGELDDLGNDFLGLLVK-ASHSDDESRRITITDLVDECKTFYIAGYDTSNTMLTWT  306

Query  1044  IFLLALHTEWQEKARREILELFGHENPTSDGIARLRTM  1157
             +FLLA+H EWQ++AR+E+L +FG+++P  DGIA+L+T+
Sbjct  307   VFLLAIHPEWQDEARKEVLNVFGNQDPYPDGIAKLKTV  344



>ref|XP_004508536.1| PREDICTED: cytochrome P450 734A1-like [Cicer arietinum]
Length=528

 Score =   382 bits (982),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/513 (38%), Positives = 312/513 (61%), Gaps = 13/513 (3%)
 Frame = +3

Query  81    IYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDI  260
             I+LL+ ++++    WW PR+++     QGI GPPY F  GN K++  M  ++  +PM + 
Sbjct  17    IFLLF-VLKVTVLFWWRPRKIQGHFSKQGIRGPPYRFFIGNVKELVEMMLKASSQPMPNF  75

Query  261   SHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDF  440
             SH+I  R+    H WK+IYG TFL W G    L +++P+LI+E+  +K   Y K +    
Sbjct  76    SHNILPRVLSFYHHWKKIYGATFLVWFGPTVRLTVSDPDLIREIFTSKSEFYEKNEAPPL  135

Query  441   AKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKELEGK---  611
              K+L G+ L++ +GEKWA  RK+ + TFH E+LK ++P M  SV  MLE+W  +  K   
Sbjct  136   VKQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKLLIPVMATSVVEMLEKWSAMAEKGQV  195

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E++V + F  LT +VI++TAFGSS+ +GK +F++ +    +       V  PG      +
Sbjct  196   EIEVSECFQTLTEDVITKTAFGSSYEDGKAVFRLQAQQMVLAADAFQKVFIPGYRFFP-T  254

Query  792   SDEIEAEKLERGIKGAILELVRKREKESNG---VVENYGNDYLGQLMKITTGGSDISKNI  962
                I+  KLE+ IK ++++L+ +R++  +G   + E    D LG +++     + IS N+
Sbjct  255   RRNIKCWKLEKEIKKSLVKLIERRKENWSGNEKIFEKGPKDLLGLMIQ---ANNKISSNV  311

Query  963   SLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN-PTSDGI  1139
             ++D +++E K+ + AG  TT++LL W   LLA+H  WQ +AR E+L++ G  + PT D +
Sbjct  312   TVDDIVEECKSFFFAGKQTTSNLLTWTTILLAMHPHWQVQARDEVLKMCGSRDLPTKDHV  371

Query  1140  ARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQ  1319
              +L+T+NMI+NE +RLYPP I   R+ + +V+LG   IP    + +PILA+HHD  IWG 
Sbjct  372   VKLKTLNMIVNESLRLYPPTIATIRRTKTDVELGGYKIPRGTELLIPILAVHHDLAIWGN  431

Query  1320  DVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTL  1499
             DV+ FNP RF++GV      +  AF PFG+G RTC+G N    + K+AL++ILQR+ F L
Sbjct  432   DVNEFNPGRFSEGV-ARAAKHPVAFIPFGLGVRTCIGQNLAVLQTKLALAIILQRFSFRL  490

Query  1500  SPNYVHYPADIFILTPKNGVQVILQNV*LLSCP  1598
             +P+Y H P  + +L P+ G  +I   +  L  P
Sbjct  491   APSYQHAPTVLMLLYPQYGAPIIFNQLSTLDNP  523



>ref|NP_001043634.1| Os01g0627800 [Oryza sativa Japonica Group]
 dbj|BAD61188.1| cytochrome P450-like [Oryza sativa Japonica Group]
 dbj|BAD61160.1| cytochrome P450-like [Oryza sativa Japonica Group]
 dbj|BAF05548.1| Os01g0627800 [Oryza sativa Japonica Group]
 dbj|BAG95211.1| unnamed protein product [Oryza sativa Japonica Group]
Length=534

 Score =   382 bits (982),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/505 (40%), Positives = 302/505 (60%), Gaps = 12/505 (2%)
 Frame = +3

Query  78    SIYLLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFD  257
             ++ +L  L R  +R W  PRR+   ++ QG+ G  Y FP G+  + +    ++  KPM  
Sbjct  32    ALLVLGALYRAAERCWLGPRRVAGALQGQGLRGTAYRFPAGDLPENARRSKEARAKPM-P  90

Query  258   ISHHIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDD  437
               H I  R+ P +    + YGN  +TW GT P + I EPEL+K++L+NK G + K  L  
Sbjct  91    PCHDIVPRVAPLLQDIVKEYGNVCITWFGTTPRVVIAEPELVKDILSNKFGHFEKFTLKS  150

Query  438   FAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERW-KELEGK-  611
               K L+   L + EGEKWA+ R++ N  FH E LK M+P        M++RW  +L G  
Sbjct  151   LGK-LIALGLASYEGEKWARHRRILNPAFHLEKLKHMLPAFSTCCSEMIDRWDSKLAGSD  209

Query  612   ---ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISML  782
                ELD++++F  LT +VISRTAFGSSF+EG+ IF++        +K +  +  PG    
Sbjct  210   GPFELDIWQEFQNLTGDVISRTAFGSSFMEGRRIFQLQEEQADRIIKTIQYIYIPGYLYF  269

Query  783   TRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISK-  956
                ++    E   R I+G +  ++ KR +   NG  E  G+D LG ++K      + S  
Sbjct  270   PTENNRRMKEN-SREIEGLLRGIIEKRSRAVENG--ELSGDDLLGLMLKSNMDSGEPSNL  326

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDG  1136
              +S + +I+E K  Y AG  TT+ LL W + +L++H EWQ +AR E+L  FG + P  DG
Sbjct  327   RMSTEDVIEECKLFYFAGMETTSVLLTWTLVVLSMHPEWQHRAREEVLSAFGRDKPNFDG  386

Query  1137  IARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWG  1316
             ++RL+T+ MIL+E +RLYPP +T++R+  +E+++G +T PA + + +PI+ +HH+  +WG
Sbjct  387   LSRLKTVTMILHEVLRLYPPAVTLSRRTFKEIQIGGITYPAGVGLELPIILIHHNTDVWG  446

Query  1317  QDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFT  1496
             +D H F P RFA G++KAT  N  AFFPFG GPR C+G NF   EAK+AL +ILQ ++F 
Sbjct  447   KDAHEFKPERFADGISKATKTNQQAFFPFGWGPRICIGQNFAMLEAKMALCVILQNFEFQ  506

Query  1497  LSPNYVHYPADIFILTPKNGVQVIL  1571
             LSP+Y H P     L P++G Q+IL
Sbjct  507   LSPSYTHAPYASVTLHPQHGAQIIL  531



>ref|XP_002455992.1| hypothetical protein SORBIDRAFT_03g028630 [Sorghum bicolor]
 gb|EES01112.1| hypothetical protein SORBIDRAFT_03g028630 [Sorghum bicolor]
Length=523

 Score =   382 bits (980),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 199/505 (39%), Positives = 306/505 (61%), Gaps = 13/505 (3%)
 Frame = +3

Query  87    LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISH  266
             ++W   R     W  PRRL + +R+QG+ G  Y FP G+ K+ + +  ++  +PM    H
Sbjct  25    IVWGAYRAAQTFWLRPRRLDRALRAQGLTGTEYCFPAGDLKENARLNDEARSRPM-PPCH  83

Query  267   HIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAK  446
              +  R+ PH+ +  + +GN  +TW G  P + ITE EL++++L+NK G + K   +    
Sbjct  84    DVVPRVMPHLFSTIKEHGNICVTWFGPIPRVVITEAELVRDILSNKFGHFEKF-TNKRLG  142

Query  447   KLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK-ELEGK----  611
             KLL   L + +GEKWAK R++ N  FH E LKRM+PE       +++RW+ ++ G     
Sbjct  143   KLLALGLASYDGEKWAKHRRILNPAFHLEKLKRMLPEFSTCCTELIDRWENKIAGSDGSY  202

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             ELD++ +F  LT +VISRTAFGSSF+EG+ IF++        +K    +  PG       
Sbjct  203   ELDIWPEFQNLTGDVISRTAFGSSFMEGRRIFQLQGEQAERLIKAFQYMYIPGFIFFPTQ  262

Query  792   SDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISKNISL  968
             ++    +++ R I+G +  ++ KRE+   NG  E  GND LG L++        S  +S 
Sbjct  263   NNR-RMKEINREIEGTLRGMIEKRERAIENG--ETSGNDLLGLLLQSNMDSGKGSLRMST  319

Query  969   DQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHE-NPTSDGIAR  1145
             + +I+E K  Y AG  TT+ LL W + +L +H EWQ++AR E+L +FG +  P  DG+ R
Sbjct  320   EDVIEECKLFYFAGMETTSVLLTWTLVILGMHPEWQDRAREEVLSVFGRDKQPNFDGLGR  379

Query  1146  LRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDV  1325
             L+T+ MIL E +RLYPP +T+ R+  +++++G +T PA + + +PI+A+HH+P IWG+D 
Sbjct  380   LKTVTMILYEVLRLYPPAVTLNRRTFKDMQIGGITYPAGVILELPIIAVHHNPHIWGKDA  439

Query  1326  HVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSP  1505
             H F P RFA+G+      +  AFFPFG GPR C+G NF   EAKIALSMILQR++F LSP
Sbjct  440   HEFKPERFAEGI-SKATKDQPAFFPFGWGPRICIGQNFALLEAKIALSMILQRFEFQLSP  498

Query  1506  NYVHYPADIFILTPKNGVQVILQNV  1580
             +Y H P  +  L P++G  +I + +
Sbjct  499   SYTHAPYTVITLHPQHGAPIIFKKI  523



>emb|CDM83378.1| unnamed protein product [Triticum aestivum]
Length=532

 Score =   381 bits (979),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/505 (38%), Positives = 303/505 (60%), Gaps = 13/505 (3%)
 Frame = +3

Query  87    LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISH  266
             LLW + R  +  W  PRRL + +R+QG+ G  Y FP G+      +  ++  KPM    H
Sbjct  34    LLWAVSRAAETCWLRPRRLSRALRAQGLGGTAYRFPAGDLADNGRLNEEARSKPM-PPCH  92

Query  267   HIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAK  446
              I  R+ PH+    + +GN  +TW G    + I EP+L++E+L++K G + K       K
Sbjct  93    DIVPRVAPHLLNIVKEHGNVCITWFGPVLRMVIAEPKLVREILSDKSGHFEKFTNKRLGK  152

Query  447   KLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK-ELEGK----  611
              L+   L + +GEKWA  R++ N  FH E LK M+P        ++  W+ +L G     
Sbjct  153   -LIALGLASYDGEKWAMHRRILNPAFHLEKLKSMLPAFSTCCTELISSWESKLAGSDGSH  211

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRS  791
             E+D+++DF  LT +VISRT+FGSSF+EG+ IF++ +      +K    +  PG       
Sbjct  212   EIDIWEDFQNLTGDVISRTSFGSSFMEGRRIFQLQAEQAERIIKAFQYMYIPGYLFFPTE  271

Query  792   SDEIEAEKLERGIKGAILELVRKREK--ESNGVVENYGNDYLGQLMKITTGGSDISKNIS  965
             +++   +++ R I+G +  ++ KRE+  E++G+  + GND LG +++           +S
Sbjct  272   NNK-RMKQINREIEGLLRGIIEKRERAMENDGL--SSGNDLLGLMLQSNKESGTSRMRMS  328

Query  966   LDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIAR  1145
              + +I+E K  Y AG  TT+ LL W + +L +H EWQ++AR E+L +FG + P  DG+ R
Sbjct  329   TEDVIEECKLFYFAGMETTSVLLTWTLVVLGMHPEWQDRAREEVLSVFGKDKPNFDGLGR  388

Query  1146  LRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDV  1325
             L+T+ MIL E +RLYPP +T+ RK  R++++G +T PA + + +PI+ +HH+P +WG+DV
Sbjct  389   LKTVTMILYEVLRLYPPAVTLNRKTSRQMQIGGITYPAGVLLELPIIMVHHNPDVWGKDV  448

Query  1326  HVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSP  1505
               F P RFA+G+      +   FFPFG GPR C+G NF   EAK+ALSMILQR++F LSP
Sbjct  449   LEFKPERFAEGI-SKATKDQPVFFPFGWGPRICIGQNFAMLEAKMALSMILQRFEFQLSP  507

Query  1506  NYVHYPADIFILTPKNGVQVILQNV  1580
             +Y H P  +  L P++G Q+IL+++
Sbjct  508   SYTHAPYTVITLHPQHGAQIILKSL  532



>ref|XP_004969233.1| PREDICTED: secologanin synthase-like [Setaria italica]
Length=548

 Score =   382 bits (981),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 204/509 (40%), Positives = 312/509 (61%), Gaps = 20/509 (4%)
 Frame = +3

Query  87    LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISH  266
             ++W   R  +R W  PRRL + +R+QG+ G  Y FP G+ ++ + +  ++  +PM    H
Sbjct  49    VVWGAYRAAERYWLRPRRLDRALRAQGLSGTEYRFPAGDLQENARLNDEARSRPMPQ-CH  107

Query  267   HIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAK  446
              +  RI PH+    + +GN  +TW G  P + ITE EL++++L+NK G + K   +    
Sbjct  108   DVVPRIMPHLFDTVKEHGNVCITWFGPIPRVIITEAELVRDILSNKFGHFEKF-TNKRLG  166

Query  447   KLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK-ELEGK----  611
             KLL   L +++GEKWAK R++ N  FH E LKRM+P        +++RW+ +L G     
Sbjct  167   KLLALGLASHDGEKWAKHRRILNPAFHLEKLKRMLPAFSTCCTELIDRWENKLAGSDGSY  226

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISML---  782
             E+D++ +F  LT +VISRTAFGSSF+EG+ IF++ +      +K    +  PG   L   
Sbjct  227   EVDIWPEFQNLTGDVISRTAFGSSFMEGRRIFQLQAEQAERIIKAFQYMYIPGFLFLPTQ  286

Query  783   -TRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISK  956
               R   EI  E     I+G +  ++ KRE+   NG  E  GND LG L++        S 
Sbjct  287   NNRRMKEINGE-----IEGILRGMIEKRERAIENG--EASGNDLLGLLLQSNMDSGKGSL  339

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN-PTSD  1133
              +S + MI+E K  Y AG  TT+ LL W + +L +H EWQ++AR EIL +FG ++ P  D
Sbjct  340   RMSTEDMIEECKLFYFAGMETTSVLLTWTLVILGMHPEWQDRAREEILRVFGKDDKPNLD  399

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
              ++RL+T+ MIL E +RLYPP +T+ R+  +++++G +T PA + + +PI+ +HH+P +W
Sbjct  400   SLSRLKTVTMILYEVLRLYPPAVTLNRRTFKDMQIGGITYPAGVILELPIIVVHHNPDVW  459

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G D H F P RFA+G++KAT ++  AFFPFG GPR C+G NF   EAK+ALSMILQR++F
Sbjct  460   GTDAHEFKPERFAEGISKATKDDQPAFFPFGWGPRICIGQNFALLEAKMALSMILQRFEF  519

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              LSP+Y H P  +  L P++G  +I++ +
Sbjct  520   QLSPSYTHAPYTVITLHPQHGAPIIVKKI  548



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   380 bits (976),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 198/495 (40%), Positives = 305/495 (62%), Gaps = 14/495 (3%)
 Frame = +3

Query  123   WWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISHHIFARIQPHVHT  302
             WW P +L K  R QGI GPP  + HGN K    MR++++ KPM ++SH I  R+ P VH 
Sbjct  28    WWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVRMRNEALSKPM-NLSHDIAPRVVPFVHQ  86

Query  303   WKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAKKLLGEALITNEG  482
               E YGN  +TW G  P + + +P+LIK++L+NK G + K   +   + L  + L+++EG
Sbjct  87    TIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNKFGQFEKPKSNPLIR-LFVDGLVSHEG  145

Query  483   EKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWKEL---EGK-ELDVFKDFGVLTT  650
             EKWAK R++ N  FH E LKRM+P    S   M+ +W++L   EG  ELD++ +   LT 
Sbjct  146   EKWAKHRRIINPAFHIEKLKRMLPAFYTSCFEMITKWEKLVALEGSCELDIWPELQNLTG  205

Query  651   EVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGI  830
             +VISRTAFGSS+ EG+ IF++ +    I +    ++  PG  +L    +    ++++R +
Sbjct  206   DVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALSIYIPGYRLLPTKRNN-RMKEIDREV  264

Query  831   KGAILELVRKREKESNGVVENYGNDYLGQLMK-----ITTGGSDISKNISLDQMIDEIKA  995
             +G +  +V KREK +  + E   +D LG L++     I   G++ +  +++D++I+E K 
Sbjct  265   RGLLRRIVNKREK-AIKLGEASKDDLLGLLLESNFKEIREHGNEKNIGMNVDEVIEECKL  323

Query  996   LYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHENPTSDGIARLRTMNMILNE  1175
              Y AG  TT++LL W + +L++H EWQ +AR E+L+ FG + P  DGI  L+ ++MIL E
Sbjct  324   FYFAGQETTSNLLVWTMVVLSMHPEWQMRAREEVLQSFGKDKPDFDGINHLKVVSMILYE  383

Query  1176  CMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIWGQDVHVFNPHRFAQ  1355
              +RLYPP + +TR+  ++VKLG++ +P  + + +P + +HH  ++WG+D   F P RF  
Sbjct  384   VLRLYPPAVALTRQTYKKVKLGDVYLPPRVELSLPTILIHHSRELWGEDAQEFKPERFLG  443

Query  1356  GVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIF  1535
             GV     NN  +F PFG GPR C+G NF   EAK+AL++ILQ + F LSP+Y H P  I 
Sbjct  444   GV-SKAANNQVSFIPFGWGPRICIGQNFAMIEAKMALALILQHFSFELSPSYAHAPCTII  502

Query  1536  ILTPKNGVQVILQNV  1580
              L P+ G Q+IL  +
Sbjct  503   TLQPQYGAQIILHKL  517



>dbj|BAN19913.1| cytochrome P450 [Echinochloa phyllopogon]
Length=527

 Score =   379 bits (974),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 200/509 (39%), Positives = 307/509 (60%), Gaps = 21/509 (4%)
 Frame = +3

Query  87    LLWKLVRLVDRAWWTPRRLRKVMRSQGIIGPPYSFPHGNTKQISNMRSQSMGKPMFDISH  266
             ++W   R  +R W  PRRL + +R+QG+ G  YSFP G+ K+   +  ++  +PM  + H
Sbjct  29    VVWGCYRAAERCWLRPRRLDRALRAQGLSGTEYSFPAGDLKENGRLNDEARSRPM-KLCH  87

Query  267   HIFARIQPHVHTWKEIYGNTFLTWHGTKPYLFITEPELIKEVLANKEGAYPKMDLDDFAK  446
              +  R+ PH+    + +GN  +TW G  P + ITE EL++++L+NK G + K   +    
Sbjct  88    DVVPRVMPHLLNTVKEHGNICITWFGPIPRVIITEAELVRDILSNKFGHFEKFT-NKRLG  146

Query  447   KLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMIASVEVMLERWK-ELEGK----  611
             KLL   L + +GEKWAK R++ N  FH E LKRM+P        + +RW+ +L G     
Sbjct  147   KLLALGLASYDGEKWAKHRRILNPAFHLEKLKRMLPAFSTCCTELTDRWESKLAGSDGSY  206

Query  612   ELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMVSNLTAITVKNVYNVKFPGISML---  782
             E+D++ +F  LT +VISRTAFGSSF+EG+ IF++ +      +K    +  PG   L   
Sbjct  207   EVDIWPEFQNLTGDVISRTAFGSSFMEGRRIFQLQAEQAERLIKAFQYMYIPGFLFLPTK  266

Query  783   -TRSSDEIEAEKLERGIKGAILELVRKREKE-SNGVVENYGNDYLGQLMKITTGGSDISK  956
               R   EI  E     I+G +  ++ KRE+    G  E  GND LGQL++        S 
Sbjct  267   NNRRMKEINGE-----IEGILRGMIEKRERAIEKG--EASGNDLLGQLLQSNMDSGKGSL  319

Query  957   NISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEWQEKARREILELFGHEN-PTSD  1133
              +S + +I+E K  Y AG  TT+ LL W + +L +H EWQ++AR E+L +FG ++ P  D
Sbjct  320   RMSTEDVIEECKLFYFAGMETTSVLLTWTLVILGMHPEWQDRAREEVLSVFGKDDTPNFD  379

Query  1134  GIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTIPADITIFMPILALHHDPQIW  1313
             G++RL+T+ MIL E +RLYPP +T+ R+  +++++G +T PA + + +P++ +HH+P +W
Sbjct  380   GLSRLKTVTMILYEVLRLYPPAVTLNRRTFKDMQIGGITYPAGVILELPVIVVHHNPDVW  439

Query  1314  GQDVHVFNPHRFAQGVakatnnnaaaFFPFGMGPRTCVGLNFTTNEAKIALSMILQRYKF  1493
             G+D   F P RFA+G+      +  AFFPFG GPR C+G NF   EAK+ALSMILQR++F
Sbjct  440   GKDAREFKPERFAEGI-SKATKDQPAFFPFGWGPRICIGQNFALLEAKMALSMILQRFEF  498

Query  1494  TLSPNYVHYPADIFILTPKNGVQVILQNV  1580
              LSP+Y H P  +  L P++G  +IL+ +
Sbjct  499   QLSPSYTHAPYTVITLHPQHGAPIILKKI  527



>ref|XP_010046258.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=383

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 262/348 (75%), Gaps = 3/348 (1%)
 Frame = +3

Query  537   LKRMVPEMIASVEVMLERWKELEGKELDVFKDFGVLTTEVISRTAFGSSFLEGKHIFKMV  716
             ++ M+P M+ SV  +L+RW++LE KE+++F++F ++T++VISRTAFGSS++EG+ IF+M+
Sbjct  35    VRGMIPAMVDSVHALLDRWQKLEAKEVELFEEFAMITSDVISRTAFGSSYIEGREIFQML  94

Query  717   SNLTAITVKNVYNVKFPGISMLTRSSDEIEAEKLERGIKGAILELVRKREKESN-GVVEN  893
             S LT +  +N++ ++ PGI  + ++SD+I++E+LE+ I  A+L ++ KREK+ N G +++
Sbjct  95    SELTIVVSRNLFKLRLPGIRNIWKTSDDIKSERLEKAICDALLGIIEKREKKVNVGEMDD  154

Query  894   YGNDYLGQLMKITTGGSDISKNISLDQMIDEIKALYGAGHLTTTSLLGWCIFLLALHTEW  1073
             YGNDYLG L+K      D SK I++D ++DE +  + +G  TTTS+L W +FLLA+H +W
Sbjct  155   YGNDYLGSLLK-AYHDPDKSKRITIDDLMDECRTFHFSGQETTTSILTWTLFLLAIHKDW  213

Query  1074  QEKARREILELFGHENPTSDGIARLRTMNMILNECMRLYPPVITVTRKVEREVKLGNLTI  1253
             QE+AR+E+ ++FG+E+P  +GI +L+T+ MI+NE +RLYPPV+   RKV R+V LG+L +
Sbjct  214   QEEARKEVTDVFGNEDPNHEGIMKLKTVGMIINESLRLYPPVVNTIRKVVRQVTLGDLVL  273

Query  1254  PADITIFMPILALHHDPQIWGQDVHVFNPHRFAQGVa-katnnnaaaFFPFGMGPRTCVG  1430
             P  I + +PIL +HH P+IWG DVH+F P RF +GVA   +N+ AAAF PFG+GPR CVG
Sbjct  274   PQGIALQIPILTIHHSPRIWGDDVHLFKPERFREGVAGAVSNDAAAAFLPFGLGPRNCVG  333

Query  1431  LNFTTNEAKIALSMILQRYKFTLSPNYVHYPADIFILTPKNGVQVILQ  1574
              NF T E KI L+MIL+ Y FT+SP+YVH P  I  + P++G++VIL 
Sbjct  334   SNFATTEVKIILAMILRHYSFTVSPDYVHLPTQILTIRPQHGLKVILH  381



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6330540990048