BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34136_g1_i1 len=481 path=[1:0-480]

Length=481
                                                                      Score     E

ref|XP_006397819.1|  hypothetical protein EUTSA_v10001752mg           52.4    4e-06   
gb|KHG23780.1|  hypothetical protein F383_09698                       50.8    7e-06   
ref|XP_007051629.1|  Arabinogalactan protein 20                       50.4    1e-05   
gb|KFK37401.1|  hypothetical protein AALP_AA4G252200                  50.1    2e-05   
ref|XP_009394147.1|  PREDICTED: arabinogalactan peptide 20-like       48.9    4e-05   
ref|XP_009133771.1|  PREDICTED: arabinogalactan peptide 16            48.5    5e-05   
gb|KHG21381.1|  hypothetical protein F383_27165                       48.5    5e-05   
ref|XP_010266430.1|  PREDICTED: arabinogalactan peptide 20-like       48.5    6e-05   
ref|NP_191723.1|  arabinogalactan protein 20                          48.1    7e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95690.1|  BnaC03g25710D                                        48.1    7e-05   
ref|XP_009142659.1|  PREDICTED: arabinogalactan peptide 16            47.8    9e-05   
gb|KHG29554.1|  hypothetical protein F383_05303                       47.0    2e-04   
ref|XP_010544793.1|  PREDICTED: arabinogalactan peptide 20            46.6    3e-04   
ref|XP_010261486.1|  PREDICTED: arabinogalactan peptide 20-like       46.6    3e-04   
gb|KHG17805.1|  hypothetical protein F383_20619                       46.2    4e-04   
ref|XP_002265607.1|  PREDICTED: arabinogalactan peptide 20            45.8    4e-04   Vitis vinifera
ref|NP_566070.3|  arabinogalactan protein 16                          45.8    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569483.1|  PREDICTED: arabinogalactan peptide 16-like       45.4    7e-04   



>ref|XP_006397819.1| hypothetical protein EUTSA_v10001752mg, partial [Eutrema salsugineum]
 gb|ESQ39272.1| hypothetical protein EUTSA_v10001752mg, partial [Eutrema salsugineum]
Length=110

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +1

Query  70   ASPVWFRTPWSLTKMAMMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSI  249
            A P  F   +      M SR S+   A+FT V A +S  A A   AP  +P  TSDGTSI
Sbjct  22   AEPTIFPRIFYFVHREMASRISVAGFALFTFVFAVISSLASAQSLAP--APAPTSDGTSI  79

Query  250  DQGIayllmllalalTYIIH  309
            DQGIAYLLM++AL LTY+IH
Sbjct  80   DQGIAYLLMVVALVLTYLIH  99



>gb|KHG23780.1| hypothetical protein F383_09698 [Gossypium arboreum]
Length=74

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +1

Query  112  MAMMS-RASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllal  288
            MA++S R  M  V IF L+ A VS P V  Q+A P+ P+ TSDGTSIDQGIAY+LML+AL
Sbjct  1    MAVISFRGLMRVVTIFALIFAIVS-PKVEAQSAAPA-PSPTSDGTSIDQGIAYVLMLVAL  58

Query  289  alTYIIH  309
             LTY+IH
Sbjct  59   VLTYLIH  65



>ref|XP_007051629.1| Arabinogalactan protein 20 [Theobroma cacao]
 gb|EOX95786.1| Arabinogalactan protein 20 [Theobroma cacao]
Length=75

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +1

Query  124  SRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalTYI  303
            SRA +  +AIF LV A VS P V  Q+A P+ P+ TSDGTSIDQGIAY+LML+AL LTY+
Sbjct  6    SRAFVGVMAIFALVFAIVS-PFVEAQSAAPA-PSPTSDGTSIDQGIAYVLMLVALVLTYL  63

Query  304  IH  309
            IH
Sbjct  64   IH  65



>gb|KFK37401.1| hypothetical protein AALP_AA4G252200 [Arabis alpina]
Length=72

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query  118  MMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalT  297
            M SR S+   A+FT V A +S  A A   AP  SPT  SDGTSIDQGIAYLLM++AL LT
Sbjct  1    MSSRNSVAGFALFTFVFAVISSLAGAQTLAPAPSPT--SDGTSIDQGIAYLLMVVALVLT  58

Query  298  YIIH  309
            Y+IH
Sbjct  59   YLIH  62



>ref|XP_009394147.1| PREDICTED: arabinogalactan peptide 20-like [Musa acuminata subsp. 
malaccensis]
Length=74

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +1

Query  112  MAMMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllala  291
            MA + RAS   VAI  L LA +  PAV  QA    +P+ TSDGTSIDQGIAYLLML+AL 
Sbjct  1    MAGIPRASFGLVAIMVLALA-ILMPAVQAQA---PAPSPTSDGTSIDQGIAYLLMLVALV  56

Query  292  lTYIIH*V*AIEPDQTF  342
            LTY+IH + A  P + F
Sbjct  57   LTYLIHPLDASSPYKLF  73



>ref|XP_009133771.1| PREDICTED: arabinogalactan peptide 16 [Brassica rapa]
 emb|CDX83372.1| BnaA03g21340D [Brassica napus]
Length=73

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query  118  MMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalT  297
            M SR+ +   A+FT V A VS  A A   AP  +P  TSDGTSIDQGIAYLLM++AL LT
Sbjct  1    MASRSYVAGFALFTFVFAVVSSLAGAQSLAP--APAPTSDGTSIDQGIAYLLMVVALVLT  58

Query  298  YIIH  309
            Y+IH
Sbjct  59   YLIH  62



>gb|KHG21381.1| hypothetical protein F383_27165 [Gossypium arboreum]
Length=75

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +1

Query  112  MAMMSRASMLAVA-IFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllal  288
            M  +S ++ L VA IF LV A++S P V  Q+A P+ P+ TSDGTSIDQGIAY+LM++AL
Sbjct  1    MTTISSSTFLGVAVIFGLVFASMS-PYVEAQSASPA-PSPTSDGTSIDQGIAYVLMVVAL  58

Query  289  alTYIIH  309
             LTY+IH
Sbjct  59   VLTYLIH  65



>ref|XP_010266430.1| PREDICTED: arabinogalactan peptide 20-like [Nelumbo nucifera]
Length=73

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  121  MSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalTY  300
            +SR S   VAI  L+ A V+ PAV  Q+  P+ P  TSDGTSIDQGIAY+LML+AL LTY
Sbjct  3    VSRVSFGVVAIVALIFA-VALPAVQAQSVAPA-PAPTSDGTSIDQGIAYVLMLVALVLTY  60

Query  301  IIH  309
            +IH
Sbjct  61   LIH  63



>ref|NP_191723.1| arabinogalactan protein 20 [Arabidopsis thaliana]
 sp|Q9M373.1|AGP20_ARATH RecName: Full=Arabinogalactan peptide 20; Short=AG-peptide 20; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB71094.1| putative protein [Arabidopsis thaliana]
 gb|AAM61203.1| unknown [Arabidopsis thaliana]
 gb|ABF58981.1| At3g61640 [Arabidopsis thaliana]
 gb|AEE80235.1| arabinogalactan protein 20 [Arabidopsis thaliana]
Length=74

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  118  MMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalT  297
            M SR S+  +A+F  V A +S  A A   AP  SPT  SDGTSIDQGIAYLLM++AL LT
Sbjct  1    MASRNSVAVIALFAFVFAVISPFAGAQSLAPAPSPT--SDGTSIDQGIAYLLMVVALVLT  58

Query  298  YIIH*V*AIEPDQTF  342
            Y+IH + A     TF
Sbjct  59   YLIHPLDASSSSYTF  73



>emb|CDX95690.1| BnaC03g25710D [Brassica napus]
Length=73

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query  118  MMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalT  297
            M SR+ +   A+FT V A +S  A A   AP  +P  TSDGTSIDQGIAYLLM+LAL LT
Sbjct  1    MASRSYVAGFALFTFVFAVISSLAGAQSLAP--APAPTSDGTSIDQGIAYLLMVLALVLT  58

Query  298  YIIH  309
            Y+IH
Sbjct  59   YLIH  62



>ref|XP_009142659.1| PREDICTED: arabinogalactan peptide 16 [Brassica rapa]
 emb|CDY42034.1| BnaC04g01120D [Brassica napus]
 emb|CDX80008.1| BnaA05g01480D [Brassica napus]
Length=73

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  118  MMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalT  297
            M SR S+   A+FT V A  S  A A   AP  +P  TSDGTSIDQGIAYLLM++AL LT
Sbjct  1    MASRNSVAGFALFTFVFAVFSSLAGAQTLAP--APAPTSDGTSIDQGIAYLLMVVALVLT  58

Query  298  YIIH  309
            Y+IH
Sbjct  59   YLIH  62



>gb|KHG29554.1| hypothetical protein F383_05303 [Gossypium arboreum]
Length=75

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  112  MAMMSRASMLAV-AIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllal  288
            MA +S    + V AI  LV A VS P V  QA+ P+ P+ TSDGTSIDQGIAY+LML+AL
Sbjct  1    MAEISYGGFMGVMAILALVFAIVS-PYVEAQASAPA-PSPTSDGTSIDQGIAYVLMLVAL  58

Query  289  alTYIIH  309
             LTY+IH
Sbjct  59   MLTYLIH  65



>ref|XP_010544793.1| PREDICTED: arabinogalactan peptide 20 [Tarenaya hassleriana]
Length=71

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = +1

Query  118  MMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalT  297
            M SR S+   A+F  + + VS P    Q+AP  +P  TSDGT+IDQGIAYLLM+LAL LT
Sbjct  1    MASRTSLAVFALFAFIFSVVS-PLAGAQSAP--APAPTSDGTAIDQGIAYLLMVLALVLT  57

Query  298  YIIH  309
            Y+IH
Sbjct  58   YLIH  61



>ref|XP_010261486.1| PREDICTED: arabinogalactan peptide 20-like [Nelumbo nucifera]
Length=73

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +1

Query  121  MSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalTY  300
            +SR S   +AI  L+ + ++FPAV  Q+  P+ P  TSDGTSIDQG+AY+LML+AL LTY
Sbjct  3    VSRVSFGVMAIVALIFS-IAFPAVQAQSLAPA-PAPTSDGTSIDQGVAYVLMLVALVLTY  60

Query  301  IIH  309
            +IH
Sbjct  61   LIH  63



>gb|KHG17805.1| hypothetical protein F383_20619 [Gossypium arboreum]
Length=75

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +1

Query  136  MLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalTYIIH  309
            M  V IF +V A VS P V  Q+  P+ P+ TSDGTSIDQGIAY+LML+AL LTY+IH
Sbjct  10   MKVVTIFAIVFATVS-PKVEAQSVAPA-PSPTSDGTSIDQGIAYILMLVALVLTYLIH  65



>ref|XP_002265607.1| PREDICTED: arabinogalactan peptide 20 [Vitis vinifera]
 emb|CAN66886.1| hypothetical protein VITISV_012134 [Vitis vinifera]
 emb|CBI22566.3| unnamed protein product [Vitis vinifera]
Length=67

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +1

Query  121  MSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalTY  300
            +SR S++ VAI  L L AV  P+   Q+  P+ P  TSDGT+IDQGIA +LML+AL LTY
Sbjct  3    VSRVSLVVVAIIAL-LYAVVLPSAHAQSLAPA-PAPTSDGTAIDQGIACVLMLVALVLTY  60

Query  301  IIH  309
            +IH
Sbjct  61   LIH  63



>ref|NP_566070.3| arabinogalactan protein 16 [Arabidopsis thaliana]
 ref|XP_002882058.1| hypothetical protein ARALYDRAFT_483786 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O82337.1|AGP16_ARATH RecName: Full=Arabinogalactan peptide 16; Short=AG-peptide 16; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG24284.1|AF195897_1 arabinogalactan protein [Arabidopsis thaliana]
 gb|AAK95262.1|AF410276_1 At2g46330/F11C10.2 [Arabidopsis thaliana]
 gb|AAD23036.1| expressed protein [Arabidopsis thaliana]
 gb|AAM15047.1| expressed protein [Arabidopsis thaliana]
 gb|AAM19886.1| At2g46330/F11C10.2 [Arabidopsis thaliana]
 gb|AAM62852.1| unknown [Arabidopsis thaliana]
 gb|EFH58317.1| hypothetical protein ARALYDRAFT_483786 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10680.1| arabinogalactan protein 16 [Arabidopsis thaliana]
Length=73

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  118  MMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllalalT  297
            M SR S+   A+F+ V A +   A A   AP  +P  TSDGTSIDQGIAYLLM++AL LT
Sbjct  1    MASRNSVTGFALFSFVFAVILSLAGAQSLAP--APAPTSDGTSIDQGIAYLLMVVALVLT  58

Query  298  YIIH  309
            Y+IH
Sbjct  59   YLIH  62



>ref|XP_003569483.1| PREDICTED: arabinogalactan peptide 16-like [Brachypodium distachyon]
Length=69

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 8/66 (12%)
 Frame = +1

Query  112  MAMMSRASMLAVAIFTLVLAAVSFPAVADQAAPPSSPTATSDGTSIDQGIayllmllala  291
            MA+ SR S+L +AI       V    VA+  AP  +PT TSDGTS+DQGIAY+LM +AL 
Sbjct  1    MAVSSRVSLLLMAI------VVVLATVANAQAP--APTPTSDGTSVDQGIAYVLMFVALV  52

Query  292  lTYIIH  309
            LTY+IH
Sbjct  53   LTYLIH  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519922816592