BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c34074_g1_i1 len=936 path=[1:0-935]

Length=936
                                                                      Score     E

ref|XP_003635288.1|  PREDICTED: NAC transcription factor 25             169   9e-46   
gb|KHG21395.1|  NAC domain-containing 18 -like protein                  163   3e-44   
gb|AHJ79194.1|  NAC domain protein NAC53                                164   8e-44   
ref|XP_010278293.1|  PREDICTED: NAC transcription factor NAM-B2-like    163   3e-43   
ref|XP_007021327.1|  NAC domain protein, IPR003441                      162   5e-43   
emb|CBI38329.3|  unnamed protein product                                160   1e-42   
ref|XP_010268761.1|  PREDICTED: NAC transcription factor 25-like        159   5e-42   
gb|AHJ79165.1|  NAC domain protein NAC24                                159   8e-42   
ref|XP_002532683.1|  NAC domain-containing protein, putative            157   2e-41   Ricinus communis
emb|CBI20351.3|  unnamed protein product                                157   3e-41   
ref|XP_007025712.1|  NAC domain containing protein 25                   156   6e-41   
gb|KHG07368.1|  NAC domain-containing 18 -like protein                  155   1e-40   
ref|XP_006467845.1|  PREDICTED: NAC transcription factor 25-like        154   4e-40   
gb|AGC27313.1|  NAC domain protein 10                                   154   7e-40   
ref|XP_006449287.1|  hypothetical protein CICLE_v10015688mg             154   7e-40   
gb|KHG20342.1|  NAC domain-containing 18 -like protein                  152   2e-39   
gb|AGL39684.1|  NAC transcription factor 028                            152   4e-39   
gb|AGC27321.1|  NAC domain protein 10                                   151   5e-39   
gb|AGL39685.1|  NAC transcription factor 029                            150   1e-38   
ref|XP_011029435.1|  PREDICTED: NAC domain-containing protein 18-...    150   2e-38   
ref|XP_006370307.1|  no apical meristem family protein                  149   7e-38   
ref|XP_002284654.2|  PREDICTED: NAC transcription factor 25 isofo...    148   7e-38   Vitis vinifera
ref|XP_002305677.1|  no apical meristem family protein                  148   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_002316919.2|  no apical meristem family protein                  147   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004293567.1|  PREDICTED: NAC transcription factor 25-like        147   1e-37   
gb|AEQ28762.1|  NAC domain class transcription factor                   147   2e-37   
ref|XP_004291668.1|  PREDICTED: NAC transcription factor ONAC010-...    147   2e-37   
emb|CAN81855.1|  hypothetical protein VITISV_041250                     143   3e-37   Vitis vinifera
ref|XP_002519008.1|  transcription factor, putative                     146   4e-37   Ricinus communis
ref|XP_002316635.1|  no apical meristem family protein                  146   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011042501.1|  PREDICTED: NAC domain-containing protein 18-...    146   5e-37   
ref|XP_011027905.1|  PREDICTED: NAC transcription factor 25-like        146   5e-37   
ref|XP_011098344.1|  PREDICTED: NAC domain-containing protein 18        145   6e-37   
gb|EYU33415.1|  hypothetical protein MIMGU_mgv1a009589mg                145   7e-37   
gb|AID55352.1|  NAC protein 1                                           144   1e-36   
ref|XP_007149615.1|  hypothetical protein PHAVU_005G084600g             145   1e-36   
ref|XP_009334622.1|  PREDICTED: NAC domain-containing protein 18        145   2e-36   
ref|XP_011096265.1|  PREDICTED: NAC transcription factor 25             144   2e-36   
emb|CAG28971.1|  NAM-like protein                                       144   2e-36   Prunus persica
ref|XP_008226677.1|  PREDICTED: NAC transcription factor 25             144   2e-36   
ref|XP_007211475.1|  hypothetical protein PRUPE_ppa007577mg             144   3e-36   
ref|XP_009759753.1|  PREDICTED: NAC transcription factor 25-like        144   3e-36   
ref|NP_001266277.1|  uncharacterized protein LOC101247735               143   3e-36   
gb|AGT56012.1|  sinor-like protein 1                                    143   3e-36   
gb|AID55348.1|  NAC protein 1                                           143   4e-36   
ref|XP_009609295.1|  PREDICTED: NAC transcription factor 25-like        143   5e-36   
ref|XP_010060527.1|  PREDICTED: NAC domain-containing protein 18-...    143   6e-36   
ref|XP_008386130.1|  PREDICTED: NAC domain-containing protein 18-...    143   7e-36   
ref|XP_009769986.1|  PREDICTED: NAC transcription factor 25             142   1e-35   
gb|AGS08759.1|  NAC domain protein                                      142   1e-35   
ref|XP_010089502.1|  NAC domain-containing protein 18                   143   1e-35   
ref|XP_006841705.1|  hypothetical protein AMTR_s00003p00252470          142   1e-35   
ref|XP_009594217.1|  PREDICTED: NAC transcription factor 25-like        142   1e-35   
gb|AID55354.1|  NAC protein 3                                           141   2e-35   
ref|XP_010100577.1|  NAC domain-containing protein 29                   141   2e-35   
emb|CDP05873.1|  unnamed protein product                                141   2e-35   
ref|NP_001280984.1|  NAC domain-containing protein 18                   141   3e-35   
gb|KHN36793.1|  NAC domain-containing protein 18                        141   4e-35   
ref|XP_003543257.1|  PREDICTED: NAC domain-containing protein 18        141   4e-35   
ref|XP_003540450.1|  PREDICTED: NAC domain-containing protein 18-...    141   5e-35   
gb|KEH38791.1|  NAC transcription factor-like protein                   140   5e-35   
gb|ACE97084.1|  NAC domain protein                                      136   9e-35   Populus tremula [European aspen]
gb|AID55350.1|  NAC protein 3                                           139   1e-34   
gb|ACE97092.1|  NAC domain protein                                      135   1e-34   Populus tremula [European aspen]
emb|CDX98562.1|  BnaC05g38130D                                          139   1e-34   
gb|ACE97083.1|  NAC domain protein                                      135   2e-34   Populus tremula [European aspen]
ref|XP_009115491.1|  PREDICTED: NAC domain-containing protein 18-...    138   3e-34   
ref|XP_011047846.1|  PREDICTED: NAC transcription factor 25-like        138   3e-34   
ref|XP_009593583.1|  PREDICTED: NAC transcription factor 25 isofo...    136   4e-34   
ref|XP_011095244.1|  PREDICTED: NAC transcription factor 25-like        138   5e-34   
ref|XP_009780447.1|  PREDICTED: NAC transcription factor 25-like        135   6e-34   
ref|XP_010465520.1|  PREDICTED: NAC domain-containing protein 18-...    137   7e-34   
ref|XP_009378497.1|  PREDICTED: NAC domain-containing protein 18-...    137   8e-34   
ref|XP_008452274.1|  PREDICTED: NAC transcription factor 25-like        137   8e-34   
ref|XP_004174082.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    137   9e-34   
ref|XP_010686575.1|  PREDICTED: NAC transcription factor 25-like        137   1e-33   
ref|NP_188170.1|  NAC domain containing protein 2                       137   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149287.1|  PREDICTED: NAC transcription factor 25-like        137   1e-33   
ref|XP_004487678.1|  PREDICTED: NAC domain-containing protein 18-...    137   1e-33   
gb|ACE97094.1|  NAC domain protein                                      132   2e-33   Populus tremula [European aspen]
ref|XP_006406961.1|  hypothetical protein EUTSA_v10022353mg             136   3e-33   
emb|CDY20131.1|  BnaA01g28710D                                          135   5e-33   
gb|AID55349.1|  NAC protein 2                                           134   5e-33   
ref|XP_006297968.1|  hypothetical protein CARUB_v10014008mg             135   5e-33   
ref|XP_010503061.1|  PREDICTED: NAC domain-containing protein 18-...    135   5e-33   
gb|EPS69130.1|  hypothetical protein M569_05637                         131   5e-33   
emb|CDX97675.1|  BnaA05g24040D                                          135   6e-33   
gb|AAU43923.2|  NAC domain protein                                      135   7e-33   Solanum lycopersicum
ref|XP_006451941.1|  hypothetical protein CICLE_v10008628mg             135   7e-33   
ref|NP_001234652.1|  NAC domain protein                                 135   7e-33   
ref|XP_002882948.1|  ATNAC2                                             135   7e-33   
ref|XP_009146237.1|  PREDICTED: NAC domain-containing protein 18        134   9e-33   
ref|XP_009379434.1|  PREDICTED: NAC transcription factor 25             135   9e-33   
ref|XP_007159283.1|  hypothetical protein PHAVU_002G224900g             134   1e-32   
gb|KFK38893.1|  hypothetical protein AALP_AA3G174600                    134   1e-32   
emb|CDY56427.1|  BnaCnng30350D                                          133   1e-32   
ref|NP_001281058.1|  NAC transcription factor 25-like                   134   1e-32   
gb|AID55353.1|  NAC protein 2                                           132   2e-32   
ref|XP_006362947.1|  PREDICTED: NAC transcription factor 25-like        133   3e-32   
gb|EYU27944.1|  hypothetical protein MIMGU_mgv1a020591mg                131   5e-32   
gb|ACJ14498.1|  mutant NAC domain protein                               132   6e-32   Solanum lycopersicum
emb|CDX82430.1|  BnaA03g33910D                                          128   7e-32   
ref|XP_010545895.1|  PREDICTED: NAC domain-containing protein 18-...    130   9e-32   
ref|XP_010921105.1|  PREDICTED: NAC transcription factor NAM-B2-like    132   1e-31   
ref|XP_008799210.1|  PREDICTED: NAC transcription factor 25-like ...    132   1e-31   
ref|XP_007211453.1|  hypothetical protein PRUPE_ppa007314mg             131   1e-31   
ref|XP_010535118.1|  PREDICTED: NAC domain-containing protein 18-...    130   2e-31   
ref|XP_010542275.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    131   2e-31   
ref|XP_008224995.1|  PREDICTED: NAC transcription factor 25             130   2e-31   
gb|KEH31125.1|  NAC transcription factor-like protein                   130   3e-31   
ref|XP_003528438.1|  PREDICTED: NAC transcription factor 25-like        129   6e-31   
ref|XP_007133059.1|  hypothetical protein PHAVU_011G148000g             129   6e-31   
ref|XP_004505006.1|  PREDICTED: NAC transcription factor 25-like        129   7e-31   
ref|XP_008800137.1|  PREDICTED: NAC transcription factor 25             130   7e-31   
emb|CDY12886.1|  BnaA09g13880D                                          128   9e-31   
ref|XP_009113148.1|  PREDICTED: NAC transcription factor 25             128   1e-30   
emb|CDY40970.1|  BnaCnng10130D                                          128   1e-30   
gb|KFK42926.1|  hypothetical protein AALP_AA1G056200                    127   2e-30   
ref|XP_010675608.1|  PREDICTED: NAC transcription factor 25             129   2e-30   
ref|NP_564771.1|  NAC domain containing protein 25                      127   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888109.1|  ANAC025                                            127   3e-30   
gb|AAM65392.1|  NAM protein, putative                                   127   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001280970.1|  NAC transcription factor 25-like                   127   4e-30   
gb|AAB71483.1|  similar to NAM (gp|X92205|1321924) and CUC2 (gp|A...    126   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003541120.1|  PREDICTED: NAC domain-containing protein 18-...    127   4e-30   
ref|XP_006392059.1|  hypothetical protein EUTSA_v10023591mg             126   5e-30   
gb|ACN62416.1|  NAC transcription factor                                127   5e-30   Lepidium latifolium
gb|ACJ48971.1|  cold stress-induced NAC domain protein                  127   6e-30   Lepidium latifolium
ref|XP_007148205.1|  hypothetical protein PHAVU_006G188900g             126   7e-30   
gb|AGS08767.1|  NAC domain protein                                      127   7e-30   
ref|NP_001274379.1|  NAC domain-containing protein 18-like              126   1e-29   
gb|KHN36348.1|  NAC domain-containing protein 18                        126   1e-29   
ref|XP_010430102.1|  PREDICTED: NAC transcription factor 25             125   1e-29   
ref|XP_006300981.1|  hypothetical protein CARUB_v10021371mg             125   2e-29   
ref|XP_010473311.1|  PREDICTED: NAC transcription factor 25-like        125   2e-29   
ref|XP_009135446.1|  PREDICTED: NAC domain-containing protein 18-...    125   2e-29   
ref|XP_010052353.1|  PREDICTED: NAC transcription factor 25-like        125   2e-29   
ref|XP_010418059.1|  PREDICTED: NAC transcription factor 25-like        125   2e-29   
ref|NP_001284435.1|  NAC domain-containing protein 18-like              124   3e-29   
emb|CDY22671.1|  BnaC08g43050D                                          121   3e-29   
ref|XP_009392346.1|  PREDICTED: NAC transcription factor NAM-B2-like    125   3e-29   
ref|XP_004172388.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    123   7e-29   
ref|XP_004147807.1|  PREDICTED: NAC transcription factor ONAC010-...    123   7e-29   
gb|AGV29510.1|  putative NAC domain class transcription factor          119   1e-28   
gb|AIZ97668.1|  NAC transcription factor NAM-D2                         122   3e-28   
ref|XP_010924066.1|  PREDICTED: NAC transcription factor 25-like        122   4e-28   
ref|XP_009392736.1|  PREDICTED: NAC domain-containing protein 67-...    121   5e-28   
dbj|BAK04712.1|  predicted protein                                      120   1e-27   
ref|XP_003562891.1|  PREDICTED: NAC transcription factor NAM-B2-like    120   2e-27   
ref|XP_003547137.1|  PREDICTED: NAC transcription factor 25-like        119   2e-27   
sp|A0SPJ6.1|NAMB2_TRITD  RecName: Full=NAC transcription factor N...    120   2e-27   Triticum turgidum subsp. durum
ref|XP_006392856.1|  hypothetical protein EUTSA_v10012308mg             118   2e-27   
emb|CDM83185.1|  unnamed protein product                                120   3e-27   
gb|AIW49540.1|  NAC transcription factor NAM-A2                         119   3e-27   
tpg|DAA63170.1|  TPA: putative NAC domain transcription factor su...    119   3e-27   
ref|XP_006305156.1|  hypothetical protein CARUB_v10009524mg             119   3e-27   
ref|NP_001060017.1|  Os07g0566500                                       120   3e-27   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA63172.1|  TPA: putative NAC domain transcription factor su...    119   4e-27   
gb|AEH68228.1|  NAC transcription factor                                119   4e-27   
gb|ABI94356.1|  NAC transcription factor NAM-D2                         119   4e-27   Aegilops tauschii
gb|AEI00651.1|  NAC3                                                    119   5e-27   
ref|XP_009416337.1|  PREDICTED: NAC transcription factor 29-like        117   5e-27   
sp|A0SPJ9.1|NAM2_HORVD  RecName: Full=NAC transcription factor NA...    119   7e-27   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010485778.1|  PREDICTED: NAC transcription factor 29-like        117   1e-26   
emb|CDY69545.1|  BnaCnng64100D                                          117   1e-26   
ref|XP_009418167.1|  PREDICTED: NAC transcription factor NAM-B2-like    118   1e-26   
ref|XP_003541742.1|  PREDICTED: NAC transcription factor 25-like        117   1e-26   
gb|KHN08560.1|  NAC domain-containing protein 18                        117   1e-26   
ref|XP_009147650.1|  PREDICTED: NAC domain-containing protein 18 ...    117   1e-26   
emb|CDY53806.1|  BnaA06g01770D                                          117   1e-26   
ref|XP_009147651.1|  PREDICTED: NAC domain-containing protein 18 ...    117   1e-26   
ref|XP_010533895.1|  PREDICTED: NAC transcription factor 25 isofo...    117   1e-26   
ref|XP_010533896.1|  PREDICTED: NAC transcription factor 25 isofo...    116   2e-26   
ref|XP_010922870.1|  PREDICTED: NAC transcription factor 29-like        117   2e-26   
ref|XP_006657850.1|  PREDICTED: NAC transcription factor ONAC010-...    117   2e-26   
ref|XP_001769642.1|  predicted protein                                  113   3e-26   
ref|XP_008793367.1|  PREDICTED: NAC transcription factor 29-like        116   3e-26   
sp|A2YMR0.1|NAC10_ORYSI  RecName: Full=NAC transcription factor O...    116   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_002463039.1|  hypothetical protein SORBIDRAFT_02g036620          116   5e-26   Sorghum bicolor [broomcorn]
gb|EPS59407.1|  hypothetical protein M569_15400                         112   5e-26   
ref|XP_010921289.1|  PREDICTED: NAC transcription factor 25-like        115   7e-26   
ref|XP_004958056.1|  PREDICTED: NAC transcription factor NAM-2-like     115   8e-26   
ref|XP_010518139.1|  PREDICTED: NAC transcription factor 29-like        115   9e-26   
ref|XP_009353167.1|  PREDICTED: NAC transcription factor 29-like        115   9e-26   
gb|AGZ20133.1|  NAC transcription factor NAM-B1                         115   1e-25   
gb|AGH32788.1|  NAC transcription factor NAM-B1                         115   1e-25   
ref|XP_010931442.1|  PREDICTED: NAC transcription factor 29-like        114   1e-25   
gb|AGZ20124.1|  NAC transcription factor NAM-B1                         115   1e-25   
gb|AGS08758.1|  NAC domain protein                                      115   1e-25   
gb|AGZ20132.1|  NAC transcription factor NAM-B1                         115   1e-25   
sp|A0SPJ4.1|NAMB1_TRIDC  RecName: Full=NAC transcription factor N...    115   1e-25   Triticum dicoccoides [wild emmer wheat]
ref|XP_001771652.1|  predicted protein                                  112   1e-25   
gb|AGH32787.1|  NAC transcription factor NAM-B1                         115   1e-25   
gb|AGZ20123.1|  NAC transcription factor NAM-B1                         115   1e-25   
ref|NP_001280963.1|  NAC transcription factor 29                        115   1e-25   
ref|XP_009420951.1|  PREDICTED: NAC transcription factor 29-like        114   1e-25   
gb|AJF38903.1|  NAC transcription factor                                112   1e-25   
ref|XP_010938117.1|  PREDICTED: NAC transcription factor 29-like        114   1e-25   
gb|AGH32785.1|  NAC transcription factor NAM-B1                         115   1e-25   
gb|AGZ20119.1|  NAC transcription factor NAM-B1                         115   1e-25   
gb|AGZ20118.1|  NAC transcription factor NAM-B1                         115   1e-25   
gb|KFK35761.1|  hypothetical protein AALP_AA4G032900                    113   1e-25   
gb|ABY67950.1|  NAM-1                                                   114   2e-25   Hordeum vulgare subsp. vulgare [barley]
sp|A0SPJ8.1|NAM1_HORVD  RecName: Full=NAC transcription factor NA...    114   2e-25   Hordeum vulgare subsp. vulgare [barley]
sp|D2SMN4.1|NAMB1_HORVS  RecName: Full=NAC transcription factor N...    114   2e-25   Hordeum vulgare subsp. spontaneum [wild barley]
emb|CBI32712.3|  unnamed protein product                                114   2e-25   
ref|XP_002275457.1|  PREDICTED: NAC domain-containing protein 2         114   2e-25   Vitis vinifera
ref|XP_008240449.1|  PREDICTED: NAC transcription factor 25             114   3e-25   
ref|XP_001752718.1|  predicted protein                                  110   3e-25   
gb|AGZ20137.1|  NAC transcription factor NAM-B1                         114   3e-25   
gb|KDO51071.1|  hypothetical protein CISIN_1g042614mg                   113   3e-25   
ref|XP_006428812.1|  hypothetical protein CICLE_v10013694mg             113   3e-25   
gb|AFD54040.1|  NAC transcription factor NAM-1                          114   3e-25   
ref|XP_001773582.1|  predicted protein                                  109   4e-25   
gb|AFD54037.1|  NAC transcription factor NAM-1                          113   4e-25   
gb|AFD54036.1|  NAC transcription factor NAM-1                          113   4e-25   
ref|XP_003557998.1|  PREDICTED: NAC transcription factor NAM-B1-like    113   4e-25   
sp|A0SPJ3.1|NAMA1_TRITD  RecName: Full=NAC transcription factor N...    113   4e-25   Triticum turgidum subsp. durum
ref|XP_009406848.1|  PREDICTED: NAC transcription factor 29-like        113   4e-25   
gb|KDO74153.1|  hypothetical protein CISIN_1g016791mg                   112   4e-25   
ref|XP_009394856.1|  PREDICTED: NAC transcription factor 25-like        112   5e-25   
ref|XP_006408226.1|  hypothetical protein EUTSA_v10021011mg             112   6e-25   
ref|XP_001779494.1|  predicted protein                                  108   6e-25   
ref|XP_010644222.1|  PREDICTED: NAC transcription factor 25 isofo...    112   6e-25   
ref|XP_010463881.1|  PREDICTED: NAC transcription factor 25-like        112   7e-25   
ref|XP_010088481.1|  NAC domain-containing protein 29                   112   7e-25   
gb|AFD54038.1|  NAC transcription factor NAM-1                          112   8e-25   
gb|ACD63687.1|  NAC domain containing protein 2-like protein            106   8e-25   Bahiopsis reticulata
gb|AFD54033.1|  NAC transcription factor NAM-1                          112   9e-25   
ref|XP_008782759.1|  PREDICTED: NAC transcription factor 25-like        112   1e-24   
ref|XP_006443351.1|  hypothetical protein CICLE_v10020717mg             112   1e-24   
ref|XP_004984512.1|  PREDICTED: NAC transcription factor NAM-B1-like    112   1e-24   
ref|XP_002976404.1|  hypothetical protein SELMODRAFT_105213             108   1e-24   
gb|AEI00653.1|  NAC5                                                    112   1e-24   
dbj|BAF36563.1|  NAC domain protein                                     111   1e-24   Cymbidium hybrid cultivar
gb|AGL39678.1|  NAC transcription factor 022                            111   1e-24   
ref|XP_002987237.1|  hypothetical protein SELMODRAFT_125697             108   1e-24   
gb|AEI98790.1|  NAC transcription factor NAM-G1                         112   1e-24   
gb|AEI00649.1|  NAC1                                                    112   1e-24   
gb|ABI94354.1|  NAC transcription factor NAM-D1                         112   1e-24   Aegilops tauschii
gb|ABK22535.1|  unknown                                                 111   1e-24   Picea sitchensis
gb|ABK23477.1|  unknown                                                 111   1e-24   Picea sitchensis
gb|AGZ20129.1|  NAC transcription factor NAM-B1                         112   1e-24   
ref|XP_010054307.1|  PREDICTED: NAC transcription factor 25-like        112   1e-24   
gb|AGZ20135.1|  NAC transcription factor NAM-B1                         112   1e-24   
ref|XP_006297959.1|  hypothetical protein CARUB_v10014000mg             111   1e-24   
gb|AEI98795.1|  NAC transcription factor NAM-G1                         112   1e-24   
gb|AEI00650.1|  NAC2                                                    112   1e-24   
gb|AEI98789.1|  NAC transcription factor NAM-G1                         112   1e-24   
ref|XP_008792524.1|  PREDICTED: NAC transcription factor 29-like        111   1e-24   
gb|AEI98791.1|  NAC transcription factor NAM-G1                         112   1e-24   
gb|AEH68227.1|  NAC transcription factor                                112   1e-24   
gb|AEI98794.1|  NAC transcription factor NAM-G1                         112   2e-24   
gb|ACD63678.1|  NAC domain containing protein 2-like protein            105   2e-24   Helianthus petiolaris
gb|AFD54034.1|  NAC transcription factor NAM-1                          111   2e-24   
gb|AEI98793.1|  NAC transcription factor NAM-G1                         111   2e-24   
ref|XP_003625606.1|  NAC domain transcription factor                    110   2e-24   
ref|XP_006344264.1|  PREDICTED: NAC transcription factor 29-like        110   2e-24   
ref|NP_187057.2|  NAC domain containing protein 47                      111   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ACD63685.1|  NAC domain containing protein 2-like protein            105   2e-24   Bahiopsis lanata
ref|XP_010558707.1|  PREDICTED: NAC transcription factor 29-like        110   2e-24   
ref|NP_001151613.1|  NAC domain transcription factor                    111   2e-24   Zea mays [maize]
gb|ACD63686.1|  NAC domain containing protein 2-like protein            105   2e-24   Bahiopsis lanata
tpg|DAA64160.1|  TPA: putative NAC domain transcription factor su...    111   3e-24   
ref|XP_002465328.1|  hypothetical protein SORBIDRAFT_01g036560          110   3e-24   Sorghum bicolor [broomcorn]
ref|XP_002884426.1|  ANAC047                                            110   3e-24   
ref|XP_009410477.1|  PREDICTED: NAC transcription factor 29-like        109   3e-24   
ref|XP_001773542.1|  predicted protein                                  107   3e-24   
gb|ACI15346.1|  NAC domain protein NAC5                                 110   3e-24   Gossypium hirsutum [American cotton]
gb|EMT26194.1|  NAC domain-containing protein 18                        110   3e-24   
gb|KHG14643.1|  NAC domain-containing 29 -like protein                  110   3e-24   
gb|AFD54039.1|  NAC transcription factor NAM-1                          110   3e-24   
ref|XP_004237044.1|  PREDICTED: NAC transcription factor 29-like        109   4e-24   
gb|AFD54031.1|  NAC transcription factor NAM-1                          110   4e-24   
ref|XP_008651547.1|  PREDICTED: NAC domain transcription factor i...    111   4e-24   
ref|XP_009130419.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    110   4e-24   
ref|XP_009366417.1|  PREDICTED: NAC transcription factor 29-like        110   4e-24   
ref|XP_009345059.1|  PREDICTED: NAC transcription factor 29-like        110   5e-24   
gb|AAN64999.1|  Putative NAM (no apical meristem) protein               110   5e-24   Oryza sativa Japonica Group [Japonica rice]
gb|ACD63677.1|  NAC domain containing protein 2-like protein            104   5e-24   
gb|EEE58985.1|  hypothetical protein OsJ_10691                          110   5e-24   
gb|ACD63654.1|  NAC domain containing protein 2-like protein            103   5e-24   
gb|ACD63649.1|  NAC domain containing protein 2-like protein            103   5e-24   
gb|AFD54035.1|  NAC transcription factor NAM-1                          110   5e-24   
gb|AEI98788.1|  NAC transcription factor NAM-G1                         110   5e-24   
gb|ACD63617.1|  NAC domain containing protein 2-like protein            103   5e-24   
gb|ACD63653.1|  NAC domain containing protein 2-like protein            103   5e-24   
emb|CDY50880.1|  BnaA05g37410D                                          109   6e-24   
tpe|CBZ41159.1|  TPA: NAC transcription factor                          109   6e-24   
ref|XP_011001235.1|  PREDICTED: NAC domain-containing protein 72-...    109   7e-24   
gb|ADP69102.1|  NAC transcription factor 1                              109   8e-24   
gb|EMS63328.1|  NAC domain-containing protein 29                        111   9e-24   
ref|XP_007027296.1|  NAC domain protein, IPR003441, putative            109   9e-24   
ref|XP_009131103.1|  PREDICTED: protein ATAF2-like                      108   1e-23   
gb|AEI98787.1|  NAC transcription factor NAM-G1                         109   1e-23   
ref|XP_002991700.1|  hypothetical protein SELMODRAFT_133982             105   1e-23   
gb|AFD54032.1|  NAC transcription factor NAM-1                          109   1e-23   
gb|AGC97438.1|  NAC protein 8                                           108   1e-23   
ref|XP_003565352.1|  PREDICTED: NAC transcription factor 29-like        108   1e-23   
ref|XP_002519550.1|  transcription factor, putative                     108   1e-23   
ref|XP_002463403.1|  hypothetical protein SORBIDRAFT_02g043210          108   1e-23   
ref|XP_010904917.1|  PREDICTED: NAC transcription factor NAM-B2-like    108   1e-23   
ref|XP_006645427.1|  PREDICTED: NAC transcription factor NAM-B1-like    108   1e-23   
emb|CDP06728.1|  unnamed protein product                                108   2e-23   
ref|XP_006843547.1|  hypothetical protein AMTR_s00007p00063550          108   2e-23   
gb|KFK37842.1|  hypothetical protein AALP_AA3G036200                    108   2e-23   
ref|NP_001238061.1|  NAC domain protein                                 108   2e-23   
gb|ACD63640.1|  NAC domain containing protein 2-like protein            102   2e-23   
ref|XP_001754918.1|  predicted protein                                  104   2e-23   
gb|AFD54030.1|  NAC transcription factor NAM-1                          108   2e-23   
ref|XP_009387374.1|  PREDICTED: NAC transcription factor 29-like        107   2e-23   
ref|XP_007202090.1|  hypothetical protein PRUPE_ppa007445mg             108   2e-23   
emb|CDM82556.1|  unnamed protein product                                107   2e-23   
ref|XP_002317321.2|  hypothetical protein POPTR_0011s05760g             107   2e-23   
gb|ACD63630.1|  NAC domain containing protein 2-like protein            102   2e-23   
gb|ACD63603.1|  NAC domain containing protein 2-like protein            102   3e-23   
ref|XP_008782049.1|  PREDICTED: NAC transcription factor 29-like        107   3e-23   
gb|ADP69101.1|  NAC transcription factor 1                              107   3e-23   
ref|XP_008799211.1|  PREDICTED: NAC transcription factor ONAC010-...    104   3e-23   
ref|XP_009781251.1|  PREDICTED: NAC transcription factor 29-like        106   3e-23   
gb|AIA57511.1|  NAC domain-containing protein                           107   4e-23   
gb|AFK38271.1|  unknown                                                 106   4e-23   
ref|XP_007150216.1|  hypothetical protein PHAVU_005G136400g             107   4e-23   
ref|XP_002305109.1|  hypothetical protein POPTR_0004s04920g             107   4e-23   
gb|AHJ79180.1|  NAC domain protein NAC39                                107   4e-23   
ref|NP_001275015.1|  NAC transcription factor 29-like                   106   4e-23   
ref|XP_010524963.1|  PREDICTED: NAC domain-containing protein 18-...    107   4e-23   
ref|XP_006829778.1|  hypothetical protein AMTR_s00119p00040230          107   4e-23   
gb|EAZ19492.1|  hypothetical protein OsJ_35058                          105   5e-23   
ref|XP_002991033.1|  hypothetical protein SELMODRAFT_47266              105   5e-23   
gb|EMS58089.1|  NAC domain-containing protein 29                        107   5e-23   
ref|XP_003559782.1|  PREDICTED: NAC domain-containing protein 18-...    107   5e-23   
gb|EMT28157.1|  NAC domain-containing protein 29                        107   5e-23   
gb|EYU22403.1|  hypothetical protein MIMGU_mgv1a012228mg                105   5e-23   
ref|XP_008655528.1|  PREDICTED: NAC transcription factor NAM-B2-like    107   5e-23   
ref|NP_001236142.1|  transcriptional factor NAC11                       107   6e-23   
gb|AAU08785.1|  NAC domain transcription factor                         107   6e-23   
gb|AAY44097.1|  NAC domain transcription factor                         107   6e-23   
ref|XP_004493961.1|  PREDICTED: NAC transcription factor ONAC010-...    106   6e-23   
gb|AHB63580.1|  NAC transcription factor                                107   6e-23   
gb|EEC82702.1|  hypothetical protein OsI_27367                          106   6e-23   
gb|KHN46799.1|  NAC domain-containing protein 29                        106   6e-23   
ref|XP_011027935.1|  PREDICTED: protein FEZ-like                        106   6e-23   
gb|ABA91266.1|  NAC domain transcription factor, putative, expressed    107   6e-23   
ref|XP_007030230.1|  NAC domain containing protein 47, putative i...    106   7e-23   
gb|AGR91634.1|  NAC transcription factor 1                              106   7e-23   
gb|EAY79778.1|  hypothetical protein OsI_34934                          106   7e-23   
gb|AGC27312.1|  NAC domain protein 9                                    105   8e-23   
ref|XP_004238810.1|  PREDICTED: NAC transcription factor 29             105   8e-23   
ref|XP_006650022.1|  PREDICTED: NAC transcription factor NAM-B2-like    106   9e-23   
gb|KEH15120.1|  NAC transcription factor-like protein                   105   9e-23   
ref|XP_010276467.1|  PREDICTED: NAC transcription factor 25-like ...    106   9e-23   
gb|ACD63642.1|  NAC domain containing protein 2-like protein            100   9e-23   
gb|AAW28573.2|  NAC-domain containing protein 29 , putative             103   9e-23   
gb|ABI34386.1|  NAC-domain containing protein 29 , putative             103   1e-22   
ref|XP_003624592.1|  NAC domain transcription factor                    106   1e-22   
gb|EMT14095.1|  NAC domain-containing protein 29                        106   1e-22   
ref|XP_007161811.1|  hypothetical protein PHAVU_001G100200g             105   1e-22   
ref|XP_010276466.1|  PREDICTED: NAC transcription factor 25-like ...    106   1e-22   
ref|XP_007030229.1|  NAC domain containing protein 47, putative i...    106   1e-22   
ref|XP_011034424.1|  PREDICTED: NAC transcription factor 29-like        105   1e-22   
ref|XP_003565559.1|  PREDICTED: NAC transcription factor 29-like        105   1e-22   
emb|CDY07348.1|  BnaA07g24270D                                          104   2e-22   
ref|XP_009105596.1|  PREDICTED: NAC transcription factor 29-like        104   2e-22   
emb|CBZ39285.1|  NAC transcription factor                               105   2e-22   
gb|ABZ89747.1|  NAC transcription factor NAP                            104   2e-22   
dbj|BAJ99416.1|  predicted protein                                      105   2e-22   
ref|XP_004505411.1|  PREDICTED: NAC transcription factor 29-like        103   2e-22   
ref|XP_010036180.1|  PREDICTED: NAC transcription factor 29-like        105   2e-22   
ref|XP_004958721.1|  PREDICTED: NAC transcription factor ONAC010-...    105   2e-22   
ref|XP_010462140.1|  PREDICTED: NAC domain-containing protein 18-...    105   2e-22   
ref|XP_010470936.1|  PREDICTED: NAC transcription factor 29-like        104   2e-22   
gb|ABK26029.1|  unknown                                                 105   2e-22   
ref|XP_007162738.1|  hypothetical protein PHAVU_001G176100g             104   2e-22   
ref|XP_008660189.1|  PREDICTED: NAC transcription factor 29-like        103   2e-22   
ref|XP_002323463.1|  hypothetical protein POPTR_0016s08970g             104   2e-22   
ref|XP_002325400.1|  hypothetical protein POPTR_0019s04690g             105   2e-22   
ref|XP_010479815.1|  PREDICTED: NAC domain-containing protein 18        105   2e-22   
ref|XP_002319143.2|  hypothetical protein POPTR_0013s05080g             105   2e-22   
ref|XP_010500912.1|  PREDICTED: NAC domain-containing protein 18-...    104   2e-22   
gb|AAY44098.1|  NAC domain transcription factor                         105   3e-22   
ref|XP_008446385.1|  PREDICTED: NAC transcription factor 29             104   3e-22   
gb|ABA95705.1|  NAC domain transcription factor, putative, expressed    105   3e-22   
gb|EAZ17264.1|  hypothetical protein OsJ_32784                          105   3e-22   
gb|EAY82108.1|  hypothetical protein OsI_37306                          105   3e-22   
ref|XP_008243919.1|  PREDICTED: NAC transcription factor 29-like        104   3e-22   
gb|EMS63116.1|  NAC domain-containing protein 29                        104   3e-22   
gb|KHG28640.1|  NAC domain-containing 29 -like protein                  103   3e-22   
ref|XP_010999473.1|  PREDICTED: NAC transcription factor 29-like        104   3e-22   
ref|XP_007223324.1|  hypothetical protein PRUPE_ppa009530mg             103   3e-22   
emb|CDY51500.1|  BnaC06g43410D                                          103   4e-22   
ref|XP_002961563.1|  hypothetical protein SELMODRAFT_69131              101   4e-22   
ref|XP_007025526.1|  NAC domain containing protein 25                   104   4e-22   
dbj|BAH57132.1|  AT5G63790                                              102   4e-22   
ref|NP_564966.1|  NAC transcription factor protein family               103   4e-22   
ref|XP_004146638.1|  PREDICTED: NAC transcription factor 25-like        104   4e-22   
gb|ACD63611.1|  NAC domain containing protein 2-like protein          99.0    4e-22   
ref|XP_010922868.1|  PREDICTED: NAC domain-containing protein 68-...    103   4e-22   
gb|AAM63330.1|  NAC domain protein NAC2                                 103   4e-22   
ref|XP_011070984.1|  PREDICTED: NAC transcription factor 29-like        103   4e-22   
gb|KGN64646.1|  hypothetical protein Csa_1G073060                       104   4e-22   
gb|ACD63639.1|  NAC domain containing protein 2-like protein          99.0    4e-22   
ref|XP_010549620.1|  PREDICTED: NAC transcription factor 29             104   4e-22   
ref|XP_002442733.1|  hypothetical protein SORBIDRAFT_08g001940          104   4e-22   
gb|AFN55272.1|  NAC domain-containing protein                           103   4e-22   
ref|XP_004490093.1|  PREDICTED: NAC transcription factor 29-like        103   4e-22   
ref|XP_004135168.1|  PREDICTED: NAC transcription factor 29-like        103   4e-22   
ref|XP_006302669.1|  hypothetical protein CARUB_v10020776mg             103   5e-22   
ref|XP_003541998.1|  PREDICTED: NAC transcription factor ONAC010-...    103   5e-22   
ref|XP_003613866.1|  NAC domain protein                                 102   5e-22   
ref|XP_008221592.1|  PREDICTED: NAC transcription factor 29             103   5e-22   
ref|XP_010651865.1|  PREDICTED: NAC transcription factor 29             103   5e-22   
ref|XP_002887238.1|  NAC domain protein NAC2                            103   5e-22   
gb|AGL39683.1|  NAC transcription factor 027                            103   5e-22   
gb|AIU47058.1|  NAC transcription factor                                103   5e-22   
ref|XP_002454866.1|  hypothetical protein SORBIDRAFT_03g000330          103   6e-22   
ref|XP_007046037.1|  NAC domain protein, IPR003441                      103   6e-22   
emb|CDP07132.1|  unnamed protein product                                103   6e-22   
ref|XP_009598866.1|  PREDICTED: NAC transcription factor 29-like        103   6e-22   
ref|XP_007015431.1|  NAC domain containing protein 25, putative         103   6e-22   
ref|XP_006658973.1|  PREDICTED: NAC transcription factor ONAC010-...    103   6e-22   
ref|XP_004493136.1|  PREDICTED: NAC transcription factor 25-like        103   6e-22   
ref|XP_010108694.1|  NAC domain-containing protein 29                   103   7e-22   
ref|XP_003539409.1|  PREDICTED: NAC domain-containing protein 2-like    103   7e-22   
ref|XP_004977420.1|  PREDICTED: NAC transcription factor 25-like        103   7e-22   
ref|XP_010257746.1|  PREDICTED: NAC domain-containing protein 68-...    103   7e-22   
ref|XP_010415593.1|  PREDICTED: NAC transcription factor 29             102   8e-22   
emb|CDP00360.1|  unnamed protein product                                102   8e-22   
ref|XP_008655238.1|  PREDICTED: NAC transcription factor NAM-2-like     103   8e-22   
gb|ACD63641.1|  NAC domain containing protein 2-like protein          98.2    8e-22   
ref|XP_010471939.1|  PREDICTED: NAC domain-containing protein 2-like    102   8e-22   
emb|CDY44788.1|  BnaC02g00990D                                          102   8e-22   
ref|XP_002960864.1|  hypothetical protein SELMODRAFT_71307              100   8e-22   
gb|AGL39682.1|  NAC transcription factor 026                            103   9e-22   
ref|XP_010258043.1|  PREDICTED: NAC transcription factor 29-like        102   9e-22   
ref|XP_002967149.1|  hypothetical protein SELMODRAFT_86855              100   9e-22   
ref|XP_002866576.1|  predicted protein                                  102   9e-22   
ref|XP_004967928.1|  PREDICTED: NAC transcription factor NAM-B2-like    103   1e-21   
dbj|BAB10472.1|  unnamed protein product                                102   1e-21   
ref|XP_010428823.1|  PREDICTED: NAC domain-containing protein 2-like    102   1e-21   
ref|XP_010107555.1|  NAC domain-containing protein 29                   102   1e-21   
ref|XP_001779492.1|  predicted protein                                  100   1e-21   
ref|NP_175696.1|  NAC domain-containing protein 18                      102   1e-21   
gb|EYU28780.1|  hypothetical protein MIMGU_mgv1a021552mg                102   1e-21   
gb|KHN01256.1|  NAC domain-containing protein 29                        102   1e-21   
ref|XP_006381471.1|  hypothetical protein POPTR_0006s13140g             101   1e-21   
emb|CAA52772.1|  ATAF2                                                  100   1e-21   
ref|XP_007206224.1|  hypothetical protein PRUPE_ppa015363mg             103   1e-21   
ref|NP_001236855.1|  NAC domain protein NAC1                            102   1e-21   
gb|KHN14494.1|  NAC domain-containing protein 29                        102   1e-21   
gb|AET07181.1|  NAC transcription factor                                103   1e-21   
gb|KFK25233.1|  hypothetical protein AALP_AA8G084600                    102   1e-21   
dbj|BAO57484.1|  transcription factor InNAP                             102   1e-21   
ref|NP_680161.1|  protein ATAF2                                         102   1e-21   
ref|XP_010921285.1|  PREDICTED: NAC domain-containing protein 68-...    102   1e-21   
gb|AAK76517.2|  unknown protein                                         102   1e-21   
ref|NP_001238204.1|  NAC domain protein                                 102   1e-21   
gb|AAM20637.1|  NAM-like protein                                        102   1e-21   
emb|CDY29983.1|  BnaC01g40250D                                          102   1e-21   
gb|AEQ94175.1|  NAC protein 1                                           101   1e-21   
ref|NP_201184.2|  NAC domain-containing protein 102                     102   1e-21   
emb|CDO99476.1|  unnamed protein product                                102   1e-21   
gb|AFI56994.1|  NAC2                                                    101   1e-21   
emb|CDY40930.1|  BnaC06g30680D                                          102   1e-21   
gb|EMT29965.1|  NAC domain-containing protein 2                         102   1e-21   
ref|XP_010258284.1|  PREDICTED: NAC transcription factor 29-like        102   2e-21   
ref|XP_002873383.1|  hypothetical protein ARALYDRAFT_908859             102   2e-21   
ref|NP_001118568.1|  NAC domain containing protein 47                   102   2e-21   
gb|AFK39171.1|  unknown                                                 101   2e-21   
ref|XP_009105493.1|  PREDICTED: NAC transcription factor 29             101   2e-21   
emb|CDX81120.1|  BnaC03g03740D                                          100   2e-21   
ref|XP_011090048.1|  PREDICTED: NAC transcription factor 25-like        103   2e-21   
ref|NP_001242756.1|  NAC domain protein                                 101   2e-21   
gb|ACI15344.1|  NAC domain protein NAC3                                 101   2e-21   
ref|XP_006434240.1|  hypothetical protein CICLE_v10001976mg             101   2e-21   
ref|XP_011015477.1|  PREDICTED: NAC transcription factor 25-like        100   2e-21   
ref|XP_003548053.1|  PREDICTED: NAC transcription factor NAM-2          102   2e-21   
gb|AGO14646.1|  NAC transcription factor                                101   2e-21   
gb|AAP35052.1|  NAC-domain protein 5-8                                  101   2e-21   
gb|KFK41373.1|  hypothetical protein AALP_AA2G121900                    101   2e-21   
gb|ACX47024.1|  NAP-like transcription factor                           101   2e-21   
gb|KHN20606.1|  NAC domain-containing protein 2                         101   2e-21   
ref|XP_009125745.1|  PREDICTED: protein ATAF2-like                      101   2e-21   
ref|NP_001235915.1|  transcriptional factor NAC51                       100   2e-21   
ref|XP_010460978.1|  PREDICTED: NAC domain-containing protein 102...    101   2e-21   
gb|KHN28140.1|  NAC domain-containing protein 29                        100   2e-21   
gb|AHC54052.1|  transcriptional factor NAC11                            102   2e-21   
gb|AEF80001.1|  nam-like protein                                        101   2e-21   
ref|XP_002894407.1|  hypothetical protein ARALYDRAFT_474412             101   2e-21   
ref|XP_009377421.1|  PREDICTED: NAC transcription factor 29-like        102   2e-21   
ref|XP_003556789.1|  PREDICTED: NAC transcription factor 29             101   2e-21   
ref|XP_006394242.1|  hypothetical protein EUTSA_v10004786mg             100   3e-21   
gb|KCW51403.1|  hypothetical protein EUGRSUZ_J00940                     100   3e-21   
emb|CDX78352.1|  BnaA03g02640D                                          100   3e-21   
ref|XP_003577115.1|  PREDICTED: NAC transcription factor 29-like        102   3e-21   
ref|XP_008782755.1|  PREDICTED: NAC domain-containing protein 68-...    101   3e-21   
gb|KFK28073.1|  hypothetical protein AALP_AA8G468800                    100   3e-21   
ref|XP_004978485.1|  PREDICTED: NAC transcription factor 25-like        102   3e-21   
emb|CDX84050.1|  BnaC08g07270D                                        99.4    3e-21   
gb|KHG19958.1|  NAC domain-containing 2 -like protein                   101   3e-21   



>ref|XP_003635288.1| PREDICTED: NAC transcription factor 25 [Vitis vinifera]
Length=326

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 109/248 (44%), Positives = 143/248 (58%), Gaps = 23/248 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG+QK GVKKALVFY GKPPKG+KTNW+MHEYRL D      + SS
Sbjct  95   YWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLID------STSS  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D+ NKK SLRLDDWVLCRI+KKN S RP+E        E++  A   SL    
Sbjct  149  NTKPPGADMGNKKGSLRLDDWVLCRIYKKNISQRPMERD-----KEESMEALLASLPAS-  202

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCMAMG  541
               +  QN  ++  R  +FG   E       + G +    I G Q+S  S       ++G
Sbjct  203  -SMTSQQNTRAQTLRSTNFGAVLEHEEIS--FEGMLTGQSIQGLQSSSMSQYWNGAGSIG  259

Query  542  ITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNNVQTGLGVSIAEG  721
             +++   +  DH    + +    M+G++SF+SLLNQL    S T + N   G   S+A+G
Sbjct  260  PSSSGKHLHTDHTSGTSTSE---MDGNSSFVSLLNQLP--QSGTFHQNTLLG---SLADG  311

Query  722  VLHQPYQL  745
               QP++L
Sbjct  312  AYRQPHRL  319



>gb|KHG21395.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=265

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/257 (42%), Positives = 143/257 (56%), Gaps = 26/257 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N      
Sbjct  25   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKTN------  78

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED--ATVATSTSLDG  355
             ++P G D+ NKK+SLRLDDWVLCRI+KKN ++RP+E   + D  +D   TV  S S+  
Sbjct  79   -NKPPGCDLGNKKNSLRLDDWVLCRIYKKNNANRPLEH-DKDDSMDDMLGTVPPSISI--  134

Query  356  CGGGGSDHQNPNSR-ASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCM  532
                 S   NP    +++G SFG   E    ++L++G M S GIN    S  +P  +   
Sbjct  135  -----SSQHNPKFHFSTKGTSFGTLLEHQEHNSLFDGMMGSDGIN--SASMVNPLKRALP  187

Query  533  AMGIT---AAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNNVQTGLG  703
            ++  T    A P   +  H      +    +G+ S  +LL+QL              G  
Sbjct  188  SLYWTDDETAGPSTSKRFHGDSNDGSMEKTDGNGSIATLLSQLPQTPPLQQQQAAMLG--  245

Query  704  VSIAEGVLHQPYQLSWL  754
             S+ +G+   PYQL  L
Sbjct  246  -SMGDGIFRPPYQLPGL  261



>gb|AHJ79194.1| NAC domain protein NAC53 [Gossypium hirsutum]
Length=335

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 109/256 (43%), Positives = 144/256 (56%), Gaps = 24/256 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKTNN-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED--ATVATSTSLDG  355
              +P G D+ NKK+SLRLDDWVLCRI+KKN ++RP+E   + D  +D   TV  S S+  
Sbjct  150  --KPPGCDLGNKKNSLRLDDWVLCRIYKKNNANRPLEH-DKDDSMDDMLGTVPPSISI--  204

Query  356  CGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCMA  535
                GS H      +++G SFG   E    ++L++G M S GIN    S  +P  +T  +
Sbjct  205  ----GSQHNPKFHFSTKGTSFGTLLEHQEHNSLFDGMMGSDGIN--SASMVNPLKRTLPS  258

Query  536  MGIT---AAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNNVQTGLGV  706
            +  T    A P   +  H      +    +G+ S  +LL+QL              G   
Sbjct  259  LYWTDDETAGPSTSKRFHGDSNDGSMEKTDGNGSIATLLSQLPQTPPLQQQQAAMLG---  315

Query  707  SIAEGVLHQPYQLSWL  754
            S+ +G+   P+QL  L
Sbjct  316  SMGDGIFRPPHQLPGL  331



>ref|XP_010278293.1| PREDICTED: NAC transcription factor NAM-B2-like [Nelumbo nucifera]
Length=359

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/277 (40%), Positives = 146/277 (53%), Gaps = 51/277 (18%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GTQK GVKKALVFY G+PPKG+KTNW+MHEYRL DN       S+
Sbjct  100  YWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGVKTNWIMHEYRLADN-------ST  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            + +P G D+ NKKSSLRLDDWVLCRI+KKN S+R +E       T+   + TST      
Sbjct  153  SSKPPGVDVSNKKSSLRLDDWVLCRIYKKNNSNRLMERDKEDSMTDMMALPTST----VE  208

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGT----------------  493
            G  S  Q P   A R  ++G    + +  N + G +   G+N +                
Sbjct  209  GQQSSKQPP---AQRTTNYGGML-LESDDNFFEGLLSEDGVNSSSLPQFGSSSISTTELS  264

Query  494  ------------QTSWDSPRDQTCMAMGITAAPPRIdedhhhheaannnaIMEGSNSFIS  637
                        +  + SP      A+G +++  +   DH+   + +       +N   +
Sbjct  265  MFPAATATQLPLKRPFPSPYFNEVAAIGPSSSTKKFHPDHNSSGSGST----NANNPIAT  320

Query  638  LLNQLSPNDSATLNNNVQTGLGVSIAEGVLHQPYQLS  748
            LLNQL P  +   +N+   G   S+ EGVL QPYQLS
Sbjct  321  LLNQL-PQAATPFHNHTLLG---SLGEGVLRQPYQLS  353



>ref|XP_007021327.1| NAC domain protein, IPR003441 [Theobroma cacao]
 gb|EOY12852.1| NAC domain protein, IPR003441 [Theobroma cacao]
Length=347

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 148/269 (55%), Gaps = 38/269 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        +
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN-------KA  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED--ATVATSTSLDG  355
            +++P G D+ NKK+SLRLDDWVLCRI+KKN + RP++   + D  ++    +  S S+  
Sbjct  148  SNKPPGCDLGNKKNSLRLDDWVLCRIYKKNNTHRPMDH-DKDDSMDEMLGPIPPSISI--  204

Query  356  CGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMM-SGGING------------TQ  496
                GS H      A++G SFG   E N  H+L+ G M  S GIN               
Sbjct  205  ----GSQHNAKFQLATKGTSFGTLLE-NQEHSLFEGMMAGSDGINSGSISQLGCSSSKPD  259

Query  497  TSWDSPRDQTCMAMGIT---AAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDS  667
             S  +P  +T  ++  T    A P   +  H      +    +G+ S  +LL+QL     
Sbjct  260  LSMVNPLKRTVPSLFWTDEDTAGPSTSKRFHGDSNDGSMEKTDGNGSIATLLSQL----P  315

Query  668  ATLNNNVQTGLGVSIAEGVLHQPYQLSWL  754
             T     QT LG S+ +G+   PYQLS L
Sbjct  316  QTPPLQQQTMLG-SMGDGIFRPPYQLSGL  343



>emb|CBI38329.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 133/232 (57%), Gaps = 20/232 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG+QK GVKKALVFY GKPPKG+KTNW+MHEYRL D      + SS
Sbjct  95   YWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLID------STSS  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D+ NKK SLRLDDWVLCRI+KKN S RP+E        E++  A   SL    
Sbjct  149  NTKPPGADMGNKKGSLRLDDWVLCRIYKKNISQRPMERD-----KEESMEALLASLPAS-  202

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCMAMG  541
               +  QN  ++  R  +FG   E       + G +    I G Q+S  S       ++G
Sbjct  203  -SMTSQQNTRAQTLRSTNFGAVLEHEEIS--FEGMLTGQSIQGLQSSSMSQYWNGAGSIG  259

Query  542  ITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNNVQTG  697
             +++   +  DH    + +    M+G++SF+SLLNQL    S T + N   G
Sbjct  260  PSSSGKHLHTDHTSGTSTSE---MDGNSSFVSLLNQLP--QSGTFHQNTLLG  306



>ref|XP_010268761.1| PREDICTED: NAC transcription factor 25-like [Nelumbo nucifera]
Length=353

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 138/265 (52%), Gaps = 29/265 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GTQK GVKKALVFY G+PPKG+KTNW+MHEYRL DN       ++
Sbjct  96   YWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGIKTNWIMHEYRLADN-----NNTT  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            +++P G D  NKKSSLRLDDWVLCRI+KKN S+RP+E        +   + TSTS     
Sbjct  151  SNKPPGADTSNKKSSLRLDDWVLCRIYKKNNSNRPMERDKEDSMDDMLGLPTSTSFMEV-  209

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQ-TSWDSPRDQTCMAM  538
                  Q+      R  ++G   E +   N + G +   G+N T  T   S   +T ++M
Sbjct  210  -----QQSSKQPTQRTATYGSLLETD--ENFFEGLLTDDGVNSTSITQLGSASSKTELSM  262

Query  539  GITAAPPRIdedhhhheaannnaIMEGS----------NSFISLLNQLSPNDSATLNNNV  688
               A+ P +          + +A+   S          NS     N  SP  +  LN   
Sbjct  263  VPAASLPPLKRTLPSPYWNDVSAVGPSSAKRFHANNHNNSGSDTTNANSPITTLLLNQLP  322

Query  689  Q-----TGLGVSIAEGVLHQPYQLS  748
            Q     + L   + +GV  QPYQ S
Sbjct  323  QATPFHSPLLGPMGDGVFRQPYQFS  347



>gb|AHJ79165.1| NAC domain protein NAC24 [Gossypium hirsutum]
Length=344

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 108/260 (42%), Positives = 151/260 (58%), Gaps = 29/260 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KT+W+MHEYRL DN  N      
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTSWIMHEYRLADNKNN------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGC  358
             ++P G D  NKK+SLRLDDWVLCRI+KKN + RP++        +   ++  S S+   
Sbjct  149  -NKPPGYDFSNKKNSLRLDDWVLCRIYKKNNTHRPLDQDKDDSIDDMLGSIQPSISI---  204

Query  359  GGGGSDHQNPNSR-ASRG--LSFGDFFEINNAHNLYNGTM---MSGGIN--GTQTSWDSP  514
               G+ H NP  + AS+G   SFG   E N+ H+L++G M      GIN      S  +P
Sbjct  205  ---GNQHNNPKFQFASKGTATSFGTLLE-NHEHSLFDGMMGNNSDEGINNGSMSQSMVNP  260

Query  515  RDQTCMAM---GITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNN  685
              +   ++     T+  P+ ++  H      +   M+G+ S  +LL+QL   +S +L   
Sbjct  261  LKRNLPSLFWTDETSIEPQANKKFHGDSNDGSMEKMDGNGSVTTLLSQLP--ESPSLQQQ  318

Query  686  VQTGLGVSIAEGVLHQPYQL  745
             +T +G S+ +G+   P+QL
Sbjct  319  QETMMG-SMGDGIYRPPFQL  337



>ref|XP_002532683.1| NAC domain-containing protein, putative [Ricinus communis]
 gb|EEF29696.1| NAC domain-containing protein, putative [Ricinus communis]
Length=346

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 148/268 (55%), Gaps = 37/268 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN V       
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKV-------  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            +++P G D+ NKK+SLRLDDWVLCRI+KKN ++RP++   + D  ED   +   SL    
Sbjct  148  SNKPPGCDLANKKNSLRLDDWVLCRIYKKNNTNRPMDQ-EKDDSMEDMLGSIPPSL----  202

Query  362  GGGSDHQNPNSRASRGLSFGDFFE----INNAHNLYNGTMMSGGINGTQTSWDSPRDQTC  529
              GS  QN   +  +G ++G   E      N H++ N   +S   + T +    P D + 
Sbjct  203  TIGS-QQNARLQLLKGTNYGTLVENDTSFFNDHSISNTNSISQLASSTCS---RPGDLSM  258

Query  530  MAMGIT-------------AAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSA  670
            + +  T             A+P         H    +    +G+ SF+SLL+QL    + 
Sbjct  259  LPLKRTLPSLYWSDDVDMAASPSSSKRYQGDHTGDESVVRSDGNGSFVSLLSQLP--QTP  316

Query  671  TLNNNVQTGLGVSIAEGVLHQPYQLSWL  754
             L+   Q  LG SI +G+   PYQLS L
Sbjct  317  PLHQQ-QATLG-SIGDGIFRPPYQLSGL  342



>emb|CBI20351.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 139/253 (55%), Gaps = 28/253 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVNT-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGC  358
              +P G D+ NKK+SLRLDDWVLCRI+KKN + R ++        +    V TS S+   
Sbjct  150  --KPPGCDMGNKKNSLRLDDWVLCRIYKKNNTHRTLDPDKDDSMDDMLGPVPTSISM---  204

Query  359  GGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCMAM  538
            G      Q P       L       + N  +L+ G + S GIN T TS   P  +T  ++
Sbjct  205  GQQSLKLQFPKVPNYSAL-------LENEQSLFEGMINSDGIN-TTTSSILPLKRTLPSL  256

Query  539  GI----TAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNNVQTGLGV  706
                  TA P         +   N     +G+NS  +LL+QL    S     + Q+ LG 
Sbjct  257  YWNDDDTAGPSTTKRFQAENTDGNIGRTTDGNNSIATLLSQLPQTPSL----HQQSMLG-  311

Query  707  SIAEGVLHQPYQL  745
            S+ EGV  QP+QL
Sbjct  312  SLGEGVFRQPFQL  324



>ref|XP_007025712.1| NAC domain containing protein 25 [Theobroma cacao]
 gb|EOY28334.1| NAC domain containing protein 25 [Theobroma cacao]
Length=351

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 102/167 (61%), Gaps = 19/167 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI+T NG QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN       +S
Sbjct  95   YWKATGTDKPIVTSNGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN-------NS  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P   D+ N+K SLRLDDWVLCRI+KKN + RP+E        + +TV    +L    
Sbjct  148  TSKPQIADVANRKGSLRLDDWVLCRIYKKNNTQRPMERD-----KDYSTVGMLATLP---  199

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTS  502
               S HQNP    S+  S+G   E  N  N + G +   G+  +  S
Sbjct  200  --TSTHQNPKPPTSKATSYGSLLE--NEENFFEGILTGEGMQHSTIS  242



>gb|KHG07368.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=347

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/260 (41%), Positives = 147/260 (57%), Gaps = 26/260 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KT+W+MHEYRL DN  N      
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTSWIMHEYRLADNKNN------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGC  358
             ++P G D  NKK+SLRLDDWVLCRI+KKN + RP++        +   ++  S S+   
Sbjct  149  -NKPPGYDFSNKKNSLRLDDWVLCRIYKKNNTHRPLDQDKDDSMDDMLGSIQPSISI---  204

Query  359  GGGGSDHQNPNSR-ASRG--LSFGDFFEINNAHNLYNGTM---MSGGIN--GTQTSWDSP  514
               G+ H NP  + AS+G   SFG   E N+ H+L++G M      GIN      S  +P
Sbjct  205  ---GNQHNNPKFQFASKGTATSFGTLLE-NHEHSLFDGMMGNNSDEGINNGSMSQSMVNP  260

Query  515  RDQTCMAM---GITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNN  685
              +   ++     T+  P+ ++  H      +   M+G+ S  +LL+QL  + S      
Sbjct  261  LKRNLPSLFWTDETSTEPQANKKFHGDSNDGSMEKMDGNGSVTTLLSQLRQSPSLQQQQQ  320

Query  686  VQTGLGVSIAEGVLHQPYQL  745
             Q  +  S+ +G+   P+QL
Sbjct  321  QQETMMGSMGDGIYRPPFQL  340



>ref|XP_006467845.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|KDO75851.1| hypothetical protein CISIN_1g017854mg [Citrus sinensis]
Length=365

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 142/282 (50%), Gaps = 52/282 (18%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G QK GVKKALVFY GKPPKG+KTNW+MHEYR+ DN+  S T   
Sbjct  95   YWKATGTDKPILTSKGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRIVDNI--SGTKPP  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             H+ L  D+ NKK SLRLDDWVLCRI+KKN + RP+E     D  ED       S +G  
Sbjct  153  PHQ-LPADLANKKHSLRLDDWVLCRIYKKNNAQRPMER----DRDED-------SFEGMC  200

Query  362  GGGSDHQNPNSRAS----RGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSW--DSPRDQ  523
                 +QNP    +      LS+G  FE ++  + + G + S G    Q S    S    
Sbjct  201  VTLPPNQNPKPFPAPPGRSTLSYGSIFEQDD--HFFEGMLSSAGEGIHQNSCVSSSKPPP  258

Query  524  TCMAMGIT---------AAPPRIdedhhhheaannnaIM------------------EGS  622
              M+M +          A PP+   +     A++ +                       S
Sbjct  259  NTMSMSLVSPTSNSIKRAIPPQFWNEASGSMASSPSRKSFLGDLNSGSGTATDHEHDHDS  318

Query  623  NSFISLLNQLSPNDSATLNNNVQTGLG-VSIAEGVLHQPYQL  745
            NSF+SLLNQL    SA  N N    LG +  A   L Q +QL
Sbjct  319  NSFVSLLNQLP--QSAQFNPNTSALLGSLGDATATLRQQFQL  358



>gb|AGC27313.1| NAC domain protein 10 [Gossypium hirsutum]
Length=349

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 107/165 (65%), Gaps = 24/165 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L   GTQK GVKKALVFY GKPPKG+KTNW+MHEYRLPDN  N      
Sbjct  95   YWKATGTDKPVLNSKGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLPDNKNN------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED---ATVATSTSLD  352
             ++P G D+  KK+SLRLDDWVLCRI+KKN ++RP+  G   D   D     V TS S+ 
Sbjct  149  -NKPPGCDLGYKKNSLRLDDWVLCRIYKKNNTNRPL--GYEKDEAIDDMGGPVPTSMSI-  204

Query  353  GCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGIN  487
                G    Q      ++G S G F E N+ HNL++G + S GIN
Sbjct  205  ----GSLQFQ------TKGTSCGTFLE-NHEHNLFDGMLGSDGIN  238



>ref|XP_006449287.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
 gb|ESR62527.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
Length=365

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 140/282 (50%), Gaps = 52/282 (18%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G QK GVKKALVFY GKPPKG+KTNW+MHEYR+ DN+  S T   
Sbjct  95   YWKATGTDKPILTSKGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRIVDNI--SGTKPP  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             H+ L  D+ NKK SLRLDDWVLCRI+KKN + RP+E     D  ED       S +G  
Sbjct  153  PHQ-LPADLANKKHSLRLDDWVLCRIYKKNNAQRPMER----DRDED-------SFEGMC  200

Query  362  GGGSDHQNPNSRAS----RGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSW--DSPRDQ  523
                 +QNP    +      LS+G  FE ++  + + G + S G    Q S    S    
Sbjct  201  VTLPPNQNPKPFPAPPGRSTLSYGSIFEQDD--HFFEGMLSSAGEGIHQNSCVSSSKPPP  258

Query  524  TCMAMGIT---------AAPPRI------dedhhhheaannnaIMEGS------------  622
              M+M +          A PP+                +    +  GS            
Sbjct  259  NTMSMSLVSPTSNSIKRAIPPQFWNEASGSMASSPSRKSFLGDLNSGSGTATDHEHDHDN  318

Query  623  NSFISLLNQLSPNDSATLNNNVQTGLG-VSIAEGVLHQPYQL  745
            NSF+SLLNQL    SA  N N    LG +  A   L Q +QL
Sbjct  319  NSFVSLLNQLP--QSAQFNPNTSALLGSLGDATATLRQQFQL  358



>gb|KHG20342.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=349

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 107/165 (65%), Gaps = 24/165 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L   GTQK GVKKALVFY GKPPKG+KTNW+MHEYRLPDN  N      
Sbjct  95   YWKATGTDKPVLNSKGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLPDNKNN------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED---ATVATSTSLD  352
             ++P G D+  KK+SLRLDDWVLCRI+KKN ++RP+  G   D   D     V TS S+ 
Sbjct  149  -NKPPGCDLGYKKNSLRLDDWVLCRIYKKNNTNRPL--GYEKDEAMDDMGGPVPTSMSI-  204

Query  353  GCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGIN  487
                G    Q      ++G S G F E N+ HNL++G + S G+N
Sbjct  205  ----GSLQFQ------TKGTSCGTFLE-NHEHNLFDGMLGSDGMN  238



>gb|AGL39684.1| NAC transcription factor 028 [Jatropha curcas]
 gb|KDP38908.1| hypothetical protein JCGZ_00665 [Jatropha curcas]
Length=345

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 104/262 (40%), Positives = 143/262 (55%), Gaps = 26/262 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN      
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVN------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             ++P G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +   +    S+    
Sbjct  149  -NKPPGCDLGNKKNSLRLDDWVLCRIYKKNNTHRPLDHDKDDSVDDMLGL-IPPSISVGN  206

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCMAMG  541
               +  QN   +  +G ++G   E N  + L+ G M +G IN   +S + P + + + + 
Sbjct  207  TNNNSQQNAKLQFLKGTNYGLLVE-NEQNCLFEGMMHNGEINQMGSS-NRPGELSVLPLK  264

Query  542  -----------ITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNNV  688
                       I AA     + +       +    +G+ S  SLL+QL      T   + 
Sbjct  265  RTLPSLYWNEEIDAAGASSSKRYQADSGDGSVVRNDGNGSIASLLSQL----PQTPPLHQ  320

Query  689  QTGLGVSIAEGVLHQPYQLSWL  754
            QT LG S+ +G+   P+Q S L
Sbjct  321  QTALG-SLGDGIYRPPFQFSGL  341



>gb|AGC27321.1| NAC domain protein 10 [Gossypium hirsutum]
Length=347

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 107/165 (65%), Gaps = 24/165 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L   GTQK GVKKALVFY GKPPKG+KTNW+MHEYRLPDN  N      
Sbjct  93   YWKATGTDKPVLNSKGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLPDNKNN------  146

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED---ATVATSTSLD  352
             ++P G D+  KK+SLRL+DWVLCRI+KKN ++RP+  G   D   D     V TS S+ 
Sbjct  147  -NKPPGCDLGYKKNSLRLEDWVLCRIYKKNNTNRPL--GYEKDEAMDDMGGPVPTSMSI-  202

Query  353  GCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGIN  487
                G    Q      ++G S G F E N+ HNL++G + S G+N
Sbjct  203  ----GSLQFQ------TKGTSCGTFLE-NHEHNLFDGMLGSDGMN  236



>gb|AGL39685.1| NAC transcription factor 029 [Jatropha curcas]
 gb|KDP20923.1| hypothetical protein JCGZ_21394 [Jatropha curcas]
Length=369

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 105/171 (61%), Gaps = 26/171 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  NS +   
Sbjct  95   YWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDNNNNSSS---  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D  NKK SLRLDDWVLCRI+KKN S RP+E        ED       S++G  
Sbjct  152  --KPPGIDSANKKGSLRLDDWVLCRIYKKNNSQRPMERD-----KED-------SMEGLF  197

Query  362  GGGSD----HQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTS  502
               +     H  P S+ +   S+    E  N  N + G +++GG +G Q S
Sbjct  198  ANATHVLPIHPKPPSKPTN--SYASVLE--NEENFFEG-ILTGGGDGMQNS  243



>ref|XP_011029435.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=355

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN V +     
Sbjct  103  YWKATGTDKPILTLGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVKN-----  157

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +       + L G  
Sbjct  158  --KPPGCDLGNKKNSLRLDDWVLCRIYKKNNTHRPIDHDRDDSMDDILGSIPPSILVG--  213

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMS  475
                +HQN     ++G ++     ++N HNL+ GT+ S
Sbjct  214  ----NHQNGTLHLAKGTNYETL--LDNDHNLFEGTISS  245



>ref|XP_006370307.1| no apical meristem family protein [Populus trichocarpa]
 gb|ERP66876.1| no apical meristem family protein [Populus trichocarpa]
Length=360

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 102/155 (66%), Gaps = 17/155 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L+  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN      
Sbjct  108  YWKATGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVN------  161

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGC  358
             ++P G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +   ++  S S+   
Sbjct  162  -NKPPGCDLGNKKNSLRLDDWVLCRIYKKNNTQRPMDHDKDDSMDDVLGSIPPSISV---  217

Query  359  GGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNG  463
                  HQN     ++G +FG    ++N HNL+ G
Sbjct  218  ----GSHQNGTLHLAKGTNFGAL--LDNDHNLFEG  246



>ref|XP_002284654.2| PREDICTED: NAC transcription factor 25 isoform X1 [Vitis vinifera]
Length=353

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 138/274 (50%), Gaps = 48/274 (18%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVNT-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGC  358
              +P G D+ NKK+SLRLDDWVLCRI+KKN + R ++        +    V TS S+   
Sbjct  150  --KPPGCDMGNKKNSLRLDDWVLCRIYKKNNTHRTLDPDKDDSMDDMLGPVPTSISM---  204

Query  359  GGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQT------SWDSPRD  520
            G      Q P       L       + N  +L+ G + S GIN + T      S   P  
Sbjct  205  GQQSLKLQFPKVPNYSAL-------LENEQSLFEGMINSDGINSSGTISQLACSSSKPDH  257

Query  521  QTCMAMGI-------------------TAAPPRIdedhhhheaannnaIMEGSNSFISLL  643
             + +A                      TA P         +   N     +G+NS  +LL
Sbjct  258  LSLVAATTSSILPLKRTLPSLYWNDDDTAGPSTTKRFQAENTDGNIGRTTDGNNSIATLL  317

Query  644  NQLSPNDSATLNNNVQTGLGVSIAEGVLHQPYQL  745
            +QL    S     + Q+ LG S+ EGV  QP+QL
Sbjct  318  SQLPQTPSL----HQQSMLG-SLGEGVFRQPFQL  346



>ref|XP_002305677.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE86188.1| no apical meristem family protein [Populus trichocarpa]
Length=351

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 144/279 (52%), Gaps = 54/279 (19%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG QK GVKKALVFY GKPPKG+KTNW+MHEYRL +N       +S
Sbjct  95   YWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIEN-------NS  147

Query  182  AHRPLGDDIVNKK-SSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGC  358
            + +P   D  NKK  SLRLDDWVLCRI+KKN S RP++   +    ED+      +L   
Sbjct  148  SPKPPAADSANKKGGSLRLDDWVLCRIYKKNNSQRPMDQRDK----EDSMEGMFATLQ--  201

Query  359  GGGGSDHQNPNS-RASRGLSFGDFFEINNAHNLYNGTMMSGGI-NGTQTSWDSPRDQTCM  532
                S HQNP    AS+  ++     + N    + G +   G+ NG+ +   S   +  M
Sbjct  202  ---NSSHQNPKPLSASKHTAYASL--LVNEDTFFEGILTGDGMQNGSISQLPSSSSKPNM  256

Query  533  AMGITAA---------PPRId----------------edhhhheaannnaIMEGSNSFIS  637
            +M   +A         PP                   +  H    +      E + SF+S
Sbjct  257  SMAPVSANTFTATRTLPPHQYWNDATGSPVGLANSSGKRFHGELNSGITGTQEDNTSFVS  316

Query  638  LLNQLSPNDSATLNNNVQTGLGVSIAEGVLHQPYQLSWL  754
            +LNQL P  +  ++ +       ++ +GVL QP+QLS L
Sbjct  317  MLNQL-PQSTPLVHPS-------TLLDGVLRQPFQLSSL  347



>ref|XP_002316919.2| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97531.2| no apical meristem family protein [Populus trichocarpa]
Length=355

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 101/158 (64%), Gaps = 15/158 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN V +     
Sbjct  103  YWKATGTDKPILTLGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVKN-----  157

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +       + L G  
Sbjct  158  --KPPGCDLGNKKNSLRLDDWVLCRIYKKNNTHRPIDHDKDDYMDDILGSIPPSILVG--  213

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMS  475
                +HQN     ++G ++     ++N HNL+ G + S
Sbjct  214  ----NHQNGTLHLAKGTNYETL--LDNDHNLFEGIISS  245



>ref|XP_004293567.1| PREDICTED: NAC transcription factor 25-like [Fragaria vesca subsp. 
vesca]
Length=360

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 105/167 (63%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG+QK GVKKALVFY GKPPKG+KTNW+MHEYRL    +N   +S+
Sbjct  95   YWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL----INDENSSA  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            A +P   D  NKK+SLRLDDWVLCRI+KKN + RP+         ED   +T+ S++G  
Sbjct  151  ALKP--PDPTNKKASLRLDDWVLCRIYKKNNAQRPMMECDHHLHKED---STTNSMEGIF  205

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTS  502
                   +P   A+   ++    E +   N ++G + S G+  +  S
Sbjct  206  VQSMTKPSPPKAAT---NYTALLENDEEDNFFDGILSSEGVQNSSHS  249



>gb|AEQ28762.1| NAC domain class transcription factor [Prunus salicina]
Length=358

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 103/164 (63%), Gaps = 23/164 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        +
Sbjct  105  YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN-------KT  157

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDAT-VATSTSLDGC  358
            +++P G D+ NKK+SLRLDDWVLCRI+KKN S RP++   R D  ED        S+   
Sbjct  158  SNKPPGCDLGNKKNSLRLDDWVLCRIYKKNNSHRPMDL-EREDSMEDMMGPLMPPSISHV  216

Query  359  GGGGSDHQN-----PNSRASRGLSFGDFFEINNAHNLYNGTMMS  475
            G     HQN     PNS  + G  F     I N   +++G M S
Sbjct  217  G----HHQNMNLHLPNSNTNYGPPF-----IENDQIIFDGIMSS  251



>ref|XP_004291668.1| PREDICTED: NAC transcription factor ONAC010-like [Fragaria vesca 
subsp. vesca]
Length=344

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 106/167 (63%), Gaps = 24/167 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-----GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNS  166
            YWKATGTDKP+L+       GT+K GVKKALVFYRGKPPKG+KTNW+MHEYR+ DN  ++
Sbjct  98   YWKATGTDKPVLSTTDEGGGGTRKVGVKKALVFYRGKPPKGIKTNWIMHEYRIADNNTSN  157

Query  167  MTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTS  346
                  H     D+ NKK+SLRLDDWVLCRI+KKN + RP++     + + D T+ +S  
Sbjct  158  KPPPGCH-----DLGNKKNSLRLDDWVLCRIYKKNNTHRPMDL----EDSMDGTMGSSFP  208

Query  347  LDGCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGIN  487
            L         H  P S  S   ++G F  ++N HN Y+G + S GIN
Sbjct  209  LSKL-----HHLPPKSTTS---TYGQF--MDNDHNFYDGMVSSEGIN  245



>emb|CAN81855.1| hypothetical protein VITISV_041250 [Vitis vinifera]
Length=226

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG+QK GVKKALVFY GKPPKG+KTNW+MHEYRL D      + SS
Sbjct  95   YWKATGTDKPILTSNGSQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLID------STSS  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRG--DPTEDATVATSTSLDG  355
              +P G D+ NKK SLRLDDWVLCRI+KKN S RP+E       D T+   VA    L G
Sbjct  149  NTKPPGADMGNKKGSLRLDDWVLCRIYKKNISQRPMERDKEEYVDRTKHTRVAKQLHLLG  208



>ref|XP_002519008.1| transcription factor, putative [Ricinus communis]
 gb|EEF43219.1| transcription factor, putative [Ricinus communis]
Length=355

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 136/276 (49%), Gaps = 50/276 (18%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPIL  NG QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN       +S
Sbjct  95   YWKATGTDKPILASNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN------NNS  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            + +P G D+ NKK SLRLDDWVLCRI+KKN S R ++        ED       S++G  
Sbjct  149  SSKPPGFDLANKKGSLRLDDWVLCRIYKKNNSQRTMDRD-----KED-------SMEGFL  196

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSG-GINGTQTSWD----SPRDQT  526
                 +  P S +    +      ++N  N + G +  G G+  +  S      SP+   
Sbjct  197  ATLPINPKPASSSVSKPAHAYGSVLDNEENFFEGILTGGDGMQNSSVSHQFPSSSPKQHM  256

Query  527  CMAMGITAAPPRIdedhhhheaannnaIM-----------------------EGSNSFIS  637
             +A   T+ P  I          +                            E + SF+S
Sbjct  257  SIASISTSNPLAIKRVIPSQYWNHEAIAGSSIAAASSGKRFHGDLNSCSTGTEDNTSFVS  316

Query  638  LLNQLSPNDSATLNNNVQTGLGVSIAEGVLHQPYQL  745
            LL+QL P   A  ++N   G   S+ +GVL Q +QL
Sbjct  317  LLSQL-PQAGAPFHSNTFIG---SLGDGVLRQQFQL  348



>ref|XP_002316635.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97247.1| no apical meristem family protein [Populus trichocarpa]
Length=335

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 102/262 (39%), Positives = 137/262 (52%), Gaps = 36/262 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG QK GVKKALVFY GKPPKG+KTNW+MHEYRL +N  +S     
Sbjct  95   YWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLINNNPSS-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P GD    K  SLRLDDWVLCRI+KKN   R ++        ED+     T+L    
Sbjct  150  --KPPGDSANKKGGSLRLDDWVLCRIYKKNNPQRQMDQM-----EEDSMEGMFTTLPST-  201

Query  362  GGGSDHQNP-NSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPR-------  517
               S ++NP +   S+   +    E  N    + G +   G+    T+  S +       
Sbjct  202  ---SSNKNPKHPSVSKPTGYASLLE--NEDTFFEGILTGDGMQNISTNTLSEKRSLPYHQ  256

Query  518  ---DQTCMAMGITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNNV  688
               + T + MG+  +  +     H    +      E +NSF+SLLNQ  P  +  ++ + 
Sbjct  257  YWNETTGLPMGLANSSAK---RFHGDLNSGITGTQEDNNSFVSLLNQF-PQSTPLVHPST  312

Query  689  QTGLGVSIAEGVLHQPYQLSWL  754
              G   S+ +GVL Q +QLS L
Sbjct  313  LLG---SLGDGVLRQTFQLSSL  331



>ref|XP_011042501.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=358

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 99/154 (64%), Gaps = 15/154 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L+  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN      
Sbjct  106  YWKATGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVN------  159

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             ++P G D+ NKK+SLRLDDWVLCRI+KKN + +P++            V  ST      
Sbjct  160  -NKPPGYDLGNKKNSLRLDDWVLCRIYKKNNTQKPMDHDKD---DSMDDVLGSTPPSISV  215

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNG  463
            G    HQN     ++G +FG    ++N  NL+ G
Sbjct  216  G---SHQNGTLHLAKGTNFGAL--LDNDQNLFEG  244



>ref|XP_011027905.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=351

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 108/280 (39%), Positives = 142/280 (51%), Gaps = 56/280 (20%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG QK GVKKALVFY GKPPKG+KTNW+MHEYRL +N       +S
Sbjct  95   YWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIEN-------NS  147

Query  182  AHRPLGDDIVNKK-SSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGC  358
            + +P   D  NKK  SLRLDDWVLCRI+KKN S RP++   R D  E    A        
Sbjct  148  SPKPPAADSANKKGGSLRLDDWVLCRIYKKNNSQRPMDQRDREDSMEGMFAALQ------  201

Query  359  GGGGSDHQN--PNSRASRGLSFGDFFEINNAHNLYNGTMMSGGI-NGTQTSWDSPRDQTC  529
                S HQN  P S AS+  ++     + N    + G +   GI NG+ +   S   +  
Sbjct  202  ---NSSHQNSKPPS-ASKHTAYASL--LVNEDTFFEGILTGDGIQNGSISQLPSSSSKPN  255

Query  530  MAMGITAA---------PPRId----------------edhhhheaannnaIMEGSNSFI  634
            M++   +          PP                   +  H    +      E + SF+
Sbjct  256  MSLAPVSTNTFTATRTLPPHQYWNDATGSPVGLANSSGKRFHGELNSGITGTQEDNTSFV  315

Query  635  SLLNQLSPNDSATLNNNVQTGLGVSIAEGVLHQPYQLSWL  754
            S+LNQL P  +  ++ +       ++ +GVL QP+QLS L
Sbjct  316  SMLNQL-PQSTPLVHPS-------TLLDGVLRQPFQLSSL  347



>ref|XP_011098344.1| PREDICTED: NAC domain-containing protein 18 [Sesamum indicum]
Length=338

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 96/162 (59%), Gaps = 27/162 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        +
Sbjct  95   YWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN------KPA  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            +++P G D  NKK+SLRLDDWVLCRI+KKN + RPV+     D   D   +   ++    
Sbjct  149  SNKPPGCDFSNKKASLRLDDWVLCRIYKKNNAQRPVDQ--ERDELNDVIGSIPPTI----  202

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGIN  487
                            +    F + N+  N Y G MM+  +N
Sbjct  203  ---------------SIGQHKFLDNNDHQNYYEGMMMNDSMN  229



>gb|EYU33415.1| hypothetical protein MIMGU_mgv1a009589mg [Erythranthe guttata]
Length=337

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 6/97 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP++T  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN   +M    
Sbjct  95   YWKATGTDKPVMTAGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDNKPPNM----  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              +P G D+ NKK+SLRLDDWVLCRI+KKN + RPV+
Sbjct  151  --KPPGCDVTNKKASLRLDDWVLCRIYKKNNAQRPVD  185



>gb|AID55352.1| NAC protein 1 [Actinidia chinensis]
Length=321

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 98/157 (62%), Gaps = 17/157 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L+  G+QK GVKKALVFY GKPPKG+KTNW+MHEYRL +N +NS     
Sbjct  95   YWKATGTDKPVLSSGGSQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLVENKLNS-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATV-ATSTSLDGC  358
              +P G D  NKK+SLRLDDWVLCRI+KK+   RP++   R D   D       +S+  C
Sbjct  150  --KPPGCDAANKKASLRLDDWVLCRIYKKSNLPRPMDH-ERDDTMSDMLARMPPSSIPLC  206

Query  359  GGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM  469
                   Q P     +  S+G F  + N H L++  +
Sbjct  207  ------QQTPKLPPEKATSYGSF--LGNEHTLFDEML  235



>ref|XP_007149615.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
 gb|ESW21609.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
Length=369

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 97/160 (61%), Gaps = 13/160 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPP+G+KTNW+MHEYRL DN  N      
Sbjct  96   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADNKPN------  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             +RP G D+ NKK+SLRLDDWVLCRI+KK+ + R      R D  ED       S++   
Sbjct  150  -NRPPGCDLGNKKNSLRLDDWVLCRIYKKSNTHRSPMEHDREDSMEDMIGGIPPSINVGH  208

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGG  481
              G  H    S+ S G S      + N  NL  G M+  G
Sbjct  209  MSGRYHL---SKMSTGYSSA---LLENDQNLLEGMMIGNG  242



>ref|XP_009334622.1| PREDICTED: NAC domain-containing protein 18 [Pyrus x bretschneideri]
Length=370

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 101/164 (62%), Gaps = 23/164 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  111  YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKPNN-----  165

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDAT-VATSTSLDGC  358
              +P G D+ NKK+SLRLDDWVLCRI+KKN + RP++   R D  ED        S+   
Sbjct  166  --KPPGCDLGNKKNSLRLDDWVLCRIYKKNNTHRPMDH-EREDSMEDIMGPLMPPSISHV  222

Query  359  GGGGSDHQN-----PNSRASRGLSFGDFFEINNAHNLYNGTMMS  475
            G     HQN     P S +S G  F     + N    ++G M S
Sbjct  223  G----HHQNMKLHFPKSNSSYGPPF-----MENDQIFFDGIMSS  257



>ref|XP_011096265.1| PREDICTED: NAC transcription factor 25 [Sesamum indicum]
Length=360

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 103/167 (62%), Gaps = 24/167 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NGTQK GVKKALVFY GKPPKG+K+NW+MHEYRL D        SS
Sbjct  96   YWKATGTDKPILTANGTQKIGVKKALVFYGGKPPKGIKSNWIMHEYRLVDK------NSS  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK-NGSSRPVESGGRGD------PTEDATVATS  340
            A++P G  +  KK SL+LDDWVLCRIFKK N SSRP+E     +      PT    V   
Sbjct  150  ANKPPGISLT-KKGSLQLDDWVLCRIFKKGNPSSRPIEMDDSMEEMPVSMPTLSMDVGYQ  208

Query  341  TSLDGCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGG  481
            +S  G G   S H       SR L+F D    ++ +N ++G +   G
Sbjct  209  SSFPGPGKPSSHHD------SRVLTFED----DHGNNFFSGMLPGSG  245



>emb|CAG28971.1| NAM-like protein [Prunus persica]
Length=363

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 103/160 (64%), Gaps = 15/160 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL D       + +
Sbjct  106  YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD-------SKT  158

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDAT-VATSTSLDGC  358
            +++P G D+ NKK+SLRLDDWVLCRI+KKN S RP++   R D  ED        S+   
Sbjct  159  SNKPPGCDLGNKKNSLRLDDWVLCRIYKKNNSHRPMDL-EREDSMEDMMGPLMPPSISHV  217

Query  359  GGGGSDHQNPNSRASRG-LSFGDFFEINNAHNLYNGTMMS  475
            G     HQN N    +   ++G  F I N   +++G M S
Sbjct  218  G----HHQNMNLHLPKSNTNYGPPF-IENDQIIFDGIMSS  252



>ref|XP_008226677.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=371

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 8/107 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        +
Sbjct  108  YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN-------KT  160

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED  322
            +++P G D+ NKK+SLRLDDWVLCRI+KKN S RP++   R D  ED
Sbjct  161  SNKPPGCDLGNKKNSLRLDDWVLCRIYKKNNSHRPMDL-EREDSMED  206



>ref|XP_007211475.1| hypothetical protein PRUPE_ppa007577mg [Prunus persica]
 gb|EMJ12674.1| hypothetical protein PRUPE_ppa007577mg [Prunus persica]
Length=363

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 103/160 (64%), Gaps = 15/160 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL D       + +
Sbjct  106  YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD-------SKT  158

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDAT-VATSTSLDGC  358
            +++P G D+ NKK+SLRLDDWVLCRI+KKN S RP++   R D  ED        S+   
Sbjct  159  SNKPPGCDLGNKKNSLRLDDWVLCRIYKKNNSHRPMDL-EREDSMEDMMGPLMPPSISHV  217

Query  359  GGGGSDHQNPNSRASRG-LSFGDFFEINNAHNLYNGTMMS  475
            G     HQN N    +   ++G  F I N   +++G M S
Sbjct  218  G----HHQNMNLHLPKSNTNYGPPF-IENDQIIFDGIMSS  252



>ref|XP_009759753.1| PREDICTED: NAC transcription factor 25-like [Nicotiana sylvestris]
Length=330

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 78/106 (74%), Gaps = 7/106 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+ T  G QK GVKKALVFY GKPPKG+KTNW+MHEYR+ +N  N+     
Sbjct  103  YWKATGTDKPVFTAGGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRIAENKTNN-----  157

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTE  319
              +P G DI NKK SLRLDDWVLCRI+KKN + RP++   R D  E
Sbjct  158  --KPPGCDIANKKGSLRLDDWVLCRIYKKNNTQRPIDHHERDDMNE  201



>ref|NP_001266277.1| uncharacterized protein LOC101247735 [Solanum lycopersicum]
 gb|AFD22355.1| NAC3 [Solanum lycopersicum]
Length=329

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 131/258 (51%), Gaps = 43/258 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  96   YWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADNKTNN-----  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D+ NKK SLRLDDWVLCRI+KKN + RP++   R D   D  + +S+    C 
Sbjct  151  --KPPGCDLANKK-SLRLDDWVLCRIYKKNNTQRPIDH-ERDDLNIDMMMGSSSIHPSCI  206

Query  362  GGGSDHQN----PNSRASRGLSFG-DFFEINNAHNLYNGTMMSGGINGTQTSWDSP----  514
                   N    P     +  +FG       N  NLY G        G+Q S   P    
Sbjct  207  PNSMSMPNIFGQPKIPQLKSSNFGTTLIHDQNDQNLYEG--------GSQYSSKRPLANL  258

Query  515  --RDQTCMAMGI-TAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNN  685
               DQ   A    + +  R   ++       N    E + S +SLL+Q            
Sbjct  259  YWNDQDGGASNDNSQSTKRFLTENMEDGLNMNARADEQNGSIVSLLSQ------------  306

Query  686  VQTGLGVSIAEGVLHQPY  739
             Q  LG S++EGV  QPY
Sbjct  307  -QQVLG-SLSEGVFRQPY  322



>gb|AGT56012.1| sinor-like protein 1 [Solanum lycopersicum]
 gb|AGT56013.1| sinor-like protein 1 [Solanum lycopersicum]
Length=329

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 131/258 (51%), Gaps = 43/258 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  96   YWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADNKTNN-----  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D+ NKK SLRLDDWVLCRI+KKN + RP++   R D   D  + +S+    C 
Sbjct  151  --KPPGCDLANKK-SLRLDDWVLCRIYKKNNTQRPIDH-ERDDLNIDMMMGSSSIHPSCI  206

Query  362  GGGSDHQN----PNSRASRGLSFG-DFFEINNAHNLYNGTMMSGGINGTQTSWDSP----  514
                   N    P     +  +FG       N  NLY G        G+Q S   P    
Sbjct  207  PNSMSMPNIFGQPKIPQLKSSNFGTTLIHDQNDQNLYEG--------GSQYSSKRPLANL  258

Query  515  --RDQTCMAMGI-TAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPNDSATLNNN  685
               DQ   A    + +  R   ++       N    E + S +SLL+Q            
Sbjct  259  YWNDQDGGASNDNSQSTKRFLTENMEDGLNMNARADEQNGSIVSLLSQ------------  306

Query  686  VQTGLGVSIAEGVLHQPY  739
             Q  LG S++EGV  QPY
Sbjct  307  -QQVLG-SLSEGVFRQPY  322



>gb|AID55348.1| NAC protein 1 [Actinidia arguta]
Length=321

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 97/157 (62%), Gaps = 17/157 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L+  G+QK GVKKALVFY GKPPKG+KTNW+MHEYRL +N +NS     
Sbjct  95   YWKATGTDKPVLSSGGSQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLVENKLNS-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATV-ATSTSLDGC  358
              +P G D  NKK+SLRLDDWVLCRI+KK+   RP++   R D   D       +S+  C
Sbjct  150  --KPPGCDAANKKASLRLDDWVLCRIYKKSNHPRPLDH-ERDDTMSDMLARMPPSSIPLC  206

Query  359  GGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM  469
                     P     +  S+G F  + N H L++  +
Sbjct  207  ------QHTPKLPPEKATSYGSF--LGNEHTLFDEML  235



>ref|XP_009609295.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=329

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 7/103 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  G QK GVKKALVFY GKPPKG+KTNW+MHEYR+ +N  N      
Sbjct  103  YWKATGTDKPVLTAGGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRITENKTN------  156

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGD  310
             ++P G DI N+K SLRLDDWVLCRI+KKN + RP++   R D
Sbjct  157  -NKPPGCDIANRKGSLRLDDWVLCRIYKKNNTQRPIDHHERDD  198



>ref|XP_010060527.1| PREDICTED: NAC domain-containing protein 18-like [Eucalyptus 
grandis]
 gb|KCW67303.1| hypothetical protein EUGRSUZ_F01091 [Eucalyptus grandis]
Length=366

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L+  G QK GVKKALVFY GKPPKG+KTNW+MHEYRL +N V       
Sbjct  96   YWKATGTDKPVLSAVGHQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLIENKV-------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            ++RP G D+ NKK+SLRLDDWVLCRI+KK+   RP++   R D  +D   +   SL    
Sbjct  149  SNRPPGCDVGNKKNSLRLDDWVLCRIYKKSNVHRPMDH-ERDDSMDDMLESIPPSLTMNP  207

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGG  481
             G   H +  S  S G+ F       +  NL+ G M + G
Sbjct  208  HGMKLHLSKPSTTSYGVLF------EHEQNLFEGMMGANG  241



>ref|XP_008386130.1| PREDICTED: NAC domain-containing protein 18-like [Malus domestica]
Length=368

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  G QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  108  YWKATGTDKPVLTSGGIQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKPNN-----  162

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDAT-VATSTSLDGC  358
              +P G D+ NKK+SLRLDDWVLCRI+KKN + RP++   R D  ED        S+   
Sbjct  163  --KPPGCDLGNKKNSLRLDDWVLCRIYKKNNTHRPMDH-EREDSMEDILGPLMPPSISHV  219

Query  359  GGGGSDHQNPNSRASRG-LSFGDFFEINNAHNLYNGTMMS  475
            G     HQN      +  LS+G  F  NN    ++G M S
Sbjct  220  G----HHQNMKLHLPKSNLSYGPPFMENN-QIFFDGMMSS  254



>ref|XP_009769986.1| PREDICTED: NAC transcription factor 25 [Nicotiana sylvestris]
Length=353

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 8/97 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N      
Sbjct  96   YWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADNKAN------  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
             ++P G D+ NKK SLRLDDWVLCRI+KKN + RP++
Sbjct  150  -NKPPGCDVANKK-SLRLDDWVLCRIYKKNNTQRPID  184



>gb|AGS08759.1| NAC domain protein [Malus hupehensis]
Length=364

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/276 (41%), Positives = 143/276 (52%), Gaps = 56/276 (20%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT   TQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  105  YWKATGTDKPVLTSGDTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKPNN-----  159

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDAT-VATSTSLDGC  358
              +P G D+ NKK+SLRLDDWVLCRI+KKN + RP++   R D  ED        S+   
Sbjct  160  --KPPGCDLGNKKNSLRLDDWVLCRIYKKNNTHRPMDH-EREDSMEDIMGPLMPPSISHV  216

Query  359  GGGGSDHQN-----PNSRASRGLSFGDFFEINNAHNLYNGTMMS--GGINGTQTS-----  502
            G     HQN     P S +S G  F     + N    ++G M S  G  +  Q       
Sbjct  217  G----HHQNMKLHFPKSNSSYGPPF-----MENDQIFFDGIMSSTDGSASTHQLQLKRPI  267

Query  503  -----WDSPRDQTCMAMGITAAPP----RIdedhhhheaannnaIMEG------SNSFIS  637
                 W++  D        TAA P    RI      +   +N A + G      S+S  +
Sbjct  268  VPSWYWNNQEDDQ------TAADPSSSKRIQLHQLDNGTNSNGAGINGGSTNNNSSSITN  321

Query  638  LLNQLSPNDSATLNNNVQTGLGVSIAEGVLHQPYQL  745
            LL+QLS   +  L+ +   G   S+ +G+   PYQL
Sbjct  322  LLSQLS--QTPPLHQHAVLG---SLGDGIFRTPYQL  352



>ref|XP_010089502.1| NAC domain-containing protein 18 [Morus notabilis]
 gb|EXB37905.1| NAC domain-containing protein 18 [Morus notabilis]
Length=391

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 106/169 (63%), Gaps = 16/169 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL +N  N+     
Sbjct  107  YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAENKANN-----  161

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVA--TSTSLDG  355
              +P G D+ NKK+SLRLDDWVLCRI+KKN ++R ++   R   + D  +     + L  
Sbjct  162  --KPPGCDLGNKKNSLRLDDWVLCRIYKKNNTNRLLDHQERDHDSIDDMLGPINQSHLSN  219

Query  356  CGG----GGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGING  490
              G    G    Q P  +++  LS+G     N+ HNL++G +     NG
Sbjct  220  LVGPQNIGKLQQQLP--KSATLLSYGSALSEND-HNLFDGMLSCSNDNG  265



>ref|XP_006841705.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
 gb|ERN03380.1| hypothetical protein AMTR_s00003p00252470 [Amborella trichopoda]
Length=349

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 104/268 (39%), Positives = 135/268 (50%), Gaps = 44/268 (16%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GTQK GVKKALVFY G+PPKG+KTNW+MHEYRL D        + 
Sbjct  95   YWKATGTDKPILTSGGTQKVGVKKALVFYGGRPPKGIKTNWIMHEYRLTDG-----GNTK  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             +  L ++  NKKSSLRLDDWVLCRI+KKN  S  +    R D  +D  +A   S+DG  
Sbjct  150  PNNDLSNN--NKKSSLRLDDWVLCRIYKKNNQSPRLMEREREDSMDD-MLAPLPSMDG--  204

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGI----------------NGT  493
                 H+ P  + S   +FG   E     N ++G +   G+                N T
Sbjct  205  ---QPHKLPAQKPS---TFGALLE---NENFFDGLLTDDGVSNNMNSMPQLPSSHQQNST  255

Query  494  QTSWDSPRDQTCMAMGITAAPPR-----IdedhhhheaannnaIMEGSNSFISLLNQLSP  658
            ++  D P     +    T   P      +          + +   +GSNS  +LLNQL P
Sbjct  256  KSGGDLPLAPAALPFKRTLPSPYWNEAAMPLAKRFQSNQSTSGSNDGSNSIATLLNQL-P  314

Query  659  NDSATLNNNVQTGLGVSIAEGVLHQPYQ  742
              +A  ++    GL  SI +GV    YQ
Sbjct  315  GAAAPFHHQ---GLLSSIGDGVFRPQYQ  339



>ref|XP_009594217.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=350

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 8/97 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N      
Sbjct  96   YWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLADNKAN------  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
             ++P G D+ NKK SLRLDDWVLCRI+KKN + RP++
Sbjct  150  -NKPPGCDVANKK-SLRLDDWVLCRIYKKNNTQRPID  184



>gb|AID55354.1| NAC protein 3 [Actinidia chinensis]
Length=319

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 100/167 (60%), Gaps = 17/167 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATG DKP+LT +GTQK GVKKALVFYRGKPPKG+KTNW+MHEYRL DN   S     
Sbjct  95   YWKATGIDKPVLTSSGTQKVGVKKALVFYRGKPPKGVKTNWIMHEYRLIDNRAKS-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D  + K SLRLDDWVLCRI+KKN  SR +     G   ED+     T L    
Sbjct  150  --KPPGYDAGHSKGSLRLDDWVLCRIYKKNYPSRLI-----GHEKEDSM----TDLPPTI  198

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTS  502
                 +Q P    ++ +S+     +++ H+L++  M+S     T  S
Sbjct  199  FSIPQNQTPKLPPTKPISYTQIPLLDHDHHLFD-EMLSHSSTDTAAS  244



>ref|XP_010100577.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB82820.1| NAC domain-containing protein 29 [Morus notabilis]
Length=345

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 7/116 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NGTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN+      + 
Sbjct  95   YWKATGTDKPILTSNGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDNI------TK  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
               P      +KK+SLRLDDWVLCRI+KKN + RP+    + D + DA +  ST++
Sbjct  149  PKLPDHHTSTDKKASLRLDDWVLCRIYKKNNAQRPMMDHDKED-SMDALLMQSTTM  203



>emb|CDP05873.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        +
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLVDN-------KT  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
            + +P G DI NKK SLRLDDWVLCRI+KKN + RP++
Sbjct  148  SIKPPGCDIGNKKGSLRLDDWVLCRIYKKNNTPRPMD  184



>ref|NP_001280984.1| NAC domain-containing protein 18 [Malus domestica]
 gb|ADL36807.1| NAC domain class transcription factor [Malus domestica]
Length=364

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 100/164 (61%), Gaps = 23/164 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT   TQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  105  YWKATGTDKPVLTSGDTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKPNN-----  159

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDAT-VATSTSLDGC  358
              +P G D+ NKK+S+RLDDWVLCRI+KKN + RP++   R D  ED        S+   
Sbjct  160  --KPPGCDLGNKKNSMRLDDWVLCRIYKKNNTHRPMDH-EREDSMEDIMGPLMPPSISHV  216

Query  359  GGGGSDHQN-----PNSRASRGLSFGDFFEINNAHNLYNGTMMS  475
            G     HQN     P S +S G  F     + N    ++G M S
Sbjct  217  G----HHQNMKLHFPKSNSSYGPPF-----MENDQIFFDGIMSS  251



>gb|KHN36793.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 101/165 (61%), Gaps = 12/165 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPP+G+KTNW+MHEYRL DN  N+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADNKPNNRP---  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
               P G D+ NKK++LRLDDWVLCRI+KK+ + R      R D  +D       S++   
Sbjct  152  ---PPGCDLGNKKNTLRLDDWVLCRIYKKSNTHRSPMEHEREDSMDDMIGGIPPSINVGH  208

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMM---SGGIN  487
                 H    S+ +   + G   E N+ HNL  G M+   +GG+N
Sbjct  209  MSARFHH--LSKMTTAYNNGALLE-NDHHNLLEGMMIGNSNGGMN  250



>ref|XP_003543257.1| PREDICTED: NAC domain-containing protein 18 [Glycine max]
Length=375

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 101/165 (61%), Gaps = 12/165 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPP+G+KTNW+MHEYRL DN  N+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLTDNKPNNRP---  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
               P G D+ NKK++LRLDDWVLCRI+KK+ + R      R D  +D       S++   
Sbjct  152  ---PPGCDLGNKKNTLRLDDWVLCRIYKKSNTHRSPMEHDREDSMDDMIGGIPPSINVGH  208

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMM---SGGIN  487
                 H    S+ +   + G   E N+ HNL  G M+   +GG+N
Sbjct  209  MSARFHH--LSKMTTAYNNGALLE-NDHHNLLEGMMIGNSNGGMN  250



>ref|XP_003540450.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN28035.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 100/165 (61%), Gaps = 13/165 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPP+G+KTNW+MHEYRL DN  N+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADNKPNNRP---  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
               P G D+ NKK++LRLDDWVLCRI+KK+ + R      R D  +D       S++   
Sbjct  152  ---PPGCDLGNKKNTLRLDDWVLCRIYKKSNTHRSPMEHEREDSMDDMIGGIPPSINVGH  208

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMM---SGGIN  487
                 H    S+ +   + G   E  N HNL  G M+   +GG+N
Sbjct  209  MSARFHH--LSKMTTAYNSGAMLE--NEHNLLEGMMIGNNNGGMN  249



>gb|KEH38791.1| NAC transcription factor-like protein [Medicago truncatula]
Length=354

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 9/108 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPP+G+KTNW+MHEYRL DN  N      
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADNKPN------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR-PVESGGRGDPTED  322
             +RP G D+ NKK+SLRLDDWVLCRI+KK+ + R PVE   R D  +D
Sbjct  149  -NRPPGCDLGNKKNSLRLDDWVLCRIYKKSNTHRSPVEH-DREDSMDD  194



>gb|ACE97084.1| NAC domain protein [Populus tremula]
 gb|ACE97086.1| NAC domain protein [Populus tremula]
 gb|ACE97088.1| NAC domain protein [Populus tremula]
 gb|ACE97100.1| NAC domain protein [Populus tremula]
Length=199

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 97/153 (63%), Gaps = 17/153 (11%)
 Frame = +2

Query  14   TGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASSAHRP  193
            TGTDKP+L+  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN       ++P
Sbjct  1    TGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVN-------NKP  53

Query  194  LGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGCGGGG  370
             G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +   ++  S S+       
Sbjct  54   PGCDLGNKKNSLRLDDWVLCRIYKKNNTQRPMDHDKDDSMDDVLGSIPPSISV-------  106

Query  371  SDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM  469
              HQN     ++G +FG   +  N  NL+ G +
Sbjct  107  GSHQNGTLHLAKGTNFGALLD--NDQNLFEGII  137



>gb|AID55350.1| NAC protein 3 [Actinidia arguta]
Length=319

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 97/167 (58%), Gaps = 17/167 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATG DKP+LT +GTQK GVKKALVFYRGKPPKG+KT+W+MHEYRL DN   S     
Sbjct  95   YWKATGIDKPVLTSSGTQKVGVKKALVFYRGKPPKGVKTDWIMHEYRLIDNRAKS-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P   D  + K SLRLDDWVLCRI+KKN  SRP+  G   D        + T L    
Sbjct  150  --KPPEYDAGHNKGSLRLDDWVLCRIYKKNHPSRPI--GHERD-------YSMTDLPSTI  198

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTS  502
                 +Q P       +S+     ++  H+L++  M+S  I  T  S
Sbjct  199  FSIPQNQTPKLPPIEPISYTPIPLLDPDHHLFD-EMLSHSITDTAAS  244



>gb|ACE97092.1| NAC domain protein [Populus tremula]
Length=199

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 98/151 (65%), Gaps = 17/151 (11%)
 Frame = +2

Query  14   TGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASSAHRP  193
            TGTDKP+L+  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN       ++P
Sbjct  1    TGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVN-------NKP  53

Query  194  LGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGCGGGG  370
             G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +   ++  S S+       
Sbjct  54   PGCDLGNKKNSLRLDDWVLCRIYKKNNTQRPMDHDKDDSMDDVLGSIPPSISV-------  106

Query  371  SDHQNPNSRASRGLSFGDFFEINNAHNLYNG  463
              HQN     ++G +FG    ++N  NL++G
Sbjct  107  GSHQNGTLHLAKGTNFGAL--LDNDQNLFDG  135



>emb|CDX98562.1| BnaC05g38130D [Brassica napus]
Length=359

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 96/160 (60%), Gaps = 14/160 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFYRGKPPKG+K++W+MHEYRL DN  N+     
Sbjct  98   YWKATGTDKPVLASDGNQKVGVKKALVFYRGKPPKGIKSDWIMHEYRLIDNKPNN-----  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D  N K+SLRLDDWVLCRI+KKN + R V++    D  +        SL    
Sbjct  153  --RPPGCDFGNTKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSLSMAA  210

Query  362  GGGSDHQNPNSRASRGLSF---GDFFEINNAHNLYNGTMM  472
                 H N     SR ++F   G     +  H LYNG+ M
Sbjct  211  ATTGLHHN----VSRSMNFFPGGYGIFSDGDHGLYNGSGM  246



>gb|ACE97083.1| NAC domain protein [Populus tremula]
 gb|ACE97085.1| NAC domain protein [Populus tremula]
 gb|ACE97087.1| NAC domain protein [Populus tremula]
 gb|ACE97089.1| NAC domain protein [Populus tremula]
 gb|ACE97090.1| NAC domain protein [Populus tremula]
 gb|ACE97091.1| NAC domain protein [Populus tremula]
 gb|ACE97093.1| NAC domain protein [Populus tremula]
 gb|ACE97095.1| NAC domain protein [Populus tremula]
 gb|ACE97096.1| NAC domain protein [Populus tremula]
 gb|ACE97097.1| NAC domain protein [Populus tremula]
 gb|ACE97099.1| NAC domain protein [Populus tremula]
 gb|ACE97101.1| NAC domain protein [Populus tremula]
 gb|ACE97102.1| NAC domain protein [Populus tremula]
 gb|ACE97103.1| NAC domain protein [Populus tremula]
 gb|ACE97104.1| NAC domain protein [Populus tremula]
 gb|ACE97105.1| NAC domain protein [Populus tremula]
 gb|ACE97106.1| NAC domain protein [Populus tremula]
Length=199

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = +2

Query  14   TGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASSAHRP  193
            TGTDKP+L+  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN       ++P
Sbjct  1    TGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVN-------NKP  53

Query  194  LGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGCGGGG  370
             G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +   ++  S S+       
Sbjct  54   PGCDLGNKKNSLRLDDWVLCRIYKKNNTQRPMDHDKDDSMDDVLGSIPPSISV-------  106

Query  371  SDHQNPNSRASRGLSFGDFFEINNAHNLYNG  463
              HQN     ++G +FG    ++N  NL+ G
Sbjct  107  GSHQNGTLHLAKGTNFGAL--LDNDQNLFEG  135



>ref|XP_009115491.1| PREDICTED: NAC domain-containing protein 18-like [Brassica rapa]
Length=358

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 76/97 (78%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL DN  N      
Sbjct  97   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDNKPN------  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
             +RP G D  NKK+SLRLDDWVLCRI+KKN + RPVE
Sbjct  151  -NRPPGCDYGNKKNSLRLDDWVLCRIYKKNNAGRPVE  186



>ref|XP_011047846.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=355

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 131/271 (48%), Gaps = 34/271 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG QK GVKKALVFY GKPPKG+KTNW+MHEYRL +N  +S     
Sbjct  95   YWKATGTDKPILTSNGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLINNNPSS-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P GD    K  SLRLDDWVLCRI+KKN   R ++     D  E       ++     
Sbjct  150  --KPPGDSANKKGGSLRLDDWVLCRIYKKNNPQRQMDQMEEEDSIEGMFATLPSTSSNKN  207

Query  362  GGGSDHQNPNSRASRGLSFGDFFE-------INNAHNLY--------NGTMMSGGINGTQ  496
                    P   AS   +   FFE       + N+            N +M S   N   
Sbjct  208  PKHPSVSKPAGYASLLENEDTFFEGILTGDGMQNSSISQLPSSSLRPNMSMTSVSTNTLS  267

Query  497  TSWDSPRDQ-----TCMAMGITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSPN  661
                 P  Q     T + MG+  +  +     H    +      E +NSF+SLLNQ  P 
Sbjct  268  EKRSLPYHQYWNETTGLPMGLATSSAK---RFHGDLNSGITGTQEDNNSFVSLLNQF-PQ  323

Query  662  DSATLNNNVQTGLGVSIAEGVLHQPYQLSWL  754
             +  ++ +   G   S+ +GVL Q +QLS L
Sbjct  324  STPLVHPSTLHG---SLGDGVLRQTFQLSSL  351



>ref|XP_009593583.1| PREDICTED: NAC transcription factor 25 isoform X1 [Nicotiana 
tomentosiformis]
Length=269

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 117/226 (52%), Gaps = 65/226 (29%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI T NGT+K GVKK L+FYRGKP KGMK+NWVMHEYRL DN         
Sbjct  95   YWKATGTDKPIFTSNGTKKIGVKKTLIFYRGKPLKGMKSNWVMHEYRLVDN---------  145

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
                  +  + KK SLRLDDWVLCRI+KKN SS  +E   + D  ED T   STS+    
Sbjct  146  ------NSSLTKKCSLRLDDWVLCRIYKKNSSSTIMEM-DKEDSIEDTT--GSTSILPAS  196

Query  362  GGGSDHQNPNSRASR-GLSFGDFFE--INNAHNLYNGTMMSGGINGTQTSWDSPRDQTCM  532
                  QNP+  A R G +F +F E  +  A N Y         NG     D+P      
Sbjct  197  SMNYFDQNPSIGALRVGSNFDEFLENDMKIAKNEYE--------NGD----DTP------  238

Query  533  AMGITAAPPRIdedhhhheaannnaIMEG-SNSFISLLNQLSPNDS  667
                                     +MEG S+SF+++LNQ+SP  S
Sbjct  239  -------------------------LMEGNSSSFLTMLNQISPRSS  259



>ref|XP_011095244.1| PREDICTED: NAC transcription factor 25-like [Sesamum indicum]
Length=354

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 94/156 (60%), Gaps = 18/156 (12%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N      
Sbjct  110  YWKATGTDKPVLTAGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKPNC-----  164

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              +P G D   KK SLRLDDWVLCRI+KK  + RP+ +  R D   D   +   +L    
Sbjct  165  --KPPGCD---KKGSLRLDDWVLCRIYKKTNAQRPM-TQERDDHINDMIGSVQPTLSLPL  218

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM  469
            G     Q+      +  S+G   E ++  NLY G M
Sbjct  219  G-----QHQKIHGIKASSYGSLLESDD--NLYEGMM  247



>ref|XP_009780447.1| PREDICTED: NAC transcription factor 25-like [Nicotiana sylvestris]
Length=269

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 116/226 (51%), Gaps = 65/226 (29%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATG DKPI TC GT+K GVKK LVFYRGKPPKG+K+NWVMHEYRL DN         
Sbjct  95   YWKATGIDKPIYTCGGTKKIGVKKTLVFYRGKPPKGIKSNWVMHEYRLVDN---------  145

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
                  +  + KK SLRLDDWVLCRI+KKN SS  +E   + D  E+ T   STS+    
Sbjct  146  ------NSSLTKKCSLRLDDWVLCRIYKKNSSSTIMEM-DKEDSIEETT--GSTSILPAS  196

Query  362  GGGSDHQNPNSRASR-GLSFGDFFE--INNAHNLYNGTMMSGGINGTQTSWDSPRDQTCM  532
                  QN +    R G +F +FFE  I  A N Y         NG     D+P      
Sbjct  197  SMNYFEQNSSIGTLRVGSNFDEFFENDIKMAKNEYE--------NGD----DTP------  238

Query  533  AMGITAAPPRIdedhhhheaannnaIMEG-SNSFISLLNQLSPNDS  667
                                     +MEG S+SF+++LNQ+SP  S
Sbjct  239  -------------------------LMEGNSSSFLTMLNQISPRSS  259



>ref|XP_010465520.1| PREDICTED: NAC domain-containing protein 18-like [Camelina sativa]
Length=369

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 104/172 (60%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL +N +N+     
Sbjct  98   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIENKLNN-----  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D  NKK+SLRLDDWVLCRI+KKN + R V++    D  +        SL    
Sbjct  153  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSLSMAA  210

Query  362  GGGSDHQNPNSRASRGLSF----------GDFFEINNAHNLYNGTMMSGGIN  487
                 H + N   SR ++F          G F + NNA +LY+G  M G IN
Sbjct  211  AATGLHHH-NHNVSRSMNFFPGRFSGGGYGIFPDGNNA-SLYDGGGM-GMIN  259



>ref|XP_009378497.1| PREDICTED: NAC domain-containing protein 18-like [Pyrus x bretschneideri]
Length=368

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  G QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN  N+     
Sbjct  108  YWKATGTDKPVLTSGGIQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKPNN-----  162

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              +P G D+ NKK+SLRLDDWVLCRI+KKN +  P++
Sbjct  163  --KPPGWDLGNKKNSLRLDDWVLCRIYKKNNTHSPMD  197



>ref|XP_008452274.1| PREDICTED: NAC transcription factor 25-like [Cucumis melo]
Length=353

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 8/117 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP+L  +G+ QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        
Sbjct  95   YWKATGTDKPVLAADGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN------KP  148

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
              ++P G D+ NKK+SL+LDDWVLCRI+KKN S RP++   R D  E+   +   SL
Sbjct  149  CINKPPGYDLANKKNSLKLDDWVLCRIYKKNNSHRPMDQ-EREDSMEEMIGSIPHSL  204



>ref|XP_004174082.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor 25-like, 
partial [Cucumis sativus]
Length=333

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 8/117 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP+L  +G+ QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        
Sbjct  76   YWKATGTDKPVLASDGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN------KP  129

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
              ++P G D+ NKK+SL+LDDWVLCRI+KKN S RP++   R D  E+   +   SL
Sbjct  130  CINKPPGYDLANKKNSLKLDDWVLCRIYKKNNSHRPMDQ-EREDSMEEMIGSIPHSL  185



>ref|XP_010686575.1| PREDICTED: NAC transcription factor 25-like [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 136/252 (54%), Gaps = 14/252 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG QK GVKKALVFY GKPP+G+KT+W+MHEYR    ++++ + S 
Sbjct  95   YWKATGTDKPILTSNGNQKVGVKKALVFYGGKPPRGIKTDWIMHEYR----IIDANSTSK  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
               PL D   +KK+SLRLDDWVLCRI+KKN + R ++   R D  E+           C 
Sbjct  151  LPHPLVDH-PSKKASLRLDDWVLCRIYKKNNTQRTMDH-ERDDLIEEMIKHQKLMRTICP  208

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCMAMG  541
               +   + N+               + H+LY+   M G  +  +       D    ++G
Sbjct  209  KNTTSMMDHNNNDQNLFDLSQLGTSTSRHDLYD---MQGNDHKRELPVSLYWDDQMGSIG  265

Query  542  ITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSP--NDSATLNNNVQTGLGV-SI  712
             ++   R        +   +      S+SF+S+L+QL    N++ T+  ++ + L V +I
Sbjct  266  SSSG--RRFHHPQSDQTTGSTGTDGNSSSFVSMLSQLPQGINNTTTVPFSMGSPLLVGNI  323

Query  713  AEGVLHQPYQLS  748
             +GVL  P+QLS
Sbjct  324  GDGVLRPPFQLS  335



>ref|NP_188170.1| NAC domain containing protein 2 [Arabidopsis thaliana]
 gb|AAF35417.1| putative jasmonic acid regulatory protein [Arabidopsis thaliana]
 dbj|BAB20600.1| AtNAC2 [Arabidopsis thaliana]
 dbj|BAB02380.1| jasmonic acid regulatory protein-like [Arabidopsis thaliana]
 gb|AAO42106.1| putative jasmonic acid regulatory protein [Arabidopsis thaliana]
 gb|AAO50577.1| putative jasmonic acid regulatory protein [Arabidopsis thaliana]
 gb|AEE75684.1| NAC domain containing protein 2 [Arabidopsis thaliana]
Length=364

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 90/139 (65%), Gaps = 8/139 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL +N  N+     
Sbjct  97   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIENKPNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D  NKK+SLRLDDWVLCRI+KKN +SR V++    D  +        SL    
Sbjct  152  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNASRHVDNDKDHDMIDYIFRKIPPSLSMAA  209

Query  362  GGGSDHQNPNSRASRGLSF  418
                 HQ+ +   SR ++F
Sbjct  210  ASTGLHQH-HHNVSRSMNF  227



>ref|XP_004149287.1| PREDICTED: NAC transcription factor 25-like [Cucumis sativus]
 gb|KGN56220.1| hypothetical protein Csa_3G100800 [Cucumis sativus]
Length=353

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 8/117 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP+L  +G+ QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN        
Sbjct  96   YWKATGTDKPVLASDGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADN------KP  149

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
              ++P G D+ NKK+SL+LDDWVLCRI+KKN S RP++   R D  E+   +   SL
Sbjct  150  CINKPPGYDLANKKNSLKLDDWVLCRIYKKNNSHRPMDQ-EREDSMEEMIGSIPHSL  205



>ref|XP_004487678.1| PREDICTED: NAC domain-containing protein 18-like [Cicer arietinum]
Length=356

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 80/108 (74%), Gaps = 9/108 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPP+G+KTNW+MHEYRL DN  N+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRLADNKPNN-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK-NGSSRPVESGGRGDPTED  322
              RP G D+ NKK+SLRLDDWVLCRI+KK N    PVE   R D  +D
Sbjct  150  --RPPGCDLGNKKNSLRLDDWVLCRIYKKSNTHWSPVEH-DREDSMDD  194



>gb|ACE97094.1| NAC domain protein [Populus tremula]
 gb|ACE97098.1| NAC domain protein [Populus tremula]
Length=199

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 96/151 (64%), Gaps = 17/151 (11%)
 Frame = +2

Query  14   TGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASSAHRP  193
            TGTDKP+L+  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN       ++P
Sbjct  1    TGTDKPVLSSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVN-------NKP  53

Query  194  LGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGCGGGG  370
             G D+ NKK+SLRLDDWVLCRI+KKN + RP++        +   ++  S S+       
Sbjct  54   PGCDLGNKKNSLRLDDWVLCRIYKKNNTQRPMDHDKDDSMDDVLGSIPPSISV-------  106

Query  371  SDHQNPNSRASRGLSFGDFFEINNAHNLYNG  463
              HQN     ++G +F     ++N  NL+ G
Sbjct  107  GSHQNGTLHLAKGTNFEAL--LDNDQNLFEG  135



>ref|XP_006406961.1| hypothetical protein EUTSA_v10022353mg [Eutrema salsugineum]
 dbj|BAJ34312.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48414.1| hypothetical protein EUTSA_v10022353mg [Eutrema salsugineum]
Length=364

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 75/97 (77%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  G QK GVKKALVFY GKPPKG+K++W+MHEYRL DN  N+     
Sbjct  97   YWKATGTDKPVLTSEGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDNKPNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              RP G D  NKK+SLRLDDWVLCRI+KKN + R V+
Sbjct  152  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNAGRHVD  186



>emb|CDY20131.1| BnaA01g28710D [Brassica napus]
Length=350

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 75/97 (77%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL DN  N      
Sbjct  97   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDNKPN------  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
             +RP G D  NKK+SLRLDDWVLCRI+KKN + R VE
Sbjct  151  -NRPPGCDYGNKKNSLRLDDWVLCRIYKKNNAGRHVE  186



>gb|AID55349.1| NAC protein 2 [Actinidia arguta]
Length=316

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 74/99 (75%), Gaps = 7/99 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT +GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN   S     
Sbjct  95   YWKATGTDKPVLTSSGTQKVGVKKALVFYLGKPPKGVKTNWIMHEYRLIDNEAKS-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESG  298
              +P G D  + K SLRLD+WVLCRI+KKN   R ++ G
Sbjct  150  --KPPGYDAGHNKGSLRLDEWVLCRIYKKNNPPRAIDDG  186



>ref|XP_006297968.1| hypothetical protein CARUB_v10014008mg [Capsella rubella]
 gb|EOA30866.1| hypothetical protein CARUB_v10014008mg [Capsella rubella]
Length=366

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 89/135 (66%), Gaps = 9/135 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL +N +N+     
Sbjct  97   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIENKLNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDA--TVATSTSLDG  355
              RP G D  NKK+SLRLDDWVLCRI+KKN + R V++    D  +     +  S S+  
Sbjct  152  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSLSMAA  209

Query  356  CGGGGSDHQNPNSRA  400
               G   H +  SR+
Sbjct  210  TATGLHHHHHNVSRS  224



>ref|XP_010503061.1| PREDICTED: NAC domain-containing protein 18-like [Camelina sativa]
Length=344

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 89/139 (64%), Gaps = 8/139 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL +N +N+     
Sbjct  97   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIENKLNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D  NKK+SLRLDDWVLCRI+KKN + R V++    D  +        SL    
Sbjct  152  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSLSMAA  209

Query  362  GGGSDHQNPNSRASRGLSF  418
                 H + +   SR ++F
Sbjct  210  AATGLHHH-HHNVSRSMNF  227



>gb|EPS69130.1| hypothetical protein M569_05637, partial [Genlisea aurea]
Length=188

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP++T  GT++ GVKKALVFY GKPP+G+K+NW+MHEYRL DN         
Sbjct  94   YWKATGTDKPVMTSGGTERVGVKKALVFYNGKPPRGIKSNWIMHEYRLVDN------NKP  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVES  295
            + +P G DI NKK+SLRLDDWVLCRI++KN   R ++ 
Sbjct  148  SSKPPGCDIANKKTSLRLDDWVLCRIYQKNNLQRAMDQ  185



>emb|CDX97675.1| BnaA05g24040D [Brassica napus]
Length=343

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL DN  N+     
Sbjct  98   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIDNKPNN-----  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              RP G D  NKK+SLRLDDWVLCRI+KKN + R V+
Sbjct  153  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNAGRHVD  187



>gb|AAU43923.2| NAC domain protein [Solanum lycopersicum]
Length=355

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 9/99 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+ T  GTQK GVKKALVFY GKPPKG+KTNW+MHEYR+ +N  N+     
Sbjct  96   YWKATGTDKPVFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVENKTNN-----  150

Query  182  AHRPLGDD--IVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              +PLG D  + NKK SLRLDDWVLCRI+KKN + R ++
Sbjct  151  --KPLGCDNIVANKKGSLRLDDWVLCRIYKKNNTQRSID  187



>ref|XP_006451941.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 ref|XP_006464707.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|ESR65181.1| hypothetical protein CICLE_v10008628mg [Citrus clementina]
 gb|KDO74152.1| hypothetical protein CISIN_1g016791mg [Citrus sinensis]
Length=382

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 7/96 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+++    QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN V       
Sbjct  96   YWKATGTDKPVMSSGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDNKV-------  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
            +++P G D+ NKK+SLRLDDWVLCRI+KKN   RP+
Sbjct  149  SNKPPGCDLGNKKNSLRLDDWVLCRIYKKNNLHRPL  184



>ref|NP_001234652.1| NAC domain protein [Solanum lycopersicum]
 gb|AAU43922.1| NAC domain protein [Solanum lycopersicum]
Length=355

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 9/99 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+ T  GTQK GVKKALVFY GKPPKG+KTNW+MHEYR+ +N  N+     
Sbjct  96   YWKATGTDKPVFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVENKTNN-----  150

Query  182  AHRPLGDD--IVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              +PLG D  + NKK SLRLDDWVLCRI+KKN + R ++
Sbjct  151  --KPLGCDNIVANKKGSLRLDDWVLCRIYKKNNTQRSID  187



>ref|XP_002882948.1| ATNAC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59207.1| ATNAC2 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL +N  N+     
Sbjct  97   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIENKPNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              RP G D  NKK+SLRLDDWVLCRI+KKN +SR V+
Sbjct  152  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNASRHVD  186



>ref|XP_009146237.1| PREDICTED: NAC domain-containing protein 18 [Brassica rapa]
Length=351

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL DN  N+     
Sbjct  98   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIDNKPNN-----  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D  NKK+SLRLDDWVLCRI+KKN + R V++    D  +        SL    
Sbjct  153  --RPPGCDFGNKKNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPPSLSMTA  210

Query  362  GGGSDHQNPNSRASRGLSF---GDFFEINNAHNLYNGTMM  472
                 H N     SR ++F   G     +    LYNG+ M
Sbjct  211  ATTGLHHN----VSRSMNFFPGGYGIFPDGDPGLYNGSGM  246



>ref|XP_009379434.1| PREDICTED: NAC transcription factor 25 [Pyrus x bretschneideri]
Length=374

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G    GVKKALVFY GKPPKG+KTNW+MHEYRL +N   +  + S
Sbjct  95   YWKATGTDKPILTSIGNHNVGVKKALVFYGGKPPKGIKTNWIMHEYRLINNTTTANMSFS  154

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVES  295
              +P   D  NKK+SLRLDDWVLCR++KKN + RP  S
Sbjct  155  TTKP--SDAANKKASLRLDDWVLCRVYKKNNAQRPTMS  190



>ref|XP_007159283.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
 gb|ESW31277.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
Length=350

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT +G QK GVKKALVFY GKPPKG+KTNW+MHEYRL   V +S  ++S
Sbjct  95   YWKATGTDKPILTSDGHQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL---VHDSFNSTS  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS----RPVESGGRGDPTEDATVATSTSL  349
               PL     NKK+SLRLD+WVLCRI+KK+ SS     P+   G     E+     ST  
Sbjct  152  KPPPLVPP--NKKNSLRLDNWVLCRIYKKSNSSILTRPPLMEQGEELSMENMLPTMST--  207

Query  350  DGCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM  469
                   ++ QN   ++SRG S+G    + N  N ++G +
Sbjct  208  --LSMANNNTQNSKPQSSRGTSYGP-LGLENDDNFFDGIL  244



>gb|KFK38893.1| hypothetical protein AALP_AA3G174600 [Arabis alpina]
Length=342

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 74/97 (76%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L   G QK GVKKALVFY GKPPKG+K++W+MHEYRL DN  N+     
Sbjct  96   YWKATGTDKPVLASEGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRLIDNKPNN-----  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              RP G D  NKK+SLRLDDWVLCRI+KKN + R V+
Sbjct  151  --RPPGCDYGNKKNSLRLDDWVLCRIYKKNNAGRHVD  185



>emb|CDY56427.1| BnaCnng30350D [Brassica napus]
Length=327

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 75/97 (77%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL DN  N      
Sbjct  97   YWKATGTDKPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDNKPN------  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
             +RP G D  NKK+SLRLDDWVLCRI+KKN + R V+
Sbjct  151  -NRPPGCDYGNKKNSLRLDDWVLCRIYKKNNAGRHVD  186



>ref|NP_001281058.1| NAC transcription factor 25-like [Malus domestica]
 gb|ADL36805.1| NAC domain class transcription factor [Malus domestica]
Length=373

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G    GVKKALVFY GKPPKG+KTNW+MHEYRL +N   +  + S
Sbjct  95   YWKATGTDKPILTSIGNHNVGVKKALVFYGGKPPKGIKTNWIMHEYRLINNTTTANMSFS  154

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVES  295
              +P   D  NKK+SLRLDDWVLCR++KKN + RP  S
Sbjct  155  TTKP--SDAANKKASLRLDDWVLCRVYKKNNAQRPTMS  190



>gb|AID55353.1| NAC protein 2 [Actinidia chinensis]
Length=315

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 6/97 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT +G QK GVKKALVFYRGKPPKG+KTNW+MHEYR+ DN   S     
Sbjct  95   YWKATGTDKPVLTSSGNQKVGVKKALVFYRGKPPKGVKTNWIMHEYRIIDNEAKSKP---  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
               P G D  + K SLRLDDWVLCRI+KKN   R ++
Sbjct  152  ---PPGYDAGHNKGSLRLDDWVLCRIYKKNNPPRTID  185



>ref|XP_006362947.1| PREDICTED: NAC transcription factor 25-like [Solanum tuberosum]
Length=351

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 75/99 (76%), Gaps = 9/99 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI T  GTQK GVKKALVFY GKPPKG+KTNW+MHEYR+ +N  N+     
Sbjct  96   YWKATGTDKPIFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVENKTNN-----  150

Query  182  AHRPLGDD--IVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              +P G D  + NKK SLRLDDWVLCRI+KKN + R ++
Sbjct  151  --KPPGCDHIVANKKGSLRLDDWVLCRIYKKNNTQRSID  187



>gb|EYU27944.1| hypothetical protein MIMGU_mgv1a020591mg, partial [Erythranthe 
guttata]
Length=304

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 76/106 (72%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT NG Q  GVKKALVFY GKPPKG+K+NW+MHEYRL D        S+
Sbjct  93   YWKATGTDKPILTANGAQTVGVKKALVFYGGKPPKGIKSNWIMHEYRLVDG------NSA  146

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK--NGSSRPVESGGRGDP  313
            A +  G   +  K+S RLDDWVLCRIFKK  +G++RPVE   +  P
Sbjct  147  AKKTPGIAFIGNKTSSRLDDWVLCRIFKKSNSGTTRPVEESMQSSP  192



>gb|ACJ14498.1| mutant NAC domain protein [Solanum lycopersicum]
Length=355

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 75/99 (76%), Gaps = 9/99 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP  T  GTQK GVKKALVFY GKPPKG+KTNW+MHEYR+ +N  N+     
Sbjct  96   YWKATGTDKPDFTSGGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRVVENKTNN-----  150

Query  182  AHRPLGDD--IVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
              +PLG D  + NKK SLRLDDWVLCRI+KKN + R ++
Sbjct  151  --KPLGCDNIVANKKGSLRLDDWVLCRIYKKNNTQRSID  187



>emb|CDX82430.1| BnaA03g33910D [Brassica napus]
Length=199

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 73/94 (78%), Gaps = 7/94 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G  K GVKKALVFY GKPPKG+K++W+MHEYRL DN  N+     
Sbjct  97   YWKATGTDKPVLASDGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDNKPNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR  283
              RP G D  NK++SLRLDDWVLCRI+KKN +SR
Sbjct  152  --RPPGCDFGNKRNSLRLDDWVLCRIYKKNNASR  183



>ref|XP_010545895.1| PREDICTED: NAC domain-containing protein 18-like, partial [Tarenaya 
hassleriana]
Length=305

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 73/96 (76%), Gaps = 7/96 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPIL+  G+ K GVKKALVFY GKPPKG+KT+W+MHEYRL DN  N      
Sbjct  45   YWKATGTDKPILSSGGSHKVGVKKALVFYGGKPPKGVKTDWIMHEYRLADNKSN------  98

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
             +RP   D  NKK+SLRLDDWVLCRI+KKN + R V
Sbjct  99   -NRPPVFDFGNKKNSLRLDDWVLCRIYKKNNTGRHV  133



>ref|XP_010921105.1| PREDICTED: NAC transcription factor NAM-B2-like [Elaeis guineensis]
Length=389

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 72/93 (77%), Gaps = 5/93 (5%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL D+  +S     
Sbjct  96   YWKATGTDKPILTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADSSPSSSARPP  155

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
                 G D+ +KK SLRLDDWVLCRI+KKN SS
Sbjct  156  -----GGDVGSKKGSLRLDDWVLCRIYKKNSSS  183



>ref|XP_008799210.1| PREDICTED: NAC transcription factor 25-like isoform X1 [Phoenix 
dactylifera]
Length=414

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 70/89 (79%), Gaps = 5/89 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL D      + SS
Sbjct  100  YWKATGTDKPILTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDT-----SPSS  154

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
              RP   D+ +KK SLRLDDWVLCRI+KK
Sbjct  155  NSRPPCGDVGSKKGSLRLDDWVLCRIYKK  183



>ref|XP_007211453.1| hypothetical protein PRUPE_ppa007314mg [Prunus persica]
 gb|EMJ12652.1| hypothetical protein PRUPE_ppa007314mg [Prunus persica]
Length=373

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 80/116 (69%), Gaps = 8/116 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G QK GVKKALVFY GKPPKG+K+NW+MHEYRL +N  N      
Sbjct  96   YWKATGTDKPILTSIGNQKVGVKKALVFYGGKPPKGIKSNWIMHEYRLVNNNNN------  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
              +P   D  NKK+SLRLDDWVLCRI+KKN + RP+      + + D   A  +S+
Sbjct  150  FSKP--PDASNKKASLRLDDWVLCRIYKKNNAQRPMMDEDSSNNSMDGMFAHPSSI  203



>ref|XP_010535118.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana]
Length=339

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 73/96 (76%), Gaps = 7/96 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L+  GT K GVKKALVFY GKPPKG+KT+WVMHEYRL +N        S
Sbjct  98   YWKATGTDKPVLSSGGTHKVGVKKALVFYGGKPPKGVKTDWVMHEYRLVEN-------KS  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
            ++R  G D  NKK SLRLDDWVLCRI+KKN + R V
Sbjct  151  SNRHPGYDFGNKKQSLRLDDWVLCRIYKKNNTGRHV  186



>ref|XP_010542275.1| PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 
18 [Tarenaya hassleriana]
Length=345

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 7/96 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPIL   G QK GVKKALVFY GKPPKG+KT+W+MHEYRL D         S
Sbjct  101  YWKATGTDKPILASGGNQKVGVKKALVFYGGKPPKGVKTDWIMHEYRLAD-------TKS  153

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
             +RP G +  NKK+SLRLDDWVLCRI+KKN + R V
Sbjct  154  INRPPGCNFGNKKNSLRLDDWVLCRIYKKNNTGRHV  189



>ref|XP_008224995.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=371

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 5/96 (5%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G QK GVKKALVFY GKPPKG+K+NW+MHEYRL   V N+   ++
Sbjct  96   YWKATGTDKPILTSIGNQKVGVKKALVFYGGKPPKGIKSNWIMHEYRL---VNNNNNNNN  152

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
              +P   D  NKK+SLRLDDWVLCRI+KKN + RP+
Sbjct  153  FSKP--PDASNKKASLRLDDWVLCRIYKKNNAQRPM  186



>gb|KEH31125.1| NAC transcription factor-like protein [Medicago truncatula]
Length=344

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRL--PDNVVNSMTA  175
            YWKATGTDKPILT +G QK GVKKALVFY GKPPKG+KTNW+MHEYRL    N  +S  A
Sbjct  95   YWKATGTDKPILTSDGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRLITDHNNHHSYNA  154

Query  176  SSAHRPLGDDIV---NKKSSLRLDDWVLCRIFKKNGSS---RPV  289
            +S   PL  D     NKK+SLRLDDWVLCRI+KK+ SS   RP+
Sbjct  155  TSKTPPLPSDHPPNNNKKNSLRLDDWVLCRIYKKSNSSNMPRPL  198



>ref|XP_003528438.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
 gb|KHN07294.1| NAC domain-containing protein 18 [Glycine soja]
Length=362

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 97/159 (61%), Gaps = 13/159 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G  K GVKKALVFY GKPPKG+KTNW+MHEYRL D+  NS   SS
Sbjct  95   YWKATGTDKPILTTYGHHKVGVKKALVFYGGKPPKGVKTNWIMHEYRLVDDSFNS---SS  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS---RPVESGGRGDPTEDATVATSTSLD  352
               PL     NKK+SLRLDDWVLCRI+KK+ ++   RP       + + D  + T ++L 
Sbjct  152  KPPPLVPH--NKKNSLRLDDWVLCRIYKKSNNTTLPRPPMMEHEEELSMDNMLPTMSTL-  208

Query  353  GCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM  469
                  +  QNP    SR  S+G    + N  N + G +
Sbjct  209  --SMANNKMQNPKP-PSRSTSYGP-LGLENDDNFFEGVL  243



>ref|XP_007133059.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
 gb|ESW05053.1| hypothetical protein PHAVU_011G148000g [Phaseolus vulgaris]
Length=356

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 96/167 (57%), Gaps = 15/167 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI  C+G QK GVKK+LVFY GKPPKG+KT+W+MHEYRL +   N+     
Sbjct  97   YWKATGTDKPI--CSGIQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRLAETKPNN-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D+ +KK+SLRLDDWVLCRI+KK  + R      R D  +D       S++   
Sbjct  150  --RPPGCDLGHKKNSLRLDDWVLCRIYKKGNTQRSPMDHERDDSMDDMIGEVPPSIN---  204

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTS  502
                 H N     S+  +      + N  N   G ++  G+NG  T+
Sbjct  205  ---VGHMNARFHLSKMSTNYSGALLENDRNTLEGVVIGNGVNGISTT  248



>ref|XP_004505006.1| PREDICTED: NAC transcription factor 25-like [Cicer arietinum]
Length=364

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (79%), Gaps = 5/98 (5%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRL---PDNVVNSMT  172
            YWKATGTDKPILT +G  K GVKKALVFY GKPPKG+KTNW+MHEYRL    ++ ++S  
Sbjct  95   YWKATGTDKPILTTDGHMKVGVKKALVFYGGKPPKGVKTNWIMHEYRLITDHNHNIHSYN  154

Query  173  ASSAHRPLGDDI--VNKKSSLRLDDWVLCRIFKKNGSS  280
            A+S   PL  D   +NKK+SLRLDDWVLCRI+KK+ SS
Sbjct  155  ATSKTPPLPADPPNLNKKNSLRLDDWVLCRIYKKSNSS  192



>ref|XP_008800137.1| PREDICTED: NAC transcription factor 25 [Phoenix dactylifera]
Length=394

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 70/92 (76%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G  K GVKKALVFY GKPPKG+KT+W+MHEYRL D+     +  S
Sbjct  97   YWKATGTDKPILTSGGAHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLADS-----SPGS  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGS  277
              RP G    +KKSSLRLDDWVLCRI+KKN +
Sbjct  152  TFRPPGSAAGSKKSSLRLDDWVLCRIYKKNST  183



>emb|CDY12886.1| BnaA09g13880D [Brassica napus]
Length=321

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +N     +
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNLN-----T  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A +P  D   ++K+SLRLDDWVLCRI+KKN S RP
Sbjct  150  AAKP-PDSTTSRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|XP_009113148.1| PREDICTED: NAC transcription factor 25 [Brassica rapa]
Length=322

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +N     +
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNLN-----T  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A +P  D   ++K+SLRLDDWVLCRI+KKN S RP
Sbjct  150  AAKP-PDSTTSRKNSLRLDDWVLCRIYKKNSSQRP  183



>emb|CDY40970.1| BnaCnng10130D [Brassica napus]
Length=322

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +N     +
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNLN-----T  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A +P  D   ++K+SLRLDDWVLCRI+KKN S RP
Sbjct  150  AAKP-PDSTTSRKNSLRLDDWVLCRIYKKNSSQRP  183



>gb|KFK42926.1| hypothetical protein AALP_AA1G056200 [Arabis alpina]
Length=324

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +    +++
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNL----STT  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A  P  D +  +K+SLRLDDWVLCRI+KKN S RP
Sbjct  151  AKPP--DPVTTRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|XP_010675608.1| PREDICTED: NAC transcription factor 25 [Beta vulgaris subsp. 
vulgaris]
Length=410

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L+ +G+QK GVKKALVFY GKPP+G+KTNW+MHEYRL DN  N+     
Sbjct  104  YWKATGTDKPVLS-SGSQKVGVKKALVFYGGKPPRGVKTNWIMHEYRLVDNKPNNKP---  159

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
               P  D   NKK SLRLDDWVLCRI+KKN ++RP++
Sbjct  160  ---PAYDLCHNKKGSLRLDDWVLCRIYKKNNTNRPMD  193



>ref|NP_564771.1| NAC domain containing protein 25 [Arabidopsis thaliana]
 sp|Q8GY42.1|NAC25_ARATH RecName: Full=NAC transcription factor 25; Short=AtNAC025 [Arabidopsis 
thaliana]
 dbj|BAC42518.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37705.1| At1g61110 [Arabidopsis thaliana]
 gb|AEE33783.1| NAC domain containing protein 25 [Arabidopsis thaliana]
Length=323

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D        S+
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG-----NLST  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A +P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  150  AAKP-PDLTTTRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|XP_002888109.1| ANAC025 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64368.1| ANAC025 [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +    +++
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNL----STA  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A +P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  151  AKQP--DLATTRKNSLRLDDWVLCRIYKKNSSQRP  183



>gb|AAM65392.1| NAM protein, putative [Arabidopsis thaliana]
Length=323

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D        S+
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG-----NLST  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A +P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  150  AAKP-PDLTTTRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|NP_001280970.1| NAC transcription factor 25-like [Malus domestica]
 gb|ADL36800.1| NAC domain class transcription factor [Malus domestica]
Length=366

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSM-TAS  178
            YWKATGTDKP+L+  G  K GVKKALVFY GKPPKG KTNW+MHEYRL +N   ++  +S
Sbjct  95   YWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTKTNWIMHEYRLVNNTTTTINMSS  154

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKN  271
            S  +P   D  NKK SLRLDDWVLCRI+KKN
Sbjct  155  STTKP--SDAANKKPSLRLDDWVLCRIYKKN  183



>gb|AAB71483.1| similar to NAM (gp|X92205|1321924) and CUC2 (gp|AB002560|1944132) 
proteins [Arabidopsis thaliana]
Length=300

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D        S+
Sbjct  93   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG-----NLST  146

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A +P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  147  AAKP-PDLTTTRKNSLRLDDWVLCRIYKKNSSQRP  180



>ref|XP_003541120.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN48759.1| NAC domain-containing protein 18 [Glycine soja]
Length=360

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 12/107 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI  C+GTQK GVKK+LVFY GKPPKG+KT+W+MHEYR+ +N  N+     
Sbjct  97   YWKATGTDKPI--CSGTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRVTENKPNN-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED  322
              RP G D+ +KK+SLRLDDWVLCRI+KK  + R  E   R D  +D
Sbjct  150  --RPPGCDLGHKKNSLRLDDWVLCRIYKKGNTQRSHE---RDDSIDD  191



>ref|XP_006392059.1| hypothetical protein EUTSA_v10023591mg [Eutrema salsugineum]
 gb|ESQ29345.1| hypothetical protein EUTSA_v10023591mg [Eutrema salsugineum]
Length=325

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +    +++
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNL----STT  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A  P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  151  AKPP--DSATTRKNSLRLDDWVLCRIYKKNSSQRP  183



>gb|ACN62416.1| NAC transcription factor [Lepidium latifolium]
Length=360

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 87/139 (63%), Gaps = 13/139 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTD+P+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL +N       +S
Sbjct  99   YWKATGTDRPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN-------NS  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             +RP G D  N K+SLRLDDWVLCRI+KKN + R V++    D  +        SL    
Sbjct  152  NNRPPGCDFGN-KNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPLSLSMAA  210

Query  362  GGGSDHQNPNSRASRGLSF  418
              G  H       SR ++F
Sbjct  211  ASGLHHN-----VSRSMNF  224



>gb|ACJ48971.1| cold stress-induced NAC domain protein [Lepidium latifolium]
Length=360

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 87/139 (63%), Gaps = 13/139 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTD+P+L  +G QK GVKKALVFY GKPPKG+K++W+MHEYRL +N       +S
Sbjct  99   YWKATGTDRPVLASDGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIEN-------NS  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             +RP G D  N K+SLRLDDWVLCRI+KKN + R V++    D  +        SL    
Sbjct  152  NNRPPGCDFGN-KNSLRLDDWVLCRIYKKNNAGRHVDNDKDHDMIDYIFRKIPLSLSMAA  210

Query  362  GGGSDHQNPNSRASRGLSF  418
              G  H       SR ++F
Sbjct  211  ASGLHHN-----VSRSMNF  224



>ref|XP_007148205.1| hypothetical protein PHAVU_006G188900g [Phaseolus vulgaris]
 gb|ESW20199.1| hypothetical protein PHAVU_006G188900g [Phaseolus vulgaris]
Length=355

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 131/264 (50%), Gaps = 29/264 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTD+PIL  +G  K GVKKALVFY GKPPKG+KTNW+MHEYRL     NS T+  
Sbjct  98   YWKATGTDRPILASHGHHKVGVKKALVFYGGKPPKGVKTNWIMHEYRLISTSSNS-TSKP  156

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS----RPVESGGRGDPTEDATVATSTSL  349
               P       KK+SLRLDDWVLCRI+KKN S+     P+    +   +E   V   ++L
Sbjct  157  PSLPADHARSTKKNSLRLDDWVLCRIYKKNNSTIMPRFPLMEQNKELSSESTMVPMMSTL  216

Query  350  DGCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTC  529
                   +  QN  +  S   S+G    + N  NL++G +   G++ +    D       
Sbjct  217  SMANNNTT--QNSKAGTSTSASYGP-LGLENDDNLFDGIL---GVDHSMQQ-DVSDSHQV  269

Query  530  MAMGITAAPPRIdedhhhheaannna------------IMEGSNSFISLLNQLSPNDSAT  673
             + GI      +     +   +++++             +E  NSF+S+L+QL  N    
Sbjct  270  SSKGIYPVKRALSSQFWNDTGSSSSSRRFHCDLNAGSNTVEEDNSFVSMLSQLPQNTGFH  329

Query  674  LNNNVQTGLGVSIAEGVLHQPYQL  745
             N      L   ++  VL Q +QL
Sbjct  330  PN-----ALLGPVSNDVLRQQFQL  348



>gb|AGS08767.1| NAC domain protein [Malus hupehensis]
Length=393

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSM-TAS  178
            YWKATGTDKP+L+  G  K GVKKALVFY GKPPKG KTNW+MHEYRL +N   ++  +S
Sbjct  139  YWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTKTNWIMHEYRLVNNTTTTINMSS  198

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKN  271
            S  +P   D  NKK SLRLDDWVLCRI+KKN
Sbjct  199  STTKP--SDAANKKPSLRLDDWVLCRIYKKN  227



>ref|NP_001274379.1| NAC domain-containing protein 18-like [Glycine max]
 gb|AHB63578.1| NAC transcription factor [Glycine max]
Length=368

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 99/167 (59%), Gaps = 19/167 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI  C+GTQK GVKK+LVFY GKPPKG+KT+W+MHEYR+ +N  N+     
Sbjct  98   YWKATGTDKPI--CSGTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRVAENKPNN-----  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D+ +KK+SLRLDDWVLCRI+KK  + R   S  R D  +D       S++   
Sbjct  151  --RPPGCDLGHKKNSLRLDDWVLCRIYKKGNTQR---SHERDDSMDDMIGEVPPSINVGH  205

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMM-SGGINGTQT  499
                 H +  S +  G        + N  N   G ++ +G +NG  T
Sbjct  206  MNARFHLSKMSTSYSGAL------LENDRNTLEGVVIGNGNVNGINT  246



>gb|KHN36348.1| NAC domain-containing protein 18 [Glycine soja]
Length=369

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 99/167 (59%), Gaps = 19/167 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI  C+GTQK GVKK+LVFY GKPPKG+KT+W+MHEYR+ +N  N+     
Sbjct  99   YWKATGTDKPI--CSGTQKVGVKKSLVFYGGKPPKGVKTDWIMHEYRVAENKPNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
              RP G D+ +KK+SLRLDDWVLCRI+KK  + R   S  R D  +D       S++   
Sbjct  152  --RPPGCDLGHKKNSLRLDDWVLCRIYKKGNTQR---SHERDDSMDDMIGEVPPSINVGH  206

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMM-SGGINGTQT  499
                 H +  S +  G        + N  N   G ++ +G +NG  T
Sbjct  207  MNARFHLSKMSTSYSGAL------LENDRNTLEGVVIGNGNVNGINT  247



>ref|XP_010430102.1| PREDICTED: NAC transcription factor 25 [Camelina sativa]
Length=324

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +    +++
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNL----STT  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A  P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  151  AKPP--DIATTRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|XP_006300981.1| hypothetical protein CARUB_v10021371mg [Capsella rubella]
 gb|EOA33879.1| hypothetical protein CARUB_v10021371mg [Capsella rubella]
Length=324

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D  +    +++
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDGNL----SNT  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
            A  P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  151  AKPP--DIATTRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|XP_010473311.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=328

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 71/95 (75%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D        S+
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG-----NLST  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
              +P G     +K+SLRLDDWVLCRI+KKN S RP
Sbjct  150  TAKPPG-IATTRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|XP_009135446.1| PREDICTED: NAC domain-containing protein 18-like [Brassica rapa]
Length=350

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 7/96 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+L  +G  K GVKKALVFY GKPPKG+K++W+MHEYRL DN  N      
Sbjct  97   YWKATGTDKPVLASDGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDNKPN------  150

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
             +RP G D  NK++SLRL DWVLCR +KKN +SR V
Sbjct  151  -NRPPGCDFGNKRNSLRLGDWVLCRSYKKNNASRHV  185



>ref|XP_010052353.1| PREDICTED: NAC transcription factor 25-like [Eucalyptus grandis]
 gb|KCW76294.1| hypothetical protein EUGRSUZ_D00665 [Eucalyptus grandis]
Length=343

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 68/97 (70%), Gaps = 7/97 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI    G  K GVKKALVFYRGKPPKG KT+W+MHEYR  D        +S
Sbjct  95   YWKATGTDKPIFASTGKCKVGVKKALVFYRGKPPKGTKTDWIMHEYRFTD-------GNS  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
            A +P   D  +KK SLRLDDWVLCRI+KK+   R VE
Sbjct  148  APKPPKADSASKKGSLRLDDWVLCRIYKKSSPVRLVE  184



>ref|XP_010418059.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=340

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 71/95 (75%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI TCN + K GVKKALVFY GKPPKG+KT+W+MHEYRL D        S+
Sbjct  96   YWKATGTDKPIFTCN-SHKVGVKKALVFYGGKPPKGIKTDWIMHEYRLTDG-----NLST  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
              +P  D    +K+SLRLDDWVLCRI+KKN S RP
Sbjct  150  TPKP-PDIATTRKNSLRLDDWVLCRIYKKNSSQRP  183



>ref|NP_001284435.1| NAC domain-containing protein 18-like [Cucumis melo]
 gb|ABM88940.1| NAC transcription factor [Cucumis melo]
Length=318

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 76/104 (73%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP++ +  G +K GVKKALVFY GKPPKG+KTNW+MHEYRL D   N     
Sbjct  97   YWKATGTDKPVIASSEGNRKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD---NKSGGG  153

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGD  310
            + ++P G  I  KK+SLRLDDWVLCRI+KKN S++P     R D
Sbjct  154  NNNKPPGFIIGGKKNSLRLDDWVLCRIYKKNNSNKPGTDHERED  197



>emb|CDY22671.1| BnaC08g43050D [Brassica napus]
Length=199

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 7/94 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDK +L  +G  K GVKKALVFY GKPPKG+K++W+MHEYRL DN  N+     
Sbjct  97   YWKATGTDKLVLASDGKLKVGVKKALVFYSGKPPKGVKSDWIMHEYRLIDNKPNN-----  151

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR  283
              RP G    NK++SLRLDDWVLCRI+KKN +SR
Sbjct  152  --RPPGCVFGNKRNSLRLDDWVLCRIYKKNNASR  183



>ref|XP_009392346.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQ-KAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP+LT  G+Q K GVKKALVFYRG+PP+G KTNW+MHEYRL D      ++S
Sbjct  101  YWKATGTDKPVLTSGGSQVKVGVKKALVFYRGRPPRGTKTNWIMHEYRLADGSSPENSSS  160

Query  179  SAHR-PLGDDIVNKKS--SLRLDDWVLCRIFKKNGS  277
            S+ R P G  + NKK   SLRLDDWVLCRI+KKN S
Sbjct  161  SSCRPPYGGHMANKKKGGSLRLDDWVLCRIYKKNNS  196



>ref|XP_004172388.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor ONAC010-like 
[Cucumis sativus]
Length=318

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP++ +  G +K GVKKALVFY GKPPKG+KTNW+MHEYRL D   N     
Sbjct  97   YWKATGTDKPVIASSEGNRKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD---NKSGGG  153

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGD  310
            + ++P G +I  KK+SLRLDDWVLCRI+KK  S++P     R D
Sbjct  154  NNNKPPGFNIGGKKNSLRLDDWVLCRIYKKTNSNKPGMDHERED  197



>ref|XP_004147807.1| PREDICTED: NAC transcription factor ONAC010-like [Cucumis sativus]
 gb|KGN59897.1| hypothetical protein Csa_3G852460 [Cucumis sativus]
Length=318

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 4/104 (4%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP++ +  G +K GVKKALVFY GKPPKG+KTNW+MHEYRL D   N     
Sbjct  97   YWKATGTDKPVIASSEGNRKVGVKKALVFYGGKPPKGIKTNWIMHEYRLAD---NKSGGG  153

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGD  310
            + ++P G +I  KK+SLRLDDWVLCRI+KK  S++P     R D
Sbjct  154  NNNKPPGFNIGGKKNSLRLDDWVLCRIYKKTNSNKPGMDHERED  197



>gb|AGV29510.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=186

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT--QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTA  175
            YWKATGTDKPIL+ N T  +K GVKKALVFY GKPP+G+KT+W+MHEYRL D+       
Sbjct  85   YWKATGTDKPILSTNDTPPRKVGVKKALVFYGGKPPRGIKTDWIMHEYRLLDSSSGGPPP  144

Query  176  SSAHR---PLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
            +   +   P  D   +KK SLRLDDWVLCRI+KKN + RP E
Sbjct  145  ACLFKSIPPRLDGTDSKKPSLRLDDWVLCRIYKKNNTQRPSE  186



>gb|AIZ97668.1| NAC transcription factor NAM-D2 [Triticum aestivum]
Length=396

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 85/137 (62%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  108  YWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSATTS-  166

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
               RP     V++ +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  167  ---RPPPVTGVSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVTAYP  220

Query  335  --TSTSLDGCGGGGSDH  379
               +  + G G  GS++
Sbjct  221  PYATAGMTGAGAHGSNY  237



>ref|XP_010924066.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=392

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 67/89 (75%), Gaps = 5/89 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  G QK GVKKALVFY GKPPKG+KTNW+MHEYRL D+   S +   
Sbjct  101  YWKATGTDKPILTSRGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADSSPGSSSRPP  160

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
                   D  +++SSLRLDDWVLCRI+KK
Sbjct  161  GC-----DAGSRRSSLRLDDWVLCRIYKK  184



>ref|XP_009392736.1| PREDICTED: NAC domain-containing protein 67-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 83/134 (62%), Gaps = 14/134 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI   +G +  GVKKALVFYRG+PPKG+KTNW+MHEYRL +       AS+
Sbjct  87   YWKATGTDKPIHATHGNESVGVKKALVFYRGRPPKGVKTNWIMHEYRLAE-----AHASN  141

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            ++RP    +    SS+RLDDWVLCRI+KKN   + V       P + A + +++S     
Sbjct  142  SYRP----VKPSDSSMRLDDWVLCRIYKKNNHLQSVPP-----PMDQAQIGSASSSKNSD  192

Query  362  GGGSDHQNPNSRAS  403
               S    P+S  S
Sbjct  193  QQSSLRPQPSSSIS  206



>dbj|BAK04712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 79/130 (61%), Gaps = 8/130 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPIL    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  111  YWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSAATS-  169

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE---SGGRGDPTEDATVATSTSL  349
               RP      ++ +SLRLDDWVLCRI+KK   +   +   S    D  EDA  A     
Sbjct  170  ---RPPPVTGGSRAASLRLDDWVLCRIYKKINKAAAADQQRSMECEDSVEDAVTAYPPYA  226

Query  350  DGCGGGGSDH  379
              C  G   H
Sbjct  227  TACMTGEGAH  236



>ref|XP_003562891.1| PREDICTED: NAC transcription factor NAM-B2-like [Brachypodium 
distachyon]
Length=435

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 82/134 (61%), Gaps = 13/134 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D+  +  TAS
Sbjct  110  YWKATGTDKPIMASGCAREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLADSSSSGATAS  169

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
                 +      + +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  170  RPPPVVAGGSGGRAASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVAAYH  226

Query  335  -TSTSLDGCGGGGS  373
             +S ++ G  G G+
Sbjct  227  PSSYAMAGMVGAGA  240



>ref|XP_003547137.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
Length=354

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 133/265 (50%), Gaps = 30/265 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQ-KAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPIL  +G   K GVKK+LVFY GKPPKG+KTNW+MHEYRL D+  NS +  
Sbjct  96   YWKATGTDKPILASHGHHHKVGVKKSLVFYGGKPPKGVKTNWIMHEYRLADSNSNSSSKP  155

Query  179  SAHRPLGDDIVN--KKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLD  352
             +   +  D     KK+SLRLDDWVLCRI+KK+ S+            E + +   ++L 
Sbjct  156  PS---MASDHAQSCKKNSLRLDDWVLCRIYKKSNSTNLPRLPLVEQNKELSMLPMRSTLS  212

Query  353  GCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQTSWDSPRDQTCM  532
                  S    P S  S   S+G    + N  NL++G +   G++      D    Q   
Sbjct  213  MANNNTSQDSKPTSSIS--TSYGP-LGVENDDNLFDGIL---GVDHQSMQHDVSDSQQVS  266

Query  533  AMGITAAPPRIdedhhhheaann--------------naIMEGSNSFISLLNQLSPNDSA  670
            + G       +   +  ++  ++              ++ +E  NSF+SLL+ LS N + 
Sbjct  267  SKGNFPMKRELSSQYFWNDTGSSSSSRRFHCDLNYAGSSTVEEDNSFVSLLSHLSQN-TT  325

Query  671  TLNNNVQTGLGVSIAEGVLHQPYQL  745
            + + N   G    I  GVL Q +QL
Sbjct  326  SFHPNALLG---PIGNGVLRQQFQL  347



>sp|A0SPJ6.1|NAMB2_TRITD RecName: Full=NAC transcription factor NAM-B2; Short=TtNAM-B2 
[Triticum turgidum subsp. durum]
 gb|ABI94355.1| NAC transcription factor NAM-B2 [Triticum turgidum subsp. durum]
 gb|AEI00652.1| NAC4 [Triticum aestivum]
 gb|AIZ97666.1| NAC transcription factor NAM-B2 [Triticum aestivum]
Length=396

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 84/137 (61%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPIL    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  108  YWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSATTS-  166

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
               RP      ++ +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  167  ---RPPPVTGGSRSASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVTAYP  220

Query  335  --TSTSLDGCGGGGSDH  379
               +  + G G  GS++
Sbjct  221  LYATAGMTGAGAHGSNY  237



>ref|XP_006392856.1| hypothetical protein EUTSA_v10012308mg, partial [Eutrema salsugineum]
 gb|ESQ30142.1| hypothetical protein EUTSA_v10012308mg, partial [Eutrema salsugineum]
Length=283

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 72/96 (75%), Gaps = 14/96 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTC--NGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTA  175
            YWKATGTDKP+++   +G +K GVKKALVFY GKPPKG+K++W+MHEYRL DN       
Sbjct  96   YWKATGTDKPVISTGGDGNKKVGVKKALVFYSGKPPKGVKSDWIMHEYRLTDN-------  148

Query  176  SSAHRP-LGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
                +P L  D  NKK+SLRLDDWVLCRI+KKN S+
Sbjct  149  ----KPSLRCDFGNKKNSLRLDDWVLCRIYKKNNST  180



>emb|CDM83185.1| unnamed protein product [Triticum aestivum]
Length=399

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 84/137 (61%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPIL    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  111  YWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSATTS-  169

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
               RP      ++ +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  170  ---RPPPVTGGSRSASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVTAYP  223

Query  335  --TSTSLDGCGGGGSDH  379
               +  + G G  GS++
Sbjct  224  LYATAGMTGAGAHGSNY  240



>gb|AIW49540.1| NAC transcription factor NAM-A2 [Triticum turgidum subsp. durum]
Length=397

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 84/137 (61%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPIL    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  109  YWKATGTDKPILASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSATTS-  167

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
               RP      ++ +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  168  ---RPPPVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVTAYP  221

Query  335  --TSTSLDGCGGGGSDH  379
               +  + G G  GS++
Sbjct  222  PYATAGMTGAGAHGSNY  238



>tpg|DAA63170.1| TPA: putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=359

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+   G  +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    + +++
Sbjct  56   YWKATGTDKPIMASGGNREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLAD----AASST  111

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDP  313
            ++  P   +   K +SLRLDDWVLCRI+KK      ++  G GDP
Sbjct  112  TSRPPPPCNAGGKATSLRLDDWVLCRIYKK------IDKLGVGDP  150



>ref|XP_006305156.1| hypothetical protein CARUB_v10009524mg, partial [Capsella rubella]
 gb|EOA38054.1| hypothetical protein CARUB_v10009524mg, partial [Capsella rubella]
Length=363

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 12/95 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNG--TQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTA  175
            YWKATGTDKP+++  G   +K GVKKALVFY GKPPKG+K++W+MHEYRL DN  N +  
Sbjct  134  YWKATGTDKPVISTGGGVNKKVGVKKALVFYSGKPPKGVKSDWIMHEYRLTDNKPNHIC-  192

Query  176  SSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
                     D  NKK+SLRLDDWVLCRI+KKN S+
Sbjct  193  ---------DFGNKKNSLRLDDWVLCRIYKKNNST  218



>ref|NP_001060017.1| Os07g0566500 [Oryza sativa Japonica Group]
 sp|Q8H4S4.1|NAC10_ORYSJ RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Japonica Group]
 dbj|BAC22555.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAC55651.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAF21931.1| Os07g0566500 [Oryza sativa Japonica Group]
 gb|EAZ40329.1| hypothetical protein OsJ_24777 [Oryza sativa Japonica Group]
Length=425

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 77/119 (65%), Gaps = 4/119 (3%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI++   T +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++   +
Sbjct  109  YWKATGTDKPIMSSGSTREKVGVKKALVFYRGKPPKGVKTNWIMHEYRLTDTSSSAAAVA  168

Query  179  SAHRPLGDDIVNKKS--SLRLDDWVLCRIFKK-NGSSRPVESGGRGDPTEDATVATSTS  346
            +  RP        K   SLRLDDWVLCRI+KK N +     S    D  EDA  A + S
Sbjct  169  TTRRPPPPITGGSKGAVSLRLDDWVLCRIYKKTNKAGAGQRSMECEDSVEDAVAAYAPS  227



>tpg|DAA63172.1| TPA: putative NAC domain transcription factor superfamily protein 
isoform 1 [Zea mays]
 tpg|DAA63173.1| TPA: putative NAC domain transcription factor superfamily protein 
isoform 2 [Zea mays]
Length=410

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+   G  +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    + +++
Sbjct  107  YWKATGTDKPIMASGGNREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLAD----AASST  162

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDP  313
            ++  P   +   K +SLRLDDWVLCRI+KK      ++  G GDP
Sbjct  163  TSRPPPPCNAGGKATSLRLDDWVLCRIYKK------IDKLGVGDP  201



>gb|AEH68228.1| NAC transcription factor [Triticum aestivum]
Length=383

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 84/137 (61%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  108  YWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSATTS-  166

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
               RP      ++ +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  167  ---RPPPVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVTAYP  220

Query  335  --TSTSLDGCGGGGSDH  379
               +  + G G  GS++
Sbjct  221  PYATAGMTGAGAHGSNY  237



>gb|ABI94356.1| NAC transcription factor NAM-D2 [Aegilops tauschii]
Length=383

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 84/137 (61%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  108  YWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSATTS-  166

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
               RP      ++ +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  167  ---RPPPVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVTAYP  220

Query  335  --TSTSLDGCGGGGSDH  379
               +  + G G  GS++
Sbjct  221  PYATAGMTGAGAHGSNY  237



>gb|AEI00651.1| NAC3 [Triticum aestivum]
Length=396

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 84/137 (61%), Gaps = 18/137 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+    G +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  108  YWKATGTDKPIMASGCGREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASSSATTS-  166

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDATVA--  334
               RP      ++ +SLRLDDWVLCRI+KK          R +E     D  EDA  A  
Sbjct  167  ---RPPPVTGGSRAASLRLDDWVLCRIYKKINKAAAGDQQRSMEC---EDSVEDAVTAYP  220

Query  335  --TSTSLDGCGGGGSDH  379
               +  + G G  GS++
Sbjct  221  PYATAGMTGAGAHGSNY  237



>ref|XP_009416337.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=284

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 86/161 (53%), Gaps = 28/161 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI    G ++ GVKKALVFY G+PPKG KTNW+MHEYRL          S+
Sbjct  87   YWKATGTDKPIHDSRGNERIGVKKALVFYEGRPPKGSKTNWIMHEYRL-----EEARRSN  141

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             ++        K +S+RLDDWVLCRI+KK G+ +PV         +D   + S+S  G  
Sbjct  142  CYK-------LKHASMRLDDWVLCRIYKKKGNLQPVPPSMDDRERQDPADSASSSFHGM-  193

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNA--HNLYNGTMMSG  478
                         +R LS  D  E  +A  H   N  +M G
Sbjct  194  -------------NRALSMADLMEDYSAPSHLFANLPVMQG  221



>sp|A0SPJ9.1|NAM2_HORVD RecName: Full=NAC transcription factor NAM-2; Short=HvNAM-2 [Hordeum 
vulgare subsp. vulgare]
 gb|ABI94358.1| NAC transcription factor NAM-2 [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 78/130 (60%), Gaps = 8/130 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCN-GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPIL    G +K GVK ALVFYRGKPPKG+KTNW+MHEYRL D   ++ T+ 
Sbjct  108  YWKATGTDKPILASGCGREKVGVKXALVFYRGKPPKGLKTNWIMHEYRLTDASSSAATS-  166

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE---SGGRGDPTEDATVATSTSL  349
               RP      ++ +SLRLDDWVLCRI+KK   +   +   S    D  EDA  A     
Sbjct  167  ---RPPPVTGGSRAASLRLDDWVLCRIYKKINKAAAADQQRSMECEDSVEDAVTAYPPYA  223

Query  350  DGCGGGGSDH  379
              C  G   H
Sbjct  224  TACMTGEGAH  233



>ref|XP_010485778.1| PREDICTED: NAC transcription factor 29-like [Camelina sativa]
Length=355

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 11/102 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT---QKAGVKKALVFYRGKPPKGMKTNWVMHEYRL-----PDNV  157
            YWKATGTDK I   NG    +  G+KKALVFYRGKPPKG+KTNW+MHEYRL     P  +
Sbjct  90   YWKATGTDKLIAVSNGQGSHENIGIKKALVFYRGKPPKGVKTNWIMHEYRLAESLSPKRI  149

Query  158  VNSMTASSAHRPLGD-DIVNKKSSLRLDDWVLCRIFKKNGSS  280
            +NS  +SS    LGD ++ +K+ S+RLDDWVLCRI+KK+ SS
Sbjct  150  INS--SSSQVNNLGDRNLKSKEYSMRLDDWVLCRIYKKSHSS  189



>emb|CDY69545.1| BnaCnng64100D [Brassica napus]
Length=312

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 13/95 (14%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP++ T +G +K GVKKALVFY GKPPKG+K++W+MHEYRL DN        
Sbjct  96   YWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWIMHEYRLADN--------  147

Query  179  SAHRP-LGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
               +P L  D  +KK+SLRLDDWVLCRI+KKN S+
Sbjct  148  ---KPSLRCDFGHKKNSLRLDDWVLCRIYKKNNST  179



>ref|XP_009418167.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 76/112 (68%), Gaps = 19/112 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQ-KAGVKKALVFYRGKPPKGMKTNWVMHEYRLPD---------  151
            YWKATGTDKP+LT  G Q K GVKKALVFYRG+PP+G+KTNW+MHEYRL D         
Sbjct  108  YWKATGTDKPVLTSGGNQVKVGVKKALVFYRGRPPRGIKTNWIMHEYRLADASSRCCPDN  167

Query  152  -------NVVNSMTASSAHRPLGDDIVNKKS--SLRLDDWVLCRIFKKNGSS  280
                   +  NS ++SS   P G  + NKK   SLRLDDWVLCRI+KKN SS
Sbjct  168  NNNSNSNSNSNSSSSSSCRPPHGGHMANKKRGGSLRLDDWVLCRIYKKNNSS  219



>ref|XP_003541742.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
Length=363

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 140/269 (52%), Gaps = 32/269 (12%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQ-KAGVKKALVFYRGKPPKGMKTNWVMHEYRL----PDNVVNS  166
            YWKATGTDKPIL  +G   K GVKK+LVFY GKPPKG+KTNW+MHEYRL     ++    
Sbjct  99   YWKATGTDKPILASHGHHNKVGVKKSLVFYGGKPPKGVKTNWIMHEYRLADSSSNSSSKP  158

Query  167  MTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR----PVESGGRGDPTEDATVA  334
             +++S H   G     KK+SLRLDDWVLCRI+KK+ S+     P+    +    E + + 
Sbjct  159  PSSASDHAHSG-----KKNSLRLDDWVLCRIYKKSNSTHLPRLPLMEQNKEISREISMLP  213

Query  335  TSTSLDGCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM------MSGGIN---  487
              ++L       +  Q+  + +SR  S+G    + N  N ++G        M   ++   
Sbjct  214  MMSTLSMANDNNTP-QDSKTASSRSTSYGP-LGVENDDNFFDGIFGVDHQSMQQDVSDHS  271

Query  488  ---GTQTSWDSPRDQTCMAMGITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSP  658
                ++ ++   R+ +      T +     + H+    A N+  +E  NSF+SLL+ L P
Sbjct  272  QQVSSKGNFPMKRELSSQFWNGTGSSSSSRQFHYDLNYAGNSTTVEEDNSFVSLLSHL-P  330

Query  659  NDSATLNNNVQTGLGVSIAEGVLHQPYQL  745
             ++ T + N   G    +  GVL Q +QL
Sbjct  331  QNTTTFHPNALLG---PVGNGVLRQQFQL  356



>gb|KHN08560.1| NAC domain-containing protein 18 [Glycine soja]
Length=360

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 140/269 (52%), Gaps = 32/269 (12%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQ-KAGVKKALVFYRGKPPKGMKTNWVMHEYRL----PDNVVNS  166
            YWKATGTDKPIL  +G   K GVKK+LVFY GKPPKG+KTNW+MHEYRL     ++    
Sbjct  96   YWKATGTDKPILASHGHHNKVGVKKSLVFYGGKPPKGVKTNWIMHEYRLADSSSNSSSKP  155

Query  167  MTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR----PVESGGRGDPTEDATVA  334
             +++S H   G     KK+SLRLDDWVLCRI+KK+ S+     P+    +    E + + 
Sbjct  156  PSSASDHAHSG-----KKNSLRLDDWVLCRIYKKSNSTHLPRLPLMEQNKEISREISMLP  210

Query  335  TSTSLDGCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTM------MSGGIN---  487
              ++L       +  Q+  + +SR  S+G    + N  N ++G        M   ++   
Sbjct  211  MMSTLSMANDNNTP-QDSKTASSRSTSYGP-LGVENDDNFFDGIFGVDHQSMQQDVSDHS  268

Query  488  ---GTQTSWDSPRDQTCMAMGITAAPPRIdedhhhheaannnaIMEGSNSFISLLNQLSP  658
                ++ ++   R+ +      T +     + H+    A N+  +E  NSF+SLL+ L P
Sbjct  269  QQVSSKGNFPMKRELSSQFWNGTGSSSSSRQFHYDLNYAGNSTTVEEDNSFVSLLSHL-P  327

Query  659  NDSATLNNNVQTGLGVSIAEGVLHQPYQL  745
             ++ T + N   G    +  GVL Q +QL
Sbjct  328  QNTTTFHPNALLG---PVGNGVLRQQFQL  353



>ref|XP_009147650.1| PREDICTED: NAC domain-containing protein 18 isoform X1 [Brassica 
rapa]
Length=335

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 13/95 (14%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP++ T +G +K GVKKALVFY GKPPKG+K++W+MHEYRL DN        
Sbjct  107  YWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWIMHEYRLADN--------  158

Query  179  SAHRP-LGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
               +P L  D  +KK+SLRLDDWVLCRI+KKN S+
Sbjct  159  ---KPSLRCDFGHKKNSLRLDDWVLCRIYKKNNST  190



>emb|CDY53806.1| BnaA06g01770D [Brassica napus]
Length=318

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 11/94 (12%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP++ T +G +K GVKKALVFY GKPPKG+K++W+MHEYRL DN  +     
Sbjct  99   YWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWIMHEYRLADNKPS-----  153

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
                 L  D  +KK+SLRLDDWVLCRI+KKN S+
Sbjct  154  -----LRCDFGHKKNSLRLDDWVLCRIYKKNNST  182



>ref|XP_009147651.1| PREDICTED: NAC domain-containing protein 18 isoform X2 [Brassica 
rapa]
Length=327

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 11/94 (12%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKP++ T +G +K GVKKALVFY GKPPKG+K++W+MHEYRL DN  +     
Sbjct  99   YWKATGTDKPVISTGDGNKKVGVKKALVFYTGKPPKGIKSDWIMHEYRLADNKPS-----  153

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
                 L  D  +KK+SLRLDDWVLCRI+KKN S+
Sbjct  154  -----LRCDFGHKKNSLRLDDWVLCRIYKKNNST  182



>ref|XP_010533895.1| PREDICTED: NAC transcription factor 25 isoform X1 [Tarenaya hassleriana]
Length=357

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 79/116 (68%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT N   K GVKKALVFY GKPPKG+KTNW+MHEYRL D  V +     
Sbjct  95   YWKATGTDKPILTSNSHHKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIDGDVPNSKPDL  154

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
            +         +KKSSLRLDDWVLCRI+KKN S RP++    G+   D  +AT  +L
Sbjct  155  S--------SSKKSSLRLDDWVLCRIYKKNTSHRPMDQRA-GEDLMDGMIATVQNL  201



>ref|XP_010533896.1| PREDICTED: NAC transcription factor 25 isoform X2 [Tarenaya hassleriana]
Length=286

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 79/116 (68%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT N   K GVKKALVFY GKPPKG+KTNW+MHEYRL D  V +     
Sbjct  95   YWKATGTDKPILTSNSHHKVGVKKALVFYGGKPPKGIKTNWIMHEYRLIDGDVPNSKPDL  154

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
            +         +KKSSLRLDDWVLCRI+KKN S RP++    G+   D  +AT  +L
Sbjct  155  S--------SSKKSSLRLDDWVLCRIYKKNTSHRPMDQRA-GEDLMDGMIATVQNL  201



>ref|XP_010922870.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=341

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (68%), Gaps = 9/114 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI++  G Q  GVKKALVFY+G+PPKG+KT+W+MHEYRL D   N++    
Sbjct  88   YWKATGTDKPIISSKGNQNIGVKKALVFYQGRPPKGVKTDWIMHEYRLADAHNNNI----  143

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATST  343
             +RP+      + +S+RLDDWVLCRI+KK+  +  ++        ED  + + T
Sbjct  144  -YRPMK----LRDTSMRLDDWVLCRIYKKSNHTLSMDRQQEDISVEDVFMPSLT  192



>ref|XP_006657850.1| PREDICTED: NAC transcription factor ONAC010-like [Oryza brachyantha]
Length=437

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 79/122 (65%), Gaps = 7/122 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTA-  175
            YWKATGTDKPI+    + +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +S+TA 
Sbjct  109  YWKATGTDKPIMASGSSREKVGVKKALVFYRGKPPKGIKTNWIMHEYRLTDTTSSSLTAA  168

Query  176  --SSAHRPLGDDIVNKKS--SLRLDDWVLCRIFKK-NGSSRPVESGGRGDPTEDATVATS  340
              ++  RP        +   SLRLDDWVLCRI+KK N +     S    D  EDA  A +
Sbjct  169  GVATTRRPPPTITGGSRGAVSLRLDDWVLCRIYKKTNKAGAGQRSMECEDSIEDAVTAYA  228

Query  341  TS  346
             S
Sbjct  229  PS  230



>ref|XP_001769642.1| predicted protein [Physcomitrella patens]
 gb|EDQ65443.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 64/89 (72%), Gaps = 12/89 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI   NG  K GVKKALVFYRGK PKG KTNW+MHEYRL + V     + S
Sbjct  92   YWKATGTDKPIHMTNGHSKVGVKKALVFYRGKAPKGEKTNWIMHEYRLAEGV-----SPS  146

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            AH        +++ SLRLDDWVLCRI++K
Sbjct  147  AHH-------HRRGSLRLDDWVLCRIYEK  168



>ref|XP_008793367.1| PREDICTED: NAC transcription factor 29-like [Phoenix dactylifera]
Length=340

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 91/163 (56%), Gaps = 20/163 (12%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI    G    GVKKALVFY+G+PPKG+KTNW+MHEYRL +       +S+
Sbjct  87   YWKATGTDKPIRMSRGNGNIGVKKALVFYKGRPPKGLKTNWIMHEYRLAE-----AQSSN  141

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
            +++P       + SS+RLDDWVLCRI+KK+    PV       P  D     S+  D   
Sbjct  142  SYKP----TRIRDSSMRLDDWVLCRIYKKSNHLEPVP------PLIDQEQDDSSPEDNYY  191

Query  362  GGGSD--HQNPNSRASRGLSFGDFFEINN--AHNLYNGTMMSG  478
               ++   QNP  R  +  S  +F E  +  +H L N   M G
Sbjct  192  SNPTNITQQNP-LRLPKSFSISEFLEDYSSFSHLLDNQPEMPG  233



>sp|A2YMR0.1|NAC10_ORYSI RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Indica Group]
 gb|EAZ04371.1| hypothetical protein OsI_26514 [Oryza sativa Indica Group]
Length=425

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+    T +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   ++   +
Sbjct  109  YWKATGTDKPIMASGSTREKVGVKKALVFYRGKPPKGVKTNWIMHEYRLTDTSSSAAAVA  168

Query  179  SAHRPLGDDIVNKKS--SLRLDDWVLCRIFKK-NGSSRPVESGGRGDPTEDATVATSTS  346
            +  +P        +   SLRLDDWVLCRI+KK N +     S    D  EDA  A + S
Sbjct  169  TTRQPPPPITGGSRGAVSLRLDDWVLCRIYKKTNKAGAGQRSMECEDSVEDAVAAYAPS  227



>ref|XP_002463039.1| hypothetical protein SORBIDRAFT_02g036620 [Sorghum bicolor]
 gb|EER99560.1| hypothetical protein SORBIDRAFT_02g036620 [Sorghum bicolor]
Length=418

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 67/92 (73%), Gaps = 8/92 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI+   G  +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D       +S
Sbjct  107  YWKATGTDKPIMASGGNREKVGVKKALVFYRGKPPKGLKTNWIMHEYRLAD-----AASS  161

Query  179  SAHRPLGDDIV--NKKSSLRLDDWVLCRIFKK  268
            +  RP     V   K +SLRLDDWVLCRI+KK
Sbjct  162  TTSRPPPPCNVGGGKATSLRLDDWVLCRIYKK  193



>gb|EPS59407.1| hypothetical protein M569_15400, partial [Genlisea aurea]
Length=171

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 10/95 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDK I+   G  + GVKKALVFY GKPPKG+KTNW+MHEYRL DN    +    
Sbjct  81   YWKATGTDKSIMAEGGASRVGVKKALVFYTGKPPKGLKTNWIMHEYRLVDNNPGPIP---  137

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRP  286
                   + ++++ S RLD+WVLCRI++K  +SRP
Sbjct  138  -------EFLSRRDSSRLDEWVLCRIYEKRAASRP  165



>ref|XP_010921289.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=340

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 68/91 (75%), Gaps = 13/91 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI T  G +  GVKKALVFY+G+PPKG+KTNW+MHEYRL +        S+
Sbjct  87   YWKATGTDKPIHTSKGNENIGVKKALVFYKGRPPKGLKTNWIMHEYRLAE-----AQNSN  141

Query  182  AHRPL--GDDIVNKKSSLRLDDWVLCRIFKK  268
            +++P+  GD      SS+RLDDWVLCRI+KK
Sbjct  142  SYKPMKFGD------SSMRLDDWVLCRIYKK  166



>ref|XP_004958056.1| PREDICTED: NAC transcription factor NAM-2-like [Setaria italica]
Length=413

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPIL   G  +K GVKKALVFYRGKPPKG+KTNW+MHEYRL     ++ +++
Sbjct  108  YWKATGTDKPILASTGNREKVGVKKALVFYRGKPPKGLKTNWIMHEYRL----ADAASSA  163

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            +A+RP       K +SLRLDDWVLCRI+KK
Sbjct  164  AANRPPPGAGGGKATSLRLDDWVLCRIYKK  193



>ref|XP_010518139.1| PREDICTED: NAC transcription factor 29-like [Camelina sativa]
Length=354

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 6/99 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT---QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMT  172
            YWKATGTDK I   NG    +  G+KKALVFYRGKPPKG+KTNW+MHEYRL +++   + 
Sbjct  90   YWKATGTDKLIAVANGQGSHENIGIKKALVFYRGKPPKGVKTNWIMHEYRLAESLSPKII  149

Query  173  ASSAHRP--LGDDIV-NKKSSLRLDDWVLCRIFKKNGSS  280
             SS+ +   LGD  + +K+ S+RLDDWVLCRI+KK+ +S
Sbjct  150  NSSSSQINNLGDRTLKSKEYSMRLDDWVLCRIYKKSHAS  188



>ref|XP_009353167.1| PREDICTED: NAC transcription factor 29-like [Pyrus x bretschneideri]
Length=373

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNG-TQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDK I+  +G  Q  GVKKALVFY+G+PPKG+KTNW+MHEYRLP++  N  T +
Sbjct  88   YWKATGTDKTIVAPSGGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPESPNNYTTTT  147

Query  179  SAHRPLG-DDIVNKKSSLRLDDWVLCRIFKK  268
            + HR +  +D+     S+RLDDWVLCRI+KK
Sbjct  148  NHHRAMKLNDL-----SMRLDDWVLCRIYKK  173



>gb|AGZ20133.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>gb|AGH32788.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
Length=405

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>ref|XP_010931442.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=341

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (65%), Gaps = 9/114 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI++  G +  GVKKALVFY+G+PPKG+KT W+MHEYRL   + N     +
Sbjct  88   YWKATGTDKPIVSSKGNENIGVKKALVFYKGRPPKGVKTGWIMHEYRLAQALNN-----N  142

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATST  343
            + RP+      + SS+RLDDWVLCRI+KKN  +   +        ED  + + T
Sbjct  143  SFRPMKL----RDSSMRLDDWVLCRIYKKNNYTLSTDPEQDDSAVEDVFMPSLT  192



>gb|AGZ20124.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>gb|AGS08758.1| NAC domain protein [Malus hupehensis]
Length=373

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNG-TQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDK I+  +G  Q  GVKKALVFY+G+PPKG+KTNW+MHEYRLP++  N  T +
Sbjct  88   YWKATGTDKTIVAPSGGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPESPNNYTTTT  147

Query  179  SAHRPLG-DDIVNKKSSLRLDDWVLCRIFKK  268
            + HR +  +D+     S+RLDDWVLCRI+KK
Sbjct  148  NHHRAVKLNDL-----SMRLDDWVLCRIYKK  173



>gb|AGZ20132.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>sp|A0SPJ4.1|NAMB1_TRIDC RecName: Full=NAC transcription factor NAM-B1; Short=TtNAM-B1 
[Triticum dicoccoides]
 gb|ABI15896.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|ABI94353.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGH32786.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
 gb|AGZ20120.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20121.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20122.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20125.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20126.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20127.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20128.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20130.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20134.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20136.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AIZ97665.1| NAC transcription factor NAM-B1 [Triticum aestivum]
Length=405

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>ref|XP_001771652.1| predicted protein [Physcomitrella patens]
 gb|EDQ63566.1| predicted protein [Physcomitrella patens]
Length=203

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 66/91 (73%), Gaps = 13/91 (14%)
 Frame = +2

Query  2    YWKATGTDKPILT-CNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI T   G +K GVKKALVFY+G+ PKG+KTNW+MHEYRL + V  S+ A 
Sbjct  97   YWKATGTDKPIHTSVGGIRKIGVKKALVFYKGRAPKGVKTNWIMHEYRLAEGVCASVHA-  155

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKN  271
                       ++K SLRLDDWVLCRI+KK+
Sbjct  156  -----------HRKGSLRLDDWVLCRIYKKS  175



>gb|AGH32787.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
Length=405

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>gb|AGZ20123.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>ref|NP_001280963.1| NAC transcription factor 29 [Malus domestica]
 gb|ADL36804.1| NAC domain class transcription factor [Malus domestica]
Length=373

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNG-TQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDK I+  +G  Q  GVKKALVFY+G+PPKG+KTNW+MHEYRLP++  N  T +
Sbjct  88   YWKATGTDKTIVAPSGGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPESPNNYTTTT  147

Query  179  SAHRPLG-DDIVNKKSSLRLDDWVLCRIFKK  268
            + HR +  +D+     S+RLDDWVLCRI+KK
Sbjct  148  NHHRAVKLNDL-----SMRLDDWVLCRIYKK  173



>ref|XP_009420951.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 10/97 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKA-GVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDK I T +G   + GVKKALVFY+G+PP+G+KTNW+MHEYRL +        S
Sbjct  87   YWKATGTDKAIHTSSGKNHSIGVKKALVFYKGRPPRGLKTNWIMHEYRLAE-----AARS  141

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
            S  RPL     +  SS+RLDDWVLCRI+KKN   +PV
Sbjct  142  SCSRPLK----SSHSSMRLDDWVLCRIYKKNSHLQPV  174



>gb|AJF38903.1| NAC transcription factor [Diospyros kaki]
Length=242

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 82/151 (54%), Gaps = 27/151 (18%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDK I +  GT+  GVKKALVFY GKPPKG+KT+W+MHEYRL D        SS
Sbjct  89   YWKATGTDKSIYS--GTKFVGVKKALVFYEGKPPKGIKTDWIMHEYRLSD--------SS  138

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             H P       K  S+RLDDWVLCRI+KK    R VE     D         S++     
Sbjct  139  THIP------RKNGSMRLDDWVLCRIYKKKSLVRTVEKTAEED---------SSAQMVAS  183

Query  362  GGGSDHQNPNSRASRGLSFGDFFEINNAHNL  454
             G SD Q   SR     S    +E++   +L
Sbjct  184  NGASDSQ--TSRIPTTCSLSQLWELDGLASL  212



>ref|XP_010938117.1| PREDICTED: NAC transcription factor 29-like [Elaeis guineensis]
Length=339

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 13/98 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRL--PDNVVNSMTA  175
            YWKATGTDKPI    G +  GVKKALVFY+G+PPKG+KTNW+MHEYRL  P+N       
Sbjct  87   YWKATGTDKPIRLSKGNENIGVKKALVFYKGRPPKGVKTNWIMHEYRLAEPEN-------  139

Query  176  SSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPV  289
            S+ ++P+      + SS+RLDDWVLCRI+KK+    PV
Sbjct  140  SNRYKPMRI----RDSSMRLDDWVLCRIYKKSNHLPPV  173



>gb|AGH32785.1| NAC transcription factor NAM-B1 [Triticum ispahanicum]
Length=405

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGARGSNYASPS  253



>gb|AGZ20119.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>gb|AGZ20118.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>gb|KFK35761.1| hypothetical protein AALP_AA4G032900 [Arabis alpina]
Length=280

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 68/92 (74%), Gaps = 12/92 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCN--GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTA  175
            YWKATGTDKP+++    G++K GVKKALVFY GKPPKG+K++W+MHEYRL DN  +    
Sbjct  96   YWKATGTDKPVISTGDGGSKKIGVKKALVFYTGKPPKGVKSDWIMHEYRLIDNKPSFRC-  154

Query  176  SSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKN  271
                     D  NKK+SLRLDDWVLCRI+KKN
Sbjct  155  ---------DYGNKKNSLRLDDWVLCRIYKKN  177



>gb|ABY67950.1| NAM-1 [Hordeum vulgare subsp. vulgare]
Length=406

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 64/92 (70%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    YWKATGTDKPIL---TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMT  172
            YWKATGTDKPIL   T  G +K GVKKALVFYRGKPP+G+KTNW+MHEYRL      S T
Sbjct  115  YWKATGTDKPILASATGCGREKVGVKKALVFYRGKPPRGLKTNWIMHEYRLTGASAGSTT  174

Query  173  ASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
             S      G       +SLRLDDWVLCRI+KK
Sbjct  175  TSRPPPVTGGS--RAPASLRLDDWVLCRIYKK  204



>sp|A0SPJ8.1|NAM1_HORVD RecName: Full=NAC transcription factor NAM-1; Short=HvNAM-1 [Hordeum 
vulgare subsp. vulgare]
 gb|ABI94357.1| NAC transcription factor NAM-1 [Hordeum vulgare subsp. vulgare]
 gb|ABY67949.1| NAM-1 [Hordeum vulgare subsp. vulgare]
Length=406

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 64/92 (70%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    YWKATGTDKPIL---TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMT  172
            YWKATGTDKPIL   T  G +K GVKKALVFYRGKPP+G+KTNW+MHEYRL      S T
Sbjct  115  YWKATGTDKPILASATGCGREKVGVKKALVFYRGKPPRGLKTNWIMHEYRLTGASAGSTT  174

Query  173  ASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
             S      G       +SLRLDDWVLCRI+KK
Sbjct  175  TSRPPPVTGGS--RAPASLRLDDWVLCRIYKK  204



>sp|D2SMN4.1|NAMB1_HORVS RecName: Full=NAC transcription factor NAM-B1 [Hordeum vulgare 
subsp. spontaneum]
 gb|ACL31422.1| NAM-B1 [Hordeum vulgare subsp. spontaneum]
Length=406

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 64/92 (70%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    YWKATGTDKPIL---TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMT  172
            YWKATGTDKPIL   T  G +K GVKKALVFYRGKPP+G+KTNW+MHEYRL      S T
Sbjct  115  YWKATGTDKPILASATGCGREKVGVKKALVFYRGKPPRGLKTNWIMHEYRLTGASAGSTT  174

Query  173  ASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
             S      G       +SLRLDDWVLCRI+KK
Sbjct  175  TSRPPPVTGGS--RAPASLRLDDWVLCRIYKK  204



>emb|CBI32712.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 73/111 (66%), Gaps = 14/111 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GT+  GVKKALVFY+G+PPKG+KT+W+MHEYRL D++  ++    
Sbjct  93   YWKATGTDKPILTSCGTRSIGVKKALVFYKGRPPKGVKTDWIMHEYRLLDSMFRTL----  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVA  334
                        K S+RLDDWVLCR+ +K+   R +     G  +E A+ +
Sbjct  149  ----------KHKGSMRLDDWVLCRVRQKSSIPRNIWEDRNGPSSEPASYS  189



>ref|XP_002275457.1| PREDICTED: NAC domain-containing protein 2 [Vitis vinifera]
Length=342

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 73/111 (66%), Gaps = 14/111 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GT+  GVKKALVFY+G+PPKG+KT+W+MHEYRL D++  ++    
Sbjct  93   YWKATGTDKPILTSCGTRSIGVKKALVFYKGRPPKGVKTDWIMHEYRLLDSMFRTL----  148

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVA  334
                        K S+RLDDWVLCR+ +K+   R +     G  +E A+ +
Sbjct  149  ----------KHKGSMRLDDWVLCRVRQKSSIPRNIWEDRNGPSSEPASYS  189



>ref|XP_008240449.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=384

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 8/94 (9%)
 Frame = +2

Query  2    YWKATGTDKPIL-TCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDK I+ +  G Q  GVKKALVFY+G+PPKG+KTNW+MHEYRLP+N  N  T S
Sbjct  89   YWKATGTDKTIVASLGGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRLPENPNNYTTTS  148

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
               +        K  S+RLDDWVLCRI+KK+  S
Sbjct  149  KTMK-------LKDLSMRLDDWVLCRIYKKSNVS  175



>ref|XP_001752718.1| predicted protein [Physcomitrella patens]
 gb|EDQ82589.1| predicted protein [Physcomitrella patens]
Length=205

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 13/91 (14%)
 Frame = +2

Query  2    YWKATGTDKPILT-CNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTAS  178
            YWKATGTDKPI T   G +K GVKKALVFY G+ PKG+KTNW+MHEYRL + V  S+ A 
Sbjct  94   YWKATGTDKPIHTAVGGIRKIGVKKALVFYEGRAPKGVKTNWIMHEYRLAEGVCASVHA-  152

Query  179  SAHRPLGDDIVNKKSSLRLDDWVLCRIFKKN  271
                       ++K SLRLDDWVLCRI+KK+
Sbjct  153  -----------HRKGSLRLDDWVLCRIYKKS  172



>gb|AGZ20137.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 87/146 (60%), Gaps = 22/146 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPP+G+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPEGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK------NGSSRPVESGGRGDPTEDA  325
            S TA++   P+        +SLRLDDWVLCRI+KK          R  E     D  EDA
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKKINKAAAGDQQRNTEC---EDSVEDA  227

Query  326  TVA----TSTSLDGCGGGGSDHQNPN  391
              A     +  + G G  GS++ +P+
Sbjct  228  VTAYPLYATAGMTGAGAHGSNYASPS  253



>gb|KDO51071.1| hypothetical protein CISIN_1g042614mg, partial [Citrus sinensis]
Length=326

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 14/94 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            +WKATGTDKPILT  GT+  GVKKALVFY G+PPKG KT+W+MHEYRLPD +        
Sbjct  75   FWKATGTDKPILTSFGTKSIGVKKALVFYEGRPPKGYKTDWIMHEYRLPDTI--------  126

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR  283
            A  P      N+K S+RLDDWVLCR+ + + +SR
Sbjct  127  AWTP------NRKGSMRLDDWVLCRVRQNSINSR  154



>ref|XP_006428812.1| hypothetical protein CICLE_v10013694mg [Citrus clementina]
 gb|ESR42052.1| hypothetical protein CICLE_v10013694mg [Citrus clementina]
Length=328

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 14/94 (15%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            +WKATGTDKPILT  GT+  GVKKALVFY G+PPKG KT+W+MHEYRLPD +        
Sbjct  77   FWKATGTDKPILTSFGTKSIGVKKALVFYEGRPPKGYKTDWIMHEYRLPDTI--------  128

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR  283
            A  P       +K S+RLDDWVLCR+ +K+ +SR
Sbjct  129  AWTP------KRKGSMRLDDWVLCRVRQKSINSR  156



>gb|AFD54040.1| NAC transcription factor NAM-1 [Aegilops longissima]
Length=405

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 84/143 (59%), Gaps = 16/143 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD--AS  169

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFK---KNGSSRPVESGGRGDPTEDATVA  334
              T +S   P         +SLRLDDWVLCRI+K   K  +     S    D  EDA  A
Sbjct  170  GSTNTSRPPPPVTGGSRAAASLRLDDWVLCRIYKKINKAAAGDQQRSTECEDSMEDAVTA  229

Query  335  ----TSTSLDGCGGGGSDHQNPN  391
                 +  + G G  GS + +P+
Sbjct  230  YPLYATPGMAGAGAHGSSYASPS  252



>ref|XP_001773582.1| predicted protein [Physcomitrella patens]
 gb|EDQ61620.1| predicted protein [Physcomitrella patens]
Length=175

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 12/94 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI    G  K GVKKALVFYRGK PKG KTNW+MHEYRL + V     ++S
Sbjct  93   YWKATGTDKPIHMSKGHSKVGVKKALVFYRGKAPKGEKTNWIMHEYRLAEGV-----STS  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR  283
             H P       +++S RLDDWVLCRI++K   ++
Sbjct  148  THHP-------RRNSSRLDDWVLCRIYEKTSHAQ  174



>gb|AFD54037.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 68/95 (72%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  170

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            S TAS    P+        +SLRLDDWVLCRI+KK
Sbjct  171  STTASRPPPPVTGG-SRAAASLRLDDWVLCRIYKK  204



>gb|AFD54036.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 68/95 (72%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  170

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            S TAS    P+        +SLRLDDWVLCRI+KK
Sbjct  171  STTASRPPPPVTGG-SRAAASLRLDDWVLCRIYKK  204



>ref|XP_003557998.1| PREDICTED: NAC transcription factor NAM-B1-like [Brachypodium 
distachyon]
Length=347

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI +   ++  GVKKALVFY+G+PPKG+KTNW+MHEYRL         A +
Sbjct  89   YWKATGTDKPIRSSATSESVGVKKALVFYKGRPPKGVKTNWIMHEYRL---AAADAHAGN  145

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVA  334
             +RP+      + +S+RLDDWVLCRI+KK     P+      D   D   A
Sbjct  146  TYRPMK----FRNTSMRLDDWVLCRIYKKTSQMSPMAVPPLSDHEHDEPCA  192



>sp|A0SPJ3.1|NAMA1_TRITD RecName: Full=NAC transcription factor NAM-A1; Short=TtNAM-A1 
[Triticum turgidum subsp. durum]
 gb|ABI94352.1| NAC transcription factor NAM-A1 [Triticum turgidum subsp. durum]
Length=405

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 68/95 (72%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D  V+
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD--VS  169

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
              T +S   P         +SLRLDDWVLCRI+KK
Sbjct  170  GSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKK  204



>ref|XP_009406848.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=345

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 80/145 (55%), Gaps = 16/145 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI    G +  GVKKALVFY+G+PP+G KTNW+MHEYRL         A +
Sbjct  87   YWKATGTDKPIHRSGGNEHIGVKKALVFYKGRPPRGRKTNWIMHEYRL---------AEA  137

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             H      +  K +S+RLDDWVLCRI+KKN + + V       P  D     S S D   
Sbjct  138  HHGNTYKPMKFKNASMRLDDWVLCRIYKKNHNLQSVP------PLVDQEQEDSGSGDIYL  191

Query  362  GGGSDHQNPNS-RASRGLSFGDFFE  433
                + + P+  R  +  S  DF E
Sbjct  192  SSFRNTEQPSGLRLQKSFSVSDFLE  216



>gb|KDO74153.1| hypothetical protein CISIN_1g016791mg [Citrus sinensis]
Length=276

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 7/85 (8%)
 Frame = +2

Query  35   LTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASSAHRPLGDDIVN  214
            ++    QK GVKKALVFY GKPPKG+KTNW+MHEYRL DN V       +++P G D+ N
Sbjct  1    MSSGSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLTDNKV-------SNKPPGCDLGN  53

Query  215  KKSSLRLDDWVLCRIFKKNGSSRPV  289
            KK+SLRLDDWVLCRI+KKN   RP+
Sbjct  54   KKNSLRLDDWVLCRIYKKNNLHRPL  78



>ref|XP_009394856.1| PREDICTED: NAC transcription factor 25-like [Musa acuminata subsp. 
malaccensis]
Length=334

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 75/115 (65%), Gaps = 9/115 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP++   G++  GVKKALVFY+G+PP+G+KT+W+MHEYRL D         +
Sbjct  88   YWKATGTDKPVMASKGSESIGVKKALVFYQGRPPRGVKTDWIMHEYRLAD-----AHNKN  142

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTS  346
            ++RP    I  +  S+RLDDWVLCRI+KK+     +++       ED  + T  S
Sbjct  143  SYRP----IKLRDCSMRLDDWVLCRIYKKSHHQPSMDAEKDDSGVEDVAMPTPPS  193



>ref|XP_006408226.1| hypothetical protein EUTSA_v10021011mg [Eutrema salsugineum]
 gb|ESQ49679.1| hypothetical protein EUTSA_v10021011mg [Eutrema salsugineum]
Length=357

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 71/101 (70%), Gaps = 8/101 (8%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT---QKAGVKKALVFYRGKPPKGMKTNWVMHEYRL-----PDNV  157
            YWKATGTDK I+  NG    +  G+KKALVFYRGKPPKG+KTNW+MHEYRL     P  +
Sbjct  90   YWKATGTDKLIVVPNGEGFNENIGIKKALVFYRGKPPKGVKTNWIMHEYRLAESLSPKRL  149

Query  158  VNSMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
             +S T    +     ++ +K+ S+RLDDWVLCRI+KK+ +S
Sbjct  150  CHSRTGIQVNNSGDRNLKSKEYSMRLDDWVLCRIYKKSHAS  190



>ref|XP_001779494.1| predicted protein [Physcomitrella patens]
 gb|EDQ55670.1| predicted protein [Physcomitrella patens]
Length=176

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 62/89 (70%), Gaps = 12/89 (13%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI   N   K GVKKALVFYRGK PKG KTNW+MHEYRL + V    +  +
Sbjct  92   YWKATGTDKPIFMTNSHSKVGVKKALVFYRGKAPKGEKTNWIMHEYRLAEGV----SPPA  147

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
             H        +++ SLRLDDWVLCRI++K
Sbjct  148  RH--------HRRGSLRLDDWVLCRIYEK  168



>ref|XP_010644222.1| PREDICTED: NAC transcription factor 25 isoform X2 [Vitis vinifera]
Length=341

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 98/274 (36%), Positives = 126/274 (46%), Gaps = 60/274 (22%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+LT  GTQK GVKKALVFY GKPPKG+KTNW+MHEYRL DN VN+     
Sbjct  95   YWKATGTDKPVLTSGGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRLADNKVNT-----  149

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTED-ATVATSTSLDGC  358
              +P G D+ NKK+SLR            N + R ++        +    V TS S+   
Sbjct  150  --KPPGCDMGNKKNSLR------------NNTHRTLDPDKDDSMDDMLGPVPTSISM---  192

Query  359  GGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMSGGINGTQT------SWDSPRD  520
            G      Q P       L       + N  +L+ G + S GIN + T      S   P  
Sbjct  193  GQQSLKLQFPKVPNYSAL-------LENEQSLFEGMINSDGINSSGTISQLACSSSKPDH  245

Query  521  QTCMAMGI-------------------TAAPPRIdedhhhheaannnaIMEGSNSFISLL  643
             + +A                      TA P         +   N     +G+NS  +LL
Sbjct  246  LSLVAATTSSILPLKRTLPSLYWNDDDTAGPSTTKRFQAENTDGNIGRTTDGNNSIATLL  305

Query  644  NQLSPNDSATLNNNVQTGLGVSIAEGVLHQPYQL  745
            +QL    S     + Q+ LG S+ EGV  QP+QL
Sbjct  306  SQLPQTPSL----HQQSMLG-SLGEGVFRQPFQL  334



>ref|XP_010463881.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=356

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 6/95 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT---QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMT  172
            YWKATGTDK I   NG    +  G+KKALVFYRGKPPKG+KTNW+MHEYRL +++     
Sbjct  90   YWKATGTDKLIAVSNGQGFHENIGIKKALVFYRGKPPKGVKTNWIMHEYRLAESLFPKRI  149

Query  173  ASSAHRP--LGD-DIVNKKSSLRLDDWVLCRIFKK  268
             SS+ +    GD  + +K+ S+RLDDWVLCRI+KK
Sbjct  150  NSSSSQVNNFGDRSLKSKEYSMRLDDWVLCRIYKK  184



>ref|XP_010088481.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB36251.1| NAC domain-containing protein 29 [Morus notabilis]
Length=358

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 79/138 (57%), Gaps = 10/138 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTC----NGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSM  169
            YWKATGTDK I+T      G Q  GVKKALVFY+G+PPKG+KTNW+MHEYRL +    + 
Sbjct  88   YWKATGTDKTIMTLVTPGGGQQNIGVKKALVFYKGRPPKGVKTNWIMHEYRLAE--TPTY  145

Query  170  TASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSL  349
            T S+ ++    +   K SS+RLDDWVLCRI+KK     P+ S    D  E+        L
Sbjct  146  TYSNVNK---SNNKFKDSSMRLDDWVLCRIYKKTNVVHPIASFP-SDQEEEEQFIQDAPL  201

Query  350  DGCGGGGSDHQNPNSRAS  403
                G   D   P   +S
Sbjct  202  PSLIGDQQDSFKPQKSSS  219



>gb|AFD54038.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 68/95 (72%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPP+G+KTNW+MHEYRL D    
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPRGLKTNWIMHEYRLTD-ASG  170

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            S TAS    P+        +SLRLDDWVLCRI+KK
Sbjct  171  STTASRPPPPVTGG-SRAAASLRLDDWVLCRIYKK  204



>gb|ACD63687.1| NAC domain containing protein 2-like protein, partial [Bahiopsis 
reticulata]
 gb|ACD63688.1| NAC domain containing protein 2-like protein, partial [Bahiopsis 
reticulata]
Length=96

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 67/98 (68%), Gaps = 9/98 (9%)
 Frame = +2

Query  62   GVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASSAHRPLGDDIVNKKSSLRLDD  241
            GVKKALVFY GKPPKG KTNW+MHEYRL D       + +  +P G D  NKK+SLRLDD
Sbjct  1    GVKKALVFYGGKPPKGSKTNWIMHEYRLAD-------SKTISKPPGCDPSNKKASLRLDD  53

Query  242  WVLCRIFKKNGSSRPVESGGRGDPTED--ATVATSTSL  349
            WVLCRI+KK+   RPV+S G+  P     A++  S SL
Sbjct  54   WVLCRIYKKHNIQRPVDSDGKDHPMTGMLASIPPSISL  91



>gb|AFD54033.1| NAC transcription factor NAM-1 [Aegilops speltoides]
Length=407

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASGS  172

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            + T+     P         +SLRLDDWVLCRI+KK
Sbjct  173  TTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKK  207



>ref|XP_008782759.1| PREDICTED: NAC transcription factor 25-like [Phoenix dactylifera]
Length=339

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 65/89 (73%), Gaps = 9/89 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI T  G +  GVKKALVFY G+PPKG+KTNW+MHEYRL +        S+
Sbjct  87   YWKATGTDKPIRTSKGNENIGVKKALVFYMGRPPKGLKTNWIMHEYRLFE-----AQNSN  141

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
             ++P+      + SS+RLDDWVLCRI+KK
Sbjct  142  NYKPMK----FRDSSMRLDDWVLCRIYKK  166



>ref|XP_006443351.1| hypothetical protein CICLE_v10020717mg [Citrus clementina]
 ref|XP_006479050.1| PREDICTED: NAC domain-containing protein 18-like [Citrus sinensis]
 gb|ESR56591.1| hypothetical protein CICLE_v10020717mg [Citrus clementina]
 gb|KDO45538.1| hypothetical protein CISIN_1g017665mg [Citrus sinensis]
Length=368

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 12/106 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCN---GTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMT  172
            YWKATGTDK IL  +     +  GVKKALVFY+G+PPKG+KTNW+MHEYRL +N  N   
Sbjct  91   YWKATGTDKIILATSVGAHQENIGVKKALVFYKGRPPKGVKTNWIMHEYRLAENPKN--L  148

Query  173  ASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGD  310
              +  RP       K SS+RLDDWVLCRI++K+  S P  +G   D
Sbjct  149  NHTKMRP-------KDSSMRLDDWVLCRIYRKSHVSLPTSAGAASD  187



>ref|XP_004984512.1| PREDICTED: NAC transcription factor NAM-B1-like [Setaria italica]
Length=363

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 17/121 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI +    +  GVKKALVFY+G+PPKG KTNW+MHEYRL  +      A  
Sbjct  90   YWKATGTDKPIHSSATGESVGVKKALVFYKGRPPKGTKTNWIMHEYRLAADA----QAGH  145

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATSTSLDGCG  361
             +RP+      + +S+RLDDWVLCRI+KK   + P+      D  +D         + CG
Sbjct  146  TYRPMK----FRNASMRLDDWVLCRIYKKTSHASPMAVPPLSDHEQD---------EPCG  192

Query  362  G  364
            G
Sbjct  193  G  193



>ref|XP_002976404.1| hypothetical protein SELMODRAFT_105213, partial [Selaginella 
moellendorffii]
 gb|EFJ22664.1| hypothetical protein SELMODRAFT_105213, partial [Selaginella 
moellendorffii]
Length=176

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 63/89 (71%), Gaps = 14/89 (16%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI T  G +K GVKKALVFY GK PKG+KTNW+MHEYRL          SS
Sbjct  95   YWKATGTDKPIHT-RGNRKVGVKKALVFYDGKAPKGVKTNWIMHEYRL--------VESS  145

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            +H+P  D       SLRLDDWVLCRI++K
Sbjct  146  SHKPAKDH-----KSLRLDDWVLCRIYEK  169



>gb|AEI00653.1| NAC5 [Triticum aestivum]
Length=406

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  111  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASGS  169

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            + T+     P         +SLRLDDWVLCRI+KK
Sbjct  170  TTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKK  204



>dbj|BAF36563.1| NAC domain protein [Cymbidium hybrid cultivar]
Length=339

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 11/97 (11%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI   +G++  GVKKALVFY+G+PPKG+KTNW+MHE+RL D        S+
Sbjct  88   YWKATGTDKPI--SSGSENIGVKKALVFYKGRPPKGLKTNWIMHEFRLAD-----ANKSN  140

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVE  292
            +++P    I  +  S+RLDDWVLCRI++K+    P E
Sbjct  141  SYKP----IRLRDHSMRLDDWVLCRIYRKSNHLSPTE  173



>gb|AGL39678.1| NAC transcription factor 022 [Jatropha curcas]
 gb|KDP29100.1| hypothetical protein JCGZ_16489 [Jatropha curcas]
Length=295

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 13/94 (14%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPILT  GT   GVKKALVFY+G+PPKG+KT+W+MHEYRL       +  + 
Sbjct  91   YWKATGTDKPILTSRGTLSIGVKKALVFYKGRPPKGIKTDWIMHEYRL-------LQTTV  143

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR  283
            A+ P       +K S+RLDDWVLCR+ +K+   R
Sbjct  144  AYNP------KRKGSMRLDDWVLCRVRQKSSLPR  171



>ref|XP_002987237.1| hypothetical protein SELMODRAFT_125697, partial [Selaginella 
moellendorffii]
 gb|EFJ11813.1| hypothetical protein SELMODRAFT_125697, partial [Selaginella 
moellendorffii]
Length=176

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 63/89 (71%), Gaps = 14/89 (16%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI T  G +K GVKKALVFY GK PKG+KTNW+MHEYRL          SS
Sbjct  95   YWKATGTDKPIHT-RGNRKVGVKKALVFYDGKAPKGVKTNWIMHEYRL--------VESS  145

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            +H+P  D       SLRLDDWVLCRI++K
Sbjct  146  SHKPAKDH-----KSLRLDDWVLCRIYEK  169



>gb|AEI98790.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 67/95 (71%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  116  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD--AS  172

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
              T +S   P         +SLRLDDWVLCRI+KK
Sbjct  173  GSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKK  207



>gb|AEI00649.1| NAC1 [Triticum aestivum]
 gb|EMT33003.1| NAC domain-containing protein 18 [Aegilops tauschii]
 gb|AIZ97667.1| NAC transcription factor NAM-D1 [Triticum aestivum]
Length=408

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASGS  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            + T+     P         +SLRLDDWVLCRI+KK
Sbjct  172  TTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKK  206



>gb|ABI94354.1| NAC transcription factor NAM-D1 [Aegilops tauschii]
Length=408

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTDASGS  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            + T+     P         +SLRLDDWVLCRI+KK
Sbjct  172  TTTSRPPPPPPVTGGSRAAASLRLDDWVLCRIYKK  206



>gb|ABK22535.1| unknown [Picea sitchensis]
Length=324

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 76/121 (63%), Gaps = 20/121 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+       K GVKKALVFY+GK P+G+KTNW+MHEYRL D      +AS 
Sbjct  100  YWKATGTDKPVTAGLNRMKVGVKKALVFYKGKAPRGIKTNWIMHEYRLAD------SASK  153

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR---PVESGGRG---DPTEDATVATST  343
            A +        +K S+RLDDWVLCRI++K+ +S+   P ES       DP ED  +A   
Sbjct  154  AAK--------RKGSIRLDDWVLCRIYEKHYASQKAVPKESNELSSCVDPEEDQYMAPVA  205

Query  344  S  346
            S
Sbjct  206  S  206



>gb|ABK23477.1| unknown [Picea sitchensis]
Length=324

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 76/121 (63%), Gaps = 20/121 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKP+       K GVKKALVFY+GK P+G+KTNW+MHEYRL D      +AS 
Sbjct  100  YWKATGTDKPVTAGLNRMKVGVKKALVFYKGKAPRGIKTNWIMHEYRLAD------SASK  153

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSR---PVESGGRG---DPTEDATVATST  343
            A +        +K S+RLDDWVLCRI++K+ +S+   P ES       DP ED  +A   
Sbjct  154  AAK--------RKGSIRLDDWVLCRIYEKHYASQKAVPKESNELSSCVDPEEDQYMAPVA  205

Query  344  S  346
            S
Sbjct  206  S  206



>gb|AGZ20129.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
 gb|AGZ20131.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            S TA++   P+        +SLRLDDWVLCRI+KK
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKK  205



>ref|XP_010054307.1| PREDICTED: NAC transcription factor 25-like [Eucalyptus grandis]
 gb|KCW89830.1| hypothetical protein EUGRSUZ_A02070 [Eucalyptus grandis]
Length=385

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 88/165 (53%), Gaps = 28/165 (17%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT-------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVV  160
            YWKATGTDK I+T + +       +K GVKKALVFY+GKPPKG+KTNW+MHEYRL +   
Sbjct  90   YWKATGTDKVIVTSSSSASAHQHHEKLGVKKALVFYKGKPPKGIKTNWIMHEYRLAE---  146

Query  161  NSMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSSRPVESGGRGDPTEDATVATS  340
               + +   RP  + +  K SS+RLDDWVLCRI+KK   S P        P +D      
Sbjct  147  ---SPAYNSRPNTNPLKLKDSSMRLDDWVLCRIYKKTNLS-PTAGASVATPDQDLEEEEE  202

Query  341  TSLDGCGGGGSDHQNPNSRASRGLSFGDFFEINNAHNLYNGTMMS  475
              L         HQN   +         F +I N H   NG +MS
Sbjct  203  EGLSNI------HQNEMLKP--------FADIPNNHVQNNGGLMS  233



>gb|AGZ20135.1| NAC transcription factor NAM-B1 [Triticum dicoccoides]
Length=405

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 69/95 (73%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D    
Sbjct  114  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD-ASG  171

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
            S TA++   P+        +SLRLDDWVLCRI+KK
Sbjct  172  STTATNRPPPVTGG-SRAAASLRLDDWVLCRIYKK  205



>ref|XP_006297959.1| hypothetical protein CARUB_v10014000mg [Capsella rubella]
 gb|EOA30857.1| hypothetical protein CARUB_v10014000mg [Capsella rubella]
Length=367

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 6/99 (6%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT---QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMT  172
            YWKATGTDK I   NG    +  G+KKALVFY+GKPPKG+KTNW+MHEYRL ++      
Sbjct  90   YWKATGTDKLIAVANGEGFHENIGIKKALVFYKGKPPKGVKTNWIMHEYRLAESFSPKRA  149

Query  173  ASSAHRP--LGD-DIVNKKSSLRLDDWVLCRIFKKNGSS  280
             SS+ +    GD ++ +K+ S+RLDDWVLCRI+KK+ +S
Sbjct  150  NSSSSKVNNFGDRNLKSKEYSMRLDDWVLCRIYKKSHAS  188



>gb|AEI98795.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 67/95 (71%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  116  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD--AS  172

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
              T +S   P         +SLRLDDWVLCRI+KK
Sbjct  173  GSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKK  207



>gb|AEI00650.1| NAC2 [Triticum aestivum]
Length=405

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 67/95 (71%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  113  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD--AS  169

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
              T +S   P         +SLRLDDWVLCRI+KK
Sbjct  170  GSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKK  204



>gb|AEI98789.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 67/95 (71%), Gaps = 9/95 (9%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGT------QKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVN  163
            YWKATGTDKPIL  +GT      +K GVKKALVFYRGKPPKG+KTNW+MHEYRL D   +
Sbjct  116  YWKATGTDKPIL-ASGTGCGLVREKLGVKKALVFYRGKPPKGLKTNWIMHEYRLTD--AS  172

Query  164  SMTASSAHRPLGDDIVNKKSSLRLDDWVLCRIFKK  268
              T +S   P         +SLRLDDWVLCRI+KK
Sbjct  173  GSTTTSRPPPPVTGGSRAAASLRLDDWVLCRIYKK  207



>ref|XP_008792524.1| PREDICTED: NAC transcription factor 29-like [Phoenix dactylifera]
Length=341

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 9/93 (10%)
 Frame = +2

Query  2    YWKATGTDKPILTCNGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRLPDNVVNSMTASS  181
            YWKATGTDKPI++    +  GVKKALVFY+G+PPKG+KT+W+MHEYRL +   N++    
Sbjct  88   YWKATGTDKPIISSKENKNIGVKKALVFYQGRPPKGLKTDWIMHEYRLAEAQNNNI----  143

Query  182  AHRPLGDDIVNKKSSLRLDDWVLCRIFKKNGSS  280
             +RP+      + SS+RLDDWVLCRI+KK+  +
Sbjct  144  -YRPMK----LRDSSMRLDDWVLCRIYKKSNHT  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2044329971256