BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3396_g1_i2 len=2303 path=[2281:0-320 2602:321-2302]

Length=2303
                                                                      Score     E

ref|XP_009793291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    739   0.0      
ref|XP_009590206.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    739   0.0      
ref|XP_004243357.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    721   0.0      
ref|XP_006357475.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    721   0.0      
emb|CDP14790.1|  unnamed protein product                                715   0.0      
ref|XP_006367645.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    714   0.0      
ref|XP_004248170.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      707   0.0      
ref|XP_009757172.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    701   0.0      
ref|XP_009588484.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    696   0.0      
ref|XP_011100262.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    685   0.0      
ref|XP_011037345.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    675   0.0      
ref|XP_002273772.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    675   0.0      Vitis vinifera
emb|CBI21857.3|  unnamed protein product                                672   0.0      
gb|ABK95966.1|  unknown                                                 664   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006376482.1|  glycosyl hydrolase family 5 family protein         662   0.0      
ref|XP_008229003.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    658   0.0      
ref|XP_009357862.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    657   0.0      
ref|XP_007198827.1|  hypothetical protein PRUPE_ppa005783mg             657   0.0      
ref|XP_009341984.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    655   0.0      
gb|KDP24127.1|  hypothetical protein JCGZ_25784                         654   0.0      
ref|XP_008367886.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    654   0.0      
ref|XP_009336206.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    652   0.0      
ref|NP_001280862.1|  mannan endo-1,4-beta-mannosidase 2-like            650   0.0      
ref|XP_010272456.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    649   0.0      
ref|XP_008353782.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    649   0.0      
ref|XP_004139946.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    647   0.0      
ref|XP_008448293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      642   0.0      
ref|XP_010260196.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    642   0.0      
ref|XP_007043603.1|  Glycosyl hydrolase superfamily protein             642   0.0      
ref|XP_010260194.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    641   0.0      
ref|XP_010260197.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    640   0.0      
ref|XP_010052017.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    637   0.0      
gb|EYU24916.1|  hypothetical protein MIMGU_mgv1a007803mg                635   0.0      
gb|KDO53904.1|  hypothetical protein CISIN_1g014151mg                   634   0.0      
ref|XP_006447301.1|  hypothetical protein CICLE_v10015394mg             632   0.0      
ref|XP_004303129.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    633   0.0      
ref|XP_010540874.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      631   0.0      
ref|XP_002517909.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    631   0.0      Ricinus communis
emb|CDY05783.1|  BnaC07g00200D                                          621   0.0      
ref|XP_006594850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    620   0.0      
gb|EPS70897.1|  mannan endo-1,4-beta-mannosidase 2                      620   0.0      
ref|XP_003540365.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    619   0.0      
ref|XP_006409005.1|  hypothetical protein EUTSA_v10001990mg             619   0.0      
ref|XP_006296707.1|  hypothetical protein CARUB_v10013751mg             619   0.0      
ref|XP_010526516.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    618   0.0      
ref|XP_007152175.1|  hypothetical protein PHAVU_004G108000g             618   0.0      
ref|NP_179660.2|  mannan endo-1,4-beta-mannosidase 2                    617   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412972.1|  hypothetical protein EUTSA_v10025261mg             616   0.0      
emb|CDX81978.1|  BnaC08g36230D                                          615   0.0      
gb|KHG04578.1|  Mannan endo-1,4-beta-mannosidase 2 -like protein        616   0.0      
ref|XP_002884216.1|  glycosyl hydrolase family 5 protein                615   0.0      
ref|XP_009117471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      615   0.0      
gb|KFK40440.1|  hypothetical protein AALP_AA3G373500                    615   0.0      
ref|XP_003539924.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    614   0.0      
ref|XP_003527431.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    612   0.0      
ref|XP_010089553.1|  Mannan endo-1,4-beta-mannosidase 2                 612   0.0      
ref|XP_009144379.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    612   0.0      
gb|AFK46805.1|  unknown                                                 612   0.0      
emb|CDY18983.1|  BnaC01g20850D                                          610   0.0      
ref|XP_010447999.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    610   0.0      
gb|KHN35251.1|  Mannan endo-1,4-beta-mannosidase 2                      608   0.0      
ref|XP_006283768.1|  hypothetical protein CARUB_v10004854mg             608   0.0      
ref|NP_194561.1|  mannan endo-1,4-beta-mannosidase 5                    607   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132717.1|  hypothetical protein PHAVU_011G118900g             606   0.0      
ref|XP_010433238.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      606   0.0      
ref|XP_002867455.1|  glycosyl hydrolase family 5 protein                604   0.0      
gb|KFK35900.1|  hypothetical protein AALP_AA4G051000                    603   0.0      
ref|XP_010438480.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    603   0.0      
ref|XP_010035760.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    603   0.0      
gb|KEH39139.1|  glycoside hydrolase family 5 protein                    603   0.0      
gb|AES89656.2|  glycoside hydrolase family 5 protein                    602   0.0      
ref|XP_004487276.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    602   0.0      
ref|XP_010689012.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    602   0.0      
emb|CDY31945.1|  BnaA07g00500D                                          600   0.0      
ref|XP_009102000.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    603   0.0      
ref|XP_004505577.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    600   0.0      
ref|XP_003607459.1|  Mannan endo-1,4-beta-mannosidase                   600   0.0      
ref|XP_010915914.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    598   0.0      
ref|XP_009144375.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    597   0.0      
gb|KHN27892.1|  Mannan endo-1,4-beta-mannosidase 2                      589   0.0      
gb|KHN31990.1|  Mannan endo-1,4-beta-mannosidase 2                      582   0.0      
ref|XP_009400567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    568   0.0      
ref|XP_009386799.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    560   0.0      
ref|XP_008791709.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      554   0.0      
ref|XP_010915420.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    549   0.0      
gb|AAD20927.1|  (1-4)-beta-mannan endohydrolase                         546   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009421284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    545   0.0      
ref|XP_006859039.1|  hypothetical protein AMTR_s00068p00182430          537   0.0      
ref|XP_002458478.1|  hypothetical protein SORBIDRAFT_03g034420          507   5e-169   Sorghum bicolor [broomcorn]
ref|XP_003569799.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    505   3e-168   
ref|XP_006644697.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    504   6e-168   
dbj|BAJ87988.1|  predicted protein                                      502   2e-167   
ref|XP_009413849.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    503   3e-167   
ref|NP_001130322.1|  uncharacterized protein LOC100191416               502   6e-167   Zea mays [maize]
gb|EMS67718.1|  Mannan endo-1,4-beta-mannosidase 2                      503   2e-166   
ref|NP_001044230.2|  Os01g0746700                                       498   1e-165   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75800.1|  hypothetical protein OsI_03716                          497   4e-165   Oryza sativa Indica Group [Indian rice]
gb|ADE76368.1|  unknown                                                 495   1e-164   
ref|XP_004969933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    493   4e-163   
gb|EAZ13519.1|  hypothetical protein OsJ_03436                          476   3e-157   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010490281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      458   6e-152   
ref|XP_010252627.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    453   4e-148   
emb|CBI33116.3|  unnamed protein product                                446   2e-145   
ref|XP_003635019.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    446   3e-145   
ref|XP_006839096.1|  hypothetical protein AMTR_s00090p00128510          442   4e-144   
emb|CAN77937.1|  hypothetical protein VITISV_033630                     440   6e-143   Vitis vinifera
ref|XP_010646197.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    438   2e-142   
ref|XP_008775162.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    426   1e-139   
ref|XP_002985744.1|  hypothetical protein SELMODRAFT_234864             423   4e-137   
ref|XP_009401505.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    424   6e-137   
gb|KHG13584.1|  Mannan endo-1,4-beta-mannosidase 6                      422   8e-136   
ref|XP_010057854.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    421   2e-135   
ref|XP_002974444.1|  hypothetical protein SELMODRAFT_101148             418   3e-135   
ref|XP_008775171.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    413   2e-134   
ref|XP_010090975.1|  Mannan endo-1,4-beta-mannosidase 6                 417   2e-134   
ref|XP_009766447.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    417   3e-134   
ref|XP_007026255.1|  Glycosyl hydrolase superfamily protein             411   8e-132   
gb|KDP37779.1|  hypothetical protein JCGZ_06458                         410   1e-131   
ref|XP_011008632.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    409   2e-131   
ref|XP_002307872.2|  hypothetical protein POPTR_0006s01100g             407   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_003563908.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    404   7e-129   
ref|XP_009631226.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    403   1e-128   
gb|EYU27707.1|  hypothetical protein MIMGU_mgv1a006272mg                402   2e-128   
sp|Q0DCM5.2|MAN6_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    402   2e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659494.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    401   3e-128   
ref|XP_002436944.1|  hypothetical protein SORBIDRAFT_10g011830          401   5e-128   Sorghum bicolor [broomcorn]
ref|XP_002520563.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    400   1e-127   Ricinus communis
ref|XP_004965323.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    399   3e-127   
ref|XP_006352360.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    399   3e-127   
ref|XP_007033492.1|  Mannan endo-1,4-beta-mannosidase 6 isoform 1       400   5e-127   
gb|KDO64139.1|  hypothetical protein CISIN_1g012093mg                   395   5e-126   
gb|KDO64137.1|  hypothetical protein CISIN_1g012093mg                   395   6e-126   
dbj|BAK00462.1|  predicted protein                                      395   6e-126   
gb|KDO64138.1|  hypothetical protein CISIN_1g012093mg                   395   2e-125   
ref|XP_006481220.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    394   3e-125   
ref|XP_006429615.1|  hypothetical protein CICLE_v10011654mg             394   6e-125   
ref|XP_002273230.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    394   7e-125   Vitis vinifera
ref|XP_004250262.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      393   1e-124   
gb|KDP21853.1|  hypothetical protein JCGZ_00640                         392   2e-124   
gb|KHG08771.1|  Mannan endo-1,4-beta-mannosidase 6 -like protein        392   3e-124   
ref|XP_010653331.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    389   7e-124   
ref|XP_010928140.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    390   8e-124   
gb|EYU42036.1|  hypothetical protein MIMGU_mgv1a005847mg                391   9e-124   
gb|EYU42035.1|  hypothetical protein MIMGU_mgv1a005847mg                391   9e-124   
emb|CBI18019.3|  unnamed protein product                                391   9e-124   
ref|XP_010653330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    390   1e-123   
ref|XP_009410508.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 8      389   2e-123   
emb|CBI18021.3|  unnamed protein product                                387   2e-123   
ref|XP_002273389.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    389   2e-123   Vitis vinifera
ref|XP_011018989.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    388   3e-123   
gb|KHN29491.1|  Mannan endo-1,4-beta-mannosidase 6                      389   3e-123   
ref|XP_008775972.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    388   5e-123   
ref|XP_010913204.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    388   6e-123   
ref|XP_010327704.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    387   6e-123   
ref|XP_003626672.1|  Mannan endo-1,4-beta-mannosidase                   388   7e-123   
ref|XP_011001681.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    389   8e-123   
gb|AET01148.2|  mannan endo-1,4-beta-mannosidase-like protein           388   9e-123   
ref|XP_011018982.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    388   9e-123   
ref|XP_004249033.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    387   1e-122   
ref|XP_007140064.1|  hypothetical protein PHAVU_008G081200g             387   1e-122   
gb|AFX59322.1|  endo-1,4-beta-mannanase                                 388   2e-122   
ref|XP_003626642.1|  Mannan endo-1,4-beta-mannosidase                   387   2e-122   
ref|XP_003534636.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    388   2e-122   
gb|KHN42134.1|  Mannan endo-1,4-beta-mannosidase 6                      385   3e-122   
ref|XP_008798844.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   4e-122   
ref|XP_010327703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    386   5e-122   
ref|XP_009614144.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   5e-122   
ref|XP_003522088.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   6e-122   
ref|XP_006576282.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   7e-122   
ref|XP_002528703.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    386   8e-122   Ricinus communis
ref|XP_006362338.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   8e-122   
ref|XP_010683461.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      385   1e-121   
ref|XP_010543149.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   1e-121   
ref|XP_006576281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   1e-121   
ref|XP_007134568.1|  hypothetical protein PHAVU_010G058300g             385   1e-121   
ref|XP_009774303.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    383   1e-121   
ref|XP_004492573.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   1e-121   
ref|XP_007134569.1|  hypothetical protein PHAVU_010G058300g             384   1e-121   
ref|XP_006576280.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    385   1e-121   
ref|XP_010043514.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    383   1e-121   
ref|XP_011018985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   2e-121   
ref|XP_009614143.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   2e-121   
gb|KEH23282.1|  mannan endo-1,4-beta-mannosidase                        384   2e-121   
ref|XP_009774302.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   2e-121   
ref|XP_008456477.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      385   2e-121   
gb|KEH23283.1|  mannan endo-1,4-beta-mannosidase                        384   2e-121   
ref|XP_011018983.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   3e-121   
ref|XP_009774301.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    383   3e-121   
ref|XP_011018984.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   3e-121   
gb|ACU19893.1|  unknown                                                 384   4e-121   Glycine max [soybeans]
ref|XP_003548330.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   4e-121   
ref|XP_006466833.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    382   5e-121   
ref|XP_011018981.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   6e-121   
gb|KDO70993.1|  hypothetical protein CISIN_1g013811mg                   382   8e-121   
ref|XP_011095154.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    384   8e-121   
ref|XP_010244546.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      384   9e-121   
ref|XP_011095155.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    382   1e-120   
ref|XP_010921181.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    382   1e-120   
ref|XP_010043507.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    383   1e-120   
gb|KEH23290.1|  mannan endo-1,4-beta-mannosidase-like protein           380   2e-120   
ref|XP_006599739.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    383   2e-120   
ref|XP_004149910.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    382   2e-120   
ref|XP_010921182.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    381   2e-120   
ref|XP_009614142.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    382   2e-120   
gb|KDP44593.1|  hypothetical protein JCGZ_22175                         380   3e-120   
ref|XP_003552321.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    382   3e-120   
ref|XP_010490492.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    381   4e-120   
gb|KEH17803.1|  mannan endo-1,4-beta-mannosidase-like protein           381   5e-120   
ref|NP_195813.1|  mannan endo-1,4-beta-mannosidase 6                    380   7e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424015.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    380   7e-120   
ref|XP_010686734.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    379   7e-120   
ref|XP_006656920.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    376   8e-120   
gb|AET01118.2|  mannan endo-1,4-beta-mannosidase-like protein           380   8e-120   
ref|XP_010921180.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    380   1e-119   
ref|NP_001280873.1|  mannan endo-1,4-beta-mannosidase 7-like prec...    378   2e-119   
ref|XP_008782689.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    378   2e-119   
ref|XP_002323680.2|  hypothetical protein POPTR_0016s14550g             379   2e-119   Populus trichocarpa [western balsam poplar]
ref|XP_006398561.1|  hypothetical protein EUTSA_v10013730mg             377   3e-119   
ref|XP_002870892.1|  hypothetical protein ARALYDRAFT_349416             379   3e-119   
ref|XP_006279332.1|  hypothetical protein CARUB_v10012718mg             378   3e-119   
gb|KHG22102.1|  Mannan endo-1,4-beta-mannosidase 7 -like protein        377   5e-119   
ref|XP_002974905.1|  hypothetical protein SELMODRAFT_232427             376   8e-119   
ref|XP_003612065.1|  Mannan endo-1,4-beta-mannosidase                   377   9e-119   
ref|XP_006425633.1|  hypothetical protein CICLE_v10025631mg             376   1e-118   
ref|XP_008370277.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    377   2e-118   
ref|XP_008370275.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    377   2e-118   
ref|XP_011015126.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    376   2e-118   
ref|XP_006841534.1|  hypothetical protein AMTR_s00003p00158370          375   2e-118   
dbj|BAJ34043.1|  unnamed protein product                                377   2e-118   
ref|XP_009370900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    377   2e-118   
ref|XP_009370901.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    377   3e-118   
gb|KCW46726.1|  hypothetical protein EUGRSUZ_K00548                     373   3e-118   
ref|XP_010424017.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    374   3e-118   
ref|XP_002988915.1|  hypothetical protein SELMODRAFT_129038             374   3e-118   
ref|XP_003553696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    375   3e-118   
ref|XP_011013722.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    375   4e-118   
ref|XP_010113415.1|  Mannan endo-1,4-beta-mannosidase 7                 375   4e-118   
ref|XP_010038519.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    374   5e-118   
ref|XP_002466346.1|  hypothetical protein SORBIDRAFT_01g006080          377   5e-118   Sorghum bicolor [broomcorn]
ref|XP_008244712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      376   5e-118   
ref|XP_001760262.1|  predicted protein                                  374   5e-118   
gb|ACN78662.1|  endo-beta-mannanase                                     374   8e-118   Actinidia arguta
ref|XP_011011941.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    374   8e-118   
ref|XP_007046870.1|  Glycosyl hydrolase superfamily protein isofo...    374   9e-118   
emb|CDY11173.1|  BnaA03g00090D                                          374   1e-117   
ref|XP_006841527.1|  hypothetical protein AMTR_s00003p00152240          373   1e-117   
ref|XP_009130619.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    374   1e-117   
emb|CDP06381.1|  unnamed protein product                                375   2e-117   
ref|XP_004302566.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    372   2e-117   
ref|XP_009130618.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    374   2e-117   
ref|XP_010424014.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    374   2e-117   
ref|XP_001784893.1|  predicted protein                                  373   3e-117   
sp|Q0JKM9.2|MAN1_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    373   3e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010029765.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      372   3e-117   
gb|EEC71222.1|  hypothetical protein OsI_03157                          372   3e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_009365114.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    372   5e-117   
ref|XP_009336054.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    372   6e-117   
gb|EMT32497.1|  Mannan endo-1,4-beta-mannosidase 2                      370   6e-117   
ref|XP_009394803.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    372   6e-117   
ref|XP_010922771.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    372   7e-117   
ref|XP_002309191.2|  hypothetical protein POPTR_0006s11040g             374   8e-117   Populus trichocarpa [western balsam poplar]
ref|XP_002281804.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      371   9e-117   Vitis vinifera
gb|ACN78663.1|  endo-beta-mannanase                                     371   1e-116   Malus domestica [apple tree]
ref|XP_010922772.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    372   1e-116   
ref|XP_010543148.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    373   2e-116   
ref|XP_010543147.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    372   2e-116   
ref|XP_004977393.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    370   2e-116   
ref|XP_010679767.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      370   2e-116   
ref|XP_008359828.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    371   3e-116   
ref|XP_008338221.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    369   5e-116   
emb|CDP19235.1|  unnamed protein product                                369   6e-116   
ref|XP_008797528.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    369   7e-116   
emb|CAC08442.1|  (1-4)-beta-mannan endohydrolase                        368   8e-116   Coffea arabica [arabica coffee]
ref|XP_006383170.1|  (1-4)-beta-mannan endohydrolase family protein     369   8e-116   
gb|KHN36084.1|  Mannan endo-1,4-beta-mannosidase 7                      369   1e-115   
ref|XP_008788512.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    369   1e-115   
ref|XP_003605853.1|  Mannan endo-1,4-beta-mannosidase                   367   1e-115   
ref|XP_009365529.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    368   2e-115   
gb|ACU18982.1|  unknown                                                 368   2e-115   Glycine max [soybeans]
ref|XP_003517214.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    367   3e-115   
ref|XP_011085841.1|  PREDICTED: putative mannan endo-1,4-beta-man...    366   3e-115   
ref|XP_009340713.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      367   3e-115   
ref|XP_007017589.1|  Glycosyl hydrolase superfamily protein             367   3e-115   
ref|XP_002974285.1|  hypothetical protein SELMODRAFT_101525             367   4e-115   
emb|CDP01989.1|  unnamed protein product                                367   4e-115   
ref|XP_006444660.1|  hypothetical protein CICLE_v10020376mg             366   4e-115   
ref|XP_002310816.2|  hypothetical protein POPTR_0007s13190g             367   4e-115   
ref|XP_006836841.1|  hypothetical protein AMTR_s00099p00070100          366   5e-115   
ref|XP_010263608.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    367   7e-115   
ref|XP_006491440.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    365   8e-115   
ref|XP_009337787.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      368   8e-115   
ref|XP_009347596.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    366   8e-115   
ref|XP_011025835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      366   8e-115   
ref|XP_001762204.1|  predicted protein                                  365   9e-115   
ref|XP_004512071.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    366   9e-115   
ref|XP_006644473.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    366   1e-114   
ref|XP_010254774.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    366   1e-114   
ref|XP_011083199.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      365   2e-114   
ref|XP_009619497.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    365   2e-114   
ref|XP_003634618.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    364   3e-114   
ref|XP_010035363.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    363   3e-114   
ref|XP_002264115.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      365   3e-114   
ref|XP_004510098.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    374   4e-114   
ref|XP_004962462.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    366   4e-114   
ref|XP_006663750.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    362   4e-114   
gb|EAZ36778.1|  hypothetical protein OsJ_21115                          366   5e-114   
ref|XP_010490985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    363   6e-114   
gb|EAZ19452.1|  hypothetical protein OsJ_35013                          362   7e-114   
gb|AGG82699.1|  endo-1,4-beta-mannosidase                               363   7e-114   
gb|ACN78666.1|  endo-beta-mannanase                                     363   8e-114   
ref|XP_010914857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    364   8e-114   
sp|Q2RBB1.3|MAN7_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    362   1e-113   
ref|XP_009391672.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    364   1e-113   
ref|XP_009395690.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    363   1e-113   
sp|Q0IQJ7.2|MAN8_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    361   1e-113   
gb|EEE52650.1|  hypothetical protein OsJ_35012                          361   2e-113   
emb|CDP07490.1|  unnamed protein product                                363   2e-113   
ref|XP_004147857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    362   2e-113   
ref|XP_010486712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    362   2e-113   
ref|XP_004154850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    362   2e-113   
ref|XP_008241714.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      363   2e-113   
ref|XP_009407087.1|  PREDICTED: putative mannan endo-1,4-beta-man...    361   2e-113   
gb|KGN59983.1|  hypothetical protein Csa_3G859700                       362   2e-113   
ref|XP_009762330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    362   3e-113   
ref|XP_007202078.1|  hypothetical protein PRUPE_ppa005992mg             362   3e-113   
gb|ABV32548.1|  endo-1,4-beta-mannosidase protein 2                     362   3e-113   
gb|ABY58035.1|  mannase                                                 362   4e-113   
ref|XP_008800703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    362   4e-113   
ref|XP_006279868.1|  hypothetical protein CARUB_v10028560mg             362   4e-113   
gb|EEC67554.1|  hypothetical protein OsI_34887                          360   5e-113   
ref|XP_003537602.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    361   5e-113   
ref|XP_010914840.1|  PREDICTED: putative mannan endo-1,4-beta-man...    361   5e-113   
ref|XP_008805817.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    360   6e-113   
ref|XP_001774665.1|  predicted protein                                  362   6e-113   
gb|KCW46727.1|  hypothetical protein EUGRSUZ_K00550                     359   6e-113   
ref|XP_004143522.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    361   7e-113   
ref|XP_008800333.1|  PREDICTED: putative mannan endo-1,4-beta-man...    360   8e-113   
ref|XP_004291857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    361   8e-113   
gb|EEC68738.1|  hypothetical protein OsI_37245                          360   9e-113   
ref|NP_187701.1|  putative mannan endo-1,4-beta-mannosidase 4           360   1e-112   
gb|KDP38537.1|  hypothetical protein JCGZ_04462                         360   1e-112   
ref|XP_002884818.1|  predicted protein                                  360   2e-112   
ref|XP_010038521.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    359   2e-112   
ref|XP_010490914.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    359   2e-112   
ref|XP_008440745.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      359   2e-112   
gb|ADN34185.1|  endo-beta-mannanase                                     360   2e-112   
ref|XP_007222385.1|  hypothetical protein PRUPE_ppa006029mg             360   2e-112   
ref|XP_010444793.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      360   2e-112   
ref|XP_002865067.1|  predicted protein                                  360   2e-112   
ref|NP_201447.1|  mannan endo-1,4-beta-mannosidase 7                    360   3e-112   
gb|ABV32547.1|  endo-1,4-beta-mannosidase protein 1                     360   3e-112   
ref|XP_009406291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    358   3e-112   
ref|XP_009103527.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      359   4e-112   
ref|XP_010926118.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      359   5e-112   
ref|XP_011083658.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    359   5e-112   
ref|XP_007156980.1|  hypothetical protein PHAVU_002G033500g             359   5e-112   
ref|XP_008805818.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    357   5e-112   
ref|XP_003591288.1|  Mannan endo-1,4-beta-mannosidase                   358   5e-112   
ref|XP_010246810.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    358   6e-112   
ref|XP_010464779.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    358   6e-112   
ref|XP_002272344.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      358   6e-112   
gb|ABF69949.1|  (1-4)-beta-mannan endohydrolase (mannan endo-1,4-...    358   6e-112   
ref|XP_006435034.1|  hypothetical protein CICLE_v10001262mg             358   6e-112   
gb|EYU45779.1|  hypothetical protein MIMGU_mgv1a020287mg                357   8e-112   
ref|XP_002270023.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      357   8e-112   
ref|XP_002450155.1|  hypothetical protein SORBIDRAFT_05g001260          357   9e-112   
gb|KEH36174.1|  mannan endo-1,4-beta-mannosidase-like protein           357   9e-112   
ref|XP_008466539.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    360   1e-111   
ref|XP_006473535.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    358   1e-111   
gb|KHN14185.1|  Putative mannan endo-1,4-beta-mannosidase 9             357   1e-111   
ref|XP_003591290.1|  Mannan endo-1,4-beta-mannosidase                   359   1e-111   
ref|XP_007051341.1|  Glycosyl hydrolase superfamily protein isofo...    357   1e-111   
gb|KEH43147.1|  mannan endo-1,4-beta-mannosidase-like protein           357   2e-111   
ref|NP_001235608.1|  endo-1,4-beta-mannanase precursor                  356   2e-111   
ref|XP_006407494.1|  hypothetical protein EUTSA_v10020842mg             356   2e-111   
ref|XP_010110051.1|  Mannan endo-1,4-beta-mannosidase 7                 357   2e-111   
gb|KFK38477.1|  hypothetical protein AALP_AA3G118100                    357   2e-111   
ref|XP_003577132.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 8      355   3e-111   
ref|XP_010522865.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    357   3e-111   
gb|KFK28321.1|  hypothetical protein AALP_AA8G500900                    357   3e-111   
ref|XP_003554587.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    356   3e-111   
gb|KHN14221.1|  Mannan endo-1,4-beta-mannosidase 1                      356   3e-111   
ref|XP_003626162.1|  Mannan endo-1,4-beta-mannosidase                   357   3e-111   
ref|XP_003521650.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    356   4e-111   
gb|EYU45780.1|  hypothetical protein MIMGU_mgv1a025011mg                355   4e-111   
ref|XP_006655193.1|  PREDICTED: putative mannan endo-1,4-beta-man...    358   5e-111   
ref|XP_004495835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    355   6e-111   
ref|XP_010943133.1|  PREDICTED: putative mannan endo-1,4-beta-man...    355   7e-111   
emb|CDY45231.1|  BnaA07g12590D                                          357   8e-111   
gb|EEC80480.1|  hypothetical protein OsI_22707                          357   8e-111   
gb|ACG41070.1|  1,4-beta-D-mannan endohydrolase precursor               355   8e-111   
ref|XP_010484638.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    356   8e-111   
ref|XP_004232427.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      356   8e-111   
ref|XP_002510418.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    356   9e-111   
emb|CDY68324.1|  BnaCnng58510D                                          368   1e-110   
ref|XP_010490811.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    355   1e-110   
ref|XP_010911540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    354   1e-110   
ref|XP_001756671.1|  predicted protein                                  353   1e-110   
ref|XP_006662679.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    353   1e-110   
ref|XP_011007449.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    354   1e-110   
ref|XP_008220834.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    355   1e-110   
gb|KHN45867.1|  Mannan endo-1,4-beta-mannosidase 7                      354   2e-110   
ref|NP_187700.1|  mannan endo-1,4-beta-mannosidase 3                    354   3e-110   
gb|KEH43148.1|  mannan endo-1,4-beta-mannosidase-like protein           353   3e-110   
ref|XP_004141631.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    354   3e-110   
ref|XP_002306881.1|  hypothetical protein POPTR_0005s25120g             354   3e-110   
gb|KDO84614.1|  hypothetical protein CISIN_1g014426mg                   354   3e-110   
gb|EMT06168.1|  Mannan endo-1,4-beta-mannosidase 7                      352   4e-110   
ref|XP_006590696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    353   4e-110   
ref|XP_008648425.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    356   4e-110   
ref|XP_007163264.1|  hypothetical protein PHAVU_001G219800g             353   5e-110   
ref|XP_006300225.1|  hypothetical protein CARUB_v10016461mg             353   6e-110   
ref|XP_010064850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    352   6e-110   
ref|NP_001176761.1|  Os12g0117250                                       350   8e-110   
gb|KHG12601.1|  Mannan endo-1,4-beta-mannosidase 4                      352   1e-109   
ref|XP_008799989.1|  PREDICTED: putative mannan endo-1,4-beta-man...    352   1e-109   
ref|XP_008778492.1|  PREDICTED: putative mannan endo-1,4-beta-man...    352   1e-109   
ref|XP_003545272.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    353   1e-109   
ref|XP_010924295.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    353   1e-109   
ref|XP_008459570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    352   1e-109   
ref|XP_006393839.1|  hypothetical protein EUTSA_v10004263mg             352   1e-109   
gb|AHA84179.1|  endo-1,4-beta-mannanase                                 352   2e-109   
gb|EMS49637.1|  Mannan endo-1,4-beta-mannosidase 7                      351   2e-109   
ref|XP_008778491.1|  PREDICTED: putative mannan endo-1,4-beta-man...    353   2e-109   
ref|XP_009785219.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    352   3e-109   
ref|XP_002272567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      351   3e-109   
ref|XP_002515142.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    351   3e-109   
ref|XP_009789471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    350   4e-109   
ref|XP_004164540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    351   4e-109   
ref|XP_009416732.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    351   5e-109   
ref|XP_003528027.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    351   5e-109   
ref|NP_001241893.1|  uncharacterized protein LOC100814337 precursor     350   5e-109   
gb|AFK43830.1|  unknown                                                 350   6e-109   
emb|CAC51690.3|  endo-beta-1,4-mannanase                                350   7e-109   
ref|XP_008799988.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    349   8e-109   
ref|XP_007163300.1|  hypothetical protein PHAVU_001G223100g             350   9e-109   
ref|XP_010465469.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    350   9e-109   
ref|XP_004969435.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    350   1e-108   
ref|XP_006340651.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    350   1e-108   
ref|XP_002454605.1|  hypothetical protein SORBIDRAFT_04g034200          349   1e-108   
gb|KHN43366.1|  Mannan endo-1,4-beta-mannosidase 1                      347   2e-108   
ref|XP_008669933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    350   2e-108   
gb|KDP28371.1|  hypothetical protein JCGZ_14142                         348   3e-108   
ref|XP_006478472.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    348   3e-108   
ref|XP_008338066.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    349   3e-108   
ref|XP_010550422.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      348   4e-108   
ref|XP_003540598.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    348   5e-108   
ref|XP_006588317.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    347   5e-108   
gb|KHN20963.1|  Mannan endo-1,4-beta-mannosidase 7                      348   7e-108   
emb|CAN71995.1|  hypothetical protein VITISV_023484                     347   7e-108   
ref|XP_009112304.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    348   8e-108   
ref|XP_009593808.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    347   8e-108   
ref|XP_006296763.1|  hypothetical protein CARUB_v10015594mg             347   1e-107   
ref|XP_009602297.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    347   1e-107   
ref|XP_004141536.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    347   1e-107   
ref|XP_009122559.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    347   1e-107   
gb|EYU22711.1|  hypothetical protein MIMGU_mgv1a025294mg                346   1e-107   
ref|XP_010522866.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    347   2e-107   
ref|XP_002269954.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      346   2e-107   
ref|XP_009779875.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    346   2e-107   
ref|XP_007136624.1|  hypothetical protein PHAVU_009G059700g             346   3e-107   
ref|XP_006441716.1|  hypothetical protein CICLE_v10023981mg             345   4e-107   
ref|XP_009621242.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    345   4e-107   
ref|XP_010061294.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    346   4e-107   
gb|KGN52650.1|  hypothetical protein Csa_5G648710                       345   6e-107   
ref|XP_004494942.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    345   7e-107   
gb|KCW68225.1|  hypothetical protein EUGRSUZ_F01879                     346   9e-107   
ref|XP_006342222.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    344   1e-106   
emb|CBI17039.3|  unnamed protein product                                345   2e-106   
emb|CAC08208.1|  (1-4)-beta-mannan endohydrolase                        344   2e-106   
ref|XP_008664308.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    344   2e-106   
tpg|DAA58240.1|  TPA: putative endo-1,4-beta-mannosidase family p...    344   2e-106   
ref|XP_004955228.1|  PREDICTED: putative mannan endo-1,4-beta-man...    343   2e-106   
ref|XP_009760858.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      342   5e-106   
ref|XP_003573047.1|  PREDICTED: putative mannan endo-1,4-beta-man...    343   5e-106   
ref|XP_004238284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    342   8e-106   
ref|XP_009785847.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    343   1e-105   
ref|XP_004303778.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    342   1e-105   
ref|NP_001145882.1|  uncharacterized protein LOC100279398 precursor     342   1e-105   
sp|Q9LW44.3|MANP_ARATH  RecName: Full=Putative mannan endo-1,4-be...    341   2e-105   
ref|XP_006356569.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    342   2e-105   
dbj|BAK05001.1|  predicted protein                                      342   2e-105   
ref|XP_010480869.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      341   2e-105   
ref|XP_007160733.1|  hypothetical protein PHAVU_001G012600g             341   2e-105   
ref|XP_009631900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    341   2e-105   
gb|EYU22710.1|  hypothetical protein MIMGU_mgv1a023976mg                340   2e-105   
emb|CDP20125.1|  unnamed protein product                                342   2e-105   
ref|XP_009601553.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    341   2e-105   
ref|XP_006356570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    342   2e-105   
ref|NP_001043785.1|  Os01g0663300                                       340   3e-105   
gb|KDO45466.1|  hypothetical protein CISIN_1g016140mg                   340   3e-105   
ref|XP_010490578.1|  PREDICTED: putative mannan endo-1,4-beta-man...    340   4e-105   
ref|XP_010457203.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    340   4e-105   
emb|CDX81394.1|  BnaC09g08050D                                          358   4e-105   
ref|XP_011069567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    340   4e-105   
ref|NP_001234473.1|  (1-4)-beta-mannan endohydrolase precursor          340   4e-105   
ref|XP_003549439.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    341   5e-105   
ref|XP_009785881.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      340   5e-105   
ref|XP_009616037.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    340   6e-105   
ref|XP_002456093.1|  hypothetical protein SORBIDRAFT_03g030340          340   1e-104   



>ref|XP_009793291.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
Length=440

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/438 (77%), Positives = 392/438 (89%), Gaps = 1/438 (0%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MVKS  S+MLA NG+FYPIIGFA+F+AF+YL+FGDLWV+Y +E + LSFVERNGTQFY D
Sbjct  1     MVKSSMSRMLAGNGLFYPIIGFASFIAFLYLSFGDLWVNYSKE-INLSFVERNGTQFYVD  59

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
             G+VFYVNGWNSYW M+HA D+  RPR+RTMLQA+AKMG+TVCRTWAFNDG YNALQISPG
Sbjct  60    GKVFYVNGWNSYWLMDHAADYSTRPRIRTMLQASAKMGLTVCRTWAFNDGGYNALQISPG  119

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             KFDE+VFRALD VIAE+RR+GIRLIL LVNNL+AYGGKTQYVKWAW+EG+ LS SNDSFF
Sbjct  120   KFDEKVFRALDHVIAEARRNGIRLILSLVNNLQAYGGKTQYVKWAWEEGVALSSSNDSFF  179

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             YDP+IRRYFKNYVKTVLTR+N  TG+EYRDDPTIFAWELINEPRCMTDP+GDTLQDWIEE
Sbjct  180   YDPSIRRYFKNYVKTVLTRRNIYTGIEYRDDPTIFAWELINEPRCMTDPSGDTLQDWIEE  239

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             MSTFVKSID+ HLLTVGLEGFYGPK PK+   NPE+WAADLGSDFIRNS LST+DFASVH
Sbjct  240   MSTFVKSIDRKHLLTVGLEGFYGPKSPKKSIANPEVWAADLGSDFIRNSILSTVDFASVH  299

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             VYPDHWF ++ F++ LKF  KW+LSHIEDG+R LKKP++FTEFGL+ + ++ EP QRDRF
Sbjct  300   VYPDHWFHHKNFEEMLKFAAKWMLSHIEDGDRELKKPVLFTEFGLSNDNEDFEPAQRDRF  359

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
              K++L+++YKSAK N+SGAGS FWQFLVERME +NDE+GIVPWE  STY LIT+ SCRLA
Sbjct  360   LKMVLDVIYKSAKRNRSGAGSFFWQFLVERMERFNDEYGIVPWENPSTYRLITDQSCRLA  419

Query  1931  GVHGVLPSQQEHLKSFCS  1984
              V G+L +Q EHLK+FC+
Sbjct  420   KVQGLLSTQVEHLKNFCA  437



>ref|XP_009590206.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009590207.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009590208.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
Length=440

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/438 (77%), Positives = 391/438 (89%), Gaps = 1/438 (0%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MVKS  S+MLA NG+FYPIIGFA+F+AF+YL+FGDLWV+Y +E + LSFVERNGTQFY D
Sbjct  1     MVKSSMSRMLAGNGLFYPIIGFASFIAFLYLSFGDLWVNYSKE-INLSFVERNGTQFYVD  59

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
             G+ FYVNGWNSYW M+HA D+  RPR+RTMLQA+AKMG+TVCRTWAFNDG YNALQISPG
Sbjct  60    GKAFYVNGWNSYWLMDHAADYSTRPRIRTMLQASAKMGLTVCRTWAFNDGGYNALQISPG  119

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             KFDE+VFRALD VIAE+RR+GIRLIL LVNNL+AYGGKTQYVKWAW+EG+ LS SNDSFF
Sbjct  120   KFDEKVFRALDHVIAEARRNGIRLILSLVNNLQAYGGKTQYVKWAWEEGVALSSSNDSFF  179

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             YDP+IRRYFKNYVKTVLTR+N  TG+EYRDDPTIFAWELINEPRCMTDP+GDTLQDWIEE
Sbjct  180   YDPSIRRYFKNYVKTVLTRRNIYTGIEYRDDPTIFAWELINEPRCMTDPSGDTLQDWIEE  239

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             MSTFVKSID+ HLLTVGLEGFYGPK PK+   NPE+WAADLGSDFIRNS LST+DFASVH
Sbjct  240   MSTFVKSIDRKHLLTVGLEGFYGPKSPKKSIANPEVWAADLGSDFIRNSILSTVDFASVH  299

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             VYPDHWF ++ F++ LKF  KW+LSHIEDG+R LKKP++FTEFGL+ + ++ EP QRDRF
Sbjct  300   VYPDHWFHHKNFEEMLKFAAKWMLSHIEDGDRELKKPVLFTEFGLSNDNEDFEPAQRDRF  359

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
              K++L+++YKSAK N+SGAGS FWQFLVERME +NDE+GIVPWE  STY LIT+ SCRLA
Sbjct  360   LKMVLDVIYKSAKRNRSGAGSFFWQFLVERMERFNDEYGIVPWENPSTYRLITDQSCRLA  419

Query  1931  GVHGVLPSQQEHLKSFCS  1984
              V G+L +Q EHLK+FC+
Sbjct  420   KVQGLLSTQVEHLKNFCA  437



>ref|XP_004243357.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Solanum lycopersicum]
Length=441

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/438 (74%), Positives = 386/438 (88%), Gaps = 1/438 (0%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MVKS  ++MLA NG+FYPIIGFA+F+AF+YL+FGDLWV+Y +E + LSFVERNGTQF+ D
Sbjct  1     MVKSSMNRMLAGNGLFYPIIGFASFIAFLYLSFGDLWVNYSKE-INLSFVERNGTQFFVD  59

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
             G+VFY+NGWNSYW M+HA D+  RPR+RTMLQA AKMG+TVCRTWAFND  YNALQISPG
Sbjct  60    GKVFYINGWNSYWLMDHAADYNTRPRIRTMLQAGAKMGLTVCRTWAFNDAGYNALQISPG  119

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             KFDE+VFRALD VIAE+RR+GIRLIL LVNNL+AYGGKTQYVKWAW+EG+ LS SNDSFF
Sbjct  120   KFDEKVFRALDHVIAEARRNGIRLILSLVNNLQAYGGKTQYVKWAWEEGVALSASNDSFF  179

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             YDP+IRRYFK+YVKTVLTR+N  TG+EYRDDPTIFAWELINEPRCMTDP+GDTLQDWIEE
Sbjct  180   YDPSIRRYFKSYVKTVLTRRNIYTGIEYRDDPTIFAWELINEPRCMTDPSGDTLQDWIEE  239

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             MSTFVKSID+ HLLTVGLEGFYGPK PK+   NPE+WAADLGSDF+RNS LST+DFASVH
Sbjct  240   MSTFVKSIDRKHLLTVGLEGFYGPKSPKKTTANPEIWAADLGSDFVRNSILSTVDFASVH  299

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             VYPDHWF ++ F++ LKF  KW+LSHIEDG++ LKKP++FTEFGL+ +  + EP QRDRF
Sbjct  300   VYPDHWFHHKNFEEMLKFAAKWMLSHIEDGDKELKKPVLFTEFGLSNDNDDFEPAQRDRF  359

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
              K++L+++YKSAK NKSGAGS FWQFLVE+ME +NDE+G+VPWE  STY LIT  SCRLA
Sbjct  360   LKMVLDVIYKSAKRNKSGAGSFFWQFLVEKMERFNDEYGVVPWESPSTYRLITEQSCRLA  419

Query  1931  GVHGVLPSQQEHLKSFCS  1984
              V G+  +Q E++ +FC+
Sbjct  420   KVQGLHSTQIENVNNFCA  437



>ref|XP_006357475.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Solanum tuberosum]
Length=441

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/438 (74%), Positives = 386/438 (88%), Gaps = 1/438 (0%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MVKS  S+MLA NG+FYPIIGFA+F+AF+YL+FGDLWV+Y +E + LSFVERNGTQF+ D
Sbjct  1     MVKSSMSRMLAGNGLFYPIIGFASFIAFLYLSFGDLWVNYSKE-INLSFVERNGTQFFVD  59

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
             G+VFY+NGWNSYW M+HA D+  RPR+RT+LQA AKMG+TVCRTWAFND  YNALQISPG
Sbjct  60    GKVFYINGWNSYWLMDHAADYNTRPRIRTILQAGAKMGLTVCRTWAFNDAGYNALQISPG  119

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             KFDE+VFRALD VIAE+RR+GIRL+L LVNNL+AYGGKTQYVKWAW+EG+ LS SNDSFF
Sbjct  120   KFDEKVFRALDHVIAEARRNGIRLLLSLVNNLQAYGGKTQYVKWAWEEGVALSSSNDSFF  179

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             YDP+IRRYFK+YVKTVLTR+N  TG+EYRDDPTIFAWELINEPRCMTDP+GDTLQDWIEE
Sbjct  180   YDPSIRRYFKSYVKTVLTRRNIYTGIEYRDDPTIFAWELINEPRCMTDPSGDTLQDWIEE  239

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             MSTFVKSID+ HLLTVGLEGFYGPK PK+   NPE+WAADLGSDF+RNS LST+DFASVH
Sbjct  240   MSTFVKSIDRKHLLTVGLEGFYGPKSPKKTTANPEIWAADLGSDFVRNSILSTVDFASVH  299

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             VYPDHWF ++ F++ LKF  KW+LSHIEDG++ LKKP++FTEFGL+ +  + EP QRDRF
Sbjct  300   VYPDHWFHHKNFEEMLKFAAKWMLSHIEDGDKELKKPVLFTEFGLSNDNDDFEPAQRDRF  359

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
              K++L+++YKSAK NKSGAGS FWQFL E+ME +NDE+G+VPWE  STY LIT  SCRLA
Sbjct  360   LKMVLDVLYKSAKRNKSGAGSFFWQFLAEKMERFNDEYGVVPWESPSTYRLITQQSCRLA  419

Query  1931  GVHGVLPSQQEHLKSFCS  1984
              V G+  +Q E++K+FC+
Sbjct  420   KVQGLHSTQIENVKNFCA  437



>emb|CDP14790.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/441 (74%), Positives = 379/441 (86%), Gaps = 1/441 (0%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MVKS  S+MLA NG+ YPI+GFA+ +AFIYL+FGDLW+++  ET KLSFVERNGT F+ D
Sbjct  1     MVKSFMSRMLAGNGLLYPILGFASCIAFIYLSFGDLWINFNTET-KLSFVERNGTHFFLD  59

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
             G+VFY+NGWNSYW M+HAVD  +RPRV+ MLQ  AKMG TVCRTWAFNDG YNALQISPG
Sbjct  60    GRVFYINGWNSYWMMDHAVDEHKRPRVKAMLQVGAKMGFTVCRTWAFNDGDYNALQISPG  119

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             +FD +VFRALD VIAE+RR GIRLILCLVNNLKAYGGKTQYVKWAW EG+G+S SNDSFF
Sbjct  120   RFDAKVFRALDHVIAEARRQGIRLILCLVNNLKAYGGKTQYVKWAWDEGVGISSSNDSFF  179

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             YDP+IR YFKNY KTVLTRKNT+TG+EYRDDPTI AWELINEPRC+TDP+GDTLQDWIEE
Sbjct  180   YDPSIRHYFKNYAKTVLTRKNTITGIEYRDDPTILAWELINEPRCITDPSGDTLQDWIEE  239

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             MST+VKSID NHL+TVGLEGFYGPK PKRL +NPE WAADLGSDFIRNS +ST+DFASVH
Sbjct  240   MSTYVKSIDGNHLITVGLEGFYGPKSPKRLTVNPEFWAADLGSDFIRNSKISTVDFASVH  299

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             +YPDHWF +Q F++KLKF  KW+LSHIEDG+  LKKP++FTEFGL+ E K+  P QRD+F
Sbjct  300   IYPDHWFHDQAFEEKLKFVSKWMLSHIEDGDGELKKPVLFTEFGLSDENKDFTPSQRDKF  359

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
              KLIL+I+YKSAK +K+GAGS  WQF V  ME+Y D+F IVPWER STY L T  SC+LA
Sbjct  360   MKLILDIIYKSAKRDKAGAGSFVWQFFVGGMEKYYDDFAIVPWERPSTYQLFTRQSCKLA  419

Query  1931  GVHGVLPSQQEHLKSFCSKTQ  1993
              + GVLPSQ++ LK FCS  Q
Sbjct  420   ALQGVLPSQKQRLKDFCSHKQ  440



>ref|XP_006367645.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Solanum tuberosum]
Length=444

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/443 (75%), Positives = 383/443 (86%), Gaps = 2/443 (0%)
 Frame = +2

Query  671   MVKSRRSKMLARNG-MFYPIIGFAAFLAFIYLTFGDLW-VSYPEETLKLSFVERNGTQFY  844
             MV+S  S+ LARNG +FYP+IGFA F+ F+YL FGDLW  ++  E +KLSFVERNGTQF+
Sbjct  1     MVQSPMSRKLARNGGLFYPVIGFALFVTFLYLAFGDLWGFNFNREEIKLSFVERNGTQFF  60

Query  845   ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQIS  1024
              DG+ FY+NGWNSYW M+HAVD+  RPR++ +LQA AKMG+TVCRTWAFNDG YNALQIS
Sbjct  61    VDGKAFYINGWNSYWLMDHAVDYSNRPRIKGILQAGAKMGLTVCRTWAFNDGGYNALQIS  120

Query  1025  PGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDS  1204
             PG+FDERVFRALD VIAE+R++GIRL+L LVNNL A+GGKT+YVKWA +EG+ LS SNDS
Sbjct  121   PGRFDERVFRALDHVIAEARKNGIRLMLSLVNNLHAFGGKTEYVKWAEKEGVALSSSNDS  180

Query  1205  FFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWI  1384
             FFYDP IRRYFKNYVKTVLTR+N  TG+EYRDDPTIFAWELINEPRCMTDP+GDTLQDWI
Sbjct  181   FFYDPTIRRYFKNYVKTVLTRRNIYTGMEYRDDPTIFAWELINEPRCMTDPSGDTLQDWI  240

Query  1385  EEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFAS  1564
             EEMSTFVKSID+ HLLTVGLEGFYG K PKR   NPE WAADLGSDFIRNS LSTIDFAS
Sbjct  241   EEMSTFVKSIDRKHLLTVGLEGFYGRKSPKRSSGNPEFWAADLGSDFIRNSMLSTIDFAS  300

Query  1565  VHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRD  1744
             VHVYPDHWF ++ F++KLKF  KW+LSHIEDG++ L+KPIMFTEFGL+ E ++ EP QRD
Sbjct  301   VHVYPDHWFHDKKFEEKLKFAAKWMLSHIEDGDKELRKPIMFTEFGLSNENEDFEPAQRD  360

Query  1745  RFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCR  1924
             RF+K++L+ +YKSAK N+SGAGS FWQFLVE ME YND+FGIVPWER STY LIT  SCR
Sbjct  361   RFYKMVLDFIYKSAKRNRSGAGSFFWQFLVEGMELYNDDFGIVPWERPSTYQLITEQSCR  420

Query  1925  LAGVHGVLPSQQEHLKSFCSKTQ  1993
             LA  HGVLP+Q EHLK FC+ T+
Sbjct  421   LAKEHGVLPTQMEHLKDFCASTR  443



>ref|XP_004248170.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Solanum lycopersicum]
Length=444

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/443 (74%), Positives = 382/443 (86%), Gaps = 2/443 (0%)
 Frame = +2

Query  671   MVKSRRSKMLARNG-MFYPIIGFAAFLAFIYLTFGDLW-VSYPEETLKLSFVERNGTQFY  844
             MV+S  S+ L RNG +FYP+IGFA F+ F+YL FG+LW  ++  E +KLSFVERNGTQF+
Sbjct  1     MVQSPMSRKLVRNGGLFYPVIGFALFVTFLYLAFGNLWGFNFNREEIKLSFVERNGTQFF  60

Query  845   ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQIS  1024
              DG+ FY+NGWNSYW M+HAVD+  RPR++ +LQA AKMG++VCRTWAFNDG YNALQIS
Sbjct  61    VDGKAFYINGWNSYWLMDHAVDYSNRPRIKGILQAGAKMGLSVCRTWAFNDGGYNALQIS  120

Query  1025  PGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDS  1204
             PG+FDERVFRALD VIAE+R++GIRL+L LVNNL A+GGKT+YVKWA +EG+ LS SNDS
Sbjct  121   PGRFDERVFRALDHVIAEARKNGIRLMLSLVNNLHAFGGKTEYVKWAEKEGVALSSSNDS  180

Query  1205  FFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWI  1384
             FFYDP IRRYFKNYVKTVLTR+N  TG+EYRDDPTIFAWELINEPRCMTDP+GDTLQDWI
Sbjct  181   FFYDPTIRRYFKNYVKTVLTRRNIYTGIEYRDDPTIFAWELINEPRCMTDPSGDTLQDWI  240

Query  1385  EEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFAS  1564
             EEMSTFVKSID+ HLLTVGLEGFYG K PKR   NPE WAADLGSDFIRNS LSTIDFAS
Sbjct  241   EEMSTFVKSIDRKHLLTVGLEGFYGRKSPKRSTGNPEFWAADLGSDFIRNSMLSTIDFAS  300

Query  1565  VHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRD  1744
             VHVYPDHWF ++ F++KLKF  KW+LSHIEDG++ L+KPIMFTEFGL+ E ++ EP QRD
Sbjct  301   VHVYPDHWFHDKNFEEKLKFAAKWMLSHIEDGDKELRKPIMFTEFGLSNENEDFEPAQRD  360

Query  1745  RFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCR  1924
             RF+K++L+ +YKSAK N+SGAGS FWQFLVE ME YND+FGIVPWER STY LIT HSCR
Sbjct  361   RFYKMVLDFIYKSAKRNRSGAGSFFWQFLVEGMELYNDDFGIVPWERPSTYELITEHSCR  420

Query  1925  LAGVHGVLPSQQEHLKSFCSKTQ  1993
             LA  HG+L +Q EHLK FC+ T+
Sbjct  421   LAKEHGLLHTQMEHLKDFCASTR  443



>ref|XP_009757172.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
 ref|XP_009757173.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
 ref|XP_009757174.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
sylvestris]
Length=444

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/443 (74%), Positives = 381/443 (86%), Gaps = 4/443 (1%)
 Frame = +2

Query  671   MVKSRRSKMLARNG-MFYPIIGFAAFLAFIYLTFGDL-WVSYPEETLKLSFVERNGTQFY  844
             MVKS  S+ L RNG + YP+IG A F+ F+YL+FGDL W SY +E ++LSFVERNGTQF+
Sbjct  3     MVKSPMSRKLTRNGGLIYPVIGLALFVTFLYLSFGDLLWFSYNKE-IELSFVERNGTQFF  61

Query  845   ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQIS  1024
              DG+VFY+NGWNSYW M+HAVD+ +R R+R +LQA AKMG+TVCRTWAFNDG YNALQIS
Sbjct  62    VDGKVFYINGWNSYWLMDHAVDYSKRSRIRGILQAGAKMGLTVCRTWAFNDGGYNALQIS  121

Query  1025  PGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDS  1204
             PG+FDERVFRALD VIAE+R++GIRL+L LVNNL A+GGKTQYVKWA +EG+ LS SNDS
Sbjct  122   PGRFDERVFRALDHVIAEARKNGIRLMLSLVNNLNAFGGKTQYVKWAEKEGVALSSSNDS  181

Query  1205  FFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWI  1384
             FFYDP IRRYFK+YVK VLTR+N  TG+EYRDDPTIFAWELINEPRCMTDP+GDTLQDWI
Sbjct  182   FFYDPTIRRYFKHYVKMVLTRRNVYTGIEYRDDPTIFAWELINEPRCMTDPSGDTLQDWI  241

Query  1385  EEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFAS  1564
             EEMSTFVKSID+ HLLTVGLEGFYG K PKR   NPE WAADLGSDFIRNS LSTIDFAS
Sbjct  242   EEMSTFVKSIDRKHLLTVGLEGFYGRKSPKRSTGNPEFWAADLGSDFIRNSMLSTIDFAS  301

Query  1565  VHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRD  1744
             VH+YPDHWF ++ F++KLKF  KW+LSHIEDG++ L+KPIMFTEFGL+ E  + EP QRD
Sbjct  302   VHIYPDHWF-HKKFEEKLKFAAKWMLSHIEDGDKELRKPIMFTEFGLSNENDDFEPVQRD  360

Query  1745  RFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCR  1924
             RF+K++L+I+YKSAK N+SGAGS  WQFLVE ME YND+FGIVPWER STY LIT  SCR
Sbjct  361   RFYKMVLDIIYKSAKRNRSGAGSFIWQFLVEGMELYNDDFGIVPWERPSTYQLITEQSCR  420

Query  1925  LAGVHGVLPSQQEHLKSFCSKTQ  1993
             LA  HGVLP+Q EHLK FC++T 
Sbjct  421   LAREHGVLPTQTEHLKDFCTRTS  443



>ref|XP_009588484.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nicotiana 
tomentosiformis]
Length=444

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/443 (73%), Positives = 383/443 (86%), Gaps = 4/443 (1%)
 Frame = +2

Query  671   MVKSRRSKMLARNG-MFYPIIGFAAFLAFIYLTFGDL-WVSYPEETLKLSFVERNGTQFY  844
             MVKS  S+ L RNG +FYP+I  A F+ F+YL+FGDL W SY +E +++SFVERNGTQF+
Sbjct  3     MVKSPMSRKLTRNGGLFYPLIALALFVTFLYLSFGDLLWFSYNKE-IEISFVERNGTQFF  61

Query  845   ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQIS  1024
              DG+VFY+NGWNSYW M+HAVD+ +R R+R +LQA AKMG+TVCRTWAFNDG YNALQIS
Sbjct  62    VDGKVFYINGWNSYWLMDHAVDYSKRSRIRGILQAGAKMGLTVCRTWAFNDGGYNALQIS  121

Query  1025  PGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDS  1204
             PG+FDERVFRALD VIAE+R++GIRL+L LVNNL A+GGKT+YVKWA +EG+ LS SNDS
Sbjct  122   PGRFDERVFRALDHVIAEARKNGIRLMLSLVNNLNAFGGKTRYVKWAEKEGVALSSSNDS  181

Query  1205  FFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWI  1384
             FFYDP IRRYFK+YVKTVLTR+N  TG+EYRDDPTIFAWE+INEPRCMTDP+GDTLQDWI
Sbjct  182   FFYDPTIRRYFKHYVKTVLTRRNVYTGIEYRDDPTIFAWEIINEPRCMTDPSGDTLQDWI  241

Query  1385  EEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFAS  1564
             EEMSTFVKSID+ HLLTVGLEGFYG K PKR   NPE WAADLGSDFIRNS LSTIDFAS
Sbjct  242   EEMSTFVKSIDRKHLLTVGLEGFYGRKSPKRSTGNPEFWAADLGSDFIRNSMLSTIDFAS  301

Query  1565  VHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRD  1744
             VH+YPDHWF ++ F++KLKF  KW+LSHIEDG++ L+KPIMFTEFGL+ E ++ EP QRD
Sbjct  302   VHIYPDHWF-HKKFEEKLKFAAKWMLSHIEDGDKELRKPIMFTEFGLSNENEDFEPVQRD  360

Query  1745  RFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCR  1924
             RF+K++L+I+YKSAK N+SGAGS FWQFLVE ME YND+FGIVPWER STY LIT  SCR
Sbjct  361   RFYKMVLDIIYKSAKRNRSGAGSFFWQFLVEGMELYNDDFGIVPWERPSTYQLITEQSCR  420

Query  1925  LAGVHGVLPSQQEHLKSFCSKTQ  1993
             LA  H +LP+Q E+LK FC++T 
Sbjct  421   LAREHDILPTQTEYLKDFCTRTS  443



>ref|XP_011100262.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Sesamum indicum]
Length=436

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/435 (71%), Positives = 372/435 (86%), Gaps = 1/435 (0%)
 Frame = +2

Query  686   RSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFY  865
             +SKM   NG+ YPIIGFA+ +AFIYL+FGDLW++   +T KLSFV RNG+QF  DG+ FY
Sbjct  3     KSKMFGGNGVLYPIIGFASCVAFIYLSFGDLWINLEGDT-KLSFVARNGSQFIVDGKPFY  61

Query  866   VNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDER  1045
              NGWNSYW M+HAVD   +PR+R MLQA AKMG+TVCRTWAFNDG YNALQI+PG+F+ER
Sbjct  62    FNGWNSYWMMDHAVDESSKPRIRAMLQAGAKMGLTVCRTWAFNDGDYNALQIAPGRFNER  121

Query  1046  VFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNI  1225
             VFRALD VIAESRR+GIRLILCLVNNL+AYGGKTQYVKWAW+EG+GLS SNDSFFYDP+I
Sbjct  122   VFRALDHVIAESRRYGIRLILCLVNNLQAYGGKTQYVKWAWEEGVGLSSSNDSFFYDPSI  181

Query  1226  RRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFV  1405
             RRYFKNYVKTVLTRKN++TG+EYRDDPTI AWELINEPRC+TD +GDTLQDWIEEMS FV
Sbjct  182   RRYFKNYVKTVLTRKNSITGVEYRDDPTILAWELINEPRCITDKSGDTLQDWIEEMSAFV  241

Query  1406  KSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDH  1585
             KSID+NH++TVGLEGFYGPK PKRL +NPE WAAD+G+DFIRNS +S +DFASVH+YPDH
Sbjct  242   KSIDRNHMITVGLEGFYGPKSPKRLTVNPEFWAADVGTDFIRNSKISAVDFASVHIYPDH  301

Query  1586  WFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLIL  1765
             W  N  F+ KLKF  KW+LSHIEDG++ LKKP+MFTEFGL+ E  +  P QR+R +K+I 
Sbjct  302   WTHNPDFEYKLKFVYKWMLSHIEDGDKELKKPVMFTEFGLSTENNDFTPTQRERMYKVIY  361

Query  1766  EIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGV  1945
             +++YKSA  NK+GAG++ WQFLVE ME++ND+FGI+PW+R STY L T  SCRLA V G 
Sbjct  362   DVIYKSALRNKAGAGALVWQFLVEGMEDFNDDFGIIPWKRPSTYKLFTEQSCRLARVQGA  421

Query  1946  LPSQQEHLKSFCSKT  1990
             LPSQ  +L+  C+++
Sbjct  422   LPSQLGYLRRLCTRS  436



>ref|XP_011037345.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Populus euphratica]
Length=435

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/434 (70%), Positives = 370/434 (85%), Gaps = 1/434 (0%)
 Frame = +2

Query  692   KMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVN  871
             KM+A NG+ YPI GFA+ +AFIYL+FGD  ++  +E  +LSFVERNGTQF  DG+ FY+N
Sbjct  3     KMVAGNGLLYPIFGFASCVAFIYLSFGDFILTNHQEHRELSFVERNGTQFMVDGRAFYIN  62

Query  872   GWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVF  1051
             GWNSYW M+H+VD  R+PRV  ML+A AKMG+TVCRTWAFNDG YNALQ+SPG+FDERV 
Sbjct  63    GWNSYWLMDHSVDEDRKPRVSAMLEAGAKMGLTVCRTWAFNDGGYNALQVSPGRFDERVL  122

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             RALD VIAE+R+HGIRL+L LVNNLKAYGGKTQYV WAW+EGIGLS SNDSFF+DP+I+R
Sbjct  123   RALDHVIAEARQHGIRLLLSLVNNLKAYGGKTQYVNWAWEEGIGLSSSNDSFFFDPSIKR  182

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             YFK+YVKT+LTRKNT+TG+EYR+DPTIFAWEL+NEPRCM+DP+GDTLQDWIEEMS FVK+
Sbjct  183   YFKHYVKTLLTRKNTITGIEYRNDPTIFAWELMNEPRCMSDPSGDTLQDWIEEMSAFVKT  242

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             IDKNHLLTVGLEGFYGPK+PKRL +NPE WA++LGSDF+RNS    IDFASVH+YPDHWF
Sbjct  243   IDKNHLLTVGLEGFYGPKNPKRLTVNPESWASNLGSDFVRNSKAPAIDFASVHIYPDHWF  302

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              +Q F+DKLK+  KW+LSHIEDG   L KP+ FTEFGL+   K+ +P QRDRF+K I +I
Sbjct  303   PHQEFEDKLKYVSKWMLSHIEDGHYELNKPVFFTEFGLSNLNKDFQPSQRDRFYKTIFDI  362

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +YKS+K N++GAG++ WQ  VE M+E+ND+FGIVPWER STY ++T+ SCRLA +HG+ P
Sbjct  363   IYKSSKRNRAGAGALIWQLFVEGMDEFNDDFGIVPWERESTYRILTDQSCRLARIHGISP  422

Query  1952  SQQEHLKSFCSKTQ  1993
              Q ++LK  C + Q
Sbjct  423   -QNKYLKELCLQRQ  435



>ref|XP_002273772.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Vitis vinifera]
 ref|XP_010656969.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Vitis vinifera]
 ref|XP_010656970.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Vitis vinifera]
Length=437

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/435 (70%), Positives = 364/435 (84%), Gaps = 1/435 (0%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             +R +M+A NG+FYPIIGFA+  AFIY++FGDL ++  EET K+SFV RNGTQF  DG+VF
Sbjct  2     QRERMMAGNGLFYPIIGFASVFAFIYMSFGDLKINLSEET-KMSFVGRNGTQFMVDGKVF  60

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+ AVD   +PRVR MLQA AKMG+TVCRTWAFNDGAY+ALQISPG+FDE
Sbjct  61    YINGWNSYWLMDQAVDEYSKPRVRAMLQAGAKMGLTVCRTWAFNDGAYHALQISPGRFDE  120

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             RVF+ALD VIAE+R+ GIRL+L LVNNL+AYGGKTQYV WAWQEGIGLS SNDSFF+DP+
Sbjct  121   RVFKALDHVIAEARKQGIRLLLTLVNNLQAYGGKTQYVNWAWQEGIGLSSSNDSFFFDPS  180

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVK VLTRKN++TG+EYR+DPTIF WELINEPRCM+D +GDTLQDW+EEMS +
Sbjct  181   IRIYFKNYVKAVLTRKNSITGIEYRNDPTIFGWELINEPRCMSDASGDTLQDWLEEMSAY  240

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VKSIDK HLLT+GLEGFYGP  PKRL +NP  WAA LG+DFIRNS +STIDFAS H+YPD
Sbjct  241   VKSIDKKHLLTIGLEGFYGPNSPKRLTVNPAEWAATLGADFIRNSKISTIDFASAHIYPD  300

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF  Q F+ +LK+  KW+LSHIEDGE+ LKKP+MFTEFG + + K   P +RDRFFK +
Sbjct  301   HWFHGQEFEAELKYVSKWMLSHIEDGEKELKKPVMFTEFGFSTDNKNFHPSKRDRFFKTV  360

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
              ++MY+SA+ N +GAGS  WQFLV  MEEYND+FGIVPWER +TY LIT H+CRLA + G
Sbjct  361   FDVMYQSARKNGAGAGSFVWQFLVGGMEEYNDDFGIVPWERPATYRLITEHTCRLARIQG  420

Query  1943  VLPSQQEHLKSFCSK  1987
              L  Q+  LK  CS+
Sbjct  421   GLAQQKASLKDLCSR  435



>emb|CBI21857.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/431 (71%), Positives = 361/431 (84%), Gaps = 1/431 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG+FYPIIGFA+  AFIY++FGDL ++  EET K+SFV RNGTQF  DG+VFY+NG
Sbjct  1     MMAGNGLFYPIIGFASVFAFIYMSFGDLKINLSEET-KMSFVGRNGTQFMVDGKVFYING  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+ AVD   +PRVR MLQA AKMG+TVCRTWAFNDGAY+ALQISPG+FDERVF+
Sbjct  60    WNSYWLMDQAVDEYSKPRVRAMLQAGAKMGLTVCRTWAFNDGAYHALQISPGRFDERVFK  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+ GIRL+L LVNNL+AYGGKTQYV WAWQEGIGLS SNDSFF+DP+IR Y
Sbjct  120   ALDHVIAEARKQGIRLLLTLVNNLQAYGGKTQYVNWAWQEGIGLSSSNDSFFFDPSIRIY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNYVK VLTRKN++TG+EYR+DPTIF WELINEPRCM+D +GDTLQDW+EEMS +VKSI
Sbjct  180   FKNYVKAVLTRKNSITGIEYRNDPTIFGWELINEPRCMSDASGDTLQDWLEEMSAYVKSI  239

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DK HLLT+GLEGFYGP  PKRL +NP  WAA LG+DFIRNS +STIDFAS H+YPDHWF 
Sbjct  240   DKKHLLTIGLEGFYGPNSPKRLTVNPAEWAATLGADFIRNSKISTIDFASAHIYPDHWFH  299

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
              Q F+ +LK+  KW+LSHIEDGE+ LKKP+MFTEFG + + K   P +RDRFFK + ++M
Sbjct  300   GQEFEAELKYVSKWMLSHIEDGEKELKKPVMFTEFGFSTDNKNFHPSKRDRFFKTVFDVM  359

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPS  1954
             Y+SA+ N +GAGS  WQFLV  MEEYND+FGIVPWER +TY LIT H+CRLA + G L  
Sbjct  360   YQSARKNGAGAGSFVWQFLVGGMEEYNDDFGIVPWERPATYRLITEHTCRLARIQGGLAQ  419

Query  1955  QQEHLKSFCSK  1987
             Q+  LK  CS+
Sbjct  420   QKASLKDLCSR  430



>gb|ABK95966.1| unknown [Populus trichocarpa]
Length=435

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/434 (68%), Positives = 367/434 (85%), Gaps = 1/434 (0%)
 Frame = +2

Query  692   KMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVN  871
             KM+A NG+ YPI+GFA+ +AFIY++FG   ++  +E  +LSFVERNGTQF  DG+ FY+N
Sbjct  3     KMVAGNGLLYPILGFASCVAFIYMSFGGFILTNHQEHRELSFVERNGTQFMVDGRAFYIN  62

Query  872   GWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVF  1051
             GWNSYW M+H+VD  R+PRV  ML+A AKMG+TVCRTWAFNDG YNALQ+SPG+FDERV 
Sbjct  63    GWNSYWLMDHSVDEDRKPRVGAMLEAGAKMGLTVCRTWAFNDGGYNALQVSPGRFDERVL  122

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             RALD VIAE+R+HG+RL+L LVNNLKAYGGKTQYV WAW+EGIGLS SNDSFF+DP+I+R
Sbjct  123   RALDYVIAEARQHGVRLLLSLVNNLKAYGGKTQYVNWAWEEGIGLSSSNDSFFFDPSIKR  182

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             YFK+YVKT+LTRKNT+TG+EYR+DPTIFAWEL+NEPRCM+DP+GDTLQDWIEEMS FVK+
Sbjct  183   YFKHYVKTLLTRKNTITGIEYRNDPTIFAWELMNEPRCMSDPSGDTLQDWIEEMSAFVKT  242

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             IDKNHLLTVGLEGFYGPK+PKRL +NPE WA+ LGSDF+RNS    IDFASVH+YPDHWF
Sbjct  243   IDKNHLLTVGLEGFYGPKNPKRLTVNPESWASSLGSDFVRNSKAPAIDFASVHIYPDHWF  302

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              +Q F+DKLK+  KW+LSHIEDG   L KP+ FTEFGL+   K+ +P QRDRF+K I +I
Sbjct  303   PHQEFEDKLKYVSKWMLSHIEDGHYELSKPVFFTEFGLSNLNKDFQPSQRDRFYKTIFDI  362

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +YKS+K  ++GAG++ WQ  VE M+++ND+FGIVPWER ST  ++T+ SCRLA +HG+ P
Sbjct  363   IYKSSKRKRAGAGALIWQLFVEGMDDFNDDFGIVPWERESTNRILTDQSCRLARIHGISP  422

Query  1952  SQQEHLKSFCSKTQ  1993
              Q ++LK  C + Q
Sbjct  423   -QNKYLKELCLQRQ  435



>ref|XP_006376482.1| glycosyl hydrolase family 5 family protein [Populus trichocarpa]
 gb|ERP54279.1| glycosyl hydrolase family 5 family protein [Populus trichocarpa]
Length=435

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/434 (68%), Positives = 366/434 (84%), Gaps = 1/434 (0%)
 Frame = +2

Query  692   KMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVN  871
             KM+A NG+ YPI+GFA+ +AFIY++FG   ++  +E  +LSFVERNGTQF  DG+ FY+N
Sbjct  3     KMVAGNGLLYPILGFASCVAFIYMSFGGFILTNHQEHRELSFVERNGTQFMVDGRAFYIN  62

Query  872   GWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVF  1051
             GWNSYW M+H+VD  R+PRV  ML+A AKMG+TVCRTWAFNDG YNALQ+SPG+FDERV 
Sbjct  63    GWNSYWLMDHSVDEDRKPRVGAMLEAGAKMGLTVCRTWAFNDGGYNALQVSPGRFDERVL  122

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             RALD VIAE+R+HG+RL+L LVNNLKAYGGKTQYV WAW+EGIGLS SNDSFF+DP+I+R
Sbjct  123   RALDYVIAEARQHGVRLLLSLVNNLKAYGGKTQYVNWAWEEGIGLSSSNDSFFFDPSIKR  182

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             YFK+YVKT+LTRKNT+TG+EYR+DPTIFAWEL+NEPRCM+DP+GDTLQDWIEEMS FVK+
Sbjct  183   YFKHYVKTLLTRKNTITGIEYRNDPTIFAWELMNEPRCMSDPSGDTLQDWIEEMSAFVKT  242

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             ID NHLLTVGLEGFYGPK+PKRL +NPE WA+ LGSDF+RNS    IDFASVH+YPDHWF
Sbjct  243   IDTNHLLTVGLEGFYGPKNPKRLTVNPESWASSLGSDFVRNSKAPAIDFASVHIYPDHWF  302

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              +Q F+DKLK+  KW+LSHIEDG   L KP+ FTEFGL+   K+ +P QRDRF+K I +I
Sbjct  303   PHQEFEDKLKYVSKWMLSHIEDGHYELNKPVFFTEFGLSNLNKDFQPSQRDRFYKTIFDI  362

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +YKS+K  ++GAG++ WQ  VE M+++ND+FGIVPWER ST  ++T+ SCRLA +HG+ P
Sbjct  363   IYKSSKRKRAGAGALIWQLFVEGMDDFNDDFGIVPWERESTNRILTDQSCRLARIHGISP  422

Query  1952  SQQEHLKSFCSKTQ  1993
              Q ++LK  C + Q
Sbjct  423   -QNKYLKELCLQRQ  435



>ref|XP_008229003.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Prunus mume]
 ref|XP_008229004.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Prunus mume]
Length=444

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/438 (69%), Positives = 367/438 (84%), Gaps = 4/438 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             RR  ++A NG+FYPI+GFA+ +AFIY++FG L  +  E+T KL FVERNGTQF  DG+ F
Sbjct  10    RRKMVVAGNGLFYPIVGFASCVAFIYMSFGGLGTNLQEKT-KLGFVERNGTQFMLDGKAF  68

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+H+VD   +PRVR +LQA AKMG+TVCRTWAFNDG YNALQISPG+F+E
Sbjct  69    YINGWNSYWLMDHSVDEYTKPRVREILQAGAKMGLTVCRTWAFNDGDYNALQISPGRFNE  128

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             +VF+ALD VI E+R+ GIRL+  LVNNL+AYGGKTQYVKWAW EG+GLS SNDSFF+DP+
Sbjct  129   QVFKALDHVIVEARQQGIRLLFSLVNNLQAYGGKTQYVKWAWDEGVGLSASNDSFFFDPS  188

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G+EYRDDPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  189   IRNYFKNYVKTLLTRKNTLNGIEYRDDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  248

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDK HLLTVGLEGFYGPK+PKRL +NPE+WA+ LGSDFIRNS +  IDFASVH+YPD
Sbjct  249   VKAIDKKHLLTVGLEGFYGPKNPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPD  308

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG++ L KP+MFTE+GL+ + K+ EP QRDRF+K+I
Sbjct  309   HWFHDKEFHENLKFVSKWMHSHIEDGDKELNKPVMFTEYGLSNQNKDFEPSQRDRFYKVI  368

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+ +YKSAK N SGAGS+ WQ  V  M++YNDEFGIVPWER STY LI   SCRLA +H 
Sbjct  369   LDAIYKSAKKNGSGAGSLVWQLFVGGMDKYNDEFGIVPWERPSTYKLIIEQSCRLARLH-  427

Query  1943  VLPSQQE-HLKSFCSKTQ  1993
               P+QQ+ +LK+ CS+ Q
Sbjct  428   -RPTQQQRNLKNLCSQRQ  444



>ref|XP_009357862.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
 ref|XP_009357869.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
Length=443

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/435 (69%), Positives = 366/435 (84%), Gaps = 4/435 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             ++  ++A NG+FYPI+GF + +AFIY++FG+L  +  +E  KLSFV RNGTQF  DG+ F
Sbjct  9     KKKMVVAGNGLFYPILGFVSCVAFIYMSFGNLGSNVGDEK-KLSFVGRNGTQFMLDGKAF  67

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+ +VD  R+PRVR +LQA AKMG+TVCRTWAFNDG YNALQISPG F+E
Sbjct  68    YINGWNSYWLMDQSVDEYRKPRVRKILQAGAKMGLTVCRTWAFNDGEYNALQISPGHFNE  127

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
              VF+ALD VI E+R+ GIRL+LCLVNNL+AYGGKTQYVKWAW+EG+GLS SNDSFF+DP+
Sbjct  128   EVFKALDHVIVEARQQGIRLLLCLVNNLQAYGGKTQYVKWAWEEGVGLSASNDSFFFDPS  187

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G+EYR+DPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  188   IRNYFKNYVKTILTRKNTLNGIEYRNDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  247

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDKNHLLTVGLEGFYGPK PKRL  NPE+WA+ LGSDFIRNS ++ IDFASVH+YPD
Sbjct  248   VKAIDKNHLLTVGLEGFYGPKSPKRLTANPEMWASRLGSDFIRNSKITNIDFASVHIYPD  307

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG+  L KPIMFTE+GL+ + K+ EP QR+RF+K I
Sbjct  308   HWFHDEEFHENLKFVSKWMRSHIEDGDNELNKPIMFTEYGLSNQNKDFEPSQRERFYKTI  367

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+++YKSAK N+SGAG++ WQFLVE M+EYNDEFGIVPWER S Y +I   SCRLA + G
Sbjct  368   LDVIYKSAKKNRSGAGALAWQFLVEGMDEYNDEFGIVPWERPSEYKMIVEQSCRLARLKG  427

Query  1943  VLPSQQE-HLKSFCS  1984
               P+QQ+ +LK  CS
Sbjct  428   --PTQQQRNLKDLCS  440



>ref|XP_007198827.1| hypothetical protein PRUPE_ppa005783mg [Prunus persica]
 gb|EMJ00026.1| hypothetical protein PRUPE_ppa005783mg [Prunus persica]
Length=444

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/438 (69%), Positives = 366/438 (84%), Gaps = 4/438 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             R+  ++A NG+FYPI+GFA+ +AFIY++FG L  +  E+T KL FVERNGTQF  DG+ F
Sbjct  10    RKKMVVAGNGLFYPIVGFASCVAFIYMSFGGLGTNLQEKT-KLGFVERNGTQFMLDGKAF  68

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+H+VD   +PRVR +LQA A MG+TVCRTWAFNDG YNALQISPG+F+E
Sbjct  69    YINGWNSYWLMDHSVDEYTKPRVREILQAGATMGLTVCRTWAFNDGDYNALQISPGRFNE  128

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             +VF+ALD VI E+R+ GIRL+  LVNNL+AYGGKTQYVKWAW EG+GLS SNDSFF+DP+
Sbjct  129   QVFKALDHVIVEARQQGIRLLFSLVNNLQAYGGKTQYVKWAWDEGVGLSASNDSFFFDPS  188

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G+EYRDDPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  189   IRNYFKNYVKTLLTRKNTLNGIEYRDDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  248

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDK HLLTVGLEGFYGPK+PKRL +NPE+WA+ LGSDFIRNS +  IDFASVH+YPD
Sbjct  249   VKAIDKKHLLTVGLEGFYGPKNPKRLTVNPEMWASRLGSDFIRNSKVPNIDFASVHIYPD  308

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG++ L KP+MFTE+GL+ + K+ EP QRDRF+K+I
Sbjct  309   HWFHDKEFHENLKFVSKWMHSHIEDGDKELNKPVMFTEYGLSNQNKDFEPSQRDRFYKVI  368

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+ +YKSAK N SGAGS+ WQ  V  M++YNDEFGIVPWER STY LI   SCRLA +HG
Sbjct  369   LDAIYKSAKKNGSGAGSLVWQLFVGGMDKYNDEFGIVPWERPSTYKLIIEQSCRLARLHG  428

Query  1943  VLPSQQE-HLKSFCSKTQ  1993
               P+QQ+ +LK  CS+ Q
Sbjct  429   --PTQQQRNLKDLCSQRQ  444



>ref|XP_009341984.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
Length=443

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/438 (68%), Positives = 368/438 (84%), Gaps = 4/438 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             ++  ++A NG+FYPIIGFA+ +AFIY++FG+L  ++  +T KLSFV RNGTQF  DG+ F
Sbjct  9     KKKMVVAGNGLFYPIIGFASCVAFIYMSFGNLGSNFGNQT-KLSFVGRNGTQFMLDGKAF  67

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+++VD  R+PRVR +LQA AKMG+TVCRTWAFNDG YNALQISPG F+E
Sbjct  68    YINGWNSYWLMDNSVDEHRKPRVRQILQAGAKMGLTVCRTWAFNDGDYNALQISPGHFNE  127

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             +VF+ALD VI E+R+ GIRL+LCLVNNL+AYGGKTQYVKWAW+EG+GLS SNDSFF+DP+
Sbjct  128   QVFKALDHVIVEARQQGIRLLLCLVNNLQAYGGKTQYVKWAWEEGVGLSASNDSFFFDPS  187

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G++YR+DPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  188   IRNYFKNYVKTLLTRKNTLNGIQYRNDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  247

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDKNHLLTVGLEGFYGPK PKRL +NPE+WA+ LGSDFIRNS +  IDFASVH+YPD
Sbjct  248   VKAIDKNHLLTVGLEGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPD  307

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG+  L KP+MFTE+GL+ E K+ EP QR RF+K I
Sbjct  308   HWFHDEEFHNNLKFVSKWMRSHIEDGDNELNKPVMFTEYGLSNENKDFEPSQRGRFYKTI  367

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+++YKSAK N+SGAG++ WQF V  M+EYNDEFGI+PWE  S Y ++   SCRLA + G
Sbjct  368   LDVIYKSAKKNQSGAGALAWQFFVGGMDEYNDEFGIIPWESPSEYKMMIEQSCRLARLKG  427

Query  1943  VLPSQQE-HLKSFCSKTQ  1993
               P+QQ+ +LK  CS+ Q
Sbjct  428   --PTQQQRNLKDLCSRRQ  443



>gb|KDP24127.1| hypothetical protein JCGZ_25784 [Jatropha curcas]
Length=433

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/429 (69%), Positives = 362/429 (84%), Gaps = 2/429 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG+FYPI+GFA+ +AFIY++FGDL ++  +E  +L+FV RNGTQF  DG  FY+NG
Sbjct  1     MVAGNGLFYPILGFASCVAFIYMSFGDLELTSRQEP-ELAFVTRNGTQFMVDGSPFYING  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNS+W M+H+ +  R+PRV  MLQA AKMG+TVCRTWAFNDG YNALQ+SPG+FDERVF+
Sbjct  60    WNSFWLMDHSAEEERKPRVSEMLQAGAKMGLTVCRTWAFNDGGYNALQVSPGRFDERVFK  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRL+L LVNNLKAYGGKTQYVKWAW+EGIGLS SNDSFF+DP  +RY
Sbjct  120   ALDHVIAEARQHGIRLLLSLVNNLKAYGGKTQYVKWAWEEGIGLSSSNDSFFFDPTTKRY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FK+YVKT+LTRKNT+TG+EYR+DPTIFAWEL+NEPRC +DP+GDTLQDWIEEMS FVKSI
Sbjct  180   FKHYVKTLLTRKNTITGIEYRNDPTIFAWELMNEPRCRSDPSGDTLQDWIEEMSIFVKSI  239

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DKNHLLTVGLEGFYGPK+ KRL +NPE WA  LGSDFIRNS +  IDFA+VH+YPDHWF 
Sbjct  240   DKNHLLTVGLEGFYGPKNAKRLTVNPENWAETLGSDFIRNSKVPDIDFATVHIYPDHWFN  299

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
             +Q F++KL+F  KW+LSHIEDG   L KP+ FTE+G +  +K  +P QR+RF+K +L+I+
Sbjct  300   DQEFEEKLRFVSKWMLSHIEDGHYELNKPVFFTEYGFSNMSKGFQPSQRERFYKTVLDII  359

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPS  1954
             YKSAK  ++GAG++ WQF VE MEE+NDEFGIVPWER STY L T  SCRLA +HG+ P 
Sbjct  360   YKSAKRKRAGAGALVWQFFVEGMEEFNDEFGIVPWERISTYRLFTEQSCRLARIHGI-PE  418

Query  1955  QQEHLKSFC  1981
             Q ++LK  C
Sbjct  419   QNKNLKELC  427



>ref|XP_008367886.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Malus domestica]
Length=443

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/438 (68%), Positives = 366/438 (84%), Gaps = 4/438 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             ++  ++A NG+FYPI+GF + +AFIYL+FG+L  +  +E  KLSFV RNG QF  DG+ F
Sbjct  9     KKKMVVAGNGLFYPILGFVSCVAFIYLSFGNLGSNVSDEK-KLSFVGRNGAQFMLDGKAF  67

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+ +VD  R+PRVR +LQA AKMG+TVCRTWAFNDG YNALQISPG F+E
Sbjct  68    YINGWNSYWLMDQSVDEYRKPRVRKILQAGAKMGLTVCRTWAFNDGEYNALQISPGHFNE  127

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
              VF+ALD VI E+R+ GIRL+LCLVNNL+AYGGKTQYVKWAW+EG+GLS SNDSFF+DP+
Sbjct  128   EVFKALDHVIVEARQQGIRLLLCLVNNLQAYGGKTQYVKWAWEEGVGLSASNDSFFFDPS  187

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G+EYR+DPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  188   IRNYFKNYVKTILTRKNTLNGIEYRNDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  247

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDKNHLLTVGLEGFYGPK PKRL  NPE+WA+ LGSDFIRNS +  IDFASVH+YPD
Sbjct  248   VKAIDKNHLLTVGLEGFYGPKSPKRLTANPEMWASRLGSDFIRNSKIPNIDFASVHIYPD  307

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG+  L KP+MFTE+GL+ + K+ EP QR+RF+K I
Sbjct  308   HWFHDEEFHENLKFVSKWMRSHIEDGBNELNKPVMFTEYGLSNQNKDFEPSQRERFYKTI  367

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+++YKSAK N+SGAG++ WQFLVE M+EYNDEFGIVPW+R S Y +I   SCRLA + G
Sbjct  368   LDVIYKSAKKNRSGAGALAWQFLVEGMDEYNDEFGIVPWKRPSEYKIIVEQSCRLARLKG  427

Query  1943  VLPSQQE-HLKSFCSKTQ  1993
               P+QQ+ +LK  CS+ +
Sbjct  428   --PTQQQRNLKDLCSQRK  443



>ref|XP_009336206.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Pyrus x bretschneideri]
Length=443

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/438 (68%), Positives = 367/438 (84%), Gaps = 4/438 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             ++  ++A NG+FYPIIGFA+ +AFIY++FG+L  ++  +T KLSFV RNGTQF  DG+ F
Sbjct  9     KKKMVVAGNGLFYPIIGFASCVAFIYMSFGNLGSNFGNQT-KLSFVGRNGTQFMLDGKAF  67

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+++VD  R+PRVR +LQA AKMG+TVCRTWAFNDG YNALQISPG F+E
Sbjct  68    YINGWNSYWLMDNSVDEHRKPRVRQILQAGAKMGLTVCRTWAFNDGDYNALQISPGHFNE  127

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             +VF+ALD VI E+R+ GIRL+LCLVNNL+AYGGKTQYVKWAW+EG+GLS SNDSFF+DP+
Sbjct  128   QVFKALDHVIVEARQQGIRLLLCLVNNLQAYGGKTQYVKWAWEEGVGLSASNDSFFFDPS  187

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G++YR+DPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  188   IRNYFKNYVKTLLTRKNTLNGIQYRNDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  247

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDKNHLLTVGLEGFYGPK PKRL +NPE+WA+ LGSDFIRNS +  IDFASVH+YPD
Sbjct  248   VKAIDKNHLLTVGLEGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPD  307

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG+  L KP+MFTE+GL+ + K+ EP QR RF+K I
Sbjct  308   HWFHDEEFHNNLKFVSKWMRSHIEDGDNELNKPVMFTEYGLSNQNKDFEPSQRGRFYKTI  367

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+++YKSAK N+SGAG++ WQF V  M EYNDEFGI+PWE  S Y ++   SCRLA + G
Sbjct  368   LDVIYKSAKKNQSGAGALAWQFFVGGMGEYNDEFGIIPWESPSEYKMMMEQSCRLARLKG  427

Query  1943  VLPSQQE-HLKSFCSKTQ  1993
               P+QQ+ +LK  CS+ Q
Sbjct  428   --PTQQQRNLKDLCSRRQ  443



>ref|NP_001280862.1| mannan endo-1,4-beta-mannosidase 2-like [Malus domestica]
 gb|ACN78665.1| endo-beta-mannanase [Malus domestica]
Length=443

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/438 (68%), Positives = 368/438 (84%), Gaps = 4/438 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             ++  ++A NG+FYPIIGFA+ +AFIY++FG+L  ++  +T KLSFV RNGTQF  DG+ F
Sbjct  9     KKKMVVAGNGLFYPIIGFASCVAFIYMSFGNLGSNFGNQT-KLSFVGRNGTQFMLDGKAF  67

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+++VD  R+PRVR +LQA AKMG+TVCRTWAFNDG YNALQISPG F+E
Sbjct  68    YINGWNSYWLMDNSVDEHRKPRVRQILQAGAKMGLTVCRTWAFNDGDYNALQISPGHFNE  127

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             +VF+ALD VI E+R+ GIRL+LCLVNNL+AYGGKTQYVKWAW+EG+GLS SNDSFF+DP+
Sbjct  128   QVFKALDHVIVEARQQGIRLLLCLVNNLQAYGGKTQYVKWAWEEGVGLSASNDSFFFDPS  187

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G++YR+DPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  188   IRIYFKNYVKTLLTRKNTLNGIQYRNDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  247

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDKNHLLTVGLEGFYGPK PKRL +NPE+WA+ LGSDFIRNS +  IDFASVH+YPD
Sbjct  248   VKAIDKNHLLTVGLEGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPD  307

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG+  L KP+MFTE+GL+ + K+ EP QR RF+K I
Sbjct  308   HWFHDEEFHNNLKFVYKWMRSHIEDGDNELNKPVMFTEYGLSNQNKDFEPSQRVRFYKTI  367

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+++YKSAK N+SGAG++ WQF V  M+EYNDEFGI+PWE  S Y ++   SCRLA + G
Sbjct  368   LDVIYKSAKKNQSGAGALAWQFFVGGMDEYNDEFGIIPWESPSEYKMMIEQSCRLARLKG  427

Query  1943  VLPSQQE-HLKSFCSKTQ  1993
               P+QQ+ +LK  CS+ Q
Sbjct  428   --PTQQQRNLKDLCSQRQ  443



>ref|XP_010272456.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nelumbo nucifera]
 ref|XP_010272457.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Nelumbo nucifera]
Length=428

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/430 (69%), Positives = 366/430 (85%), Gaps = 3/430 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG+ YP++GFA+ + FIY++ GDL + + EE  K++FVERNGT+F  DG+ FYVNG
Sbjct  1     MVAGNGLLYPLLGFASCVVFIYISLGDLTLYHFEEP-KMAFVERNGTRFMVDGRAFYVNG  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+ AV+   RPRV+ MLQA AKMG+TVCRTWAFNDGAYNALQ SPG+F+ERVF+
Sbjct  60    WNSYWLMDQAVEAFSRPRVKAMLQAGAKMGLTVCRTWAFNDGAYNALQTSPGRFNERVFK  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRLIL LVNNL+AYGGKTQYVKWAW+EG+ LS SNDSFF+DP+IR Y
Sbjct  120   ALDGVIAEARQHGIRLILSLVNNLQAYGGKTQYVKWAWEEGVALSSSNDSFFFDPSIRSY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNYVKT+LTR+N++TG+EYRDDPTIFAWELINEPRCM+DP+GDTLQDWIEEMS FVKSI
Sbjct  180   FKNYVKTILTRRNSLTGIEYRDDPTIFAWELINEPRCMSDPSGDTLQDWIEEMSRFVKSI  239

Query  1415  DKNHLLTVGLEGFYGP-KDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             DKNHLLTVGLEGFYGP ++P++L +NPE WA  LGSDFI+NS +STIDFAS+HVYPD+WF
Sbjct  240   DKNHLLTVGLEGFYGPSRNPEKLSVNPEAWATLLGSDFIQNSEISTIDFASIHVYPDNWF  299

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
             K +  +DKLKF  KW++SHIEDG++ LKKP+M TEFGL+ + K+ EP  RD+F+K I +I
Sbjct  300   KEKELEDKLKFVSKWVISHIEDGDKVLKKPVMVTEFGLSNKNKDFEPSHRDKFYKTIYDI  359

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +Y+SA+ N +GAG+  WQFLVE MEEYND+FGIVPWER+STY +I + SCRLAG+ G   
Sbjct  360   IYESARKNGAGAGAFPWQFLVEGMEEYNDDFGIVPWERSSTYRMILDQSCRLAGIGGQDQ  419

Query  1952  SQQEHLKSFC  1981
             S+   LK  C
Sbjct  420   SKG-ILKEIC  428



>ref|XP_008353782.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Malus domestica]
Length=443

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/438 (68%), Positives = 367/438 (84%), Gaps = 4/438 (1%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             ++  ++A NG+FYPIIGFA+ +AFIY++FG+L  ++  +T KLSFV RNGTQF  DG+ F
Sbjct  9     KKKMVVAGNGLFYPIIGFASCVAFIYMSFGNLGSNFGNQT-KLSFVGRNGTQFMLDGKAF  67

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             Y+NGWNSYW M+++VD  R+PRVR +LQA AKMG+TVCRTWAFNDG YNALQISPG F+E
Sbjct  68    YINGWNSYWLMDNSVDEHRKPRVRQILQAGAKMGLTVCRTWAFNDGDYNALQISPGHFNE  127

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             +VF+ALD VI E+R+ GIRL+LCLVNNL+AYGGKTQYVKWAW+EG+GLS SNDSFF+DP+
Sbjct  128   QVFKALDHVIVEARQQGIRLLLCLVNNLQAYGGKTQYVKWAWEEGVGLSASNDSFFFDPS  187

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR YFKNYVKT+LTRKNT+ G++YR+DPTIFAWELINEPRC+TD +GDTLQDWIEEMS F
Sbjct  188   IRIYFKNYVKTLLTRKNTLNGIQYRNDPTIFAWELINEPRCITDASGDTLQDWIEEMSAF  247

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK+IDKNHLLTVGLEGFYGPK PKRL +NPE+WA+ LGSDFIRNS +  IDFASVH+YPD
Sbjct  248   VKAIDKNHLLTVGLEGFYGPKSPKRLTVNPEMWASRLGSDFIRNSKIPNIDFASVHIYPD  307

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF ++ F + LKF  KW+ SHIEDG+  L KP+MFTE+GL+ + K+ EP QR RF+K I
Sbjct  308   HWFHDEEFHNNLKFVYKWMRSHIEDGDNELNKPVMFTEYGLSNQNKDFEPSQRVRFYKTI  367

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             L+++YKSAK N+SGAG++ WQF V  M+EYNDEFGI+PWE  S Y ++   SCRLA + G
Sbjct  368   LDVIYKSAKKNQSGAGALAWQFFVGGMDEYNDEFGIIPWESPSEYKMMIEQSCRLARLXG  427

Query  1943  VLPSQ-QEHLKSFCSKTQ  1993
               P+Q Q +LK  CS+ Q
Sbjct  428   --PTQXQRNLKDLCSQRQ  443



>ref|XP_004139946.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cucumis sativus]
 ref|XP_004154548.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cucumis sativus]
 gb|KGN46738.1| hypothetical protein Csa_6G127990 [Cucumis sativus]
Length=431

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/430 (69%), Positives = 360/430 (84%), Gaps = 1/430 (0%)
 Frame = +2

Query  698   LARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGW  877
             +A NG+FYPI+GFA+ LAFIYL+FGDL +   +    + FVERNGTQF  +G+ FY+NGW
Sbjct  1     MAGNGLFYPILGFASCLAFIYLSFGDLRIGDTKVIPIVDFVERNGTQFMLNGKAFYINGW  60

Query  878   NSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRA  1057
             NSYWFM+H+V+  R+PR+R MLQAA KMG+TVCRTWAFNDG YNALQ+SPG+F+ERVF+A
Sbjct  61    NSYWFMDHSVEEYRKPRIRAMLQAARKMGLTVCRTWAFNDGGYNALQVSPGRFNERVFKA  120

Query  1058  LDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYF  1237
             LD VIAESR+HGIRL+L LVNNL+AYGGKTQYVKWAWQ+G+GLS SNDSFFYDP+IR YF
Sbjct  121   LDHVIAESRQHGIRLLLSLVNNLQAYGGKTQYVKWAWQDGVGLSSSNDSFFYDPSIRIYF  180

Query  1238  KNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSID  1417
             KNY+KTVLTRKN++TG+EYR+DPTIF WELINEPRCMTD +GDTLQ+WIEEM+ ++KSID
Sbjct  181   KNYLKTVLTRKNSITGIEYRNDPTIFGWELINEPRCMTDASGDTLQEWIEEMTAYIKSID  240

Query  1418  KNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKN  1597
             K HLLTVGLEGFYGP  PK+  +NPE WA+ LGSDFIRNS +  +DFASVH+YPDHWF +
Sbjct  241   KKHLLTVGLEGFYGPNSPKKSTVNPEEWASRLGSDFIRNSEIQHVDFASVHIYPDHWFHD  300

Query  1598  QTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMY  1777
             Q F+D+LKF  KW+LSHIEDG++ LKKP+MFTEFGL+   K   P QRD F+K + +++Y
Sbjct  301   QDFEDELKFVSKWMLSHIEDGDKELKKPVMFTEFGLSDLNKGFTPAQRDSFYKTVYDVIY  360

Query  1778  KSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQ  1957
             KSAK N+SGAGS+ WQFLVE MEE ND+FGIVPWER+S Y LI   SCRLA + G    Q
Sbjct  361   KSAKRNRSGAGSLAWQFLVEGMEESNDDFGIVPWERSSIYQLIIEQSCRLARIGGD-TQQ  419

Query  1958  QEHLKSFCSK  1987
              + LK  C++
Sbjct  420   LKALKYVCAQ  429



>ref|XP_008448293.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Cucumis melo]
Length=431

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/430 (68%), Positives = 358/430 (83%), Gaps = 1/430 (0%)
 Frame = +2

Query  698   LARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGW  877
             +A NG+FYPI+GFA+ LAFIYL+FGDL +   +    + FVERNGTQF  +G+ FY+NGW
Sbjct  1     MAGNGLFYPILGFASCLAFIYLSFGDLRIGDTKVIPIVDFVERNGTQFMLNGKAFYINGW  60

Query  878   NSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRA  1057
             NSYWFM+H+V+  R+PR+R MLQAA KMG+TVCRTWAFNDG YNALQ+SPG+F+ERVF+A
Sbjct  61    NSYWFMDHSVEEYRKPRIRAMLQAARKMGLTVCRTWAFNDGGYNALQVSPGRFNERVFKA  120

Query  1058  LDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYF  1237
             LD VIAESR+HGIRL+L LVNNL+AYGGKTQYVKWAWQ+G+GLS SNDSFFYDP+IR YF
Sbjct  121   LDHVIAESRQHGIRLLLSLVNNLQAYGGKTQYVKWAWQDGVGLSSSNDSFFYDPSIRIYF  180

Query  1238  KNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSID  1417
             KNY+KTVLTRKN++TG+EYR+DPTIF WELINEPRCMTD +GDTLQ+WIEEM+ ++KSID
Sbjct  181   KNYIKTVLTRKNSITGIEYRNDPTIFGWELINEPRCMTDASGDTLQEWIEEMTAYIKSID  240

Query  1418  KNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKN  1597
             K HLLTVGLEGFYGP  PK+  +NPE WA+ LGSDFIRNS +  +DFASVH+YPDHWF +
Sbjct  241   KKHLLTVGLEGFYGPNSPKKSTVNPEEWASRLGSDFIRNSEIPHVDFASVHIYPDHWFHD  300

Query  1598  QTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMY  1777
             Q F+D+LKF  KW+LSHIEDG++ LKKP+MFTEFGL+   K     QRD F+K + +++Y
Sbjct  301   QDFEDELKFVSKWMLSHIEDGDKELKKPVMFTEFGLSDLNKGFTHAQRDSFYKTVYDVIY  360

Query  1778  KSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQ  1957
             KSAK  +SGAGS+ WQFLVE MEE ND+FGIVPWER+S Y LI   SCRLA + G    Q
Sbjct  361   KSAKRKRSGAGSLAWQFLVEGMEESNDDFGIVPWERSSIYQLIIEQSCRLARIGGD-TQQ  419

Query  1958  QEHLKSFCSK  1987
              + LK  C++
Sbjct  420   LKALKYVCAQ  429



>ref|XP_010260196.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X2 
[Nelumbo nucifera]
Length=433

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/420 (70%), Positives = 355/420 (85%), Gaps = 1/420 (0%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             R  +M+A NG  YP++GFA+ +AFIY++ GDL ++Y EE  K++FVERNGT F  DG+ F
Sbjct  3     REGRMVAGNGFLYPLLGFASCVAFIYMSLGDLRLNYYEEP-KVAFVERNGTHFILDGRPF  61

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             YVNGWNSYW M+ AV+   RPRVR MLQA AKMG+TVCRTWAFNDGAYNALQISPG+F+E
Sbjct  62    YVNGWNSYWLMDQAVEDFSRPRVRAMLQAGAKMGLTVCRTWAFNDGAYNALQISPGRFEE  121

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             RVF+ALD VIAE+RRHGI+LIL LVNNL+A+GGKTQYVKWAW+EG+ LS SNDSFF+DP+
Sbjct  122   RVFKALDRVIAEARRHGIKLILSLVNNLQAFGGKTQYVKWAWEEGVALSSSNDSFFFDPS  181

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IR+YFKNYVK VLTRKN++TG+EYR+DPTIFAWELINEPRCMTDP+GDTLQDWIEEMS +
Sbjct  182   IRKYFKNYVKAVLTRKNSITGIEYRNDPTIFAWELINEPRCMTDPSGDTLQDWIEEMSRY  241

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             VK IDKNHLLTVGLEGFYGP+ P++L +NPE WA+ LGSDFIRNS +S IDFASVH+YPD
Sbjct  242   VKLIDKNHLLTVGLEGFYGPRSPEKLSVNPEAWASVLGSDFIRNSKISIIDFASVHIYPD  301

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
              WFK    +DKLKF  KW+ SHIEDG++ LKKP+MFTEFGL+   +  +P  R++ +K +
Sbjct  302   QWFKEIELEDKLKFVSKWMTSHIEDGDKMLKKPVMFTEFGLSNTNRNFQPSHREKLYKTV  361

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
              +I+Y+SA+ N +GAG+  WQFLV  MEEYND+FGIVPWER+STY +I   SCRLAG+ G
Sbjct  362   YDIIYESARKNGAGAGAFPWQFLVGGMEEYNDDFGIVPWERSSTYRMILEQSCRLAGIGG  421



>ref|XP_007043603.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOX99434.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=451

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/435 (66%), Positives = 363/435 (83%), Gaps = 3/435 (1%)
 Frame = +2

Query  692   KMLARNGMFYPIIGFAAFLAFIYLTFGDLWVS-YPEETLKLSFVERNGTQFYADGQVFYV  868
             KM+A NG+ YPI+GFA+ +AFIY++FGDL +S +P+E  +LSFVERNGTQF+ DG+  YV
Sbjct  19    KMVAGNGLLYPILGFASCVAFIYMSFGDLKLSSFPKEP-RLSFVERNGTQFFLDGKPLYV  77

Query  869   NGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERV  1048
             NGWNSYW M H+VD   RPRV  MLQA AKMG+TVCRTWAFNDG Y+ALQISPG+FDERV
Sbjct  78    NGWNSYWLMAHSVDENNRPRVSAMLQAGAKMGLTVCRTWAFNDGGYDALQISPGQFDERV  137

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
             F+ALD VI E+R+HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IR
Sbjct  138   FKALDYVIVEARQHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIR  197

Query  1229  RYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVK  1408
             +YFKNYV TVLTRKNT+TG+EYR+DPTIFAWEL+NEPRCM+DP+GDTLQDW+EEM+ FVK
Sbjct  198   KYFKNYVLTVLTRKNTITGIEYRNDPTIFAWELMNEPRCMSDPSGDTLQDWLEEMTAFVK  257

Query  1409  SIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHW  1588
             SIDKNHLLT+GLEGFYGPK PK+  +NPE WA+ LGSDF+RNSN++ +DF SVH+YPDHW
Sbjct  258   SIDKNHLLTIGLEGFYGPKSPKKSTVNPEEWASTLGSDFVRNSNIANVDFTSVHIYPDHW  317

Query  1589  FKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILE  1768
             F +  F++K  +  KW+ SHIED ++ LKKP+MFTE+GL+ + K+ +P QR+RF++ I +
Sbjct  318   FHDLGFEEKRSYVSKWMRSHIEDCDKELKKPVMFTEYGLSNQNKDFQPSQRERFYRTISD  377

Query  1769  IMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
             I+YKSAK   SGAG++ WQF VE MEEYND+FG+VPWE  + Y L    SCRLA + G++
Sbjct  378   IIYKSAKKKGSGAGALVWQFFVEGMEEYNDDFGLVPWESPAIYKLTIEQSCRLARIQGLI  437

Query  1949  PSQQEHLKSFCSKTQ  1993
               ++ + K  CSK +
Sbjct  438   -HEKGNWKELCSKRE  451



>ref|XP_010260194.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010260195.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X1 
[Nelumbo nucifera]
Length=437

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/417 (70%), Positives = 354/417 (85%), Gaps = 1/417 (0%)
 Frame = +2

Query  692   KMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVN  871
             +M+A NG  YP++GFA+ +AFIY++ GDL ++Y EE  K++FVERNGT F  DG+ FYVN
Sbjct  10    RMVAGNGFLYPLLGFASCVAFIYMSLGDLRLNYYEEP-KVAFVERNGTHFILDGRPFYVN  68

Query  872   GWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVF  1051
             GWNSYW M+ AV+   RPRVR MLQA AKMG+TVCRTWAFNDGAYNALQISPG+F+ERVF
Sbjct  69    GWNSYWLMDQAVEDFSRPRVRAMLQAGAKMGLTVCRTWAFNDGAYNALQISPGRFEERVF  128

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             +ALD VIAE+RRHGI+LIL LVNNL+A+GGKTQYVKWAW+EG+ LS SNDSFF+DP+IR+
Sbjct  129   KALDRVIAEARRHGIKLILSLVNNLQAFGGKTQYVKWAWEEGVALSSSNDSFFFDPSIRK  188

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             YFKNYVK VLTRKN++TG+EYR+DPTIFAWELINEPRCMTDP+GDTLQDWIEEMS +VK 
Sbjct  189   YFKNYVKAVLTRKNSITGIEYRNDPTIFAWELINEPRCMTDPSGDTLQDWIEEMSRYVKL  248

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             IDKNHLLTVGLEGFYGP+ P++L +NPE WA+ LGSDFIRNS +S IDFASVH+YPD WF
Sbjct  249   IDKNHLLTVGLEGFYGPRSPEKLSVNPEAWASVLGSDFIRNSKISIIDFASVHIYPDQWF  308

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
             K    +DKLKF  KW+ SHIEDG++ LKKP+MFTEFGL+   +  +P  R++ +K + +I
Sbjct  309   KEIELEDKLKFVSKWMTSHIEDGDKMLKKPVMFTEFGLSNTNRNFQPSHREKLYKTVYDI  368

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             +Y+SA+ N +GAG+  WQFLV  MEEYND+FGIVPWER+STY +I   SCRLAG+ G
Sbjct  369   IYESARKNGAGAGAFPWQFLVGGMEEYNDDFGIVPWERSSTYRMILEQSCRLAGIGG  425



>ref|XP_010260197.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like isoform X3 
[Nelumbo nucifera]
Length=427

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/416 (70%), Positives = 353/416 (85%), Gaps = 1/416 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG  YP++GFA+ +AFIY++ GDL ++Y EE  K++FVERNGT F  DG+ FYVNG
Sbjct  1     MVAGNGFLYPLLGFASCVAFIYMSLGDLRLNYYEEP-KVAFVERNGTHFILDGRPFYVNG  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+ AV+   RPRVR MLQA AKMG+TVCRTWAFNDGAYNALQISPG+F+ERVF+
Sbjct  60    WNSYWLMDQAVEDFSRPRVRAMLQAGAKMGLTVCRTWAFNDGAYNALQISPGRFEERVFK  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+RRHGI+LIL LVNNL+A+GGKTQYVKWAW+EG+ LS SNDSFF+DP+IR+Y
Sbjct  120   ALDRVIAEARRHGIKLILSLVNNLQAFGGKTQYVKWAWEEGVALSSSNDSFFFDPSIRKY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNYVK VLTRKN++TG+EYR+DPTIFAWELINEPRCMTDP+GDTLQDWIEEMS +VK I
Sbjct  180   FKNYVKAVLTRKNSITGIEYRNDPTIFAWELINEPRCMTDPSGDTLQDWIEEMSRYVKLI  239

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DKNHLLTVGLEGFYGP+ P++L +NPE WA+ LGSDFIRNS +S IDFASVH+YPD WFK
Sbjct  240   DKNHLLTVGLEGFYGPRSPEKLSVNPEAWASVLGSDFIRNSKISIIDFASVHIYPDQWFK  299

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
                 +DKLKF  KW+ SHIEDG++ LKKP+MFTEFGL+   +  +P  R++ +K + +I+
Sbjct  300   EIELEDKLKFVSKWMTSHIEDGDKMLKKPVMFTEFGLSNTNRNFQPSHREKLYKTVYDII  359

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             Y+SA+ N +GAG+  WQFLV  MEEYND+FGIVPWER+STY +I   SCRLAG+ G
Sbjct  360   YESARKNGAGAGAFPWQFLVGGMEEYNDDFGIVPWERSSTYRMILEQSCRLAGIGG  415



>ref|XP_010052017.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Eucalyptus 
grandis]
 gb|KCW89538.1| hypothetical protein EUGRSUZ_A01823 [Eucalyptus grandis]
Length=435

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/431 (68%), Positives = 352/431 (82%), Gaps = 2/431 (0%)
 Frame = +2

Query  689   SKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYV  868
             S+ +ARNG+FYPI+GFA+ +AFIYL+FGD  +++     ++ FV RNGTQF  DG+VFYV
Sbjct  3     SRTVARNGLFYPIVGFASCVAFIYLSFGDFRLNFYVGK-RMDFVGRNGTQFVVDGKVFYV  61

Query  869   NGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERV  1048
             NGWNSYW M+ AVD   RPRVRT+LQA A+MG+TVCRTWAFND  Y+ALQI+PG+FDE V
Sbjct  62    NGWNSYWLMDQAVDEYSRPRVRTVLQAGARMGLTVCRTWAFNDNTYHALQIAPGQFDEGV  121

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
             F+ALDLVIAE+ +HGIRL+L LVNNL+A+GGKTQYVKWAW+EGIGLS SNDSFFYDP+IR
Sbjct  122   FQALDLVIAEANQHGIRLLLSLVNNLQAFGGKTQYVKWAWEEGIGLSSSNDSFFYDPSIR  181

Query  1229  RYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVK  1408
             +Y+KNYVK VLTRKNT+TG+EYRDDPTIF WEL+NEPRCMTDP GDTLQDW+EEMSTFV+
Sbjct  182   QYYKNYVKAVLTRKNTITGIEYRDDPTIFGWELMNEPRCMTDPAGDTLQDWLEEMSTFVR  241

Query  1409  SIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHW  1588
             SIDK HLLTVGLEGFYGPK+PK L +NP  WAA  GSDF+ NSNL  IDFAS H+YPDHW
Sbjct  242   SIDKKHLLTVGLEGFYGPKNPKSLTVNPADWAALYGSDFVHNSNLPNIDFASAHIYPDHW  301

Query  1589  FKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILE  1768
             F    F++ +KF  KW+ SHI+DG+R LKKP+MFTEFG + +     P QRDRFFK I +
Sbjct  302   FHEIEFEESVKFVSKWVRSHIDDGDRELKKPVMFTEFGYSNQNPNFHPSQRDRFFKTIFD  361

Query  1769  IMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
              +Y SA+ N +GAGS  WQF V  MEEYND+FGIVPW+R+STY LIT HSCRLA + G L
Sbjct  362   EIYASARKNGAGAGSFVWQFFVGGMEEYNDDFGIVPWQRSSTYQLITEHSCRLAALRG-L  420

Query  1949  PSQQEHLKSFC  1981
                +  L+  C
Sbjct  421   NQLKGSLRELC  431



>gb|EYU24916.1| hypothetical protein MIMGU_mgv1a007803mg [Erythranthe guttata]
Length=394

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/393 (73%), Positives = 340/393 (87%), Gaps = 0/393 (0%)
 Frame = +2

Query  809   LSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWA  988
             + FVERNGTQF  DG+ FY NGWNSYW M+H+VD  ++ R+R +LQ  A+MG+TVCRTWA
Sbjct  1     MGFVERNGTQFIVDGKPFYFNGWNSYWMMDHSVDESKKHRIRQILQTGARMGLTVCRTWA  60

Query  989   FNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAW  1168
             FNDG YNALQISPG+FDERVFRALD VIAE+RR+G+RL+LCLVNNL AYGGKTQYVKWAW
Sbjct  61    FNDGDYNALQISPGRFDERVFRALDHVIAEARRYGVRLVLCLVNNLHAYGGKTQYVKWAW  120

Query  1169  QEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCM  1348
             +EG+GLS SNDSFFYDP+IRRYFKNYVKTVLTR+NT+TG+EYRDDPTIFAWELINEPRC+
Sbjct  121   EEGVGLSSSNDSFFYDPSIRRYFKNYVKTVLTRRNTLTGVEYRDDPTIFAWELINEPRCI  180

Query  1349  TDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFI  1528
             TD +GDTLQDWIEEMSTFVKSID+NHLLTVGLEGFYGPK PKRL +NPE WAAD+G+DFI
Sbjct  181   TDKSGDTLQDWIEEMSTFVKSIDRNHLLTVGLEGFYGPKSPKRLTVNPEFWAADIGTDFI  240

Query  1529  RNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLA  1708
             RNS +ST+DFASVH+YPDHW  N  F+ KLKF  KW+LSHIEDG++ LKKPIMFTEFGL+
Sbjct  241   RNSKISTVDFASVHIYPDHWTHNPDFEYKLKFVTKWMLSHIEDGDKELKKPIMFTEFGLS  300

Query  1709  GETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERA  1888
              E  +  P QR+RF+K+IL+I+YKSA  NKSGAGS+ WQFLVE MEE+ND+FGIVP++  
Sbjct  301   TENIDFTPSQRERFYKVILDIIYKSAVRNKSGAGSLVWQFLVEGMEEFNDDFGIVPYDNP  360

Query  1889  STYNLITNHSCRLAGVHGVLPSQQEHLKSFCSK  1987
             ST  L T  SC+LA + G LP+Q ++LK  C +
Sbjct  361   STDKLFTEQSCKLARIQGALPTQMDYLKKLCRQ  393



>gb|KDO53904.1| hypothetical protein CISIN_1g014151mg [Citrus sinensis]
Length=430

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/428 (68%), Positives = 352/428 (82%), Gaps = 2/428 (0%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             A NG+F+PIIGFA+ +AFIY++FG L VSYP+E  ++ FV RNGT F  DG+  YVNGWN
Sbjct  4     AGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEP-EMGFVTRNGTHFMLDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYW M+HAV    R RV  MLQA AKMG+TVCRTWAFNDG YN+LQISPG+FDERVF+AL
Sbjct  63    SYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VI E+R++G+RL+L LVNNL+AYGGKTQYV WAW+EGIG+S SNDSFF+DP+I +YFK
Sbjct  123   DHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             +YVKTVLTRKNT+TG+EYR+DPTIFAWELINEPRCM+DP+GDTLQDWI+EMS FVKSIDK
Sbjct  183   HYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDK  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HL+TVGLEGFYGPK PKRL +NPE+WA+ LGSDFIRNSN   IDFASVH+YPDHWF + 
Sbjct  243   KHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDL  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
              F+D LKF  KW+LSHIEDG++ L KP+ FTE+GL+   K  EP  RD+ +K IL+I+YK
Sbjct  303   EFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  +SGAG++ WQ  VE MEEYND+FGIVPWER STY L+T  SC L  +   L  ++
Sbjct  363   SAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRI-SRLNLEK  421

Query  1961  EHLKSFCS  1984
              +LK  CS
Sbjct  422   GNLKELCS  429



>ref|XP_006447301.1| hypothetical protein CICLE_v10015394mg [Citrus clementina]
 ref|XP_006494943.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Citrus sinensis]
 gb|ESR60541.1| hypothetical protein CICLE_v10015394mg [Citrus clementina]
Length=415

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/412 (70%), Positives = 345/412 (84%), Gaps = 1/412 (0%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             A NG+F+PIIGFA+ +AFIY++FG L VSYP+E  ++ FV RNGT F  DG+  YVNGWN
Sbjct  4     AGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEP-EMGFVTRNGTHFMLDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYW M+HAV    R RV  MLQA AKMG+TVCRTWAFNDG YN+LQISPG+FDERVF+AL
Sbjct  63    SYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VI E+R++G+RL+L LVNNL+AYGGKTQYV WAW+EGIG+S SNDSFF+DP+I +YFK
Sbjct  123   DHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             +YVKTVLTRKNT+TG+EYR+DPTIFAWELINEPRCM+DP+GDTLQDWI+EMS FVKSIDK
Sbjct  183   HYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDK  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HL+TVGLEGFYGPK PKRL +NPE+WA+ LGSDFIRNSN   IDFASVH+YPDHWF + 
Sbjct  243   KHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDL  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
              F+D LKF  KW+LSHIEDG++ L KP+ FTE+GL+   K  EP  RD+ +K IL+I+YK
Sbjct  303   EFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
             SAK  +SGAG++ WQ  VE MEEYND+FGIVPWER STY L+T  SCRL  +
Sbjct  363   SAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCRLGRI  414



>ref|XP_004303129.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/434 (67%), Positives = 355/434 (82%), Gaps = 9/434 (2%)
 Frame = +2

Query  680   SRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQV  859
             S +  + A NG+FYPI+GFA+ LA IYL+FGDL  ++ EE  +L+FV+RNGTQF +DG+ 
Sbjct  9     STKKMVAAGNGLFYPIVGFASCLALIYLSFGDLRSNFREEDHQLAFVKRNGTQFTSDGKP  68

Query  860   FYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFD  1039
             FY+NGWNSYW M H VD   RPRVR +LQA AKMG+T+CRTWAFNDG YNALQ+SPG+FD
Sbjct  69    FYINGWNSYWLMYHGVDEYTRPRVREILQAGAKMGLTLCRTWAFNDGDYNALQVSPGQFD  128

Query  1040  ERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDP  1219
             ERVF+ALD VI E+R+ GIRL+LCLVNNL+ YGGK+QYV+WAWQEG+GLS SNDSFF+DP
Sbjct  129   ERVFKALDHVIVEARQQGIRLLLCLVNNLENYGGKSQYVRWAWQEGVGLSASNDSFFFDP  188

Query  1220  NIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMST  1399
             +IR YFK+Y+KT+LTRKNT+ G+EYRDDPTIF WELINEPRC TD +GDTLQDWIEEMS 
Sbjct  189   SIRNYFKSYIKTILTRKNTLNGIEYRDDPTIFGWELINEPRCSTDASGDTLQDWIEEMSA  248

Query  1400  FVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYP  1579
             FVK IDK HLLTVGLEGFYGPKDPK L +NPE WA+ LGSDFIRNS + +IDFASVH+YP
Sbjct  249   FVKLIDKKHLLTVGLEGFYGPKDPKALTVNPERWASRLGSDFIRNSKIPSIDFASVHIYP  308

Query  1580  DHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKL  1759
             DHWF +   +D LKF  KW+LSHIEDGE+ L KP+MFTEFGLA         Q DRF+K 
Sbjct  309   DHWFHDLEVEDHLKFVTKWMLSHIEDGEKELNKPVMFTEFGLAD--------QLDRFYKT  360

Query  1760  ILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVH  1939
             I +I+YKSAK +++GAG++ WQF+V  ME++NDEFGI+PWER +TY LI  H+CRLA + 
Sbjct  361   IYDIIYKSAKKHQAGAGALAWQFIVGGMEKFNDEFGIIPWERPATYKLIIEHTCRLARIQ  420

Query  1940  GVLPSQQEHLKSFC  1981
             G +  +Q +LK  C
Sbjct  421   GPV-LEQRNLKELC  433



>ref|XP_010540874.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Tarenaya hassleriana]
Length=428

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/431 (68%), Positives = 348/431 (81%), Gaps = 6/431 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             A NG  YPI+GF     FIY++FGDLW+ Y  E  +L FV+RNGTQF  D +V YVNGWN
Sbjct  4     AGNGPVYPILGFLVCAIFIYMSFGDLWLDYKVEP-ELGFVKRNGTQFVVDDKVLYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQ+SPG+FDERVF+AL
Sbjct  63    SYWFMDHAVNDHSRYRVGDMLEAGAKMGLTVCRTWAFNDGGYNALQMSPGRFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+R+HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP IRRYFK
Sbjct  123   DHVIAEARKHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGLGLSSSNDSFFFDPTIRRYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+ T+LTRKN+VTG+EYRDDPT+FAWELINEPRCM+D +G+TLQDWI+EMS F+KSID 
Sbjct  183   NYLTTLLTRKNSVTGIEYRDDPTVFAWELINEPRCMSDASGNTLQDWIDEMSAFIKSIDN  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYG  +PKRL +NPE WA++LGSDFIRNS    IDFASVH+YPDHWF +Q
Sbjct  243   KHLLTVGLEGFYGSNNPKRLTVNPERWASELGSDFIRNSASRNIDFASVHIYPDHWFHDQ  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
              F+DKLKF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ EP QRDRF+K I +++YK
Sbjct  303   GFEDKLKFVMKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYEPSQRDRFYKTIFDVIYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  +SGAG++ WQ LVE ME +ND+FGIVPWER S Y L+   SCRL         Q 
Sbjct  363   SAKRKRSGAGTLVWQLLVEGMEGFNDDFGIVPWERESLYKLMIQQSCRLG-----RDRQD  417

Query  1961  EHLKSFCSKTQ  1993
             + LK  CS  Q
Sbjct  418   KSLKELCSHRQ  428



>ref|XP_002517909.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF44427.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=431

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/433 (66%), Positives = 354/433 (82%), Gaps = 2/433 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG+FYPI+GFA+ +AF+Y++FGD  +SY  +  +L+FV RNGTQF  +G+ FY+NG
Sbjct  1     MVAANGLFYPILGFASCVAFLYMSFGDFKLSY-HQGPELAFVTRNGTQFMVEGRPFYING  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNS+W M+H+ +  R+PRV  MLQA AKMG+TVCRTWAFNDG YNALQ+SPGKFDE VF+
Sbjct  60    WNSFWLMDHSAEDDRKPRVSAMLQAGAKMGLTVCRTWAFNDGDYNALQVSPGKFDEGVFQ  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+ RHG+RL+L LVNNLKAYGGKTQYVKWAW+EGIGLS SNDSFF+DP I+RY
Sbjct  120   ALDYVIAEAGRHGVRLLLSLVNNLKAYGGKTQYVKWAWEEGIGLSSSNDSFFFDPTIKRY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNYVKT+LTRKNT+TG+ Y +DPTIFAWEL+NEPRC+TDP+GDTLQ+WIEEMS FVKSI
Sbjct  180   FKNYVKTILTRKNTITGIVYMNDPTIFAWELMNEPRCITDPSGDTLQEWIEEMSAFVKSI  239

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             D NHLLTVGLEGFYGPK+PKRL +NPE WA++LGSDFIRNS +  IDFASVH+YPDHW +
Sbjct  240   DNNHLLTVGLEGFYGPKNPKRLTVNPEEWASNLGSDFIRNSKVPDIDFASVHIYPDHWIQ  299

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
             NQ  ++KL F  KW+ SHIEDG   L KP+ FTE+G +   K+  P  RDRF+K +L+++
Sbjct  300   NQGLEEKLTFVYKWMQSHIEDGHYELNKPVFFTEYGFSNLNKDFRPDHRDRFYKTVLDVI  359

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPS  1954
             YKSAK  ++GAG++ WQ  VE MEE+ND+FGIVPWER STY  +T  SC+LA + G  P 
Sbjct  360   YKSAKRKRAGAGALVWQLFVEEMEEFNDDFGIVPWERPSTYRFLTEQSCKLARIQGD-PR  418

Query  1955  QQEHLKSFCSKTQ  1993
               ++ K  C + +
Sbjct  419   PNQYFKDLCLRRE  431



>emb|CDY05783.1| BnaC07g00200D [Brassica napus]
Length=431

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/429 (66%), Positives = 345/429 (80%), Gaps = 1/429 (0%)
 Frame = +2

Query  698   LARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGW  877
             +  NG   PI+GF    AFIYL+ GDLW  +     +L FV RNGTQF  DG+  YVNGW
Sbjct  1     MGNNGPLIPILGFLTCAAFIYLSLGDLWFRFGGGEPELGFVSRNGTQFVLDGKPLYVNGW  60

Query  878   NSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRA  1057
             NSYWFM+HAV+   R RV  ML+A +KMG+TVCRTWAFNDG YNALQISPG+FDERVF+A
Sbjct  61    NSYWFMDHAVNDHSRHRVGAMLEAGSKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKA  120

Query  1058  LDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYF  1237
             LD VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYF
Sbjct  121   LDHVIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYF  180

Query  1238  KNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSID  1417
             KNY+  +LTRKN++TG+EYR+DPTIFAWELINEPRC TD +GDTLQDWI EM+ F+KSID
Sbjct  181   KNYLTVLLTRKNSITGIEYRNDPTIFAWELINEPRCFTDISGDTLQDWINEMTAFIKSID  240

Query  1418  KNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKN  1597
             K HLLTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS    IDFASVH+YPDHWF +
Sbjct  241   KKHLLTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHD  300

Query  1598  QTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMY  1777
             Q F+DK+KF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I +++Y
Sbjct  301   QGFEDKVKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTIFDVVY  360

Query  1778  KSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQ  1957
             KSAK  +SGAG++ WQFL++ ME +ND+FGIVPWE+ S   L+T  SCRLA V G    Q
Sbjct  361   KSAKRTRSGAGTLVWQFLIQGMEGFNDDFGIVPWEKDSIQRLMTEQSCRLARVTG-RHLQ  419

Query  1958  QEHLKSFCS  1984
              E  +  CS
Sbjct  420   DEKWREICS  428



>ref|XP_006594850.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=428

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 344/416 (83%), Gaps = 0/416 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+  N +FYPI+GFA+F+ FIY++FG +  S+ EE  +LSFVERNGTQF  D + FYVNG
Sbjct  1     MVFGNSLFYPILGFASFVVFIYMSFGGIRFSFLEEGPELSFVERNGTQFVLDEKAFYVNG  60

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M  +VD   R +VR M++  AKMG+TVCRTWAFNDG YNALQ SPG+FDE+ F+
Sbjct  61    WNSYWLMVQSVDVYSRSKVREMMKTGAKMGLTVCRTWAFNDGDYNALQTSPGRFDEQAFQ  120

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR Y
Sbjct  121   ALDYVIAEARQHGIRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRTY  180

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNY+KTVLTRKNT+TG+EYR+DPTIF WELINEPRCM+DP+GDTLQ WI+EMSTFVK I
Sbjct  181   FKNYIKTVLTRKNTITGIEYRNDPTIFGWELINEPRCMSDPSGDTLQGWIDEMSTFVKMI  240

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DKNHLLTVGLEGFYGP DPK   +NPELWA+ LGSDFIRNS +S IDFASVH+YPDHWF 
Sbjct  241   DKNHLLTVGLEGFYGPNDPKSSTVNPELWASRLGSDFIRNSKISNIDFASVHIYPDHWFH  300

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
              Q F+D+LKF  KW+LSHIEDG++ LKKP++F+EFGL+   +      R++  + +L+I+
Sbjct  301   EQVFEDQLKFVSKWMLSHIEDGDKVLKKPVLFSEFGLSETNQNFSMSDREKMHRAVLDII  360

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             YKSAK N+SGAG++ WQFLV  M+E++DE+G+VPWE +ST ++    SCRLA   G
Sbjct  361   YKSAKRNRSGAGALVWQFLVGGMKEFSDEYGMVPWESSSTPHIFIEQSCRLANAKG  416



>gb|EPS70897.1| mannan endo-1,4-beta-mannosidase 2 [Genlisea aurea]
Length=439

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/428 (67%), Positives = 346/428 (81%), Gaps = 6/428 (1%)
 Frame = +2

Query  713   MFYPIIGFAAFLAFIYLTFGD---LWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNS  883
             + YPI+GF +F+AF+ L+FGD   +   +     + +FV+RNGTQF  DG+ FYVNGWNS
Sbjct  14    LLYPIVGFVSFIAFLLLSFGDWFDVIYGHTAAAKRPTFVQRNGTQFTVDGKPFYVNGWNS  73

Query  884   YWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALD  1063
             YW M+HAV+   R R+R MLQ  + MG+TVCRTWAFNDG YNALQISPG+FDERVFRALD
Sbjct  74    YWLMDHAVEERNRHRIRAMLQRGSGMGLTVCRTWAFNDGDYNALQISPGRFDERVFRALD  133

Query  1064  LVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKN  1243
              VIAES R+GIRL+LCLVNNLKAYGGKTQYVKWAW+EG+GLS SNDSFFYDP+IR YFKN
Sbjct  134   YVIAESGRYGIRLVLCLVNNLKAYGGKTQYVKWAWEEGVGLSSSNDSFFYDPSIRTYFKN  193

Query  1244  YVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKN  1423
             YVKTVLTRKN +TG+EYRDDPTIFAWELINEPRCMTD +GDTLQ    EMS+FVK ID N
Sbjct  194   YVKTVLTRKNRLTGVEYRDDPTIFAWELINEPRCMTDKSGDTLQ---AEMSSFVKRIDGN  250

Query  1424  HLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQT  1603
             HLLTVGLEGFYGPK  KRL +NPE+WAA+ G+DFIRNS + TIDFASVH+YPDHW +   
Sbjct  251   HLLTVGLEGFYGPKSAKRLTVNPEVWAAEFGTDFIRNSKIPTIDFASVHIYPDHWTRKPD  310

Query  1604  FQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKS  1783
             F+ +L+F  +W+LSHIEDG++ L+KPI+FTEFGL+ E K      RD+ +++IL+++YKS
Sbjct  311   FEYQLRFAFRWMLSHIEDGDKELRKPILFTEFGLSTENKGFSHSNRDKLYRIILDVIYKS  370

Query  1784  AKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQE  1963
                 +SGAG++ WQFLVE MEE+ND+FGIVPWER STY L    SCRLA + G LPSQ  
Sbjct  371   GLRKRSGAGTLVWQFLVEGMEEFNDDFGIVPWERQSTYKLFAEQSCRLARIQGALPSQLR  430

Query  1964  HLKSFCSK  1987
             HL+  C++
Sbjct  431   HLRKLCTQ  438



>ref|XP_003540365.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=428

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 344/416 (83%), Gaps = 0/416 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+  N +FYPI+GFA+F+ FIY++FG +  S+ EE  +LSFVERNGTQF  DG+ FYVNG
Sbjct  1     MVFGNSLFYPILGFASFVVFIYMSFGGIKFSFLEEGPELSFVERNGTQFVLDGKAFYVNG  60

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M  +VD   R +VR M++  AKMG+TVCRTWAFNDG YNALQ SPG+FDE+ F+
Sbjct  61    WNSYWLMVQSVDVYSRSKVREMMKTGAKMGLTVCRTWAFNDGDYNALQTSPGRFDEQSFQ  120

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR Y
Sbjct  121   ALDYVIAEARQHGIRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRTY  180

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNY+KTVLTRKNT+TG+EYR+DP+IF WELINEPRCM+DP+GDTLQ WI+EMSTFVK I
Sbjct  181   FKNYIKTVLTRKNTITGIEYRNDPSIFGWELINEPRCMSDPSGDTLQGWIDEMSTFVKMI  240

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DKNHLLTVGLEGFYGP DPK   +NPELWA+ LGSDFIRNS +S IDFASVH+YPDHWF 
Sbjct  241   DKNHLLTVGLEGFYGPNDPKSSTVNPELWASRLGSDFIRNSKISHIDFASVHIYPDHWFH  300

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
              Q F+D+LKF  KW+LSHIEDG+  LKKP++F+EFGL+   +      R++  + +L+I+
Sbjct  301   EQVFEDQLKFVYKWMLSHIEDGDEVLKKPVLFSEFGLSKTNQNFSLSDREKMHRAVLDII  360

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             YKSAK N+SGAG++ WQFLV  M+E++DE+G+VPWE +ST ++    SCRLA   G
Sbjct  361   YKSAKRNRSGAGALVWQFLVGGMKEFSDEYGMVPWESSSTPHVFIEQSCRLANAKG  416



>ref|XP_006409005.1| hypothetical protein EUTSA_v10001990mg [Eutrema salsugineum]
 gb|ESQ50458.1| hypothetical protein EUTSA_v10001990mg [Eutrema salsugineum]
Length=434

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/427 (66%), Positives = 345/427 (81%), Gaps = 1/427 (0%)
 Frame = +2

Query  707   NGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSY  886
             NG   PI+GF   +AFIYL+FGDLW  Y  E  +L FV RNGTQF  DG+  YVNGWNSY
Sbjct  6     NGPLIPILGFLTCVAFIYLSFGDLWFDYKGEA-ELGFVRRNGTQFVVDGKALYVNGWNSY  64

Query  887   WFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDL  1066
             WFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD 
Sbjct  65    WFMDHAVNDHSRHRVGAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH  124

Query  1067  VIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNY  1246
             VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFKNY
Sbjct  125   VIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNY  184

Query  1247  VKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNH  1426
             +  +LTRKN++TG+EYR+DPTIFAWELINEPRC++D +GDTLQDWI EM+ F+K+IDK H
Sbjct  185   LTVLLTRKNSITGIEYRNDPTIFAWELINEPRCLSDISGDTLQDWINEMTAFIKTIDKKH  244

Query  1427  LLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTF  1606
             LLTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS    IDFASVH+YPDHWF +Q F
Sbjct  245   LLTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGF  304

Query  1607  QDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSA  1786
             ++K+KF  KW+ SHIEDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I +++YKSA
Sbjct  305   EEKVKFVVKWMQSHIEDGDKELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTIFDVVYKSA  364

Query  1787  KHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEH  1966
             K  +SGAG++ WQ L++ ME +ND+FGIVPWE+ S   L+   SCRL  V G    Q + 
Sbjct  365   KRRRSGAGTLVWQLLIQGMEGFNDDFGIVPWEQDSIQRLMMEQSCRLIRVTGRHHLQDKK  424

Query  1967  LKSFCSK  1987
              +  CS+
Sbjct  425   SRDMCSQ  431



>ref|XP_006296707.1| hypothetical protein CARUB_v10013751mg [Capsella rubella]
 gb|EOA29605.1| hypothetical protein CARUB_v10013751mg [Capsella rubella]
Length=433

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/427 (66%), Positives = 346/427 (81%), Gaps = 1/427 (0%)
 Frame = +2

Query  707   NGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSY  886
             NG   PI+GF   +AFIYL+FGDLW  +  E     FV+RNGTQF  DG+  YVNGWNSY
Sbjct  6     NGPLIPILGFLTCVAFIYLSFGDLWFDFKREADLGGFVKRNGTQFVVDGKPLYVNGWNSY  65

Query  887   WFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDL  1066
             WFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD 
Sbjct  66    WFMDHAVNDHSRHRVGAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH  125

Query  1067  VIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNY  1246
             VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFKNY
Sbjct  126   VIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNY  185

Query  1247  VKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNH  1426
             +  +LTRKN++TG+EYR+DPTIFAWELINEPRCM+D +GDTLQDWI EM+ F+KSID  H
Sbjct  186   LTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDISGDTLQDWINEMTAFIKSIDNKH  245

Query  1427  LLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTF  1606
             LLTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS+   IDFASVH+YPDHWF +  F
Sbjct  246   LLTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDLGF  305

Query  1607  QDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSA  1786
             +DKLKF  KWILSHIEDG++ LKKP++FTEFGL+   K+ +P QRDRF++ I +I+YKSA
Sbjct  306   EDKLKFVVKWILSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDIIYKSA  365

Query  1787  KHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEH  1966
             K  +SGAG++ WQFL+E ME +ND+FGIVPWE+ S   L+   SCRL  + G     ++ 
Sbjct  366   KRRRSGAGTLMWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLGRITGRHLQDKKS  425

Query  1967  LKSFCSK  1987
             ++  CS+
Sbjct  426   IE-ICSQ  431



>ref|XP_010526516.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Tarenaya 
hassleriana]
Length=431

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/434 (66%), Positives = 350/434 (81%), Gaps = 9/434 (2%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARNG  YP++GF     FIYL+FGDLW  Y  E  +L FV+RNGTQF  D +V YVNGWN
Sbjct  4     ARNGPLYPVLGFLVCAIFIYLSFGDLWFDYKAEP-ELGFVKRNGTQFVVDDKVLYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM+HAV+   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  63    SYWFMDHAVNEHSRYLVSGMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+R+HGIRL+L LVNNL+AYGGKTQYVKWAWQEG+GLS SNDSFF+DP+IRRYFK
Sbjct  123   DHVIAEARKHGIRLLLSLVNNLQAYGGKTQYVKWAWQEGVGLSSSNDSFFFDPSIRRYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+ T+L RKNT TG+EYRDDPTIFAWELINEPRCM+D +G+TLQDWI+EMS F+KSID 
Sbjct  183   NYLTTLLNRKNTETGIEYRDDPTIFAWELINEPRCMSDVSGNTLQDWIDEMSAFIKSIDS  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGP +PKRL +NPE WA++LGSDF+RNS  S IDFASVH+YPDHWF ++
Sbjct  243   KHLLTVGLEGFYGPDNPKRLTVNPERWASELGSDFVRNSASSNIDFASVHIYPDHWFHDK  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
              F++ LKF KKW++SHIEDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I +++YK
Sbjct  303   GFEENLKFVKKWMMSHIEDGDKVLKKPVVFTEFGLSNLNKDYEPSQRDRFYREIFDVIYK  362

Query  1781  SAKHNK---SGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
              +K N+   S AG++ WQ L+E M+ +ND+FGIVPWER S + L+   SCRL G H    
Sbjct  363   CSKRNRTSSSAAGTLVWQLLMEGMDGFNDDFGIVPWERESIHRLMIEQSCRL-GRH----  417

Query  1952  SQQEHLKSFCSKTQ  1993
                + L+  CS+ Q
Sbjct  418   RMDKKLEQVCSRGQ  431



>ref|XP_007152175.1| hypothetical protein PHAVU_004G108000g [Phaseolus vulgaris]
 gb|ESW24169.1| hypothetical protein PHAVU_004G108000g [Phaseolus vulgaris]
Length=428

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/416 (66%), Positives = 342/416 (82%), Gaps = 0/416 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+  N +FYPI+GFA+F+ F+Y++FG +  S  EE  +LSFVERNGTQF  DG+ FYVNG
Sbjct  1     MVFGNSLFYPILGFASFVVFVYMSFGGIRFSVLEEGPELSFVERNGTQFVLDGKAFYVNG  60

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M  +VD   R +VR M++  AKMG+TVCRTWAFNDG YNALQ SPG FDE+ F+
Sbjct  61    WNSYWLMVQSVDVYSRSKVREMMKTGAKMGLTVCRTWAFNDGDYNALQTSPGHFDEQAFQ  120

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR Y
Sbjct  121   ALDYVIAEARQHGIRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRTY  180

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNY+KTVLTRKN++TG+EYR+DPTIF WELINEPRCM+DP+GDTLQ WI+EMS+FVK I
Sbjct  181   FKNYIKTVLTRKNSITGIEYRNDPTIFGWELINEPRCMSDPSGDTLQGWIDEMSSFVKLI  240

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DKNHLLTVGLEGFYGP DPK   +NPELWA+ LGSDFIRNS +S IDFASVH+YPDHWF 
Sbjct  241   DKNHLLTVGLEGFYGPNDPKSSTVNPELWASRLGSDFIRNSKISNIDFASVHIYPDHWFH  300

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
              Q F+D+LKF  KW+LSHIEDG++ LKKP++F+EFGL+   +      R++  + +L+I+
Sbjct  301   EQVFEDQLKFVSKWMLSHIEDGDKVLKKPVLFSEFGLSETNQNFSLSDREKMHRTVLDII  360

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             YKSAK N+SG G++ WQFLV  M+E++DE+G+VPWE +ST ++    SCRLA   G
Sbjct  361   YKSAKRNRSGGGALVWQFLVGGMKEFSDEYGMVPWESSSTPSIFIEQSCRLANAKG  416



>ref|NP_179660.2| mannan endo-1,4-beta-mannosidase 2 [Arabidopsis thaliana]
 sp|Q7Y223.1|MAN2_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 
2; AltName: Full=Endo-beta-1,4-mannanase 2; 
Short=AtMAN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAP40422.1| putative glycosyl hydrolase family 5 protein/cellulase ((1-4)-beta-mannan 
endohydrolase) [Arabidopsis thaliana]
 gb|ABG25077.1| At2g20680 [Arabidopsis thaliana]
 dbj|BAF00487.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07056.1| mannan endo-1,4-beta-mannosidase 2 [Arabidopsis thaliana]
Length=433

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/412 (67%), Positives = 342/412 (83%), Gaps = 1/412 (0%)
 Frame = +2

Query  707   NGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSY  886
             NG   PI+GF   +AFIYL+FGDLW     E  +L+FV+RNGTQF  DG+  YVNGWNSY
Sbjct  7     NGPVIPILGFLTCVAFIYLSFGDLWFGLKTEG-ELAFVKRNGTQFVVDGKALYVNGWNSY  65

Query  887   WFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDL  1066
             WFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD 
Sbjct  66    WFMDHAVNDHSRHRVSAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH  125

Query  1067  VIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNY  1246
             VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFKNY
Sbjct  126   VIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNY  185

Query  1247  VKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNH  1426
             +  +LTRKN++TG+EYR+DPTIFAWELINEPRCM+D +GDTLQDWI EM+ F+KSID  H
Sbjct  186   LTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDVSGDTLQDWINEMTAFIKSIDNKH  245

Query  1427  LLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTF  1606
             LLTVGLEGFYGP  PK+L +NPE WA++LGSDF+RNS+   IDFASVH+YPDHWF +Q F
Sbjct  246   LLTVGLEGFYGPSSPKKLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGF  305

Query  1607  QDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSA  1786
             ++KLKF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ +P QRDRF++ I +++YKSA
Sbjct  306   EEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKSA  365

Query  1787  KHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             K  +SGAG++ WQFL+E ME +ND+FGIVPWE+ S   L+   SCRL+ + G
Sbjct  366   KRKRSGAGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRITG  417



>ref|XP_006412972.1| hypothetical protein EUTSA_v10025261mg [Eutrema salsugineum]
 gb|ESQ54425.1| hypothetical protein EUTSA_v10025261mg [Eutrema salsugineum]
Length=431

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/428 (66%), Positives = 348/428 (81%), Gaps = 3/428 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARNG   PI+GF    AFIY +F DLW+ +  +T +L FV+RNGTQF  DG+  YVNGWN
Sbjct  4     ARNGAVLPILGFLICAAFIYFSFRDLWLYHKAKT-ELGFVKRNGTQFVVDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQISPG FDERVF+AL
Sbjct  63    SYWFMDHAVNEHSRYRVSEMLEAGAKMGLTVCRTWAFNDGGYNALQISPGHFDERVFQAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+R+H +RL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR+YFK
Sbjct  123   DHVIAEARKHDVRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRKYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+  +LTRKN+VTG+EYR+DPTIFAWELINEPRC +D +GDTLQ+WI+EM+ F+KSID 
Sbjct  183   NYLTALLTRKNSVTGIEYRNDPTIFAWELINEPRCSSDVSGDTLQEWIDEMTGFIKSIDD  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGPK PKRL +NPE W ++LG+DF+RNSN S IDFASVH+YPDHWF +Q
Sbjct  243   KHLLTVGLEGFYGPKSPKRLTVNPEQWPSELGTDFVRNSNSSNIDFASVHIYPDHWFHDQ  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
             +F+DKLKF  KW+ SH+EDG + LKKP++FTEFGL+   K+ EP QR+RF+++I +++YK
Sbjct  303   SFEDKLKFVVKWMQSHVEDGMKELKKPVLFTEFGLSNLNKDYEPSQRERFYRIIFDVVYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  KSGAG++ WQ  +E ME +NDEFGIVP E+ S Y L+   SCRL  V G L  ++
Sbjct  363   SAKRRKSGAGTLVWQLFMEGMEGFNDEFGIVPHEQDSMYRLMIEQSCRLGRVTGRL--KE  420

Query  1961  EHLKSFCS  1984
               LK  CS
Sbjct  421   HKLKKLCS  428



>emb|CDX81978.1| BnaC08g36230D [Brassica napus]
Length=432

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/426 (66%), Positives = 344/426 (81%), Gaps = 2/426 (0%)
 Frame = +2

Query  707   NGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSY  886
             NG   PI+GF   +AF+YL+FGDLW+ Y  E  +L FV RNGTQF  DG+  YVNGWNSY
Sbjct  6     NGPMVPILGFLTCVAFLYLSFGDLWLDYNREA-ELGFVSRNGTQFVLDGKPLYVNGWNSY  64

Query  887   WFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDL  1066
             WFM+HAV+   R RV  ML+A +KMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD 
Sbjct  65    WFMDHAVNDHSRHRVGAMLEAGSKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH  124

Query  1067  VIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNY  1246
             VIAE++ HG+RL+L LVNNL+ YGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFKNY
Sbjct  125   VIAEAKTHGVRLLLSLVNNLQNYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNY  184

Query  1247  VKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNH  1426
             +  +LTRKN++TG+EYR+DPTIFAWELINEPRC+TD +GDTLQDWI EM+ F+KSIDK H
Sbjct  185   LTVLLTRKNSITGIEYRNDPTIFAWELINEPRCLTDISGDTLQDWINEMTAFIKSIDKKH  244

Query  1427  LLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTF  1606
             LLTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS    IDFASVH+YPDHWF +Q F
Sbjct  245   LLTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGF  304

Query  1607  QDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSA  1786
             ++ L+F  KW+ SH+EDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I +++YKSA
Sbjct  305   EENLRFAVKWMQSHMEDGDKELKKPVLFTEFGLSNMNKDYEPSQRDRFYRTIFDVVYKSA  364

Query  1787  KHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEH  1966
             K  +SGAG++ WQFL++ ME +NDEFGIVPWE+ S   L+   SCRL  V G L  Q + 
Sbjct  365   KRKRSGAGTLVWQFLIQGMEGFNDEFGIVPWEKDSIQRLMMEQSCRLGRVTGRL-LQDKK  423

Query  1967  LKSFCS  1984
                 CS
Sbjct  424   ATEICS  429



>gb|KHG04578.1| Mannan endo-1,4-beta-mannosidase 2 -like protein [Gossypium arboreum]
Length=445

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/433 (64%), Positives = 352/433 (81%), Gaps = 3/433 (1%)
 Frame = +2

Query  692   KMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYP-EETLKLSFVERNGTQFYADGQVFYV  868
             KM+ RNGM YPI+GFA+ +AF+Y++FGDL +S    +  + SFVERNGTQF+ +G+  YV
Sbjct  13    KMVTRNGMLYPILGFASCVAFLYMSFGDLKLSANFTKGPRFSFVERNGTQFFLNGKPLYV  72

Query  869   NGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERV  1048
             NGWNSYW M H+VD   RP+V  MLQA AKMG+TVCRTWAFNDG YNALQISPG+FDERV
Sbjct  73    NGWNSYWLMAHSVDESSRPKVSAMLQAGAKMGLTVCRTWAFNDGGYNALQISPGQFDERV  132

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
             F+ALD VIAE+R+ GIRL+L LVNNL+ YGGKTQYV WAWQEG+GLS SNDSFF+DP+IR
Sbjct  133   FKALDYVIAEARQQGIRLLLSLVNNLQPYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIR  192

Query  1229  RYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVK  1408
             +YFKNYV TVLTRKNT+TG++YR+DPTIFAWELINEPRCMTDP+GDTLQDW+EEMS F+K
Sbjct  193   KYFKNYVLTVLTRKNTITGIQYRNDPTIFAWELINEPRCMTDPSGDTLQDWLEEMSAFIK  252

Query  1409  SIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHW  1588
             SIDKNHLLT+GLEGFYGP  PK+  +NPE WA+ LG+DF+RNSN++ +DFASVH+YPD  
Sbjct  253   SIDKNHLLTIGLEGFYGPSSPKKATVNPEQWASALGADFMRNSNITNVDFASVHIYPDQ-  311

Query  1589  FKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILE  1768
             F    F++K  +  KW+ SHIED ++ LKKP+MFTE+GL+ + K+ +  QR++ ++ I +
Sbjct  312   FHGLGFEEKRNYVSKWMHSHIEDCDKELKKPVMFTEYGLSDQNKDFQLSQREQLYRTIQD  371

Query  1769  IMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
             I+YKSAK   SGAG++ WQF VE M+EY+D+FG+VPW+    Y L   HSC+LA + G++
Sbjct  372   IIYKSAKKKGSGAGALVWQFFVEGMQEYSDDFGMVPWQSPPIYKLTIEHSCKLARIQGLI  431

Query  1949  PSQQEHLKSFCSK  1987
               +  +LK  CSK
Sbjct  432   -QENGNLKQLCSK  443



>ref|XP_002884216.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60475.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/412 (68%), Positives = 342/412 (83%), Gaps = 1/412 (0%)
 Frame = +2

Query  707   NGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSY  886
             NG   PI+GF   +AFIYL+FGDL   +  E  +L FV+RNGTQF  DG+  YVNGWNSY
Sbjct  6     NGPVIPILGFLTCVAFIYLSFGDLLFDFKREG-ELGFVKRNGTQFVVDGKALYVNGWNSY  64

Query  887   WFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDL  1066
             WFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD 
Sbjct  65    WFMDHAVNDHSRHRVGAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH  124

Query  1067  VIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNY  1246
             VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFKNY
Sbjct  125   VIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNY  184

Query  1247  VKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNH  1426
             +  +LTRKN++TG+EYR+DPTIFAWELINEPRCM+D +GDTLQDWI EM+ F+KSID  H
Sbjct  185   LTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDVSGDTLQDWINEMTAFIKSIDNKH  244

Query  1427  LLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTF  1606
             LLTVGLEGFYGP +PKRL +NPE WA++LGSDF+RNS+   IDFASVH+YPDHWF +Q F
Sbjct  245   LLTVGLEGFYGPNNPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGF  304

Query  1607  QDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSA  1786
             ++KLKF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ +P QRDRF++ I +++YKSA
Sbjct  305   EEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKSA  364

Query  1787  KHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             K  +SGAG++ WQFL+E ME +ND+FGIVPWE+ S   L+   SCRL+ V G
Sbjct  365   KRKRSGAGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRVTG  416



>ref|XP_009117471.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Brassica rapa]
 ref|XP_009117472.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Brassica rapa]
 emb|CDY13860.1| BnaA09g43620D [Brassica napus]
Length=432

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/426 (66%), Positives = 343/426 (81%), Gaps = 2/426 (0%)
 Frame = +2

Query  707   NGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSY  886
             NG   PI+GF   +AF+YL+FGDLW  Y  E  +L FV RNGTQF  DG+  YVNGWNSY
Sbjct  6     NGPMVPILGFLTCVAFLYLSFGDLWFDYNREA-ELGFVSRNGTQFVLDGKPLYVNGWNSY  64

Query  887   WFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDL  1066
             WFM+HAV+   R RV  ML+A +KMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD 
Sbjct  65    WFMDHAVNDHSRHRVGAMLEAGSKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH  124

Query  1067  VIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNY  1246
             VIAE++ HG+RL+L LVNNL+ YGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFKNY
Sbjct  125   VIAEAKTHGVRLLLSLVNNLQNYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNY  184

Query  1247  VKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNH  1426
             +  +LTRKN++TG+EYR+DPTIFAWELINEPRC+TD +GDTLQDWI EM+ F+KSIDK H
Sbjct  185   LTVLLTRKNSITGIEYRNDPTIFAWELINEPRCLTDISGDTLQDWINEMTAFIKSIDKKH  244

Query  1427  LLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTF  1606
             LLTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS    IDFASVH+YPDHWF +Q F
Sbjct  245   LLTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGF  304

Query  1607  QDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSA  1786
             ++ LKF  KW+ SH+EDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I +++YKSA
Sbjct  305   EENLKFAVKWMQSHMEDGDKELKKPVLFTEFGLSNMNKDYEPSQRDRFYRTIFDVIYKSA  364

Query  1787  KHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEH  1966
             K  +SGAG++ WQFL++ ME +NDEFGIVPWE+ S   L+   SCRL  V G L  Q + 
Sbjct  365   KRKRSGAGTLVWQFLIQGMEGFNDEFGIVPWEKDSIQRLMMEQSCRLGRVTGRL-LQDKK  423

Query  1967  LKSFCS  1984
                 CS
Sbjct  424   STEVCS  429



>gb|KFK40440.1| hypothetical protein AALP_AA3G373500 [Arabis alpina]
Length=432

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/414 (67%), Positives = 341/414 (82%), Gaps = 1/414 (0%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             A NG   PI+GF   +AFIYL+FGDLW     +  +  FV+RNGTQF  DG+  YVNGWN
Sbjct  4     AGNGPLIPILGFLTCVAFIYLSFGDLWFDIKGDA-ESGFVKRNGTQFVVDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  63    SYWFMDHAVNDHSRHRVGAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFK
Sbjct  123   DHVIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+  +LTRKN++TG+EYR+DPTIFAWELINEPRC++D +GDTLQDWI EM+ F+KSID 
Sbjct  183   NYLTALLTRKNSITGIEYRNDPTIFAWELINEPRCLSDISGDTLQDWINEMTAFIKSIDN  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS+   IDFASVH+YPDHWF +Q
Sbjct  243   KHLLTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQ  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
              F++KLKF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I +++YK
Sbjct  303   GFEEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYEPAQRDRFYRTIFDVVYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             SAK  +SGAG++ WQF++E ME +ND+FGIVPWE+ S   L+   SCRL  V G
Sbjct  363   SAKRKRSGAGTLVWQFVIEGMEGFNDDFGIVPWEQDSIQRLMKEQSCRLGRVTG  416



>ref|XP_003539924.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=436

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/436 (65%), Positives = 348/436 (80%), Gaps = 4/436 (1%)
 Frame = +2

Query  674   VKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADG  853
             V  R   M++ NG+FYP++GFA+ + FIY++FGD+   + EE  +L+FVERNGTQF  DG
Sbjct  5     VCKRYRIMVSGNGLFYPVVGFASIVLFIYMSFGDVRFGFEEEA-ELAFVERNGTQFMVDG  63

Query  854   QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGK  1033
             + FY+NGWNSYW M  +VD   RP+VR ML+A AKMG+TVCRTWAFNDG YNALQ SPG 
Sbjct  64    KAFYINGWNSYWLMVQSVDEYSRPKVREMLRAGAKMGLTVCRTWAFNDGDYNALQSSPGV  123

Query  1034  FDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFY  1213
             F+E+ F+ALD VIAE+R+HGIRL+L LVNNL AYGGKTQYVKWAWQEG+GLS SNDSFF+
Sbjct  124   FNEQAFKALDYVIAEARQHGIRLLLSLVNNLHAYGGKTQYVKWAWQEGVGLSSSNDSFFF  183

Query  1214  DPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEM  1393
             DP+IR YFKNYVKT+LTRKNT+TG+EYR+DPTIF WELINEPRC+TDP+GDTLQDWIEEM
Sbjct  184   DPSIRSYFKNYVKTILTRKNTITGIEYRNDPTIFGWELINEPRCLTDPSGDTLQDWIEEM  243

Query  1394  STFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHV  1573
             S FVK IDK HL+TVGLEGFYGP DPKRL +NPE WA+ LGSDFIRNS +S IDF SVH+
Sbjct  244   SAFVKLIDKRHLVTVGLEGFYGPNDPKRLTVNPEDWASRLGSDFIRNSKISNIDFTSVHI  303

Query  1574  YPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFF  1753
             YPDHWF +Q F+D +KF  KW+LSHIEDG++ L KP++F+E+GL+ +     P +R   +
Sbjct  304   YPDHWFHHQVFEDYMKFVSKWMLSHIEDGDKVLNKPVLFSEYGLS-DINFTMP-ERKTMY  361

Query  1754  KLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAG  1933
             K IL+I YKSAK N+SGAG++ WQFLV  M+E+ D+FGI+PWE+    +L    SCRLA 
Sbjct  362   KTILDISYKSAKKNRSGAGALVWQFLVGGMQEFTDDFGIIPWEKTPIPSLFVEQSCRLAK  421

Query  1934  VHGVLPSQQEHLKSFC  1981
               G  P +    K FC
Sbjct  422   TKG-WPHKDTSFKQFC  436



>ref|XP_003527431.2| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Glycine max]
Length=436

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/438 (65%), Positives = 349/438 (80%), Gaps = 4/438 (1%)
 Frame = +2

Query  668   FMVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYA  847
             + V  R   M++ NG+FYP++GFA+ + FIY++FGD+   + EE  +L+FVERNGTQF  
Sbjct  3     YRVCKRYRIMVSGNGLFYPVVGFASIVLFIYMSFGDVRFGFEEEA-ELAFVERNGTQFMV  61

Query  848   DGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISP  1027
             DG+ FY+NGWNSYW M  +VD   RP+VR ML++ AKMG+TVCRTWAFNDG YNALQ SP
Sbjct  62    DGKAFYINGWNSYWLMVQSVDEYSRPKVREMLRSGAKMGLTVCRTWAFNDGDYNALQSSP  121

Query  1028  GKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSF  1207
             G F+E+ F+ALD VIAE+R+HGIRL+L LVNNL AYGGKTQYVKWAWQEG+GLS SNDSF
Sbjct  122   GVFNEQAFKALDYVIAEARQHGIRLLLSLVNNLHAYGGKTQYVKWAWQEGVGLSSSNDSF  181

Query  1208  FYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIE  1387
             F+DP+IR YFKNYVKT+LTRKNT+TG+EYR+DPTIF WELINEPRC+TDP+GDTLQDWIE
Sbjct  182   FFDPSIRSYFKNYVKTILTRKNTITGIEYRNDPTIFGWELINEPRCLTDPSGDTLQDWIE  241

Query  1388  EMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASV  1567
             EMS FVK IDK HL+TVGLEGFYGP DPKRL +NPE WA+ LGSDFIRNS +S IDF SV
Sbjct  242   EMSAFVKLIDKRHLVTVGLEGFYGPNDPKRLTVNPEDWASRLGSDFIRNSKISNIDFTSV  301

Query  1568  HVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDR  1747
             H+YPDHWF +Q F+D +KF  KW+LSHIEDG++ L KP++F+E+GL+ +     P +R  
Sbjct  302   HIYPDHWFHHQVFEDYMKFVSKWMLSHIEDGDKILNKPVLFSEYGLS-DINFTMP-ERKT  359

Query  1748  FFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRL  1927
              +K IL+I YKSAK N+SGAG++ WQFLV  M+E+ D+FGI+PWE+    +L    SCRL
Sbjct  360   MYKTILDISYKSAKRNRSGAGALVWQFLVGGMQEFTDDFGIIPWEKTPIPSLFVEQSCRL  419

Query  1928  AGVHGVLPSQQEHLKSFC  1981
               V G  P +    K FC
Sbjct  420   TKVKG-WPHKDTSFKQFC  436



>ref|XP_010089553.1| Mannan endo-1,4-beta-mannosidase 2 [Morus notabilis]
 gb|EXB37999.1| Mannan endo-1,4-beta-mannosidase 2 [Morus notabilis]
Length=433

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/434 (66%), Positives = 353/434 (81%), Gaps = 2/434 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYP-EETLKLSFVERNGTQFYADGQVFYVN  871
             M+A NG+FYPI+GFA+ +AFIYL+FGD+ V+    +  ++ FVERNGT+F  +G+ FY+N
Sbjct  1     MVAGNGLFYPILGFASCMAFIYLSFGDVKVNLSLGKGPEMDFVERNGTKFMVNGKPFYIN  60

Query  872   GWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVF  1051
             GWNSYW M+HAV+   R RV  MLQA +KMG+TVCRTWAFNDG YNALQ+SPG F+ERVF
Sbjct  61    GWNSYWLMDHAVNDYSRSRVGAMLQAGSKMGLTVCRTWAFNDGTYNALQVSPGVFNERVF  120

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             +ALD VIAE+RRHGIRL+L LVNNL+AYGGKTQYVKWAW+EG+ LS SNDSFF+DP+IR 
Sbjct  121   QALDYVIAEARRHGIRLLLSLVNNLQAYGGKTQYVKWAWEEGLALSASNDSFFFDPSIRD  180

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             YFKNYVKT+LTRKNT+TG+ Y+DD TIF WELINEPRC+TD +GDTLQDW+EEMS FVKS
Sbjct  181   YFKNYVKTILTRKNTITGVRYKDDSTIFGWELINEPRCITDASGDTLQDWLEEMSAFVKS  240

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             IDK HLLT+GLEGFYGPK PKRL +NPE WA+ LG+DFIRNS +  IDFASVH+YPDHWF
Sbjct  241   IDKRHLLTIGLEGFYGPKSPKRLTVNPEEWASRLGADFIRNSQIPYIDFASVHIYPDHWF  300

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
                 F+D LK+  KW+ SHIEDG++ L KP+MFTEFGL+   K+ EP QRD+++  I ++
Sbjct  301   HGLAFEDNLKYLSKWVRSHIEDGDKELMKPVMFTEFGLSNLNKDFEPSQRDKYYITIYDL  360

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +YKSAK   +GAG+  WQFLVE MEEYND+FG++PWE  S Y+L+   SCRLA + GV  
Sbjct  361   IYKSAKKGGAGAGAFIWQFLVEGMEEYNDDFGMIPWENPSIYSLVVRQSCRLARLQGV-T  419

Query  1952  SQQEHLKSFCSKTQ  1993
              QQ +L + C + Q
Sbjct  420   QQQGNLNALCMQRQ  433



>ref|XP_009144379.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 isoform X2 [Brassica 
rapa]
 emb|CDX89187.1| BnaA01g17060D [Brassica napus]
Length=431

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 349/429 (81%), Gaps = 5/429 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARNG   P++GF    AFIYL+F DLW+++   T ++ FV+RNGTQF  DG+  YVNGWN
Sbjct  4     ARNGSAIPVLGFLICAAFIYLSFRDLWLNHKWRT-EIGFVKRNGTQFVVDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM+HAV+   R  V  ML+  AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  63    SYWFMDHAVNEHSRYLVSEMLETGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+++H +RL+LCLVNNL+AYGGK+QYV+WAWQEG+GLS SNDSFF+DP+IR+YFK
Sbjct  123   DHVIAEAKKHDVRLLLCLVNNLQAYGGKSQYVQWAWQEGVGLSSSNDSFFFDPSIRKYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+  +LTRKN+VTG+EYR+DPTIFAWELINEPRC +D +GDTLQDWI+EM++F+KSID 
Sbjct  183   NYLTALLTRKNSVTGIEYRNDPTIFAWELINEPRCTSDVSGDTLQDWIDEMTSFIKSIDD  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGP  PKRL +NPE+W ++LG+DF+RNSN S IDFASVH+YPDHWF NQ
Sbjct  243   KHLLTVGLEGFYGPNSPKRLTVNPEMWPSELGTDFVRNSNSSNIDFASVHIYPDHWFHNQ  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
             TF+DKLKF  +W+ SHIEDG + LKKP++FTEFGL+   K+ EP QR+RF++ I +++YK
Sbjct  303   TFEDKLKFVVQWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRERFYRTIFDVVYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  K+GAG++ WQ  +E ME +NDEFGIVP E+   Y L+   SCRL  V G    ++
Sbjct  363   SAKRRKAGAGTLVWQLFMEGMEGFNDEFGIVPHEQDPMYRLMVEQSCRLGKVTG---RRE  419

Query  1961  EH-LKSFCS  1984
             EH L+  CS
Sbjct  420   EHKLRKLCS  428



>gb|AFK46805.1| unknown [Lotus japonicus]
Length=440

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/430 (66%), Positives = 343/430 (80%), Gaps = 3/430 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG+FYPI+GFA+ + FIY++FGD+   + EE   LSFVERNGTQF  DG+ FY+NG
Sbjct  13    MVAGNGLFYPILGFASLVVFIYMSFGDVRFGF-EEGPDLSFVERNGTQFVVDGKPFYING  71

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYWFM  +VD   +PRV  ML+A AK+G+TVCRTWAFNDG YNALQ SPG FDE+ F+
Sbjct  72    WNSYWFMVQSVDDYTKPRVHEMLKAGAKIGLTVCRTWAFNDGDYNALQTSPGVFDEQTFK  131

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRL+L LVNNL AYGGKTQYVKWAWQEG+GLS SNDSFFYDP+IR Y
Sbjct  132   ALDYVIAEARQHGIRLLLSLVNNLHAYGGKTQYVKWAWQEGVGLSSSNDSFFYDPSIRSY  191

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNYVKT+LTRKNT+TG+EYR DP IF WELINEPRC TDP+GDTLQDW+EEMS+FVKSI
Sbjct  192   FKNYVKTILTRKNTITGIEYRHDPAIFGWELINEPRCSTDPSGDTLQDWLEEMSSFVKSI  251

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKIN-PELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             DK HL+T+GLEGFYGP DPKRL +N PE WA+ LGSDFIRNS +S IDF SVH+YPDHWF
Sbjct  252   DKKHLVTIGLEGFYGPNDPKRLTVNPPEEWASRLGSDFIRNSQISDIDFTSVHIYPDHWF  311

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
             K Q F+D +KF  KW+LSHIEDG+  LKKP++F+E+GL+   K      R+  ++ IL+I
Sbjct  312   KKQVFEDYMKFLSKWMLSHIEDGDTVLKKPVLFSEYGLSDSIKNFSMAHRETMYRTILDI  371

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
              YK AK N+ GAG++ WQFLV  M+E+ D+FG+VPWE+ S Y+L    SC+LA V G + 
Sbjct  372   SYKFAKKNRFGAGALVWQFLVGGMDEFIDDFGMVPWEKPSIYSLFIQQSCKLAKVKGWI-  430

Query  1952  SQQEHLKSFC  1981
                   K FC
Sbjct  431   QHDLSFKKFC  440



>emb|CDY18983.1| BnaC01g20850D [Brassica napus]
Length=431

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 348/429 (81%), Gaps = 5/429 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARNG   P++GF    AFIYL+F DLW+++   T ++ FV+RNGTQF  DG+  YVNGWN
Sbjct  4     ARNGSAIPVLGFLICAAFIYLSFRDLWLNHKWRT-EIGFVKRNGTQFVVDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM+HAV+   R  V  ML+  AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  63    SYWFMDHAVNEHSRYLVSEMLETGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+++H +RL+LCLVNNL+AYGGK+QYV+WAWQEG+GLS SNDSFF+DP+IR+YFK
Sbjct  123   DHVIAEAKKHDVRLLLCLVNNLQAYGGKSQYVQWAWQEGVGLSSSNDSFFFDPSIRKYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+  +LTRKN+VTG+EYR+DPTIFAWELINEPRC +D +GDTLQDWI+EM+ F+KSID 
Sbjct  183   NYLTALLTRKNSVTGIEYRNDPTIFAWELINEPRCTSDVSGDTLQDWIDEMTGFIKSIDD  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGP  PKRL ++PE+W ++LG+DF+RNSN S IDFASVH+YPDHWF NQ
Sbjct  243   KHLLTVGLEGFYGPNSPKRLTVHPEMWPSELGTDFVRNSNSSNIDFASVHIYPDHWFHNQ  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
             TF+DKLKF  KW+ SHIEDG + LKKP++FTEFGL+   K+ EP QR+RF++ I +++YK
Sbjct  303   TFEDKLKFVVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRERFYRTIFDVVYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  K+GAG++ WQ  +E ME +NDEFGIVP E+   Y L+   SCRL  V G    ++
Sbjct  363   SAKRRKAGAGTLVWQLFMEGMEGFNDEFGIVPHEQDPMYRLMVEQSCRLGKVTG---RRE  419

Query  1961  EH-LKSFCS  1984
             EH L+  CS
Sbjct  420   EHKLRKLCS  428



>ref|XP_010447999.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Camelina 
sativa]
Length=432

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/429 (67%), Positives = 345/429 (80%), Gaps = 5/429 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARN     I+GF    AFIYLTF DLW+++  +  KL FV+RNGTQF  D    YVNGWN
Sbjct  5     ARNRPMLRILGFFICAAFIYLTFRDLWLNHKRKP-KLGFVKRNGTQFVVDDMPLYVNGWN  63

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM HAVD   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  64    SYWFMAHAVDEQSRNLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFQAL  123

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+++H +RL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR YFK
Sbjct  124   DHVIAEAKKHDVRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRSYFK  183

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+K +LTRKN+VTG+EYRDDPTIFAWELINEPRC TD TG TLQDWIEEM+ ++KSID 
Sbjct  184   NYLKVLLTRKNSVTGIEYRDDPTIFAWELINEPRCTTDVTGKTLQDWIEEMTGYIKSIDD  243

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGP++PKRL +NPE WA+ LGSDF++NSN S IDFASVH+YPDHWF NQ
Sbjct  244   KHLLTVGLEGFYGPENPKRLTVNPEQWASTLGSDFVQNSNSSNIDFASVHIYPDHWFHNQ  303

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
             T+++KLKF  KW+ SHIEDG + LKKP++FTEFGL+  TK+ EP QRD+F+++I +++YK
Sbjct  304   TYEEKLKFVVKWMQSHIEDGMKELKKPVLFTEFGLSNLTKDYEPSQRDKFYRIIFDVVYK  363

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  K+GAG++ WQ  +E ME + DEFGIVP E+ S Y L+   SCRLA V G    + 
Sbjct  364   SAKRRKAGAGTLVWQLFMEGMETFGDEFGIVPHEQDSIYKLMIEQSCRLAKVTG---RRN  420

Query  1961  EH-LKSFCS  1984
             EH LK  CS
Sbjct  421   EHKLKKLCS  429



>gb|KHN35251.1| Mannan endo-1,4-beta-mannosidase 2 [Glycine soja]
Length=425

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/429 (65%), Positives = 345/429 (80%), Gaps = 4/429 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M++ NG+FYP++GFA+ + FIY++FGD+   + EE  +L+FVERNGTQF  DG+ FY+NG
Sbjct  1     MVSGNGLFYPVVGFASIVLFIYMSFGDVRFGFEEEA-ELAFVERNGTQFMVDGKAFYING  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M  +VD   RP+VR ML++ AKMG+TVCRTWAFNDG YNALQ SPG F+E+ F+
Sbjct  60    WNSYWLMVQSVDEYSRPKVREMLRSGAKMGLTVCRTWAFNDGDYNALQSSPGVFNEQAFK  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRL+L LVNNL AYGGKTQYVKWAWQEG+GLS SNDSFF+DP+IR Y
Sbjct  120   ALDYVIAEARQHGIRLLLSLVNNLHAYGGKTQYVKWAWQEGVGLSSSNDSFFFDPSIRSY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNYVKT+LTRKNT+TG+EYR+DPTIF WELINEPRC+TDP+GDTLQDWIEEMS FVK I
Sbjct  180   FKNYVKTILTRKNTITGIEYRNDPTIFGWELINEPRCLTDPSGDTLQDWIEEMSAFVKLI  239

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DK HL+TVGLEGFYGP DPKRL +NPE WA+ LGSDFIRNS +S IDF SVH+YPDHWF 
Sbjct  240   DKRHLVTVGLEGFYGPNDPKRLTVNPEDWASRLGSDFIRNSKISNIDFTSVHIYPDHWFH  299

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
             +Q F+D +KF  KW+LSHIEDG++ L KP++F+E+GL+ +     P +R   +K IL+I 
Sbjct  300   HQVFEDYMKFVSKWMLSHIEDGDKILNKPVLFSEYGLS-DINFTMP-ERKTMYKTILDIS  357

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPS  1954
             YKSAK N+SGAG++ WQFLV  M+E+ D+FGI+PWE+    +L    SCRL  V    P 
Sbjct  358   YKSAKRNRSGAGALVWQFLVGGMQEFTDDFGIIPWEKTPIPSLFVEQSCRLTKVKE-WPH  416

Query  1955  QQEHLKSFC  1981
             +    K FC
Sbjct  417   KDTSFKQFC  425



>ref|XP_006283768.1| hypothetical protein CARUB_v10004854mg [Capsella rubella]
 gb|EOA16666.1| hypothetical protein CARUB_v10004854mg [Capsella rubella]
Length=432

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/438 (66%), Positives = 347/438 (79%), Gaps = 9/438 (2%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MV SR   ML        I+GF    AFIYL+F DLW+++ +   +L FV+RNGTQF  D
Sbjct  1     MVSSRNRPMLR-------ILGFFICAAFIYLSFRDLWLNHYKRKPELGFVKRNGTQFVLD  53

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
                 YVNGWNSYWFM HAVD   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG
Sbjct  54    DMPLYVNGWNSYWFMNHAVDEHSRNLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPG  113

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             +FDERVF+ALD VIAE+++H +RL+L LVNNL+AYGGKTQYV+WAWQEG+GLS SNDSFF
Sbjct  114   RFDERVFQALDHVIAEAKKHDVRLLLSLVNNLQAYGGKTQYVQWAWQEGVGLSSSNDSFF  173

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             +DP+IR YFKNY+K +LTRKN+VTG+EYR+DPTIFAWELINEPRC TD +G TLQDWIEE
Sbjct  174   FDPSIRNYFKNYLKALLTRKNSVTGIEYRNDPTIFAWELINEPRCTTDVSGKTLQDWIEE  233

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             M+ F+KSID  HLLTVGLEGFYGP++PKRL INPE WA+ LGSDF++NSN S IDFASVH
Sbjct  234   MTGFIKSIDDKHLLTVGLEGFYGPENPKRLTINPEQWASQLGSDFVQNSNSSNIDFASVH  293

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             VYPDHWF NQTF++KLKF  KW+ SHIEDG + LKKP++FTEFGL+   K+ EP QRD+F
Sbjct  294   VYPDHWFHNQTFEEKLKFVVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPAQRDKF  353

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
             +++I +++YKSAK  K+GAGS+ WQ  +E ME ++D+FGIVP E+ S Y L+   SCRL 
Sbjct  354   YRVIFDVVYKSAKRRKAGAGSLVWQLFMEGMETFSDDFGIVPHEQDSIYKLMIEQSCRLG  413

Query  1931  GVHGVLPSQQEHLKSFCS  1984
              V G L  ++  LK  CS
Sbjct  414   KVTGRL--KERKLKELCS  429



>ref|NP_194561.1| mannan endo-1,4-beta-mannosidase 5 [Arabidopsis thaliana]
 sp|Q9M0H6.1|MAN5_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 5; AltName: Full=Beta-mannanase 
5; AltName: Full=Endo-beta-1,4-mannanase 5; 
Short=AtMAN5; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB79634.1| putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|ABG48480.1| At4g28320 [Arabidopsis thaliana]
 dbj|BAF00634.1| putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|AEE85469.1| mannan endo-1,4-beta-mannosidase 5 [Arabidopsis thaliana]
Length=431

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/438 (65%), Positives = 347/438 (79%), Gaps = 10/438 (2%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MV +R   ML        I+GF    AFIYL+F DLW+++  +  KL FV+RNGTQF  D
Sbjct  1     MVPTRNRPMLR-------ILGFFICAAFIYLSFRDLWLNHKGKA-KLGFVKRNGTQFVVD  52

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
              +  YVNGWNSYWFM+HAVD   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG
Sbjct  53    DKPLYVNGWNSYWFMDHAVDEHSRNLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPG  112

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             +FDERVF+ALD VIAE+R+H +RL+L LVNNL+AYGGKTQYVKWAWQEG+GLS SNDSFF
Sbjct  113   RFDERVFQALDHVIAEARKHDVRLLLSLVNNLQAYGGKTQYVKWAWQEGVGLSSSNDSFF  172

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             +DP+IR YFKNY+K +LTRKN+VTG+EYR+DPTIFAWELINEPRC TD +G TLQDWI+E
Sbjct  173   FDPSIRNYFKNYLKVLLTRKNSVTGIEYRNDPTIFAWELINEPRCTTDVSGKTLQDWIDE  232

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             M+ F+KSID  HLLTVGLEGFYGP  PK L +NPE WA+ LG+DF++NSN S IDFASVH
Sbjct  233   MTGFIKSIDDKHLLTVGLEGFYGPNSPKGLTVNPEQWASQLGTDFVQNSNSSNIDFASVH  292

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             +YPDHWF NQTF++KLKF  KW+ SHIEDG + LKKP++FTEFGL+ + K+ EP QRD+F
Sbjct  293   IYPDHWFHNQTFEEKLKFVVKWMQSHIEDGLKELKKPVLFTEFGLSNQNKDYEPSQRDKF  352

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
             +++I +++YKSAK  KSGAG++ WQ  +E ME +ND+FGIVP E+ S Y L+   SCRL 
Sbjct  353   YRIIFDVVYKSAKRKKSGAGTLVWQLFMEGMETFNDDFGIVPHEQDSIYKLMIEQSCRLG  412

Query  1931  GVHGVLPSQQEHLKSFCS  1984
              V G L  Q+  LK  CS
Sbjct  413   KVTGRLKEQK--LKELCS  428



>ref|XP_007132717.1| hypothetical protein PHAVU_011G118900g [Phaseolus vulgaris]
 gb|ESW04711.1| hypothetical protein PHAVU_011G118900g [Phaseolus vulgaris]
Length=436

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/436 (64%), Positives = 345/436 (79%), Gaps = 4/436 (1%)
 Frame = +2

Query  674   VKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADG  853
             V  R   M+  NG+FYP++GFA+ + FIY++FGD+   + EE ++L+FVERNGTQF  DG
Sbjct  5     VCKRYRIMVGGNGLFYPVVGFASIVLFIYMSFGDVKFGF-EEEVELAFVERNGTQFMVDG  63

Query  854   QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGK  1033
             + FY+NGWNSYW M  +VD   RP+VR ML+A AKMG+TVCRTWAFNDG YNALQ SPG 
Sbjct  64    KAFYINGWNSYWLMVQSVDEYSRPKVREMLKAGAKMGLTVCRTWAFNDGDYNALQSSPGV  123

Query  1034  FDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFY  1213
             F+E+ F+ALD VIAE+R+HGIRL+L LVNNL AYGGKTQYVKWAWQEG+GLS SNDSFF+
Sbjct  124   FNEQAFKALDYVIAEARKHGIRLLLSLVNNLHAYGGKTQYVKWAWQEGVGLSSSNDSFFF  183

Query  1214  DPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEM  1393
             DP+IR YFKNY+KT+LTRKNT+TGLEYR+DPTIF WELINEPRC+TDP+GDTLQDWIEEM
Sbjct  184   DPSIRSYFKNYIKTILTRKNTITGLEYRNDPTIFGWELINEPRCITDPSGDTLQDWIEEM  243

Query  1394  STFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHV  1573
             S FVK IDK HL+T+GLEGFYGP DPKRL +NPE WA+ LGSDFI NS +S IDF SVH+
Sbjct  244   SAFVKLIDKRHLVTIGLEGFYGPNDPKRLTVNPEDWASRLGSDFITNSLISNIDFTSVHI  303

Query  1574  YPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFF  1753
             YPDHWF  Q  +D +KF  KW+LSHIEDG++ L KP++F+EFGL+     +   +R   +
Sbjct  304   YPDHWFHEQVSEDYIKFVSKWMLSHIEDGDKVLNKPVVFSEFGLSDINFTMS--ERKTMY  361

Query  1754  KLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAG  1933
             K IL+I YKSAK N+SGAG++ WQFLV  M+E+ D+FGI+P E+    +L    SCRLA 
Sbjct  362   KTILDISYKSAKKNRSGAGALVWQFLVGGMQEFTDDFGIIPAEKTPIPSLFIEQSCRLAK  421

Query  1934  VHGVLPSQQEHLKSFC  1981
             V G  P + +  K FC
Sbjct  422   VKG-WPHKDKSFKQFC  436



>ref|XP_010433238.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Camelina sativa]
Length=432

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/429 (66%), Positives = 345/429 (80%), Gaps = 5/429 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARN     I+GF    AFIYLTF DLW+++ E   KL FV+RNGTQF  D    YVNGWN
Sbjct  5     ARNRPMLRILGFFICAAFIYLTFRDLWLNH-ERKPKLGFVKRNGTQFVVDDMPLYVNGWN  63

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM HAVD   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  64    SYWFMAHAVDEQSRNLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFQAL  123

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+++H +RL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR YFK
Sbjct  124   DHVIAEAKKHDVRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRNYFK  183

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+KT+LTRKN+VTG+EYR+DPTIFAWELINEPRC TD +G TLQDWI+EM+ ++KSID 
Sbjct  184   NYLKTLLTRKNSVTGIEYRNDPTIFAWELINEPRCTTDVSGKTLQDWIDEMTGYIKSIDD  243

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGP++PKRL +NPE WA+ LGSDF++NSN S IDFASVH+YPDHWF NQ
Sbjct  244   KHLLTVGLEGFYGPENPKRLTVNPEQWASALGSDFVQNSNSSNIDFASVHIYPDHWFHNQ  303

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
             TF++KLKF  KW+ SHIEDG + LKKP++FTEFGL+   K+ EP QRD+F+++I +++YK
Sbjct  304   TFEEKLKFVVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRDKFYRIIFDVVYK  363

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  K+GAG++ WQ  +E ME + D+FGIVP E+ S Y L+   SCRLA V G    + 
Sbjct  364   SAKRRKAGAGTLVWQLFMEGMETFGDDFGIVPHEQDSIYKLMIEQSCRLAKVTG---RRN  420

Query  1961  EH-LKSFCS  1984
             EH LK  CS
Sbjct  421   EHKLKKLCS  429



>ref|XP_002867455.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43714.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=431

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/438 (65%), Positives = 349/438 (80%), Gaps = 10/438 (2%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD  850
             MV +R   ML        I+GF    AFIYL+F DLW+++  +  KL FV+RNGTQF  D
Sbjct  1     MVPTRNRPMLR-------ILGFFICAAFIYLSFRDLWLNHKGKA-KLGFVKRNGTQFVVD  52

Query  851   GQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPG  1030
              +  YVNGWNSYWFM+HAVD   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG
Sbjct  53    DKPLYVNGWNSYWFMDHAVDEHSRNLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPG  112

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
             +FDERVF+ALD VIAE+R+H +RL+L LVNNL+AYGGKTQYV WAWQEG+G+S SNDSFF
Sbjct  113   RFDERVFQALDHVIAEARKHDVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGVSSSNDSFF  172

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
             +DP+IR YFKNY+K +LTRKN+VTG+EYR+DPTIFAWELINEPRC TD +G TLQDWI+E
Sbjct  173   FDPSIRNYFKNYLKVLLTRKNSVTGIEYRNDPTIFAWELINEPRCTTDVSGKTLQDWIDE  232

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             M+ F+KSID  HLLTVGLEGFYGP  PKRL +NPE WA++LG+DF++NSN S IDFASVH
Sbjct  233   MTGFIKSIDDKHLLTVGLEGFYGPNSPKRLTVNPEQWASELGTDFVQNSNSSNIDFASVH  292

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
             +YPDHWF NQTF++KLKF  KW+ SHIEDG + LKKP++FTEFGL+   K+ EP QRD+F
Sbjct  293   IYPDHWFHNQTFEEKLKFVVKWMQSHIEDGFKELKKPVLFTEFGLSNLNKDYEPSQRDKF  352

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
             +++I +++YKSAK  KSGAG++ WQ  +E ME ++D+FGIVP E+ S Y L+   SCRL 
Sbjct  353   YRIIFDVIYKSAKRKKSGAGTLVWQLFMEGMETFSDDFGIVPHEQDSIYKLMIEQSCRLG  412

Query  1931  GVHGVLPSQQEHLKSFCS  1984
              V G L  ++++LK  CS
Sbjct  413   KVTGRL--KEQNLKELCS  428



>gb|KFK35900.1| hypothetical protein AALP_AA4G051000 [Arabis alpina]
Length=431

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 345/429 (80%), Gaps = 5/429 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
              RNG   PI+G      FIY +  DLW+++ + + +L FV+RNGTQF  DG+  YVNGWN
Sbjct  4     GRNGAVLPILGLLICAVFIYFSIRDLWLNH-KGSPELGFVKRNGTQFVLDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYW M+HAV+   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  63    SYWLMDHAVNQHSRFLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+R+H IRL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR+YFK
Sbjct  123   DHVIAEARKHDIRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRKYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+  +LTRKN+V G+EYR+DPTIFAWELINEPRC +D +GDTLQDWI+EM+ F+KSID 
Sbjct  183   NYLTALLTRKNSVNGIEYRNDPTIFAWELINEPRCTSDVSGDTLQDWIDEMTGFIKSIDD  242

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGPK+PKRL +NPE W ++LG+DF++NSN S IDFASVH+YPDHWF NQ
Sbjct  243   KHLLTVGLEGFYGPKNPKRLTVNPEQWPSELGTDFVQNSNSSNIDFASVHIYPDHWFHNQ  302

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
             +F+DKLKF  KW+ SHIEDG + LKKP++FTEFGL+   K+ EP QRDRF+++I +++YK
Sbjct  303   SFEDKLKFVVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRDRFYRVIFDVIYK  362

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  KSGAG++ WQ  +E ME +NDEFGIVP E+ S Y L+   SCRL  V G    ++
Sbjct  363   SAKRRKSGAGTLVWQLFMEGMEGFNDEFGIVPHEQDSMYRLMIEQSCRLGKVTG---RRK  419

Query  1961  EH-LKSFCS  1984
             EH L+  CS
Sbjct  420   EHKLRQICS  428



>ref|XP_010438480.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Camelina 
sativa]
Length=432

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/429 (66%), Positives = 345/429 (80%), Gaps = 5/429 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARN     I+GF    +FIYLTF DLW+++  +  KL FV+RNGTQF  D    YVNGWN
Sbjct  5     ARNRPMLRILGFFICASFIYLTFRDLWLNHKRKP-KLGFVKRNGTQFVVDDMPLYVNGWN  63

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM HAVD   R  V  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  64    SYWFMAHAVDEQSRNLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFQAL  123

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+++H +RL+L LVNNL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR YFK
Sbjct  124   DHVIAEAKKHDVRLLLSLVNNLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRNYFK  183

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
             NY+KT+LTRKN+VTG+EYR+DPTIFAWELINEPRC TD +G TLQDWI+EM+ ++KSID 
Sbjct  184   NYLKTLLTRKNSVTGIEYRNDPTIFAWELINEPRCTTDVSGKTLQDWIDEMTGYIKSIDD  243

Query  1421  NHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQ  1600
              HLLTVGLEGFYGP++PKRL +NPE WA+ LGSDF++NSN S IDFASVH+YPDHWF NQ
Sbjct  244   KHLLTVGLEGFYGPENPKRLTVNPEQWASALGSDFVQNSNSSNIDFASVHIYPDHWFHNQ  303

Query  1601  TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYK  1780
             T+++KLKF  KW+ SHIEDG + LKKP++FTEFGL+   K+ EP QRD+F+++I +++YK
Sbjct  304   TYEEKLKFVVKWMQSHIEDGMKELKKPVLFTEFGLSNLNKDYEPSQRDKFYRIIFDVVYK  363

Query  1781  SAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQ  1960
             SAK  K+GAG++ WQ  +E ME + D+FGIVP E+ S Y L+   SCRLA V G    + 
Sbjct  364   SAKRRKAGAGTLVWQLFMEGMETFGDDFGIVPHEQDSIYKLMIEQSCRLAKVTG---RRN  420

Query  1961  EH-LKSFCS  1984
             EH LK  CS
Sbjct  421   EHKLKKLCS  429



>ref|XP_010035760.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Eucalyptus 
grandis]
 gb|KCW47223.1| hypothetical protein EUGRSUZ_K01032 [Eucalyptus grandis]
Length=438

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/436 (65%), Positives = 339/436 (78%), Gaps = 2/436 (0%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYAD-GQV  859
             + S+M     +  PI+G A+ +AFIY++F DL         K+ FV RNGT    D G++
Sbjct  4     KSSRMSTGQRLMCPILGIASCIAFIYVSFSDLSFGDYHAEQKMDFVRRNGTHLVVDDGKM  63

Query  860   FYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFD  1039
             FYVNGWNSYW M+ AVD   RPRVR M Q  +KMGMTVCR WAFNDG YNALQISPG+FD
Sbjct  64    FYVNGWNSYWLMDQAVDEYSRPRVRAMFQTGSKMGMTVCRAWAFNDGDYNALQISPGRFD  123

Query  1040  ERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDP  1219
             ERVFRALD VIAE+RRH IRL+  LVNNL+AYGGKTQYVKWAW+EGIGLS SNDSFFYDP
Sbjct  124   ERVFRALDYVIAEARRHEIRLLFSLVNNLEAYGGKTQYVKWAWEEGIGLSLSNDSFFYDP  183

Query  1220  NIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMST  1399
             +IR+YFK+YVK +LTRKNT+TG+EYR+DPTIF WELINEPRCMTD +GDTLQDWI EMS 
Sbjct  184   SIRQYFKDYVKVILTRKNTITGVEYRNDPTIFGWELINEPRCMTDNSGDTLQDWIVEMSA  243

Query  1400  FVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYP  1579
             +VKSIDKNHLLTVGLEGFYGP  PK+  +NP  + + LGSDFIRNS +  IDFAS H+YP
Sbjct  244   YVKSIDKNHLLTVGLEGFYGPNSPKKPTVNPGEYFSLLGSDFIRNSEIQNIDFASAHIYP  303

Query  1580  DHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKL  1759
             DHWFKNQ F+++LK+   W  SHI+DG+R L+KPIMFTEFG +   K+ +P +RDRFFK 
Sbjct  304   DHWFKNQDFEEELKYVALWTRSHIDDGDRILRKPIMFTEFGYSTLNKDFDPSKRDRFFKT  363

Query  1760  ILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVH  1939
             I +++YKSAK   +GAGS  WQF V  ME+YND+FGIVPWER  TY LIT HSCR+A + 
Sbjct  364   IYDVIYKSAKKQGAGAGSFVWQFWVGGMEKYNDDFGIVPWERPETYKLITQHSCRMARIR  423

Query  1940  GVLPSQQEHLKSFCSK  1987
             G     + +LK  CS+
Sbjct  424   GS-AELKGNLKELCSQ  438



>gb|KEH39139.1| glycoside hydrolase family 5 protein [Medicago truncatula]
Length=430

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/431 (65%), Positives = 341/431 (79%), Gaps = 3/431 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M A NG+FYPI+GFA+F+ FIY++FG L  S+ EE  ++ FV RNGTQF  DG VFYVNG
Sbjct  1     MFAGNGLFYPILGFASFVVFIYMSFGGLRFSF-EEGREMGFVMRNGTQFVLDGNVFYVNG  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+H+VDF  R +VR ML+  A MG+TVCRTWAFNDG YNALQISPG FDE+VF+
Sbjct  60    WNSYWLMDHSVDFTSRFKVRQMLKTGANMGLTVCRTWAFNDGHYNALQISPGHFDEQVFQ  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R++GIRL+LCLVNNL+ YGGK+QYVKWAWQEG+GLS SNDSFFYDP+IR Y
Sbjct  120   ALDYVIAEARQNGIRLLLCLVNNLQPYGGKSQYVKWAWQEGVGLSASNDSFFYDPSIRSY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNY+KTVLTRKN+ TG+EYR+DPTIF WELINEPRCMTD +GDTLQ+WIEEMS FVK I
Sbjct  180   FKNYIKTVLTRKNSFTGIEYRNDPTIFGWELINEPRCMTDRSGDTLQEWIEEMSAFVKLI  239

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF-  1591
             DKNH+LTVG EGFYGP DPK L +NP  WA+ LGSD+IRNS +S IDF SVH+YPD WF 
Sbjct  240   DKNHMLTVGNEGFYGPNDPKDLTVNPNYWASRLGSDYIRNSKISDIDFTSVHIYPDQWFH  299

Query  1592  -KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILE  1768
                +  + +LKF  KW+LSHI+DG+  LKKP++F+E+GL+ + +      R++ +  IL 
Sbjct  300   EDEKAIETQLKFVHKWMLSHIDDGDEVLKKPVLFSEYGLSKKNQNFTVSDREKMYDTILN  359

Query  1769  IMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
             I+YKSAK NKSGAG++ WQFLV  MEEY+D++GIVP E  ST +L    SCR+    G +
Sbjct  360   IVYKSAKRNKSGAGALVWQFLVGGMEEYSDDYGIVPAESRSTQSLFIKQSCRMGKTKGWI  419

Query  1949  PSQQEHLKSFC  1981
               Q  + K+ C
Sbjct  420   NQQDVNFKALC  430



>gb|AES89656.2| glycoside hydrolase family 5 protein [Medicago truncatula]
Length=428

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/430 (65%), Positives = 340/430 (79%), Gaps = 3/430 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG+FYPI  FA+ + FIY++FG + + Y EE ++LSFVER G+QF  DG+ FY+NG
Sbjct  1     MMAGNGLFYPIFCFASVVLFIYMSFG-VRMDYDEE-IELSFVERKGSQFVLDGKAFYING  58

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYWFM  +VD   RPRV  ML+A AKMG+TVCRTWAFNDG YNALQ SPG FDE+ F+
Sbjct  59    WNSYWFMVQSVDAYTRPRVGEMLKAGAKMGLTVCRTWAFNDGDYNALQTSPGVFDEQAFK  118

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+RRH IRL+L LVNNL+AYGGK QYV+WAWQEG+GLS SNDSFFYDP+IR Y
Sbjct  119   ALDYVIAEARRHRIRLLLSLVNNLQAYGGKDQYVQWAWQEGLGLSSSNDSFFYDPSIRSY  178

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNYVKT+LTRKNT+TG+EYR DP IF WELINEPRC+TDP+GDTLQDWIEEMSTFVKSI
Sbjct  179   FKNYVKTILTRKNTITGIEYRHDPIIFGWELINEPRCITDPSGDTLQDWIEEMSTFVKSI  238

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKIN-PELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             DK HL+T+GLEGFYGP DPKRL +N PE WA+ LGSDFIRNS  S IDF SVH+YPDHWF
Sbjct  239   DKKHLVTIGLEGFYGPNDPKRLTVNPPEGWASRLGSDFIRNSQTSNIDFTSVHIYPDHWF  298

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
               Q F++ +KF  KW+LSHIEDG+  L KP++F+E+GL+   +      R++ +K IL+I
Sbjct  299   HKQDFEEYMKFLSKWMLSHIEDGDNVLNKPVLFSEYGLSDSIENFSLSNREKMYKKILDI  358

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
              +KSAK N+SGAG++ WQFLV  M E+ D+FG+VPWE+ S Y+L   HSCRL  V+  L 
Sbjct  359   SHKSAKKNQSGAGALVWQFLVSGMSEFIDDFGMVPWEKPSMYSLFIEHSCRLTKVNKGLT  418

Query  1952  SQQEHLKSFC  1981
                   K  C
Sbjct  419   LHNPSFKHVC  428



>ref|XP_004487276.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cicer arietinum]
Length=428

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/429 (64%), Positives = 342/429 (80%), Gaps = 2/429 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M A NG+FYP++GFA+F+ FIY++FG L  S+ +E  ++ FV RNGTQF  DG+ FYVNG
Sbjct  2     MFAGNGLFYPLLGFASFVVFIYMSFGGLRFSF-DEGKEMGFVTRNGTQFMLDGKAFYVNG  60

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+H+VDF  R +VR ML+  AKMG+TVCRTWAFNDG YNALQISPG FDE+VF+
Sbjct  61    WNSYWLMDHSVDFSSRFKVREMLKTGAKMGLTVCRTWAFNDGHYNALQISPGHFDEQVFQ  120

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+R+HGIRL+L LVNNL+ YGGK+QYVKWAWQEG+GLS SNDSFF+DP+I  Y
Sbjct  121   ALDHVIAEARQHGIRLLLSLVNNLQPYGGKSQYVKWAWQEGVGLSASNDSFFFDPSIHSY  180

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNY+KTVLTRKNT+TG+EYR+DPTIF WELINEPRCM+D +GDTLQ+WIEEMS+FVK I
Sbjct  181   FKNYIKTVLTRKNTITGIEYRNDPTIFGWELINEPRCMSDRSGDTLQEWIEEMSSFVKLI  240

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             DKNHLLTVGLEGFYGP DPK L +NP  WA+ LGSD+IRNS L+ IDF SVH+YPD WF 
Sbjct  241   DKNHLLTVGLEGFYGPNDPKDLTVNPNYWASKLGSDYIRNSELANIDFTSVHIYPDQWFH  300

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
              +  + +LKF  KW+ SHIEDG+  LKKP++F+E+GL+      +   R++ +++IL I+
Sbjct  301   EKEIEAQLKFVSKWMHSHIEDGDEVLKKPVLFSEYGLSKTNPNFKLSDREKMYEIILGII  360

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPS  1954
             YKSAK N+SGAG++ WQFLV  ME+Y+D++GIVP E  ST +L    SCRLA + G    
Sbjct  361   YKSAKKNRSGAGALVWQFLVGGMEDYSDDYGIVPGENPSTLSLFIKQSCRLAKLKG-YTQ  419

Query  1955  QQEHLKSFC  1981
             Q    K  C
Sbjct  420   QDVSFKELC  428



>ref|XP_010689012.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=444

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/435 (62%), Positives = 352/435 (81%), Gaps = 4/435 (1%)
 Frame = +2

Query  692   KMLARNGMFYPIIGFAAFLAFIYLTFG-DLWVSYPEETLKLSFVERNGTQFYADGQVFYV  868
             KM A NG FYPI+G A  +AFIY++FG D+ +   +E    SFVER G QF  DG+ FY+
Sbjct  13    KMFATNGWFYPIVGMATLVAFIYMSFGGDIRIKVTKEP-NYSFVERVGNQFMLDGKPFYI  71

Query  869   NGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERV  1048
             NGWNSYW M+H+VD   RPRV+ MLQA +KMG+TVCRTWAFNDG Y+ALQISPG +DE+V
Sbjct  72    NGWNSYWLMDHSVDGFSRPRVKAMLQAGSKMGLTVCRTWAFNDGTYHALQISPGVYDEQV  131

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
             +++LD VIAE+R++G+RLIL LVNNL+AYGGKTQYVKWAWQEGIG+S SNDSFFYDP+I+
Sbjct  132   YQSLDYVIAEARKNGVRLILSLVNNLQAYGGKTQYVKWAWQEGIGISSSNDSFFYDPSIQ  191

Query  1229  RYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVK  1408
              YFK+Y+KT+LTRKNT+TG+EYRDDP IFAWELINEPRCM+DP+GDTLQDWI+EMS F+K
Sbjct  192   TYFKSYIKTMLTRKNTITGIEYRDDPVIFAWELINEPRCMSDPSGDTLQDWIKEMSEFIK  251

Query  1409  SIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHW  1588
              ID+ HL+TVGLEGFYG K+ K   +NP  W   +G+DF+RN+++ T+DFAS+H+YPD W
Sbjct  252   VIDEKHLVTVGLEGFYGSKNSKS-ALNPSEWEGTIGTDFVRNNDIPTVDFASIHMYPDQW  310

Query  1589  FKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILE  1768
                   +DKL+F +KW+ SHIEDGE+ LKKP+M TEFGL+ + K+ +P QRDR FK++ +
Sbjct  311   LTVDNLEDKLEFVRKWVSSHIEDGEKQLKKPVMLTEFGLSSQNKDFDPAQRDRLFKVVYD  370

Query  1769  IMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
             I+YKSAK N SGAGS+ WQ  VE M++++D+FGI+PW R STY++IT  SCRLA +H   
Sbjct  371   IIYKSAKKNGSGAGSLLWQLFVEGMDDFHDDFGIIPWRRQSTYDVITRQSCRLALLHQ-R  429

Query  1949  PSQQEHLKSFCSKTQ  1993
              + + +LK+ C +++
Sbjct  430   SNLEGNLKNLCQRSR  444



>emb|CDY31945.1| BnaA07g00500D [Brassica napus]
Length=423

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/425 (65%), Positives = 339/425 (80%), Gaps = 6/425 (1%)
 Frame = +2

Query  710   GMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYW  889
             G   PI+GF    AF+YL+ G     +     ++ FV RNGTQF  DG+  YVNGWNSYW
Sbjct  2     GPVIPILGFLTCAAFMYLSLG-----FRGGEPEVGFVSRNGTQFVLDGKPLYVNGWNSYW  56

Query  890   FMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLV  1069
             FM+HAV+   R RV  MLQA +KMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD V
Sbjct  57    FMDHAVNDHSRHRVGAMLQAGSKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDHV  116

Query  1070  IAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYV  1249
             IAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRRYFKNY+
Sbjct  117   IAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNYL  176

Query  1250  KTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHL  1429
               +LTRKN++TG+EYR+DPTIFAWELINEPRC TD +GDTLQDWI EM+ F+KSID  HL
Sbjct  177   TVLLTRKNSITGIEYRNDPTIFAWELINEPRCFTDISGDTLQDWINEMTAFIKSIDNKHL  236

Query  1430  LTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQ  1609
             LTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS    IDFASVH+YPDHWF +Q F+
Sbjct  237   LTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPDHWFHDQGFE  296

Query  1610  DKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAK  1789
             DK+KF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I +++YKSAK
Sbjct  297   DKVKFVVKWMLSHIEDGDQELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTIFDLVYKSAK  356

Query  1790  HNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEHL  1969
               +SGAG++ WQFL++ ME +ND+FGIVPWE+ S   L+T  SCRLA V G    Q +  
Sbjct  357   RKRSGAGTLVWQFLIQGMEGFNDDFGIVPWEKKSIQRLMTEQSCRLARVTG-RHLQDKKS  415

Query  1970  KSFCS  1984
             +  CS
Sbjct  416   REICS  420



>ref|XP_009102000.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Brassica 
rapa]
Length=498

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/434 (65%), Positives = 342/434 (79%), Gaps = 10/434 (2%)
 Frame = +2

Query  683   RRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVF  862
             RR  M    G   PI+GF    AF+YL+ G     +     ++ FV RNGTQF  DG+  
Sbjct  72    RRGNM----GPVIPILGFLTCAAFMYLSLG-----FRGGEPEVGFVSRNGTQFVLDGKPL  122

Query  863   YVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDE  1042
             YVNGWNSYWFM+HAV+   R RV  MLQA +KMG+TVCRTWAFNDG YNALQISPG+FDE
Sbjct  123   YVNGWNSYWFMDHAVNDHSRHRVGAMLQAGSKMGLTVCRTWAFNDGGYNALQISPGRFDE  182

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             RVF+ALD VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+
Sbjct  183   RVFKALDHVIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPS  242

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             IRRYFKNY+  +LTRKN++TG+EYR+DPTIFAWELINEPRC TD +GDTLQDWI EM+ F
Sbjct  243   IRRYFKNYLTVLLTRKNSITGIEYRNDPTIFAWELINEPRCFTDISGDTLQDWINEMTAF  302

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             +KSID  HLLTVGLEGFYGPK PKRL +NPE WA++LGSDF+RNS    IDFASVH+YPD
Sbjct  303   IKSIDNKHLLTVGLEGFYGPKSPKRLTVNPERWASELGSDFVRNSESPNIDFASVHIYPD  362

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
             HWF +Q F+DK+KF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ EP QRDRF++ I
Sbjct  363   HWFHDQGFEDKVKFVVKWMLSHIEDGDQELKKPVLFTEFGLSNLNKDYEPSQRDRFYRTI  422

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
              +++YKSAK  +SGAG++ WQFL++ ME +ND+FGIVPWE+ S   L+T  SCRLA V G
Sbjct  423   FDLVYKSAKRKRSGAGTLVWQFLIQGMEGFNDDFGIVPWEKKSIQRLMTEQSCRLARVTG  482

Query  1943  VLPSQQEHLKSFCS  1984
                 Q +  +  CS
Sbjct  483   -RHLQDKKSREICS  495



>ref|XP_004505577.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cicer arietinum]
Length=429

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/430 (65%), Positives = 331/430 (77%), Gaps = 2/430 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M A NG+FYP+  FA  + FIY +FGD+   + EE ++L FVER G+QF  DG+ FY+NG
Sbjct  1     MGAGNGLFYPLFAFATVVFFIYTSFGDVRFGFEEE-IELGFVERKGSQFVLDGKAFYING  59

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M  +VD   RPRVR M +A AKMG+TVCRTWAFNDG YNALQ SPG F+E  F+
Sbjct  60    WNSYWLMVQSVDAYTRPRVREMFKAGAKMGLTVCRTWAFNDGDYNALQTSPGVFNEEAFK  119

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VIAE+RRH IRL+L LVNNL+AYGGK QYVKWAWQEG+GLS SNDSFFYDP+IR Y
Sbjct  120   ALDYVIAEARRHRIRLLLSLVNNLRAYGGKDQYVKWAWQEGVGLSSSNDSFFYDPSIRSY  179

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FK+YVKT+LTRKNT+TG+EYR DP IF WELINEPRC+TDP+GDTLQDWIEEMSTFVKSI
Sbjct  180   FKSYVKTILTRKNTITGIEYRHDPIIFGWELINEPRCVTDPSGDTLQDWIEEMSTFVKSI  239

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKIN-PELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             DK HL+TVGLEGFYGP DPKRL  N PE WA+ LGSDFIRNS  S IDF SVH+Y DHWF
Sbjct  240   DKKHLVTVGLEGFYGPNDPKRLTANPPEEWASKLGSDFIRNSQTSNIDFTSVHIYADHWF  299

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
               Q F+D +KF  KW+ SHIEDG+  L KP++F+E+GL+   K      R+  +K IL+I
Sbjct  300   HKQVFEDYMKFVSKWMHSHIEDGDNVLNKPVLFSEYGLSDTVKNFSLSNRETMYKTILDI  359

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
              + SAK N+SGAG++ WQFLV  M E  D+FG+VPWER+STY+L   HSCRL  V+  L 
Sbjct  360   SFNSAKKNRSGAGALVWQFLVGGMSELIDDFGMVPWERSSTYSLFIKHSCRLTKVNKGLT  419

Query  1952  SQQEHLKSFC  1981
              Q    K  C
Sbjct  420   QQNPSFKQLC  429



>ref|XP_003607459.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=427

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/429 (65%), Positives = 339/429 (79%), Gaps = 3/429 (1%)
 Frame = +2

Query  698   LARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGW  877
             +A NG+FYPI  FA+ + FIY++FG + + Y EE ++LSFVER G+QF  DG+ FY+NGW
Sbjct  1     MAGNGLFYPIFCFASVVLFIYMSFG-VRMDYDEE-IELSFVERKGSQFVLDGKAFYINGW  58

Query  878   NSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRA  1057
             NSYWFM  +VD   RPRV  ML+A AKMG+TVCRTWAFNDG YNALQ SPG FDE+ F+A
Sbjct  59    NSYWFMVQSVDAYTRPRVGEMLKAGAKMGLTVCRTWAFNDGDYNALQTSPGVFDEQAFKA  118

Query  1058  LDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYF  1237
             LD VIAE+RRH IRL+L LVNNL+AYGGK QYV+WAWQEG+GLS SNDSFFYDP+IR YF
Sbjct  119   LDYVIAEARRHRIRLLLSLVNNLQAYGGKDQYVQWAWQEGLGLSSSNDSFFYDPSIRSYF  178

Query  1238  KNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSID  1417
             KNYVKT+LTRKNT+TG+EYR DP IF WELINEPRC+TDP+GDTLQDWIEEMSTFVKSID
Sbjct  179   KNYVKTILTRKNTITGIEYRHDPIIFGWELINEPRCITDPSGDTLQDWIEEMSTFVKSID  238

Query  1418  KNHLLTVGLEGFYGPKDPKRLKIN-PELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             K HL+T+GLEGFYGP DPKRL +N PE WA+ LGSDFIRNS  S IDF SVH+YPDHWF 
Sbjct  239   KKHLVTIGLEGFYGPNDPKRLTVNPPEGWASRLGSDFIRNSQTSNIDFTSVHIYPDHWFH  298

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
              Q F++ +KF  KW+LSHIEDG+  L KP++F+E+GL+   +      R++ +K IL+I 
Sbjct  299   KQDFEEYMKFLSKWMLSHIEDGDNVLNKPVLFSEYGLSDSIENFSLSNREKMYKKILDIS  358

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPS  1954
             +KSAK N+SGAG++ WQFLV  M E+ D+FG+VPWE+ S Y+L   HSCRL  V+  L  
Sbjct  359   HKSAKKNQSGAGALVWQFLVSGMSEFIDDFGMVPWEKPSMYSLFIEHSCRLTKVNKGLTL  418

Query  1955  QQEHLKSFC  1981
                  K  C
Sbjct  419   HNPSFKHVC  427



>ref|XP_010915914.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
2-like [Elaeis guineensis]
Length=433

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/432 (64%), Positives = 339/432 (78%), Gaps = 4/432 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETL--KLSFVERNGTQFYADGQVFYV  868
             ML  NG+FYPI+G A+ +AFIYL+FGDL V +    +  K+SFVER GTQF  DG+ FYV
Sbjct  1     MLVSNGVFYPILGLASCVAFIYLSFGDL-VEFHFHFIEPKMSFVERKGTQFTVDGRAFYV  59

Query  869   NGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERV  1048
             NGWNSYW M+ AV+   RPRVRTM Q  AKMG+TVCRTWAFNDG YNALQ+SPG+FDERV
Sbjct  60    NGWNSYWLMDQAVEENSRPRVRTMFQNGAKMGLTVCRTWAFNDGTYNALQVSPGRFDERV  119

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
             F+ALD VI E+RRHGIRL+L L NNL+AYGGKTQYVKWAW+EGIGLS SNDSFFYDP+IR
Sbjct  120   FKALDRVIVEARRHGIRLLLSLANNLEAYGGKTQYVKWAWEEGIGLSSSNDSFFYDPSIR  179

Query  1229  RYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVK  1408
              YFK Y+KT+LTRKN + G++Y+DDP IFAWEL+NEPRCM+D TGDTLQDWIE+M+ + K
Sbjct  180   SYFKTYLKTILTRKNHLNGIQYKDDPAIFAWELMNEPRCMSDATGDTLQDWIEDMAAYAK  239

Query  1409  SIDKNHLLTVGLEGFYGPK-DPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDH  1585
             SIDK HLLTVGLEGFYGP    ++L +NP  W + LGSDFIRNS +  IDFASVH+YPD+
Sbjct  240   SIDKKHLLTVGLEGFYGPTXSAEKLSVNPGPWFSTLGSDFIRNSKIPDIDFASVHIYPDN  299

Query  1586  WFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLIL  1765
             W     F +K+K+  KW++SHIEDG+R LKKPI+FTEFG++   K  +   RD F+K I 
Sbjct  300   WLVQAGFDEKMKYISKWVVSHIEDGDRVLKKPILFTEFGISNRNKNFDHSHRDVFYKNIF  359

Query  1766  EIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGV  1945
             +I+++SAK N +GAG+  WQF+VE M+EYND+FGIVPWER S Y LI   SCRLA +H  
Sbjct  360   DIIHESAKKNGAGAGAFVWQFMVEGMQEYNDDFGIVPWERPSMYQLIKGQSCRLASLHYG  419

Query  1946  LPSQQEHLKSFC  1981
                 ++    FC
Sbjct  420   KDLAKKSFWKFC  431



>ref|XP_009144375.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 isoform X1 [Brassica 
rapa]
Length=463

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/461 (61%), Positives = 349/461 (76%), Gaps = 37/461 (8%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             ARNG   P++GF    AFIYL+F DLW+++   T ++ FV+RNGTQF  DG+  YVNGWN
Sbjct  4     ARNGSAIPVLGFLICAAFIYLSFRDLWLNHKWRT-EIGFVKRNGTQFVVDGKALYVNGWN  62

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYWFM+HAV+   R  V  ML+  AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+AL
Sbjct  63    SYWFMDHAVNEHSRYLVSEMLETGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKAL  122

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VIAE+++H +RL+LCLVNNL+AYGGK+QYV+WAWQEG+GLS SNDSFF+DP+IR+YFK
Sbjct  123   DHVIAEAKKHDVRLLLCLVNNLQAYGGKSQYVQWAWQEGVGLSSSNDSFFFDPSIRKYFK  182

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTL----------------  1372
             NY+  +LTRKN+VTG+EYR+DPTIFAWELINEPRC +D +GDTL                
Sbjct  183   NYLTALLTRKNSVTGIEYRNDPTIFAWELINEPRCTSDVSGDTLQVSPAFSHLLVITFRL  242

Query  1373  ----------------QDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWA  1504
                             QDWI+EM++F+KSID  HLLTVGLEGFYGP  PKRL +NPE+W 
Sbjct  243   FTIQQKYQYGVVLVGSQDWIDEMTSFIKSIDDKHLLTVGLEGFYGPNSPKRLTVNPEMWP  302

Query  1505  ADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPI  1684
             ++LG+DF+RNSN S IDFASVH+YPDHWF NQTF+DKLKF  +W+ SHIEDG + LKKP+
Sbjct  303   SELGTDFVRNSNSSNIDFASVHIYPDHWFHNQTFEDKLKFVVQWMQSHIEDGMKELKKPV  362

Query  1685  MFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEF  1864
             +FTEFGL+   K+ EP QR+RF++ I +++YKSAK  K+GAG++ WQ  +E ME +NDEF
Sbjct  363   LFTEFGLSNLNKDYEPSQRERFYRTIFDVVYKSAKRRKAGAGTLVWQLFMEGMEGFNDEF  422

Query  1865  GIVPWERASTYNLITNHSCRLAGVHGVLPSQQEH-LKSFCS  1984
             GIVP E+   Y L+   SCRL  V G    ++EH L+  CS
Sbjct  423   GIVPHEQDPMYRLMVEQSCRLGKVTG---RREEHKLRKLCS  460



>gb|KHN27892.1| Mannan endo-1,4-beta-mannosidase 2 [Glycine soja]
Length=406

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/394 (68%), Positives = 326/394 (83%), Gaps = 0/394 (0%)
 Frame = +2

Query  761   LTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTM  940
             ++FG +  S+ EE  +LSFVERNGTQF  DG+ FYVNGWNSYW M  +VD   R +VR M
Sbjct  1     MSFGGIKFSFLEEGPELSFVERNGTQFVLDGKAFYVNGWNSYWLMVQSVDVYSRSKVREM  60

Query  941   LQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVN  1120
             ++  AKMG+TVCRTWAFNDG YNALQ SPG+FDE+ F+ALD VIAE+R+HGIRL+L LVN
Sbjct  61    MKTGAKMGLTVCRTWAFNDGDYNALQTSPGRFDEQSFQALDYVIAEARQHGIRLLLSLVN  120

Query  1121  NLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRD  1300
             NL+AYGGK+QYVKWAWQEG+GLS SNDSFF+DP+IR YFKNY+KTVLTRKNT+TG+EYR+
Sbjct  121   NLQAYGGKSQYVKWAWQEGVGLSSSNDSFFFDPSIRTYFKNYIKTVLTRKNTITGIEYRN  180

Query  1301  DPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRL  1480
             DP+IF WELINEPRCM+DP+GDTLQ WI+EMSTFVK IDKNHLLTVGLEGFYGP DPK  
Sbjct  181   DPSIFGWELINEPRCMSDPSGDTLQGWIDEMSTFVKMIDKNHLLTVGLEGFYGPNDPKSS  240

Query  1481  KINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDG  1660
              +NPELWA+ LGSDFIRNS +S IDFASVH+YPDHWF  Q F+D+LKF  KW+LSHIEDG
Sbjct  241   TVNPELWASRLGSDFIRNSKISHIDFASVHIYPDHWFHEQVFEDQLKFVYKWMLSHIEDG  300

Query  1661  ERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVER  1840
             +  LKKP++F+EFGL+   +      R++  + +L+I+YKSAK N+SGAG++ WQFLV  
Sbjct  301   DEVLKKPVLFSEFGLSKTNQNFSLSDREKMHRAVLDIIYKSAKRNRSGAGALVWQFLVGG  360

Query  1841  MEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             M+E++DE+G+VPWE +ST ++    SCRLA   G
Sbjct  361   MKEFSDEYGMVPWESSSTPHVFIEQSCRLANAKG  394



>gb|KHN31990.1| Mannan endo-1,4-beta-mannosidase 2 [Glycine soja]
Length=403

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/407 (66%), Positives = 327/407 (80%), Gaps = 4/407 (1%)
 Frame = +2

Query  761   LTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTM  940
             ++FGD+   + EE  +L+FVERNGTQF  DG+ FY+NGWNSYW M  +VD   RP+VR M
Sbjct  1     MSFGDVRFGFEEEA-ELAFVERNGTQFMVDGKAFYINGWNSYWLMVQSVDEYSRPKVREM  59

Query  941   LQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVN  1120
             L+A AKMG+TVCRTWAFNDG YNALQ SPG F+E+ F+ALD VIAE+R+HGIRL+L LVN
Sbjct  60    LRAGAKMGLTVCRTWAFNDGDYNALQSSPGVFNEQAFKALDYVIAEARQHGIRLLLSLVN  119

Query  1121  NLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRD  1300
             NL AYGGKTQYVKWAWQEG+GLS SNDSFF+DP+IR YFKNYVKT+LTRKNT+TG+EYR+
Sbjct  120   NLHAYGGKTQYVKWAWQEGVGLSSSNDSFFFDPSIRSYFKNYVKTILTRKNTITGIEYRN  179

Query  1301  DPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRL  1480
             DPTIF WELINEPRC+TDP+GDTLQDWIEEMS FVK IDK HL+TVGLEGFYGP DPKRL
Sbjct  180   DPTIFGWELINEPRCLTDPSGDTLQDWIEEMSAFVKLIDKRHLVTVGLEGFYGPNDPKRL  239

Query  1481  KINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDG  1660
              +NPE WA+ LGSDFIRNS +S IDF SVH+YPDHWF +Q F+D +KF  KW+LSHIEDG
Sbjct  240   TVNPEDWASRLGSDFIRNSKISNIDFTSVHIYPDHWFHHQVFEDYMKFVSKWMLSHIEDG  299

Query  1661  ERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVER  1840
             ++ L KP++F+E+GL+ +     P +R   +K IL+I YKSAK N+SGAG++ WQFLV  
Sbjct  300   DKVLNKPVLFSEYGLS-DINFTMP-ERKTMYKTILDISYKSAKKNRSGAGALVWQFLVGG  357

Query  1841  MEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEHLKSFC  1981
             M+E+ D+FGI+PWE+    +L    SCRLA   G  P +    K FC
Sbjct  358   MQEFTDDFGIIPWEKTPIPSLFVEQSCRLAKTKG-WPHKDTSFKQFC  403



>ref|XP_009400567.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/419 (63%), Positives = 328/419 (78%), Gaps = 11/419 (3%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDL-W-----VSYPEETLKLSFVERNGTQFYADGQ  856
             MLA NG+FYPI+G A+  AFIY++FGDL W     V  PE    +SFV RNGT+F  DG+
Sbjct  1     MLATNGVFYPILGLASCAAFIYMSFGDLAWDIGTHVRGPE----MSFVGRNGTRFTVDGK  56

Query  857   VFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKF  1036
              FYVNGWNSYW M+ AV+   RPRVR MLQA AKMG+TVCRTWAFNDGAYNALQ+S G F
Sbjct  57    AFYVNGWNSYWLMDQAVEEVSRPRVRAMLQAGAKMGLTVCRTWAFNDGAYNALQVSLGHF  116

Query  1037  DERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYD  1216
             DERVF+ALD VI E++RHGIRL+L L NNL+AYGGKTQYVKWAW+EGIGLS SNDSFF+D
Sbjct  117   DERVFKALDWVIVEAKRHGIRLLLSLANNLEAYGGKTQYVKWAWEEGIGLSSSNDSFFFD  176

Query  1217  PNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMS  1396
             P+IR YFK Y+KT+LTRKN + G++Y+DDPTIFAWEL+NEPRCM+D +GDTLQ WIEEM+
Sbjct  177   PSIRSYFKTYLKTILTRKNHLNGIQYKDDPTIFAWELMNEPRCMSDVSGDTLQKWIEEMA  236

Query  1397  TFVKSIDKNHLLTVGLEGFYGPKD-PKRLKINPELWAADLGSDFIRNSNLSTIDFASVHV  1573
              +VKSIDKNHLLT+GLEGFYG    P++L +NP  W + +GSDF++NS +  IDFASVH+
Sbjct  237   AYVKSIDKNHLLTIGLEGFYGSTSPPEKLNVNPGQWFSTVGSDFVQNSRVPEIDFASVHI  296

Query  1574  YPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFF  1753
             YPD W        K+K+  +W+ SHIEDG++ LKKP++FTEFGL+ +TK  +   RD F+
Sbjct  297   YPDQWEVGAGLDQKMKYISRWLTSHIEDGDKELKKPVLFTEFGLSDKTKGFDHSHRDVFY  356

Query  1754  KLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
             K I  I+Y+SA+  +SGAG+  WQF+V  M+EY D+FG VP ER S Y LI   SCR+A
Sbjct  357   KSIFNIVYRSARKGRSGAGAFVWQFMVAGMQEYCDDFGFVPEERPSMYRLIKKQSCRMA  415



>ref|XP_009386799.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=436

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/435 (60%), Positives = 340/435 (78%), Gaps = 4/435 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWV--SYPEETLKLSFVERNGTQFYADGQVFYV  868
             MLA NG  YP++G A+ +A +Y++FGDL +  S      ++SFV RNGT+F  DG+ FYV
Sbjct  2     MLANNGALYPVLGLASCVALVYMSFGDLALDLSTHAREPEMSFVGRNGTRFTMDGKAFYV  61

Query  869   NGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERV  1048
             NGWNSYW M+ AV+   RPRV+ M QA AKMG+TVCRTWAFNDG YNALQ+S G FDE V
Sbjct  62    NGWNSYWLMDQAVEEISRPRVKAMFQAGAKMGLTVCRTWAFNDGGYNALQVSLGHFDEHV  121

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
             F+ALD VI E++RHGIRL+L L NNL+AYGGKTQYVKWAW+EGIGLS SNDSFF+DP+IR
Sbjct  122   FQALDRVIVEAKRHGIRLLLSLANNLEAYGGKTQYVKWAWEEGIGLSSSNDSFFFDPSIR  181

Query  1229  RYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVK  1408
              +FK Y+KTVLTRKN + G++Y+D+PTIFAWEL+NEPRCM+DP+GDTLQDWIEE++ +VK
Sbjct  182   SHFKTYLKTVLTRKNRLNGIQYKDEPTIFAWELMNEPRCMSDPSGDTLQDWIEELAAYVK  241

Query  1409  SIDKNHLLTVGLEGFYGP-KDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDH  1585
             SIDKNHLLTVGLEGFYGP   P++LK+NP  W   LGSDFIRNS +S IDFASVH+YPD 
Sbjct  242   SIDKNHLLTVGLEGFYGPASSPEKLKVNPGQWFGTLGSDFIRNSKVSDIDFASVHIYPDQ  301

Query  1586  WFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLIL  1765
             W      ++K+K+   W+ SHIEDGE  LKKP++FTEFGL+ ++++ +   RD F++ I 
Sbjct  302   WQVGAGLEEKMKYISGWLTSHIEDGEEELKKPVLFTEFGLSDKSRDFDHAHRDVFYESIF  361

Query  1766  EIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV-HG  1942
             +++Y+SA+   +GAG++ WQF+   M+EY+D+FGIVP ER+S Y LI   SCRL  + HG
Sbjct  362   DVVYESARRGGAGAGALVWQFMAAGMQEYSDDFGIVPEERSSMYRLIKKQSCRLMRLSHG  421

Query  1943  VLPSQQEHLKSFCSK  1987
                 ++   ++FC++
Sbjct  422   RDWMKRRDSETFCAE  436



>ref|XP_008791709.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Phoenix dactylifera]
Length=428

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/430 (60%), Positives = 321/430 (75%), Gaps = 3/430 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M A NG  YP++G A+ +AFI ++   L     E   K+SFV+RNG  F  D + FYVNG
Sbjct  1     MKAENGALYPVLGLASIIAFICISLRGLEFHSVEP--KMSFVKRNGANFMVDERAFYVNG  58

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+ AV+   RPRVR M Q AAKMG+TVCR WAFNDGA+NALQ+S G+FDERVF+
Sbjct  59    WNSYWLMDQAVEEFSRPRVRKMFQTAAKMGLTVCRAWAFNDGAHNALQVSLGRFDERVFK  118

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VI E+R+HGIRL+L LVNNL+ YGGKTQYV+WAW+EGIGLS SNDSFF+DP IRRY
Sbjct  119   ALDYVIVEARKHGIRLLLSLVNNLEHYGGKTQYVRWAWEEGIGLSFSNDSFFFDPTIRRY  178

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FK Y+KT+L RKN +TG+EYRDDPTIFAWEL+NEP+C++D +GDTLQDWIEEM+ +VKSI
Sbjct  179   FKVYLKTILARKNHLTGIEYRDDPTIFAWELMNEPQCISDASGDTLQDWIEEMAEYVKSI  238

Query  1415  DKNHLLTVGLEGFYGPKD-PKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             DK HLLT+GLEGFYGP   P++L +NP  W   +GSDFIRNS +S IDFASVH+YPD W 
Sbjct  239   DKKHLLTIGLEGFYGPTSPPEKLSMNPGEWYNTIGSDFIRNSKISAIDFASVHIYPDQWL  298

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
                   +KL++  KW+ SHIEDG+R LKKP++FTEFGL+ + K  +   R+ F+K I + 
Sbjct  299   LEAELDEKLEYISKWMTSHIEDGDRELKKPVLFTEFGLSNKNKNFDHSHREAFYKSIFDT  358

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +Y+SA+ N +GAG+  WQ LV  MEEYND+FGI+P ER S   LI   SCRL  +     
Sbjct  359   IYESARKNGAGAGAFIWQILVPGMEEYNDDFGIIPGERPSIDRLIKEQSCRLMALQHQHD  418

Query  1952  SQQEHLKSFC  1981
               +   K  C
Sbjct  419   LSRRSSKGIC  428



>ref|XP_010915420.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Elaeis guineensis]
Length=428

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/430 (60%), Positives = 318/430 (74%), Gaps = 3/430 (1%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M A NG  YP++G A  +AF+ ++F  L     E   K+SFV+R+GT F  D + FYVNG
Sbjct  1     MKAENGALYPVLGLACCIAFMCMSFRGLEFHSGES--KISFVKRSGTNFMIDERAFYVNG  58

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+ AV+   RPRVR M   AAKMG+TVCRTWAFNDGA+NALQ+S G+FDERVF+
Sbjct  59    WNSYWLMDQAVEEFSRPRVRKMFHTAAKMGLTVCRTWAFNDGAHNALQVSLGRFDERVFK  118

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
             ALD VI E+R+HGIRL+L LVNNL+ YGGKTQYVKWAW+EGIGLS SNDSFF+DP IRRY
Sbjct  119   ALDYVIVEARKHGIRLLLSLVNNLEHYGGKTQYVKWAWEEGIGLSFSNDSFFFDPTIRRY  178

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FK Y+KT+L RKN +TG+EYRDDPTIFAWEL+NEP+C++D +GDTLQDWIEEM+ +VKSI
Sbjct  179   FKIYLKTILARKNHLTGIEYRDDPTIFAWELMNEPQCISDASGDTLQDWIEEMAEYVKSI  238

Query  1415  DKNHLLTVGLEGFYGPKD-PKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             DK HLLT+GLEGFYGP   P++L +NP  W   +GSDFIRNS +S IDFASVH+YPD W 
Sbjct  239   DKKHLLTIGLEGFYGPTSPPEKLSMNPGEWYKTIGSDFIRNSKISAIDFASVHIYPDQWL  298

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
                   +K ++  KW+ SHIEDG+R LKKP++FTEFGL+   K  +   R+ F K I + 
Sbjct  299   LEAALDEKFEYISKWMTSHIEDGDRELKKPVLFTEFGLSNRNKNFDHSHREAFCKSIFDT  358

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +Y SA+ N +GAG+  WQFLV  MEEYND+FG +P ER S   LI   SCRL  +     
Sbjct  359   IYASARMNGAGAGAFIWQFLVPGMEEYNDDFGFIPGERPSIDRLIKEQSCRLMALQRRHD  418

Query  1952  SQQEHLKSFC  1981
               +   K  C
Sbjct  419   LSRRSSKGIC  428



>gb|AAD20927.1| (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
Length=403

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/412 (61%), Positives = 314/412 (76%), Gaps = 31/412 (8%)
 Frame = +2

Query  707   NGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSY  886
             NG   PI+GF   +AFIYL+FGDLW     E  +L+FV+RNGTQF  DG+  YVNGWNSY
Sbjct  7     NGPVIPILGFLTCVAFIYLSFGDLWFGLKTEG-ELAFVKRNGTQFVVDGKALYVNGWNSY  65

Query  887   WFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDL  1066
             WFM+HAV+   R RV  ML+A AKMG+TVCRTWAFNDG YNALQISPG+FDERVF+ALD 
Sbjct  66    WFMDHAVNDHSRHRVSAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH  125

Query  1067  VIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNY  1246
             VIAE++ HG+                              S SNDSFF+DP+IRRYFKNY
Sbjct  126   VIAEAKTHGV------------------------------SSSNDSFFFDPSIRRYFKNY  155

Query  1247  VKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNH  1426
             +  +LTRKN++TG+EYR+DPTIFAWELINEPRCM+D +GDTLQDWI EM+ F+KSID  H
Sbjct  156   LTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDVSGDTLQDWINEMTAFIKSIDNKH  215

Query  1427  LLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTF  1606
             LLTVGLEGFYGP  PK+L +NPE WA++LGSDF+RNS+   IDFASVH+YPDHWF +Q F
Sbjct  216   LLTVGLEGFYGPSSPKKLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGF  275

Query  1607  QDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSA  1786
             ++KLKF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ +P QRDRF++ I +++YKSA
Sbjct  276   EEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKSA  335

Query  1787  KHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
             K  +SGAG++ WQFL+E ME +ND+FGIVPWE+ S   L+   SCRL+ + G
Sbjct  336   KRKRSGAGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRITG  387



>ref|XP_009421284.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/413 (62%), Positives = 316/413 (77%), Gaps = 3/413 (1%)
 Frame = +2

Query  701   ARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWN  880
             A NG+ YP++G A  +A IYL  GD   S P ++ +LSFV+RNGTQF  DG+ FYVNGWN
Sbjct  23    AGNGIVYPVLGIAVCVALIYLMLGDFKFS-PGKS-QLSFVQRNGTQFVVDGRAFYVNGWN  80

Query  881   SYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRAL  1060
             SYW M+ +V+   RPRV  + Q  AKMGMTVCRTWAFNDGAY+ALQ+S G FDERVF+AL
Sbjct  81    SYWLMDQSVEESSRPRVSEIFQTGAKMGMTVCRTWAFNDGAYHALQVSLGIFDERVFKAL  140

Query  1061  DLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFK  1240
             D VI E+RRHGIRL+L LVNNL+ YGGKTQYVKWAW EG GLS SNDSFF+DP+IR YFK
Sbjct  141   DWVIVEARRHGIRLLLSLVNNLQHYGGKTQYVKWAWDEGFGLSSSNDSFFFDPSIRSYFK  200

Query  1241  NYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDK  1420
              Y+KT+LTRKN +TG+EYRDDPTIFAWEL+NEP+C +D +GDTLQ+WIEEM+ +VK+IDK
Sbjct  201   IYLKTILTRKNHLTGIEYRDDPTIFAWELMNEPQCQSDASGDTLQEWIEEMTEYVKTIDK  260

Query  1421  NHLLTVGLEGFYGPKDPK-RLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKN  1597
              HLLT+GLEGFYGP  P+ +  INP  W + LGSDF+RNS +  +DFAS H+YPD W   
Sbjct  261   KHLLTIGLEGFYGPVSPEVKQNINPGKWYSTLGSDFVRNSKVPYVDFASAHIYPDQWLVE  320

Query  1598  QTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMY  1777
                 +K+++  KWI SHIEDGE+ L KPIMFTEFGL+ + K  E   R  F+K I   ++
Sbjct  321   ADLNEKVEYISKWITSHIEDGEKTLNKPIMFTEFGLSTKAKNFEYSHRIIFYKSIFNKIH  380

Query  1778  KSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
             +SA+ N +GAG++ WQ LV+ ME+YND++GIVP ER S   LI   SC+L  V
Sbjct  381   ESARQNGAGAGALIWQLLVQGMEDYNDDYGIVPRERPSVDKLIKEQSCQLIAV  433



>ref|XP_006859039.1| hypothetical protein AMTR_s00068p00182430 [Amborella trichopoda]
 gb|ERN20506.1| hypothetical protein AMTR_s00068p00182430 [Amborella trichopoda]
Length=428

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/430 (60%), Positives = 322/430 (75%), Gaps = 2/430 (0%)
 Frame = +2

Query  695   MLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNG  874
             M+A NG+  PI+GFA+ +AFIY+T GDL + + E   +L FVE+NGTQF  DG+ FYVNG
Sbjct  1     MVAGNGLLVPILGFASSVAFIYMTLGDLRLYFAEP--QLGFVEKNGTQFMVDGKAFYVNG  58

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFR  1054
             WNSYW M+ AV+   RPRVR MLQA A+MG+TVCRTWAFNDG YNALQ+S G  DERVF+
Sbjct  59    WNSYWLMDQAVEEFSRPRVRAMLQAGARMGLTVCRTWAFNDGGYNALQLSLGTIDERVFK  118

Query  1055  ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRY  1234
              LD VIAE+R  GIRLILCLVNNL AYGGK QYV+WA ++G   S SNDSFF DP IR +
Sbjct  119   GLDRVIAEARHQGIRLILCLVNNLHAYGGKGQYVQWALEQGAASSSSNDSFFSDPFIRSH  178

Query  1235  FKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSI  1414
             FKNY+KT+LTR+N++TG++Y+DDPTIFAWE++NEPRC +DP+GDTLQ WI+EM+ FVKSI
Sbjct  179   FKNYMKTILTRRNSLTGIKYKDDPTIFAWEIMNEPRCKSDPSGDTLQGWIKEMAEFVKSI  238

Query  1415  DKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFK  1594
             D  HLL+VG EGFYGP  P++   NP  WA+ LG DFIRN+ +S IDFASVH YPD+WF 
Sbjct  239   DNKHLLSVGNEGFYGPTTPEKFDRNPGDWASSLGVDFIRNNMISAIDFASVHAYPDNWFP  298

Query  1595  NQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIM  1774
               + + KL +  KW+ SHIEDG+  L+KP++FTEFG++ + +  EP QRD F+  I +I+
Sbjct  299   EPSPEKKLNYLAKWVKSHIEDGDTMLQKPVLFTEFGISTQQEGFEPTQRDAFYSTIYDII  358

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPS  1954
             YKSAK  +SGAG++ WQFL   M EY D F IVPWE  STY+LI   SCRL  +      
Sbjct  359   YKSAKRRRSGAGAMAWQFLAGGMNEYGDAFAIVPWEWPSTYSLIIKQSCRLRAIRQDKGL  418

Query  1955  QQEHLKSFCS  1984
                   S CS
Sbjct  419   VDSDSSSICS  428



>ref|XP_002458478.1| hypothetical protein SORBIDRAFT_03g034420 [Sorghum bicolor]
 gb|EES03598.1| hypothetical protein SORBIDRAFT_03g034420 [Sorghum bicolor]
Length=461

 Score =   507 bits (1306),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 316/449 (70%), Gaps = 26/449 (6%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGDL---WVSYPEETLKLS------------------FVERNG  832
              Y ++G A  +A +Y TFG++    +S P      S                  FVER G
Sbjct  9     LYHVLGVATCVALLYFTFGEVDLRHISLPSMPASASVPGSWSSSSRAAAAVAAPFVERRG  68

Query  833   TQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNA  1012
              Q + DG+ FY NGWNSYW M+ AV+   R RV  M +  A+MG+TVCR+WAFNDGAYNA
Sbjct  69    AQLFLDGRPFYANGWNSYWLMDQAVEPRSRDRVSRMFRTGAEMGLTVCRSWAFNDGAYNA  128

Query  1013  LQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSP  1192
             LQ+SPG FDERVF+ALD V+ E+ RHG+RLIL L NNL+AYGGKTQYV+WAW+EG+GLS 
Sbjct  129   LQVSPGHFDERVFKALDRVLVEAARHGVRLILSLANNLEAYGGKTQYVRWAWEEGVGLSA  188

Query  1193  SNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTL  1372
             SNDSFFYDP IR YFK Y+KT+LTRKN +TG+EYRDDPTI AWEL+NEPRC TDP+GDTL
Sbjct  189   SNDSFFYDPAIRDYFKVYLKTLLTRKNHLTGVEYRDDPTILAWELMNEPRCTTDPSGDTL  248

Query  1373  QDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPK-RLKINPELWA-ADLGSDFIRNSNLS  1546
             Q W+EEM+ +VKSIDK HLLTVG EGFYGP  P+ +L +NP +W   + GSDFIRN+ + 
Sbjct  249   QRWMEEMAAYVKSIDKKHLLTVGTEGFYGPTSPQEKLNVNPGIWKDNNYGSDFIRNAKIP  308

Query  1547  TIDFASVHVYPDHWFKNQ--TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETK  1720
              IDFAS+H+YPD W + Q  T  +KLKF K+W+ SHIEDG+R L KP++ TEFGL+   K
Sbjct  309   DIDFASIHLYPDTWLQQQHATVDEKLKFVKRWVASHIEDGDRELGKPVLTTEFGLSHRAK  368

Query  1721  EVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYN  1900
               +   RD F+K + +I+Y+SA    +GAG+  WQ  VE MEE++D+F +VP E  S + 
Sbjct  369   GFDHAHRDVFYKAVYDIVYRSAVRGGAGAGAFVWQLAVEDMEEFHDDFSVVPSEHPSLHR  428

Query  1901  LITNHSCRLAGV-HGVLPSQQEHLKSFCS  1984
             LI + SCRLA +  GV   + +   S C+
Sbjct  429   LIKSQSCRLARLRRGVAGEEAKRTLSVCA  457



>ref|XP_003569799.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Brachypodium 
distachyon]
Length=446

 Score =   505 bits (1300),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 248/445 (56%), Positives = 312/445 (70%), Gaps = 16/445 (4%)
 Frame = +2

Query  695   MLARNGMF-YPIIGFAAFLAFIYLTF-------GDLWVSYPEETLKLS------FVERNG  832
             M A NG+F Y I+G A+ LA  Y +        G L  S P  +   S      FVER G
Sbjct  1     MAACNGLFLYHILGLASLLAVFYFSLLGEVDLRGPLLPSSPAGSHNASSSPQPPFVERRG  60

Query  833   TQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNA  1012
             TQ +  G+ FY+NGWNSYW M+ AV+   R RV  M +AAA MG+TVCRTWAFNDG YNA
Sbjct  61    TQLFLGGRPFYINGWNSYWLMDQAVEPSSRHRVSAMFRAAAGMGLTVCRTWAFNDGTYNA  120

Query  1013  LQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSP  1192
             LQ++PG+FDERVFRALD V+AE+ RHG+RL+L L NNL+AYGGKTQYV+WAW+EGIGLS 
Sbjct  121   LQLAPGRFDERVFRALDRVLAEAPRHGVRLVLSLANNLEAYGGKTQYVRWAWEEGIGLSS  180

Query  1193  SNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTL  1372
             SNDSFF+DP IR YFK Y+K +LTRKN +TG+ Y+DDPTI AWELINEPRC+TDPTG+TL
Sbjct  181   SNDSFFFDPAIRDYFKVYIKALLTRKNHLTGVLYKDDPTILAWELINEPRCITDPTGNTL  240

Query  1373  QDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKD-PKRLKINPELWAADLGSDFIRNSNLST  1549
             Q WIEEM+ +VKSID+ HLLTVG EGFYGP   P +L +NP  W  + G DFIRNS +S 
Sbjct  241   QRWIEEMAAYVKSIDRKHLLTVGTEGFYGPTSTPDKLNVNPGHWFNNYGLDFIRNSMVSD  300

Query  1550  IDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVE  1729
             IDFAS+H+YPD W  +   ++K+KF  +W+ SH EDGE+ L KP++ TEFGL+  TK  E
Sbjct  301   IDFASIHLYPDTWLLDAKLEEKIKFVGQWMSSHFEDGEKELGKPVLLTEFGLSHMTKGFE  360

Query  1730  PYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLIT  1909
                RD  ++ + +I Y SA+   +GAG+  WQ   E ME+Y+D F IVP E  S   L+ 
Sbjct  361   QSHRDALYRAVYDIAYASAERGGAGAGAFVWQLAAEGMEDYHDGFSIVPSETPSMRALLK  420

Query  1910  NHSCRLAGV-HGVLPSQQEHLKSFC  1981
               SCR+A + HG     +  L++ C
Sbjct  421   EQSCRMAALRHGEAAEAKRILRTVC  445



>ref|XP_006644697.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Oryza brachyantha]
Length=444

 Score =   504 bits (1298),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 317/444 (71%), Gaps = 15/444 (3%)
 Frame = +2

Query  698   LARNGM-FYPIIGFAAFLAFIYLTFG--DLWVSYP----------EETLKLSFVERNGTQ  838
             +A NG+  Y I+G A+ +A +Y + G  DL +S P               L FVER G +
Sbjct  1     MAGNGLILYHILGLASCIALVYFSLGEVDLRLSLPALPFSGGGASSRAASLPFVERRGAR  60

Query  839   FYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQ  1018
              + DG+ FY+NGWNSYW M+ AV+   RPRV +M + A  MG+TVCRTWAFNDG+YNALQ
Sbjct  61    LFLDGRPFYINGWNSYWLMDLAVEPDTRPRVPSMFRTAVSMGLTVCRTWAFNDGSYNALQ  120

Query  1019  ISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSN  1198
             +SPG FDERVF+ALD V+AE+ +HG+RLIL L NNL AYGGK QYV+WAW+EG+G++ SN
Sbjct  121   LSPGHFDERVFKALDRVVAEASQHGVRLILSLANNLDAYGGKRQYVRWAWEEGVGITASN  180

Query  1199  DSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQD  1378
             DSFF+DP IR YFK Y+KT++TRKN +TGLEYRDDPTI AWEL+NEPRC +DP+GDTLQ 
Sbjct  181   DSFFFDPAIRDYFKVYLKTLVTRKNHLTGLEYRDDPTILAWELMNEPRCTSDPSGDTLQR  240

Query  1379  WIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPK-RLKINPELW-AADLGSDFIRNSNLSTI  1552
             W+EEM+ +VKSIDK HLLTVG EGFYGP   + +L INP  W   + G+DFIRNS +  I
Sbjct  241   WMEEMAAYVKSIDKKHLLTVGTEGFYGPTSSQDKLNINPGEWFPNNYGADFIRNSKIPDI  300

Query  1553  DFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEP  1732
             DFASVHVYPD+W ++ +  +KLKF  +WI SH+EDG++ L KP++ TEFGL+ + +  + 
Sbjct  301   DFASVHVYPDNWLQHASLDEKLKFMTQWITSHVEDGDKELDKPVLVTEFGLSHQVEGFDD  360

Query  1733  YQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITN  1912
               RD  ++ + +I+Y SA+   +G G++ WQ   E ME+Y+D F IVP ER S   LI  
Sbjct  361   AHRDVLYRAVYDIVYDSARRGGAGGGALVWQLAAEGMEQYHDGFSIVPVERPSMMRLIKE  420

Query  1913  HSCRLAGVHGVLPSQQEHLKSFCS  1984
              SCRLA V       ++ LK+ CS
Sbjct  421   QSCRLAAVRYGEEGARKVLKTVCS  444



>dbj|BAJ87988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   502 bits (1293),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 316/443 (71%), Gaps = 14/443 (3%)
 Frame = +2

Query  695   MLARNGMF-YPIIGFAAFLAFIYLTF-GDLWVSYP----------EETLKLSFVERNGTQ  838
             M A NG+F Y I+G A+ +A  Y +  G++ + +P               L FVER G Q
Sbjct  1     MAACNGLFVYHILGLASLVAVFYFSLLGEVDLRFPGLLPSPGASPSHGASLPFVERRGAQ  60

Query  839   FYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQ  1018
                +G+ FY+NGWNSYW M+ AV+   R RV  M +A A MG+TVCRTWAFNDGAYNALQ
Sbjct  61    LLLEGRPFYINGWNSYWLMDQAVEPASRHRVSDMFRAGAGMGLTVCRTWAFNDGAYNALQ  120

Query  1019  ISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSN  1198
             +SPG FDERVFRALD+V+ E+RRHG+RL+L L NNL+AYGGKTQY +WAW EG+GL+ SN
Sbjct  121   LSPGHFDERVFRALDMVVVEARRHGVRLVLSLANNLEAYGGKTQYARWAWDEGVGLTSSN  180

Query  1199  DSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQD  1378
             DSFF+DP IR YFK Y+KT+LTR N +TG++Y+DDPTI AWEL+NEPRC+TDP+G+TLQ 
Sbjct  181   DSFFFDPAIRDYFKVYLKTLLTRTNHLTGVQYKDDPTILAWELMNEPRCITDPSGNTLQR  240

Query  1379  WIEEMSTFVKSIDKNHLLTVGLEGFYGPKD-PKRLKINPELWAADLGSDFIRNSNLSTID  1555
             WIEEM+ +VKSID+ HLLTVG EGFYGP   P++L +NP  W  + G DFIRNS +S ID
Sbjct  241   WIEEMAGYVKSIDRRHLLTVGTEGFYGPTSPPEKLSVNPGHWFNNYGLDFIRNSKISDID  300

Query  1556  FASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERAL-KKPIMFTEFGLAGETKEVEP  1732
             FAS+H+YPD+W  +   ++KLKF  +W+ SH EDG+  L  KP++ TEFGL+   +  E 
Sbjct  301   FASIHLYPDNWLLHANLEEKLKFVTQWVSSHFEDGDTELGGKPVVLTEFGLSHMVQGFEQ  360

Query  1733  YQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITN  1912
              QRD F+K + +I+++SAK   +GAG++ WQ   E MEE++D F IVP ER S   L+T 
Sbjct  361   SQRDAFYKSVYDIVHESAKRGGAGAGAMVWQLAAEDMEEFHDGFAIVPSERPSMQKLLTE  420

Query  1913  HSCRLAGVHGVLPSQQEHLKSFC  1981
              SCRLA +       +  LK+ C
Sbjct  421   QSCRLATLRHGEQEAKRILKTVC  443



>ref|XP_009413849.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   503 bits (1294),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 305/423 (72%), Gaps = 6/423 (1%)
 Frame = +2

Query  680   SRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQV  859
             S+R+K   RNG   P +GF   + F+Y+ FG + +   E   + SFV+RNGT F  DG+V
Sbjct  19    SKRTK--PRNGKLCPALGFVCCMVFMYMAFGAVKLRTQEP--RSSFVKRNGTHFMVDGRV  74

Query  860   FYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFD  1039
             FYVNGWNSYW M+ A +   R RV  + Q  A+MG+TVCRTWAFNDGA +ALQ+S G FD
Sbjct  75    FYVNGWNSYWLMDQAAEASSRSRVTEIFQTGARMGLTVCRTWAFNDGADHALQVSLGIFD  134

Query  1040  ERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDP  1219
             ERVF ALD VI E+++HGIRL+L LVNNL+ YGGKTQYVKWA +EG G S +NDSFF+DP
Sbjct  135   ERVFEALDWVIVEAQKHGIRLLLSLVNNLQLYGGKTQYVKWAREEGFGSSSTNDSFFFDP  194

Query  1220  NIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMST  1399
             +IR YFK Y+KT+LTRKN +TG EYRDDPTIFAWEL+NEP+C +D +GDTLQ+WIEEM+ 
Sbjct  195   SIRSYFKIYLKTILTRKNHLTGTEYRDDPTIFAWELMNEPQCTSDASGDTLQEWIEEMAE  254

Query  1400  FVKSIDKNHLLTVGLEGFYG-PKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVY  1576
             +VK IDK HLLTVGLEGFYG P  P++ K+NP     +LGSDF+RNS    IDFAS H+ 
Sbjct  255   YVKRIDKKHLLTVGLEGFYGAPSPPEKTKVNPGKSYGELGSDFLRNSKTPDIDFASAHIN  314

Query  1577  PDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFK  1756
             PD+W  +    +K  +  KW+ SHIEDGE+ L KP++FTEFGL+ + K  +   R  F+K
Sbjct  315   PDNWLMDANLTEKTDYVSKWVTSHIEDGEKELNKPVLFTEFGLSDKNKNFDHSHRATFYK  374

Query  1757  LILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
              I + +Y+SA  N +GAG+  W FLV  ME+Y D+FGI+P E  S   LI   SCRL  +
Sbjct  375   SIYDTIYESALRNGAGAGTFIWHFLVGGMEKYTDDFGIIPGETPSIDRLIKEQSCRLITL  434

Query  1937  -HG  1942
              HG
Sbjct  435   QHG  437



>ref|NP_001130322.1| uncharacterized protein LOC100191416 [Zea mays]
 gb|ACF78505.1| unknown [Zea mays]
 gb|ACF87838.1| unknown [Zea mays]
 gb|ACN30643.1| unknown [Zea mays]
 tpg|DAA57619.1| TPA: putative endo-1,4-beta-mannosidase family protein [Zea mays]
Length=453

 Score =   502 bits (1292),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 249/442 (56%), Positives = 313/442 (71%), Gaps = 20/442 (5%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGD----------LWVSYPE----ETLKLSFVERNGTQFYADG  853
              Y ++G A  +A +Y TFG+          L VS P       +   FVER G Q +  G
Sbjct  9     LYHVLGVATCVALLYFTFGEVDLRHISLPSLPVSRPSPFRAAAVAAPFVERRGAQLFLAG  68

Query  854   QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGK  1033
             + FYVNGWNSYW M+ AV+   R RV  M +  A+MG+TVCR+WAFNDGAYNALQ+SPG 
Sbjct  69    RPFYVNGWNSYWLMDQAVEPRSRDRVSRMFRTGAEMGLTVCRSWAFNDGAYNALQVSPGH  128

Query  1034  FDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFY  1213
             FDERVF+ALD V+ E+ RHG+RLIL L NNL+AYGGKTQYV+WAW+EG+G+S SNDSFFY
Sbjct  129   FDERVFKALDRVVVEAGRHGVRLILSLANNLEAYGGKTQYVRWAWEEGVGMSASNDSFFY  188

Query  1214  DPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEM  1393
             DP IR YFK Y+KT+LTRKN +TG+EYRDDPTI AWEL+NEPRC TDP+GDTLQ W+EEM
Sbjct  189   DPAIRDYFKVYLKTLLTRKNHLTGVEYRDDPTILAWELMNEPRCTTDPSGDTLQRWMEEM  248

Query  1394  STFVKSIDKNHLLTVGLEGFYGPKDPK-RLKINPELWA-ADLGSDFIRNSNLSTIDFASV  1567
             S +VKSIDK HLLTVG EGFYGP  P+ +L +NP  W   + GSDFIRN+ +  IDFAS+
Sbjct  249   SAYVKSIDKKHLLTVGTEGFYGPTSPQEKLDVNPGTWKDNNYGSDFIRNAKIPDIDFASI  308

Query  1568  HVYPDHWFKNQ--TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQR  1741
             H+YPD W   Q  T  +KLKF K+W+ SHIEDG++ L KP++ TEFGL+   K      R
Sbjct  309   HLYPDTWLLQQHATVDEKLKFVKRWVASHIEDGDKELGKPVLATEFGLSHRAKGFHHSHR  368

Query  1742  DRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSC  1921
             D F+K + + +Y+SA    +GAG+  WQ  VE MEE++D+F +VP E  S + LI + SC
Sbjct  369   DVFYKAVYDTVYRSAARGGAGAGAFVWQLAVEDMEEFHDDFSVVPSEHPSLHRLIKSQSC  428

Query  1922  RLAGV-HGVLPSQQEHLKSFCS  1984
             RLA + HGV    +  L S C+
Sbjct  429   RLAKLRHGVGEEAKRTL-SVCA  449



>gb|EMS67718.1| Mannan endo-1,4-beta-mannosidase 2 [Triticum urartu]
Length=509

 Score =   503 bits (1294),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 311/431 (72%), Gaps = 15/431 (3%)
 Frame = +2

Query  695   MLARNGMF-YPIIGFAAFLAFIYLTF-GDLWVSYP----------EETLKLSFVERNGTQ  838
             M A NG+F Y I+G A+ LA  Y +  G++ + +P               L FVER G Q
Sbjct  1     MAACNGLFVYHILGLASLLAVFYFSLLGEVDLRFPGLLPSPGASRSHDASLPFVERRGAQ  60

Query  839   FYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQ  1018
              +  G+ FY+NGWNSYW M+ AV+   R RV  M +AA  MG+TVCRTWAFNDGAYNALQ
Sbjct  61    LFLAGRPFYINGWNSYWLMDQAVEPASRHRVSDMFRAATGMGLTVCRTWAFNDGAYNALQ  120

Query  1019  ISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSN  1198
             +SPG FDERVF+ALD+V+ E+RRHG+RLIL L NNL+AYGGKTQYV+WAW EG+GL+ SN
Sbjct  121   LSPGHFDERVFKALDMVVVEARRHGVRLILSLANNLEAYGGKTQYVRWAWDEGVGLTASN  180

Query  1199  DSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQD  1378
             DSFF+DP IR YFK Y+K +LTR N +TG++Y+DDPTI AWEL+NEPRC+TDP+G+TLQ 
Sbjct  181   DSFFFDPAIRDYFKVYLKALLTRTNHLTGVQYKDDPTILAWELMNEPRCITDPSGNTLQR  240

Query  1379  WIEEMSTFVKSIDKNHLLTVGLEGFYGPKD-PKRLKINPELWAADLGSDFIRNSNLSTID  1555
             WIEEM+ +VKSID+ HLLTVG EGFYGP   P++L +NP  W  + G DFIRNS +S ID
Sbjct  241   WIEEMAGYVKSIDRRHLLTVGTEGFYGPTSPPEKLSVNPGHWFNNYGLDFIRNSKISDID  300

Query  1556  FASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERAL-KKPIMFTEFGLAGETKEVEP  1732
             FASVH+YPD W  +   ++KLKF  KW+ SH EDG+  L  KP++ TEFGL+   K  E 
Sbjct  301   FASVHLYPDTWLLDANLEEKLKFVTKWVSSHFEDGDTELGGKPVVLTEFGLSHLVKGFEQ  360

Query  1733  YQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITN  1912
              QRD F+K + +I+++SAK   +GAG++ WQ   E MEEY+D F IVP E  S   L+T 
Sbjct  361   SQRDAFYKSVYDIVHESAKRGGAGAGAIVWQLAAEDMEEYHDGFAIVPSETPSMQKLLTE  420

Query  1913  HSCRLAGV-HG  1942
              SCRLA + HG
Sbjct  421   QSCRLAALRHG  431



>ref|NP_001044230.2| Os01g0746700 [Oryza sativa Japonica Group]
 sp|Q0JJD4.2|MAN2_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 
2; AltName: Full=Endo-beta-1,4-mannanase 2; 
AltName: Full=OsMAN2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB56016.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 dbj|BAC05600.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 dbj|BAF06144.2| Os01g0746700 [Oryza sativa Japonica Group]
Length=445

 Score =   498 bits (1282),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 312/445 (70%), Gaps = 15/445 (3%)
 Frame = +2

Query  695   MLARNGM-FYPIIGFAAFLAFIYLTFG--DLWVSYPE----------ETLKLSFVERNGT  835
             M   NG+  Y I+G A+ +A +Y + G  DL  + P               L FVER G 
Sbjct  1     MAVGNGLILYHILGLASCIALVYFSLGEVDLRDALPSLPFSGGASRAAAASLPFVERRGK  60

Query  836   QFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNAL  1015
             + + DG+ FY+NGWNSYW M+ AV+   RPRV +M + A  MG+TVCRTWAFNDG+YNAL
Sbjct  61    RLFLDGRPFYINGWNSYWLMDLAVEPNTRPRVSSMFRTAVSMGLTVCRTWAFNDGSYNAL  120

Query  1016  QISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPS  1195
             Q+SPG FDERVF+ALD V+AE+  HG+RLIL L NNL AYGGK QYV+WAW+EG+GL+ S
Sbjct  121   QLSPGHFDERVFKALDRVVAEASEHGVRLILSLANNLDAYGGKRQYVRWAWEEGVGLTAS  180

Query  1196  NDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQ  1375
             NDSFF+DP IR YFK Y+KT+L RKN +TGLEYRDDPTI AWEL+NEPRC +DP+GDTLQ
Sbjct  181   NDSFFFDPAIRDYFKVYLKTLLMRKNHLTGLEYRDDPTILAWELMNEPRCTSDPSGDTLQ  240

Query  1376  DWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPK-RLKINPELW-AADLGSDFIRNSNLST  1549
              W+EEMS +VKSIDK HLLTVG EGFYGP   + +L INP  W   + G+DFIRNS +  
Sbjct  241   RWMEEMSAYVKSIDKKHLLTVGTEGFYGPTSSQEKLNINPGEWFPNNYGADFIRNSKIQD  300

Query  1550  IDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVE  1729
             IDFASVHVYPD+W ++ +  +KLKF  +WI +H+EDG+  L+KP++ TEFGL+ + +  E
Sbjct  301   IDFASVHVYPDNWLQHASLDEKLKFMTRWITAHVEDGDGELEKPVLVTEFGLSHQVEGFE  360

Query  1730  PYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLIT  1909
                RD  ++ + +I++ SA+   +  G++ WQ   E MEEY+D F IVP ER S   LI 
Sbjct  361   DAHRDVLYRAVYDIVHGSARRGGAAGGALVWQLAAEGMEEYHDGFSIVPSERPSMMRLIK  420

Query  1910  NHSCRLAGVHGVLPSQQEHLKSFCS  1984
               SCRLA V       ++ LK+ C+
Sbjct  421   EQSCRLAAVRYGEEGARKVLKTVCA  445



>gb|EAY75800.1| hypothetical protein OsI_03716 [Oryza sativa Indica Group]
Length=445

 Score =   497 bits (1279),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 311/445 (70%), Gaps = 15/445 (3%)
 Frame = +2

Query  695   MLARNGM-FYPIIGFAAFLAFIYLTFG--DLWVSYPE----------ETLKLSFVERNGT  835
             M   NG+  Y I+G A+ +A +Y + G  DL  + P               L FVER G 
Sbjct  1     MAVGNGLILYHILGLASCIALVYFSLGEVDLRDALPSLPFSGGASRAAAASLPFVERRGK  60

Query  836   QFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNAL  1015
             + + DG+ FY+NGWNSYW M+ AV+   RPRV +M + A  MG+TVCRTWAFNDG+YNAL
Sbjct  61    RLFLDGRPFYINGWNSYWLMDLAVEPNTRPRVSSMFRTAVSMGLTVCRTWAFNDGSYNAL  120

Query  1016  QISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPS  1195
             Q+SPG FDERVF+ALD V+AE+  HG+RLIL L NNL AYGGK QYV+WAW+EG+GL+ S
Sbjct  121   QLSPGHFDERVFKALDRVVAEASEHGVRLILSLANNLDAYGGKRQYVRWAWEEGVGLTAS  180

Query  1196  NDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQ  1375
             NDSFF+DP IR YFK Y+KT+LTRKN +TGLEYRDDPTI AWEL+NEPRC +DP+GDTLQ
Sbjct  181   NDSFFFDPAIRDYFKVYLKTLLTRKNHLTGLEYRDDPTILAWELMNEPRCTSDPSGDTLQ  240

Query  1376  DWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPK-RLKINPELW-AADLGSDFIRNSNLST  1549
              W+EEMS +VKSIDK HLLTVG EGFYGP   + +L INP  W   + G+DFIRNS +  
Sbjct  241   RWMEEMSAYVKSIDKKHLLTVGTEGFYGPTSSQEKLNINPGEWFPNNYGADFIRNSKIQD  300

Query  1550  IDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVE  1729
             IDFASVHVYPD+W ++ +  +KLKF  +WI +H+EDG+  L+KP++  EFGL+ + +  E
Sbjct  301   IDFASVHVYPDNWLQHASLDEKLKFMTRWITAHVEDGDGELEKPVLVMEFGLSHQVEGFE  360

Query  1730  PYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLIT  1909
                RD  ++ + +I++ SA+   +  G+  WQ   E MEEY+D F IVP ER S   LI 
Sbjct  361   DAHRDVLYRAVYDIVHGSARRGGAAGGAFVWQLAAEGMEEYHDGFSIVPSERPSMMRLIK  420

Query  1910  NHSCRLAGVHGVLPSQQEHLKSFCS  1984
               SCRLA V       ++ LK+ C+
Sbjct  421   EQSCRLAAVRYGEEGARKVLKTVCA  445



>gb|ADE76368.1| unknown [Picea sitchensis]
Length=429

 Score =   495 bits (1274),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 233/423 (55%), Positives = 297/423 (70%), Gaps = 1/423 (0%)
 Frame = +2

Query  719   YPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFME  898
             Y ++G  + + F+YL FGD+ +  P    ++SFVERNG+ F  D +  YVNGWNSYW M+
Sbjct  8     YTVLGVVSCIVFLYLNFGDVHI-LPFSQPRMSFVERNGSHFVVDDKELYVNGWNSYWLMD  66

Query  899   HAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAE  1078
              +V    R RV+TML+  A+MG+TV RTWAFNDG YNALQ  PG FDERV RALD VI E
Sbjct  67    QSVGDSTRHRVKTMLRRGAEMGLTVVRTWAFNDGGYNALQQFPGTFDERVLRALDFVIVE  126

Query  1079  SRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTV  1258
             +RR+G+RLI  LVNNL AYGGK QYV+WA   GI +  SNDSFF DP IR Y+K YVK++
Sbjct  127   ARRNGLRLIFSLVNNLNAYGGKVQYVEWAHAAGINVGSSNDSFFSDPTIRGYYKEYVKSI  186

Query  1259  LTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTV  1438
             L RKN+++G+EYR++P IFAWEL+NEPRC +D +G TLQ WI EM+ F+KS+D  HLLTV
Sbjct  187   LVRKNSISGVEYRNEPAIFAWELVNEPRCTSDASGQTLQTWISEMAKFIKSLDSRHLLTV  246

Query  1439  GLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKL  1618
             GLEGFYG   P ++++NP  WA  LGSDFI NS +  IDFASVH YPD W  N   +D L
Sbjct  247   GLEGFYGKTTPNKIELNPGDWAVSLGSDFIWNSQVEEIDFASVHAYPDSWIPNVDLEDHL  306

Query  1619  KFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNK  1798
              +  KW+ SHI+DGE+ LKKP++FTEFGL+   K  E   RDR FK + E + +SA+   
Sbjct  307   NYFSKWVTSHIDDGEQILKKPVLFTEFGLSSHHKGFEQSHRDRLFKTMYEEIDESARKGG  366

Query  1799  SGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEHLKSF  1978
             +G G++ WQF+VE MEEY DEF  VPW+  ST+ LI   SCRL  ++       + L + 
Sbjct  367   AGGGALIWQFVVEGMEEYGDEFAFVPWQFPSTHKLIVEQSCRLQTLYEGQHQVNKSLYAA  426

Query  1979  CSK  1987
             CS 
Sbjct  427   CSS  429



>ref|XP_004969933.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Setaria italica]
Length=464

 Score =   493 bits (1268),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 242/452 (54%), Positives = 311/452 (69%), Gaps = 29/452 (6%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGDL------WVSYPEETLKLS-------------------FV  820
              Y ++G A  +A +Y TFG++        S P                          FV
Sbjct  9     LYHVLGVATCVALLYFTFGEVDLRHISLSSLPASGFGFGSGAGPSSSSSRAAAAVTAPFV  68

Query  821   ERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG  1000
             ER G Q + DGQ FY NGWNSYW M+ AV+   R RV  M +AAA+MG+TVCR+WAFNDG
Sbjct  69    ERRGAQLFLDGQPFYPNGWNSYWLMDQAVEPRSRDRVSRMFRAAAEMGLTVCRSWAFNDG  128

Query  1001  AYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGI  1180
             AYNALQ+SPG FD RVF+ALD V+ E+ RHG+RLIL L NNL+AYGGKTQYV+WAW+EG+
Sbjct  129   AYNALQVSPGHFDTRVFKALDWVVVEAGRHGVRLILSLANNLEAYGGKTQYVRWAWEEGV  188

Query  1181  GLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPT  1360
             GLS SNDSFFYDP IR YFK Y+KT+LTRKN +TG+EYRDDPTI AWEL+NEPRC TDP+
Sbjct  189   GLSASNDSFFYDPAIRDYFKAYLKTLLTRKNHLTGVEYRDDPTILAWELMNEPRCTTDPS  248

Query  1361  GDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPK-RLKINPELWA-ADLGSDFIRN  1534
             GDTLQ WIEEM+ +VKSIDK HLLTVG EGFYGP  P+ +  +NP +W   + GSDFIRN
Sbjct  249   GDTLQRWIEEMAAYVKSIDKKHLLTVGTEGFYGPTSPESKRDVNPGVWKDNNYGSDFIRN  308

Query  1535  SNLSTIDFASVHVYPDHWFKNQ--TFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLA  1708
             + +  IDFAS+H+YPD W + Q  T  +KL+F K+W+ SHIEDG++ L KP++ TEFGL+
Sbjct  309   AKIPDIDFASIHLYPDTWLQKQHATVNEKLQFVKRWVSSHIEDGDKELNKPVLTTEFGLS  368

Query  1709  GETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERA  1888
                +  +P  RD F+K I +I+Y SA    +GA ++ WQ   E MEE++D++ +VP E  
Sbjct  369   HRAQGFDPSHRDVFYKAIYDIVYASASRGGAGAAALVWQLAPEGMEEFHDDYSVVPSEHP  428

Query  1889  STYNLITNHSCRLAGVHGVLPSQQEHLKSFCS  1984
             S   LI   SCRLA +   +  + + + + C+
Sbjct  429   SLRRLIKKQSCRLAKLRPGVGEEAKRVLAACA  460



>gb|EAZ13519.1| hypothetical protein OsJ_03436 [Oryza sativa Japonica Group]
Length=422

 Score =   476 bits (1224),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 229/414 (55%), Positives = 295/414 (71%), Gaps = 15/414 (4%)
 Frame = +2

Query  695   MLARNGM-FYPIIGFAAFLAFIYLTFG--DLWVSYPE----------ETLKLSFVERNGT  835
             M   NG+  Y I+G A+ +A +Y + G  DL  + P               L FVER G 
Sbjct  1     MAVGNGLILYHILGLASCIALVYFSLGEVDLRDALPSLPFSGGASRAAAASLPFVERRGK  60

Query  836   QFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNAL  1015
             + + DG+ FY+NGWNSYW M+ AV+   RPRV +M + A  MG+TVCRTWAFNDG+YNAL
Sbjct  61    RLFLDGRPFYINGWNSYWLMDLAVEPNTRPRVSSMFRTAVSMGLTVCRTWAFNDGSYNAL  120

Query  1016  QISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPS  1195
             Q+SPG FDERVF+ALD V+AE+  HG+RLIL L NNL AYGGK QYV+WAW+EG+GL+ S
Sbjct  121   QLSPGHFDERVFKALDRVVAEASEHGVRLILSLANNLDAYGGKRQYVRWAWEEGVGLTAS  180

Query  1196  NDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQ  1375
             NDSFF+DP IR YFK Y+KT+L RKN +TGLEYRDDPTI AWEL+NEPRC +DP+GDTLQ
Sbjct  181   NDSFFFDPAIRDYFKVYLKTLLMRKNHLTGLEYRDDPTILAWELMNEPRCTSDPSGDTLQ  240

Query  1376  DWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPK-RLKINPELW-AADLGSDFIRNSNLST  1549
              W+EEMS +VKSIDK HLLTVG EGFYGP   + +L INP  W   + G+DFIRNS +  
Sbjct  241   RWMEEMSAYVKSIDKKHLLTVGTEGFYGPTSSQEKLNINPGEWFPNNYGADFIRNSKIQD  300

Query  1550  IDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVE  1729
             IDFASVHVYPD+W ++ +  +KLKF  +WI +H+EDG+  L+KP++ TEFGL+ + +  E
Sbjct  301   IDFASVHVYPDNWLQHASLDEKLKFMTRWITAHVEDGDGELEKPVLVTEFGLSHQVEGFE  360

Query  1730  PYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
                RD  ++ + +I++ SA+   +  G++ WQ   E MEEY D   IVP +R S
Sbjct  361   DAHRDVLYRAVYDIVHGSARRGGAAGGALVWQLAAEGMEEYQDGLSIVPGKRPS  414



>ref|XP_010490281.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2 [Camelina sativa]
Length=330

 Score =   458 bits (1179),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 256/312 (82%), Gaps = 0/312 (0%)
 Frame = +2

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             +ALD VIAE++ HG+RL+L LVNNL+AYGGKTQYV WAWQEG+GLS SNDSFF+DP+IRR
Sbjct  17    KALDHVIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRR  76

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             YFKNY+  +LTRKN++TG+EYR+DPTIFAWELINEPRCM+D +GDTLQDWI EM+ F+KS
Sbjct  77    YFKNYLTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDVSGDTLQDWINEMTAFIKS  136

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             +D  HLLTVGLEGFYGP  PKRL +NPE WA++LGSDF+RNS+   IDFASVH+YPDHWF
Sbjct  137   VDNKHLLTVGLEGFYGPNSPKRLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWF  196

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              ++ F++KLKF  KW+LSHIEDG++ LKKP++FTEFGL+   K+ +P QRDRF++ I +I
Sbjct  197   HDKGFEEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDI  256

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLP  1951
             +YKSAK  +SGAG++ WQFL++ ME +ND+FGIVPWE+ S   L+  HSCRL  V G   
Sbjct  257   IYKSAKRRRSGAGTLMWQFLIQGMERFNDDFGIVPWEQGSIQRLMMEHSCRLGRVTGRHL  316

Query  1952  SQQEHLKSFCSK  1987
              Q       CS+
Sbjct  317   LQDNKSIDMCSQ  328



>ref|XP_010252627.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Nelumbo nucifera]
Length=443

 Score =   453 bits (1165),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 215/418 (51%), Positives = 282/418 (67%), Gaps = 8/418 (2%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEE-TLKLSFVERNGTQFYADGQ-----VFY  865
             R    YP +G  +  A +Y+ FGD  V++P     ++SFV  N T+F    Q       Y
Sbjct  6     RERGLYPFLGLLSIAALLYMNFGDR-VTFPVLWQPRMSFVGTNSTRFVVIDQNGEQSTLY  64

Query  866   VNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDE  1042
             VNGWNSYW ME +V    R RV  ML+  A+MGMTVCRTWAFNDG  +N+LQISPG F+E
Sbjct  65    VNGWNSYWLMEESVWSNSRHRVSKMLKRGAEMGMTVCRTWAFNDGDGHNSLQISPGNFNE  124

Query  1043  RVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPN  1222
             +VFR LD  I E+R+H IRLIL LVNNL A+GGK QYVKWA + G  +S S DSFF  P 
Sbjct  125   KVFRGLDFAIVEARKHRIRLILSLVNNLNAFGGKAQYVKWAKEAGFNVSSSTDSFFSHPT  184

Query  1223  IRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTF  1402
             I+ Y+K+YVK ++TRKN+++G+ Y ++P IFAWELINEPRC +  +   LQ WI +M+ F
Sbjct  185   IKGYYKDYVKAIVTRKNSLSGVRYSEEPAIFAWELINEPRCTSSSSAPVLQSWIIDMAAF  244

Query  1403  VKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPD  1582
             +KS+D+ HLLTVGLEGFYGP+  +R   NP  WA+  GSDFI+NS +  IDFASVH YPD
Sbjct  245   IKSLDQKHLLTVGLEGFYGPETTERSGANPGDWASSFGSDFIQNSAIENIDFASVHAYPD  304

Query  1583  HWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLI  1762
              W  +   ++K  +  KW+  H+ D E  LKKP++FTE G +   KE   Y RD   K++
Sbjct  305   SWIPDADLKEKANYLSKWVDYHVNDSEYVLKKPVLFTEVGSSLHAKEQGTYDRDFLLKIV  364

Query  1763  LEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
              + +Y+SAK  ++GAG++ WQ LVE+ME+Y D+F +V WE  STY LI   SCRL  +
Sbjct  365   YDKIYESAKRRQAGAGALIWQLLVEKMEDYGDQFSLVAWEHPSTYKLILEQSCRLRSI  422



>emb|CBI33116.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   446 bits (1147),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/415 (52%), Positives = 282/415 (68%), Gaps = 9/415 (2%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGDLWVSYPEETL-KLSFVERNGTQFY---ADGQ---VFYVNG  874
              YP++G  + L F+Y  F D + ++P   L  + FV  N T+F     DG      Y+NG
Sbjct  10    LYPLLGTLSILLFLYFNFSD-YFNFPVLWLPAIGFVGTNSTKFVIVEPDGSHQSTLYING  68

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDERVF  1051
             WNSYW ME +V    R RV  ML+  A+MGM+VCRTWAFNDG   N+LQISPG F+ERVF
Sbjct  69    WNSYWLMEESVWAPSRSRVSNMLRRGAEMGMSVCRTWAFNDGDGPNSLQISPGVFNERVF  128

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             + LD VI E+RRH +RLIL LVNNL AYGGK QYV+WA + GI +S S DSFF  P I+ 
Sbjct  129   QGLDYVIVEARRHQVRLILSLVNNLNAYGGKAQYVRWAQEAGINVSSSTDSFFSHPTIKD  188

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             Y+K Y+K V+TRKN+++G++Y ++P IFAWEL+NEPRC +  +   LQ WI EM+ ++KS
Sbjct  189   YYKAYIKAVVTRKNSLSGVKYSEEPAIFAWELMNEPRCASSSSAPILQAWITEMAAYIKS  248

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             +D+ HL+TVGLEGFYG K  +R  +NP  WA+ LGSDFI+NS +  IDFASVH YPD W 
Sbjct  249   LDQKHLVTVGLEGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWL  308

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              +   ++K  F   W+ SHI DGE  LKKP++FTE G     K+   Y  D F K + + 
Sbjct  309   PDADLEEKANFLSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDK  368

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
             +Y+SAK  ++GAG++ WQ LVE MEEY+D+F IV W+  ST+ LI   SCRL  V
Sbjct  369   IYESAKKRQAGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRLRSV  423



>ref|XP_003635019.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Vitis vinifera]
Length=449

 Score =   446 bits (1146),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/415 (52%), Positives = 282/415 (68%), Gaps = 9/415 (2%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGDLWVSYPEETL-KLSFVERNGTQFY---ADGQ---VFYVNG  874
              YP++G  + L F+Y  F D + ++P   L  + FV  N T+F     DG      Y+NG
Sbjct  10    LYPLLGTLSILLFLYFNFSD-YFNFPVLWLPAIGFVGTNSTKFVIVEPDGSHQSTLYING  68

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDERVF  1051
             WNSYW ME +V    R RV  ML+  A+MGM+VCRTWAFNDG   N+LQISPG F+ERVF
Sbjct  69    WNSYWLMEESVWAPSRSRVSNMLRRGAEMGMSVCRTWAFNDGDGPNSLQISPGVFNERVF  128

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             + LD VI E+RRH +RLIL LVNNL AYGGK QYV+WA + GI +S S DSFF  P I+ 
Sbjct  129   QGLDYVIVEARRHQVRLILSLVNNLNAYGGKAQYVRWAQEAGINVSSSTDSFFSHPTIKD  188

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             Y+K Y+K V+TRKN+++G++Y ++P IFAWEL+NEPRC +  +   LQ WI EM+ ++KS
Sbjct  189   YYKAYIKAVVTRKNSLSGVKYSEEPAIFAWELMNEPRCASSSSAPILQAWITEMAAYIKS  248

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             +D+ HL+TVGLEGFYG K  +R  +NP  WA+ LGSDFI+NS +  IDFASVH YPD W 
Sbjct  249   LDQKHLVTVGLEGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWL  308

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              +   ++K  F   W+ SHI DGE  LKKP++FTE G     K+   Y  D F K + + 
Sbjct  309   PDADLEEKANFLSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDK  368

Query  1772  MYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
             +Y+SAK  ++GAG++ WQ LVE MEEY+D+F IV W+  ST+ LI   SCRL  V
Sbjct  369   IYESAKKRQAGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRLRSV  423



>ref|XP_006839096.1| hypothetical protein AMTR_s00090p00128510 [Amborella trichopoda]
 gb|ERN01665.1| hypothetical protein AMTR_s00090p00128510 [Amborella trichopoda]
Length=431

 Score =   442 bits (1137),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 209/411 (51%), Positives = 284/411 (69%), Gaps = 13/411 (3%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGDLWVSY------PEETLKLSFVERNGTQFYADGQVFYVNGW  877
              + ++G  +  A IYL FG  +  Y      P    K+SFVE N T F  DG+  YVNGW
Sbjct  7     LHSLLGALSIGALIYLNFGGDFSQYFPFLWQP----KMSFVEVNNTHFSVDGRALYVNGW  62

Query  878   NSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRA  1057
             NSYW ME ++    RP+VR + + AA MGMTVCRTWAFNDG  +ALQISP  FDE+VF A
Sbjct  63    NSYWLMEQSIWPSSRPKVRKIFRRAADMGMTVCRTWAFNDGGTHALQISPRNFDEKVFEA  122

Query  1058  LDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYF  1237
             LD VI E+R++ IRLIL LVNNL A+GGK QYVKWA ++G+ ++ S+DSFF D  I+ YF
Sbjct  123   LDFVIVEARKYKIRLILSLVNNLNAFGGKRQYVKWAQEDGVNVTFSDDSFFSDLTIKGYF  182

Query  1238  KNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSID  1417
             K+Y+KT+LTRKN+ +G+ Y ++P IFAWELINEPRC+++ +   LQ WI EM+  +K +D
Sbjct  183   KDYIKTILTRKNSFSGVRYSEEPAIFAWELINEPRCVSNSSAPLLQAWINEMAAHIKFLD  242

Query  1418  KNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKN  1597
               HL+TVGLEGFYGP  P++  +NP  WAA LGSDFI++S    IDFASVH YPD W  N
Sbjct  243   HKHLVTVGLEGFYGPTTPEKSNVNPGSWAASLGSDFIQDSKSEYIDFASVHSYPDSWIPN  302

Query  1598  QTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFG-LAGETKEVEPYQRDRFFKLILEIM  1774
                ++K+K+  KW+ SHI DGE  LKKP++FTE G L G     +P+      +++ + +
Sbjct  303   ARLEEKVKYLSKWVDSHINDGENVLKKPVLFTEVGSLRGNMH--DPHGGGVLLEIVYDKI  360

Query  1775  YKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRL  1927
             ++SA+  ++GAG++ WQ  V+ +++Y DEF +V W++ S Y L+   SCRL
Sbjct  361   FESARKKQAGAGALVWQLTVQGLDKYGDEFSLVAWDQPSIYKLMLEQSCRL  411



>emb|CAN77937.1| hypothetical protein VITISV_033630 [Vitis vinifera]
Length=451

 Score =   440 bits (1131),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 216/417 (52%), Positives = 281/417 (67%), Gaps = 11/417 (3%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGDLWVSYPEETL-KLSFVERNGTQFY---ADGQ---VFYVNG  874
              YP++G  + L F+Y  F D + ++P   L  + FV  N T+F     DG      Y+NG
Sbjct  10    LYPLLGTLSILLFLYFNFSD-YFNFPVLWLPAIGFVGTNSTKFVIVEPDGSHQSTLYING  68

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDERVF  1051
             WNSYW ME +V    R RV  ML+  A+MGM+VCRTWAFNDG   N+LQISPG F+ERVF
Sbjct  69    WNSYWLMEESVWXPSRSRVSNMLRRGAEMGMSVCRTWAFNDGDGPNSLQISPGVFNERVF  128

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             + LD VI E+RRH +RLIL LVNNL AYGGK QYV+WA + GI +S S DSFF  P I+ 
Sbjct  129   QGLDYVIXEARRHQVRLILSLVNNLNAYGGKAQYVRWAQEAGINVSSSTDSFFSHPTIKD  188

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             Y+K Y+K V+TRKN+++G++Y ++P IF WEL+NEPRC +  +   LQ WI EM+ F+KS
Sbjct  189   YYKAYIKAVVTRKNSLSGVKYSEEPAIFGWELMNEPRCASSSSAPILQAWITEMAAFIKS  248

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             +D+ HL+TVGLEGFYG K  +R  +NP  WA+ LGSDFI+NS +  IDFASVH YPD W 
Sbjct  249   LDQKHLVTVGLEGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWL  308

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              +   ++K  F   W+ SHI DGE  LKKP++FTE G     K+   Y  D F K + + 
Sbjct  309   PDADLEEKANFLSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDK  368

Query  1772  MYKSAKHNK--SGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
             +Y+SAK  +  +GAG++ WQ LVE MEEY+D+F IV W+  ST+ LI   SCRL  V
Sbjct  369   IYESAKKRQAGAGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRLRSV  425



>ref|XP_010646197.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Vitis vinifera]
 emb|CBI33121.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   438 bits (1127),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 216/417 (52%), Positives = 281/417 (67%), Gaps = 11/417 (3%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGDLWVSYPEETL-KLSFVERNGTQFY---ADGQ---VFYVNG  874
              YP++G  + L F+Y  F D + ++P   L  + FV  N T+F     DG      Y+NG
Sbjct  10    LYPLLGTLSILLFLYFNFSD-YFNFPVLWLPAIGFVGTNSTKFVIVEPDGSHQSTLYING  68

Query  875   WNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDERVF  1051
             WNSYW ME +V    R RV  ML+  A+MGM+VCRTWAFNDG   N+LQISPG F+ERVF
Sbjct  69    WNSYWLMEESVWGPSRSRVSNMLRRGAEMGMSVCRTWAFNDGDGPNSLQISPGVFNERVF  128

Query  1052  RALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRR  1231
             + LD VI E+RRH +RLIL LVNNL AYGGK QYV+WA + GI +S S DSFF  P I+ 
Sbjct  129   QGLDYVIFEARRHQVRLILSLVNNLNAYGGKAQYVRWAQEAGINVSSSTDSFFSHPTIKD  188

Query  1232  YFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKS  1411
             Y+K Y+K V+TRKN+++G++Y ++P IF WEL+NEPRC +  +   LQ WI EM+ F+KS
Sbjct  189   YYKAYIKAVVTRKNSLSGVKYSEEPAIFGWELMNEPRCASSSSAPILQAWITEMAAFIKS  248

Query  1412  IDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF  1591
             +D+ HL+TVGLEGFYG K  +R  +NP  WA+ LGSDFI+NS +  IDFASVH YPD W 
Sbjct  249   LDQKHLVTVGLEGFYGLKTTERSGVNPGDWASKLGSDFIQNSAIDDIDFASVHAYPDSWL  308

Query  1592  KNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEI  1771
              +   ++K  F   W+ SHI DGE  LKKP++FTE G     K+   Y  D F K + + 
Sbjct  309   PDADLEEKANFLSHWVDSHISDGEYVLKKPVLFTEVGSIMHRKKQGLYDTDTFLKTVYDK  368

Query  1772  MYKSAKHNK--SGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
             +Y+SAK  +  +GAG++ WQ LVE MEEY+D+F IV W+  ST+ LI   SCRL  V
Sbjct  369   IYESAKKRQAGAGAGALIWQLLVEGMEEYSDQFSIVAWDYPSTHELIIEQSCRLRSV  425



>ref|XP_008775162.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Phoenix dactylifera]
Length=314

 Score =   426 bits (1095),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 240/312 (77%), Gaps = 1/312 (0%)
 Frame = +2

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
              +ALD VI E+RRHGIRL+L L NNL+AYGGKTQYVKWAW+EGIGLS SNDSFFYDP+IR
Sbjct  1     MQALDRVIGEARRHGIRLLLSLANNLEAYGGKTQYVKWAWEEGIGLSSSNDSFFYDPSIR  60

Query  1229  RYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVK  1408
              YFK Y+KT+LTRKN + G++Y+DDPTIFAWEL+NEPRCM+D TGDTLQDWIEEM+ +VK
Sbjct  61    SYFKTYLKTILTRKNHLNGIQYKDDPTIFAWELMNEPRCMSDATGDTLQDWIEEMAAYVK  120

Query  1409  SIDKNHLLTVGLEGFYGPK-DPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDH  1585
             +ID+ HLLTVGLEGFYGP   P++L +NP  W   LGSDFIRN  +  IDFASVH+YPDH
Sbjct  121   AIDRKHLLTVGLEGFYGPTCPPEKLSVNPGPWFRTLGSDFIRNCKILDIDFASVHIYPDH  180

Query  1586  WFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLIL  1765
             W       +K+K+  KW++SHIEDG+  LKKP++FTEFGL+   K      RD F+K I 
Sbjct  181   WLVQAGLDEKMKYISKWVVSHIEDGDSVLKKPVLFTEFGLSNRNKNFNHSHRDVFYKNIF  240

Query  1766  EIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGV  1945
             +I+++SA  N +GAG+  WQF+VE M+E ND+FGIVPWER STY LI   SCRLA +H  
Sbjct  241   DIIHESATKNGAGAGAFVWQFMVEGMQENNDDFGIVPWERPSTYQLIKEQSCRLASLHYA  300

Query  1946  LPSQQEHLKSFC  1981
                 ++  +  C
Sbjct  301   KDLAKKSFRKIC  312



>ref|XP_002985744.1| hypothetical protein SELMODRAFT_234864 [Selaginella moellendorffii]
 gb|EFJ13322.1| hypothetical protein SELMODRAFT_234864 [Selaginella moellendorffii]
Length=398

 Score =   423 bits (1087),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 196/373 (53%), Positives = 261/373 (70%), Gaps = 3/373 (1%)
 Frame = +2

Query  809   LSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWA  988
             + FV R+GTQF+ DG+ FY+NGWNSYW M  AV++  R  VR++L   A MG+ + RTWA
Sbjct  1     MGFVRRDGTQFFVDGRPFYINGWNSYWMMSEAVEWLSRSNVRSILDDGAGMGLNLVRTWA  60

Query  989   FNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAW  1168
             FND  Y+ALQ SPG +DE VF+ALD VI E+RR  IRL+L L NNL+A+GGK QYV WA 
Sbjct  61    FNDAGYHALQRSPGHYDEDVFKALDYVIVEARRRNIRLLLSLTNNLEAFGGKGQYVYWAR  120

Query  1169  QEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCM  1348
             Q    +  SND+FF DP I+ Y+K++VK +LTR N++TG+ Y+D+P IFAWEL+NEPRC+
Sbjct  121   QASADVGYSNDTFFSDPTIKDYYKSHVKKILTRVNSITGVAYKDEPAIFAWELMNEPRCI  180

Query  1349  TDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFI  1528
              DP+G+TLQ WIEEMS +VKS+D  HLLTVGLEGFY    P  L  NP  WA  LGSDFI
Sbjct  181   IDPSGNTLQTWIEEMSVYVKSLDSKHLLTVGLEGFYNSWSPDSLVANPGHWADFLGSDFI  240

Query  1529  RNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLA  1708
             RN  LSTIDFAS+H YPD W    +F+++LK   KW+ +H++DG   L+KP++ TEFGL 
Sbjct  241   RNHLLSTIDFASIHAYPDIWMPEVSFEEQLKGFSKWVDTHVQDGALRLQKPVLVTEFGLK  300

Query  1709  GETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERA  1888
              ++       R    K + +  + SA++ ++ AG++ WQ L E ++EY D++ IVP +  
Sbjct  301   TKSS---TRHRLELLKAMYDAAFDSARNGEACAGAMLWQLLEEGLDEYGDDYAIVPRDEP  357

Query  1889  STYNLITNHSCRL  1927
                 L+  HSCRL
Sbjct  358   QVTELVGAHSCRL  370



>ref|XP_009401505.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   424 bits (1090),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 204/380 (54%), Positives = 262/380 (69%), Gaps = 6/380 (2%)
 Frame = +2

Query  806   KLSFVERNGTQF--YADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCR  979
             K+ FV RNGT+F    DG   YVNGWNSYW M          RV  ML+    MGM+VCR
Sbjct  45    KMGFVGRNGTRFIDLEDGSPAYVNGWNSYWLMSS----DSSDRVVEMLRRGRAMGMSVCR  100

Query  980   TWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVK  1159
             TWAF+DG  NALQI PG FDER+F+ALD VI ++R+H IRLILCLVNNL A+GGK+QYV+
Sbjct  101   TWAFSDGGPNALQIYPGHFDERIFQALDFVIYQARKHYIRLILCLVNNLGAFGGKSQYVR  160

Query  1160  WAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEP  1339
             WA   GI +S S D FF  P I+ Y+K+YVK +++RKNT +G+ YRD+P IFAWELINEP
Sbjct  161   WAQASGINVSTSTDPFFSHPTIKGYYKDYVKAIISRKNTYSGIRYRDEPAIFAWELINEP  220

Query  1340  RCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGS  1519
             RC  + +G  LQ WI EM+++VKS+D+ HL+TVGLEGFYGP    RL  NP  WAA LGS
Sbjct  221   RCEYNSSGPLLQAWIAEMASYVKSLDEKHLVTVGLEGFYGPARNDRLGANPGSWAASLGS  280

Query  1520  DFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEF  1699
             DFI+NS +  IDFASVH YPD W    + ++K+++   W+ SH+ D E  LKKP++F+E 
Sbjct  281   DFIQNSAIENIDFASVHAYPDSWIPKASLEEKVEYLSSWVDSHVNDSEHVLKKPVLFSEV  340

Query  1700  GLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPW  1879
             G     K+   Y RD   K++ + +Y+SAK  ++ AG++ WQ +VE M+ Y DEF +V  
Sbjct  341   GSHLRVKKNGTYDRDILLKIVYDKVYESAKKGQAAAGALIWQLMVEGMQSYQDEFSLVAS  400

Query  1880  ERASTYNLITNHSCRLAGVH  1939
             E  STY LI   SCRL  +H
Sbjct  401   EHPSTYKLIAQQSCRLRNLH  420



>gb|KHG13584.1| Mannan endo-1,4-beta-mannosidase 6 [Gossypium arboreum]
Length=468

 Score =   422 bits (1085),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 210/419 (50%), Positives = 271/419 (65%), Gaps = 17/419 (4%)
 Frame = +2

Query  761   LTFGDLWVSYPEETLKLSFVERNGTQF--------YADGQVFYVNGWNSYWFMEHAVDFG  916
             +TF  LW S+      + FV  N T F          +   FY+NGWNSYW M+ +V  G
Sbjct  52    ITFPILWQSH------MDFVSANSTHFIIVNPRAPLENQSTFYINGWNSYWLMQESVWAG  105

Query  917   -RRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDERVFRALDLVIAESRRH  1090
               R RV  ML+  A+MG+TVCRTWAFNDG   NALQISPG F+ERVFR LD VI E+R+H
Sbjct  106   PSRSRVSKMLKKGAEMGLTVCRTWAFNDGVGPNALQISPGVFNERVFRGLDYVIVEARKH  165

Query  1091  GIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRK  1270
             GIRLIL LVNNL  +GGK QYV+WA + G  +S S DSFF  P I+ Y+K YVK +L+RK
Sbjct  166   GIRLILSLVNNLSNFGGKAQYVRWAQEAGHNVSSSTDSFFSHPMIKDYYKAYVKAILSRK  225

Query  1271  NTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEG  1450
             N+++G++Y ++P IFAWEL+NEPRC +  +   LQ W++EM+ FVKS+D+ HL+TVGLEG
Sbjct  226   NSLSGVKYAEEPAIFAWELMNEPRCSSSSSAPILQAWLDEMAAFVKSLDQKHLVTVGLEG  285

Query  1451  FYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWF-KNQTFQDKLKFT  1627
             FYG    K L++NP  WAA LGSDFI+NS +  IDFASVH YPD W   +   + K +F 
Sbjct  286   FYGLNTTKGLEVNPGEWAASLGSDFIQNSAIENIDFASVHAYPDSWLIPHDDMEAKARFL  345

Query  1628  KKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGA  1807
              +W+ SHI DG+  LKKP++FTE G            +D   K + E +Y+SAK  ++GA
Sbjct  346   SRWVDSHISDGDHVLKKPVIFTEVGTLVHADNQGLADKDILLKTMYEKIYESAKKRQAGA  405

Query  1808  GSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEHLKSFCS  1984
             G++ WQ LVE   EY+D F  V W+  STY LI   SCRL  +       Q+  K  CS
Sbjct  406   GALIWQLLVEGAGEYSDRFSFVAWDNPSTYKLILKQSCRLKSIFAKSIQSQKLNKDPCS  464



>ref|XP_010057854.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Eucalyptus 
grandis]
 gb|KCW75194.1| hypothetical protein EUGRSUZ_E03950 [Eucalyptus grandis]
Length=453

 Score =   421 bits (1081),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 206/424 (49%), Positives = 277/424 (65%), Gaps = 16/424 (4%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETL-KLSFVERNGTQFYADG---------  853
             R+   YPI+G A  L  +YL F +   ++P   L K+ FV  N T+F             
Sbjct  6     RDKALYPILGGATVLLILYLNFEEPSFTFPVLWLPKMGFVGTNSTRFVVVEDGGGGGGGV  65

Query  854   ----QVFYVNGWNSYWFMEHAVDFG-RRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNAL  1015
                    YVNGWNSYW ME +V  G  R RV  M++  A MGMTVCRTWAF+DG   NAL
Sbjct  66    GRAQSAVYVNGWNSYWLMEESVWGGPSRGRVSEMMRRGAGMGMTVCRTWAFSDGDGPNAL  125

Query  1016  QISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPS  1195
             Q SPG FDERVFR LD VI E+RR+ +R+IL LVNNL A+GGK QY++WA + G  +S S
Sbjct  126   QRSPGVFDERVFRGLDYVIVEARRNRVRVILSLVNNLNAFGGKAQYIRWAQEAGENVSSS  185

Query  1196  NDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQ  1375
              DSFF  P I+ Y+K YVK V+TRKN++TG+ Y D+P IFAWEL+NEPR ++  +   LQ
Sbjct  186   ADSFFSHPTIKEYYKAYVKAVVTRKNSMTGVHYFDEPAIFAWELMNEPRGVSGSSAPLLQ  245

Query  1376  DWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTID  1555
              WI EM+ ++KS+D+ HL+T+G+EGFYG +  ++  +NP  WA+ LG+DF+ NS +  ID
Sbjct  246   SWITEMAAYIKSLDQRHLITIGVEGFYGLQRQEKNAVNPGEWASSLGTDFLNNSAIHNID  305

Query  1556  FASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPY  1735
             FASVH YPD W    +  +K+K+  +W+ SHI DG+  LKKP++FTE G +    + E +
Sbjct  306   FASVHAYPDSWIPEASLDEKVKYLSQWVDSHIHDGDEILKKPVLFTEVGSSLHQNQQELH  365

Query  1736  QRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNH  1915
             QRD F K + + +Y+SAK  ++GAG++ WQ LV+  + Y D+F  V W   STY LI   
Sbjct  366   QRDIFLKTVYDKIYESAKKRQAGAGALIWQLLVDDTQGYADQFSFVAWNHLSTYKLIIEQ  425

Query  1916  SCRL  1927
             SCRL
Sbjct  426   SCRL  429



>ref|XP_002974444.1| hypothetical protein SELMODRAFT_101148 [Selaginella moellendorffii]
 gb|EFJ24666.1| hypothetical protein SELMODRAFT_101148 [Selaginella moellendorffii]
Length=398

 Score =   418 bits (1074),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 259/373 (69%), Gaps = 3/373 (1%)
 Frame = +2

Query  809   LSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWA  988
             + FV R+GTQF+ D + FY+NGWNSYW M   V++  R  VR++L   A MG+ + RTWA
Sbjct  1     MGFVRRDGTQFFVDDRPFYINGWNSYWMMSEGVEWLSRSNVRSILDDGAGMGLNLVRTWA  60

Query  989   FNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAW  1168
             FND  Y+ALQ SPG +DE VF+ALD VI E+RR  IRL+L L NNL+A+GGK QYV WA 
Sbjct  61    FNDAGYHALQRSPGHYDEDVFKALDYVIVEARRRNIRLLLSLTNNLEAFGGKGQYVYWAR  120

Query  1169  QEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCM  1348
             Q    +  SND+FF DP I+ Y+K++VK +LTR N++TG+ Y+D+P IFAWEL+NEPRC+
Sbjct  121   QANADVGYSNDTFFSDPTIKDYYKSHVKKILTRVNSITGVAYKDEPAIFAWELMNEPRCI  180

Query  1349  TDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFI  1528
              DP+G+TLQ WIEEMS +VKS+D  HLLTVGLEGFY    P  L  NP  WA  LGSDFI
Sbjct  181   IDPSGNTLQTWIEEMSVYVKSLDSKHLLTVGLEGFYNSWSPDSLVANPGHWADFLGSDFI  240

Query  1529  RNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLA  1708
             RN  LSTIDFAS+H YPD W    +F+++LK   KW+ +H++DG   L+KP++ TEFGL 
Sbjct  241   RNHLLSTIDFASIHAYPDIWMPEVSFEEQLKGFSKWVDTHVQDGALRLQKPVLVTEFGLK  300

Query  1709  GETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERA  1888
              ++       R    K + +  + SA++ ++ AG++ WQ L E ++EY D++ IVP +  
Sbjct  301   TKSS---TRHRLELLKAMYDAAFDSARNGEACAGAMLWQLLEEGLDEYGDDYAIVPRDEP  357

Query  1889  STYNLITNHSCRL  1927
                 L+  HSCRL
Sbjct  358   QVTELVGAHSCRL  370



>ref|XP_008775171.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Phoenix dactylifera]
Length=321

 Score =   413 bits (1061),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 239/319 (75%), Gaps = 8/319 (3%)
 Frame = +2

Query  1049  FRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIR  1228
              +ALD VI ++RRHGIRL+L L NNL+AYGGKTQYVK AW+EGIG S SNDSFFYDP+IR
Sbjct  1     MQALDRVIVQARRHGIRLLLSLANNLEAYGGKTQYVKLAWEEGIGWSSSNDSFFYDPSIR  60

Query  1229  RYFKNYVK-------TVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIE  1387
              YFK Y+K       T+LTRKN + G++Y+DDPTIFAWEL+NEPRCM+D TGDTLQDWIE
Sbjct  61    SYFKTYLKVMYAPCQTILTRKNHLNGIQYKDDPTIFAWELMNEPRCMSDTTGDTLQDWIE  120

Query  1388  EMSTFVKSIDKNHLLTVGLEGFYGPK-DPKRLKINPELWAADLGSDFIRNSNLSTIDFAS  1564
             EM+ +VK+ID+ HLLTVGLEGFYGP   P++L +NP  W   LGSDFIRNS +  IDFAS
Sbjct  121   EMAAYVKAIDRKHLLTVGLEGFYGPTCPPEKLSVNPGPWFRTLGSDFIRNSKILDIDFAS  180

Query  1565  VHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRD  1744
             VH+YPDHW       +K+K+  KW++SHIEDG+  LKKP++FTEFGL+   K      RD
Sbjct  181   VHIYPDHWLVQAGLDEKMKYISKWVVSHIEDGDSVLKKPVLFTEFGLSNRNKNFNHSHRD  240

Query  1745  RFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCR  1924
              F+K I +I+++SA  N +GAG+  WQF+VE M+E ND+FGIVPWER STY LI   SCR
Sbjct  241   VFYKNIFDIIHESATKNGAGAGAFVWQFMVEGMQENNDDFGIVPWERPSTYQLIKEQSCR  300

Query  1925  LAGVHGVLPSQQEHLKSFC  1981
             LA +H      ++  +  C
Sbjct  301   LASLHYAKDLAKKSFRKIC  319



>ref|XP_010090975.1| Mannan endo-1,4-beta-mannosidase 6 [Morus notabilis]
 gb|EXB41560.1| Mannan endo-1,4-beta-mannosidase 6 [Morus notabilis]
Length=440

 Score =   417 bits (1072),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/422 (50%), Positives = 283/422 (67%), Gaps = 20/422 (5%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEE-TLKLSFVERNGTQFYADG------QVF  862
             R  + YP++G  +  A +YL F D  +S+P     K+ FV  N T F   G         
Sbjct  6     RERILYPLVGILSISALLYLNFNDE-LSFPVLWQPKMGFVATNSTHFIVVGDRNDNNSAM  64

Query  863   YVNGWNSYWFMEHAV-DFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKF  1036
             YVNGWNSYW ME ++     R +V   L+  AKMG++VCRTWAF+DG   +ALQ SPG F
Sbjct  65    YVNGWNSYWLMEKSIWGSSSRSKVSKTLKMGAKMGLSVCRTWAFSDGDGPSALQTSPGVF  124

Query  1037  DERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIG-LSPSNDSFFY  1213
             +ERVFRALD VI E+R++ IRLIL LVNNL A+GGKTQYV+WA + GI  +S  +DSFF 
Sbjct  125   NERVFRALDYVIVEARKNRIRLILSLVNNLSAFGGKTQYVRWAEEAGINNVSSFDDSFFS  184

Query  1214  DPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEM  1393
              P I+ Y+K YVK +LTRKN+++ ++Y ++P IFAWEL+NEPRC ++ +   LQ WI EM
Sbjct  185   HPTIKDYYKAYVKAILTRKNSLSRVKYSEEPAIFAWELMNEPRCSSNSSAPVLQAWITEM  244

Query  1394  STFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHV  1573
             + +VKS+DK HL+TVGLEGFYG K  +R  +NP  W A LGSDFI+NS ++ IDFASVH 
Sbjct  245   AAYVKSLDKKHLVTVGLEGFYGLKSTQRSSVNPGEWGALLGSDFIQNSAINNIDFASVHA  304

Query  1574  YPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLA----GETKEVEPYQR  1741
             YPD W ++   + K  F   W+ SH+ D E  LKKP++FTE G +     +T++V     
Sbjct  305   YPDSWIRHGDLEAKANFLSHWVDSHMSDAENVLKKPVLFTEVGFSLRMNKKTEDV-----  359

Query  1742  DRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSC  1921
             +   K + + +Y+SAK  ++GAG++ WQ LVE +EEY+D+F +V  +  ST+ LIT HSC
Sbjct  360   NFLLKTVYDRIYESAKKRQAGAGALIWQLLVEGVEEYSDQFSLVARDHPSTFKLITRHSC  419

Query  1922  RL  1927
             RL
Sbjct  420   RL  421



>ref|XP_009766447.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Nicotiana 
sylvestris]
Length=452

 Score =   417 bits (1072),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/423 (48%), Positives = 274/423 (65%), Gaps = 15/423 (4%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGD-LWVSYPEETL---KLSFVERNGTQFYADG------  853
             R+   YP +G    L+ +Y +F D L  S+P+  L   K+ FV  N TQF          
Sbjct  6     RDKKLYPALGIFTILSLLYFSFSDNLNFSFPQIFLRQPKMGFVGVNKTQFVIKNEDPKTH  65

Query  854   ----QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAY-NALQ  1018
                 Q  Y+NGWNSYW ME +V    R RV  ML+  A+MG+ VCRTWAF+DG   N LQ
Sbjct  66    SLTFQELYINGWNSYWLMEESVWESSRYRVSEMLRRGAEMGLNVCRTWAFSDGGGPNDLQ  125

Query  1019  ISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSN  1198
             + PG F+ERVF+ LD VI E+R+H IRLIL LVNNL AYGG  QYV+WA + G  +S S 
Sbjct  126   LLPGVFNERVFKGLDYVIVEARKHNIRLILSLVNNLNAYGGTAQYVRWAQEAGTNVSSSG  185

Query  1199  DSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQD  1378
             D+FF +P ++ Y+K++VK V+TRKN+++G++Y ++P IFAWELINEPRC +  +   LQ 
Sbjct  186   DAFFTNPTVKAYYKSFVKAVVTRKNSISGVKYSEEPAIFAWELINEPRCESSSSAAALQA  245

Query  1379  WIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDF  1558
             WI EM+ FVK++D+ HL+T+GLEGFYG +      +NP  WAA LG DFI NS +  IDF
Sbjct  246   WIVEMAGFVKNLDQKHLVTIGLEGFYGVEKTGSFGVNPGKWAASLGVDFIENSAIDNIDF  305

Query  1559  ASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQ  1738
              SVH YP  W +      K++F   W+ SHI + E+ LKKP++FTE G    T++   + 
Sbjct  306   TSVHAYPHSWIQGINSDAKVEFLSHWVDSHISEAEKILKKPVLFTEVGFPSSTQKEGLHD  365

Query  1739  RDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHS  1918
             R+ + K++ + +Y+SAK  K+GAG++ WQ LVE ME Y D+F  + W+  STY LI   S
Sbjct  366   RNIYLKIVYDKIYESAKKRKAGAGALVWQLLVEGMERYGDKFSFIAWKHPSTYKLIVQQS  425

Query  1919  CRL  1927
             CRL
Sbjct  426   CRL  428



>ref|XP_007026255.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY28877.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=448

 Score =   411 bits (1056),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 208/412 (50%), Positives = 274/412 (67%), Gaps = 11/412 (3%)
 Frame = +2

Query  782   VSYP-EETLKLSFVERNGTQFY-------ADGQ-VFYVNGWNSYWFMEHAVDFG-RRPRV  931
             +S+P     +L FV  N T F        A+ Q   YVNGWNSYW M+ +V  G  R RV
Sbjct  33    ISFPISRQPRLDFVSANSTHFIVVNGGGAAENQSAAYVNGWNSYWLMQESVWGGPSRSRV  92

Query  932   RTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDERVFRALDLVIAESRRHGIRLIL  1108
               MLQ  A+MG+TVCRTWAF+DG   NALQISPG F+ERVFR LD VI E+R+HGIRL+L
Sbjct  93    SKMLQRGAQMGLTVCRTWAFSDGNGPNALQISPGVFNERVFRGLDYVIVEARKHGIRLVL  152

Query  1109  CLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGL  1288
              LVNNL  +GGK QYV+WA + GI +S S+DSFF  P I+ Y+K YVK +L+RKN+++G+
Sbjct  153   SLVNNLNNFGGKAQYVRWAQEAGINVSSSSDSFFSHPMIKDYYKAYVKAILSRKNSLSGV  212

Query  1289  EYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKD  1468
             +Y D+P IFAWEL+NEPRC +  +   LQ WI EM+ FVKS+D+ HL+TVGLEGFYG   
Sbjct  213   KYSDEPAIFAWELMNEPRCESSSSAPILQAWITEMAAFVKSLDQKHLVTVGLEGFYGLNT  272

Query  1469  PKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSH  1648
              K  ++NP  WAA LGSDF++NS +  IDFASVH YPD W  +   ++K ++  +W+ SH
Sbjct  273   TKGPEVNPGEWAASLGSDFVQNSAIENIDFASVHAYPDSWIPHADLEEKTRYLSQWVDSH  332

Query  1649  IEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQF  1828
             I DG++ LKKPI+FTE G            +D   K + + +Y+SAK  ++GAG++ WQ 
Sbjct  333   ISDGDQVLKKPILFTEVGSLVYVNNQSIADKDILLKTMYDKIYESAKKRQAGAGALIWQL  392

Query  1829  LVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEHLKSFCS  1984
             LVE +EEY D F  + W++ STY LI   SCRL  +       ++  K  CS
Sbjct  393   LVEGVEEYGDRFSFIAWDKPSTYKLILRQSCRLQSIFPKSSQNRKLSKDPCS  444



>gb|KDP37779.1| hypothetical protein JCGZ_06458 [Jatropha curcas]
Length=436

 Score =   410 bits (1054),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 203/414 (49%), Positives = 269/414 (65%), Gaps = 10/414 (2%)
 Frame = +2

Query  716   FYPIIGFAAFLAFIYLTFGD-LWVSYPEETLKLSFVERNGTQFY--------ADGQVFYV  868
              YP++G    ++ +YL F + L  S      K+ FV  N TQF          D    Y+
Sbjct  9     LYPLLGIFLLVSLLYLNFSNNLTFSVLLWQPKMGFVSTNSTQFIIINGGPGDQDLSTLYI  68

Query  869   NGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGKFDER  1045
             NGWNSYW M+ +V    R +V  ML+  A++G+TVCRTWAF+DG   +ALQ+SPG F+ER
Sbjct  69    NGWNSYWLMQESVWTPSRSKVSKMLKKGAELGLTVCRTWAFSDGNGSSALQVSPGVFNER  128

Query  1046  VFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNI  1225
             VF+ LD VI E+R+H IRLIL LVNNL A+GGK QYVKWA + G  +S S+DSFF +P I
Sbjct  129   VFQGLDYVIVEARKHHIRLILSLVNNLNAFGGKAQYVKWAQEAGTNVSSSDDSFFSNPTI  188

Query  1226  RRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFV  1405
             + Y+K Y+K ++TRKN+++G+ Y D+P IFAWEL+NEPRC +  +   LQ WI EM+ F+
Sbjct  189   KDYYKTYIKAIMTRKNSISGVSYSDEPAIFAWELMNEPRCASSSSAPVLQAWITEMAAFI  248

Query  1406  KSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDH  1585
             KS+D+ HL+TVG+EGFYG     + ++NP  WAA LGSDFI+NS +  IDFASVH YPD 
Sbjct  249   KSLDRRHLVTVGIEGFYGLNTTNKSEVNPGEWAASLGSDFIQNSAIDNIDFASVHAYPDS  308

Query  1586  WFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLIL  1765
             W  +   + K  +   W+ SHI DGE  L+KP++FTE G          Y  D   K++ 
Sbjct  309   WIPHADSEAKANYLSLWVDSHISDGEFVLRKPVLFTEVGSTRHVNNKGLYDLDVLLKIVY  368

Query  1766  EIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRL  1927
               +Y SAK  +SGAG++ WQ LVE +EEY+D F  VPW   STY LI   S RL
Sbjct  369   NKIYDSAKKGQSGAGALIWQLLVEGVEEYSDRFSFVPWNYPSTYKLIEAQSYRL  422



>ref|XP_011008632.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Populus euphratica]
Length=440

 Score =   409 bits (1052),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 261/382 (68%), Gaps = 8/382 (2%)
 Frame = +2

Query  806   KLSFVERNGTQFY-----ADGQV--FYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMG  964
             K+ FV  N TQF        G V  FYVNGWNSYW M  +V    R +V  ML+  A+MG
Sbjct  45    KMGFVSTNSTQFIIIDDRGGGGVSAFYVNGWNSYWLMMKSVWSPSRSKVSEMLKTGAQMG  104

Query  965   MTVCRTWAFNDG-AYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGG  1141
             +TVCRTWAF+DG   +ALQ+SPG F+ERVFR LD VI E+RR+ IRLIL LVNNL A+GG
Sbjct  105   LTVCRTWAFSDGRGPDALQVSPGLFNERVFRGLDYVIVEARRNHIRLILSLVNNLAAFGG  164

Query  1142  KTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAW  1321
             K QYVKWA + G+ +S S+DSFF +P I+ Y+K Y+K V+ RKN+++G+ Y ++P IFAW
Sbjct  165   KNQYVKWAKEAGVNVSLSDDSFFSNPVIKDYYKAYIKAVVKRKNSLSGVRYSEEPAIFAW  224

Query  1322  ELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELW  1501
             ELINEPRC +  +   LQ WI EM+ ++KS+D  HL+TVGLEGFYG     + ++NP +W
Sbjct  225   ELINEPRCASSSSAPVLQAWIAEMAAYIKSLDIRHLVTVGLEGFYGLNTTNKSEVNPGIW  284

Query  1502  AADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKP  1681
             AA LG+DFI NS +  IDFASVH YPD W  +   + K  +   W+ SHI DGE  L+KP
Sbjct  285   AASLGTDFILNSAIDKIDFASVHAYPDSWIPHTDLEAKTNYLSNWVDSHISDGEFVLRKP  344

Query  1682  IMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDE  1861
             ++FTE G   +      ++RD   K++ + +Y+SAK  ++GAG++ WQ LVE ++ Y+D+
Sbjct  345   VLFTEVGSRWDEDGKGVHERDVLLKVVYDKIYESAKKRQAGAGALIWQLLVEDVDRYSDQ  404

Query  1862  FGIVPWERASTYNLITNHSCRL  1927
             F  +P +  STY LI   SCRL
Sbjct  405   FSFIPQDSPSTYKLIEEQSCRL  426



>ref|XP_002307872.2| hypothetical protein POPTR_0006s01100g [Populus trichocarpa]
 gb|EEE91395.2| hypothetical protein POPTR_0006s01100g [Populus trichocarpa]
Length=439

 Score =   407 bits (1045),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 262/382 (69%), Gaps = 9/382 (2%)
 Frame = +2

Query  806   KLSFVERNGTQFYA--DG-----QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMG  964
             K+ FV  N TQF    DG       FYVNGWNSYW M  +V    R +V  ML+  A+MG
Sbjct  45    KMGFVSTNSTQFIIIDDGGGGRVSAFYVNGWNSYWLMMKSVWSPSRSKVSEMLKRGAQMG  104

Query  965   MTVCRTWAFNDG-AYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGG  1141
             +TVCRTWAF+DG   +ALQ+SPG F+ERVFR LD VI E+RR+ IRLIL LVNNL A+GG
Sbjct  105   LTVCRTWAFSDGRGPDALQVSPGLFNERVFRGLDYVIVEARRNHIRLILSLVNNLAAFGG  164

Query  1142  KTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAW  1321
             K QYVKWA + G+ +S S+DSFF +P I+ Y+K Y+K V+ RKN+++G+ Y ++P IFAW
Sbjct  165   KNQYVKWAKEAGVNVSLSDDSFFSNPVIKDYYKAYIKAVVKRKNSLSGVRYSEEPAIFAW  224

Query  1322  ELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELW  1501
             EL+NEPRC +  +   LQ WI EM+ ++KS+DK HL+TVGLEGFYG     + ++NP +W
Sbjct  225   ELMNEPRCASSSSAPVLQAWIAEMAAYIKSLDKRHLVTVGLEGFYGLNTTNKSEVNPGIW  284

Query  1502  AADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKP  1681
             AA LG+DFI NS +  IDFASVH YPD W  +   + K  +   W+ SHI DG+  L+KP
Sbjct  285   AASLGTDFILNSAIDNIDFASVHAYPDSWIPHADLEAKTNYLSNWVDSHISDGDFVLRKP  344

Query  1682  IMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDE  1861
             + FTE G   +  + + ++RD   K++ + +Y+SAK  ++GAG++ WQ LVE ++ Y+D+
Sbjct  345   VFFTEVGSRWDV-DGKVHERDVLLKIVYDKIYESAKKRQAGAGALIWQLLVEDVDGYSDQ  403

Query  1862  FGIVPWERASTYNLITNHSCRL  1927
             F  VP    STY LI   SCRL
Sbjct  404   FSFVPQYSPSTYKLIEEQSCRL  425



>ref|XP_003563908.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Brachypodium 
distachyon]
Length=473

 Score =   404 bits (1039),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 257/393 (65%), Gaps = 8/393 (2%)
 Frame = +2

Query  770   GDLWVSYPEETLKLSFVERNGTQFY--ADGQVFYVNGWNSYWFMEHAVDFGRRPR-VRTM  940
             G L +  P    +++F  RNGT F   A G   YVNGWNSYW +       R P  V  M
Sbjct  72    GGLKLPVPWLQPRMAFAGRNGTHFVDAATGSPLYVNGWNSYWLLS-----SRSPALVAEM  126

Query  941   LQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVN  1120
             L+   +MG+ VCRTWAF+DG  +ALQISPG+F E VF+ LD VI E+RR+ IRLILCLVN
Sbjct  127   LRRGRRMGLGVCRTWAFSDGGPDALQISPGRFSEAVFQVLDYVIYEARRNNIRLILCLVN  186

Query  1121  NLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRD  1300
             NL  +GGK QYVKWA   G  L+ S DSFFY P I+ Y+K+YVK +LTRKN+ +G+ Y D
Sbjct  187   NLDNFGGKAQYVKWAQAAGANLTNSTDSFFYHPTIKGYYKDYVKAMLTRKNSYSGITYCD  246

Query  1301  DPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRL  1480
             +P IFAWEL+NEPRC+++ +G  LQ WI EM+ +VKS+D NHL+TVG+EGFYGP   +RL
Sbjct  247   EPAIFAWELMNEPRCVSNSSGPHLQAWIAEMAAYVKSLDNNHLVTVGIEGFYGPGIAERL  306

Query  1481  KINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDG  1660
               NP  WAA L  DF++NS +  IDFASVH YPD W      ++K+++   W+ SH+ D 
Sbjct  307   GFNPGDWAASLCCDFLQNSAVEHIDFASVHAYPDSWLPKARMEEKVRYLSSWVDSHLNDS  366

Query  1661  ERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVER  1840
             E  LKKP++F+E G            RD   +++ + +Y SA+  ++G G++ WQ +V+ 
Sbjct  367   ENILKKPVLFSEVGYLQHANANTTVDRDILLRVVYDKIYDSARKLQAGGGALIWQLMVKG  426

Query  1841  MEEYNDEFGIVPWERASTYNLITNHSCRLAGVH  1939
                Y+D F +V  +  STY LI  HSCRL  +H
Sbjct  427   THMYHDNFSLVARDHPSTYKLIKEHSCRLQMLH  459



>ref|XP_009631226.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Nicotiana 
tomentosiformis]
Length=453

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 207/424 (49%), Positives = 275/424 (65%), Gaps = 16/424 (4%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGD-LWVSYPEETL---KLSFVERNGTQFYADG------  853
             R+   YP +G    L+ +YL F D L  S+P+  L   K+ FV  N TQF          
Sbjct  6     RDKKLYPALGIFTILSLLYLNFNDNLNFSFPQIFLRQPKMGFVGVNKTQFVIKNEDPKTH  65

Query  854   ----QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAY-NALQ  1018
                 Q  Y+NGWNSYW ME +V    R RV  ML+  A+MG++VCRTWAF+DG   N LQ
Sbjct  66    SLTFQELYINGWNSYWLMEESVWESSRYRVSEMLRRGAEMGLSVCRTWAFSDGGGPNDLQ  125

Query  1019  ISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG-IGLSPS  1195
             + PG F+ERVF+ LD VI E+R+H IRLIL LVNNL AYGG  QYV+WA +EG   +S S
Sbjct  126   LLPGVFNERVFKGLDYVIVEARKHNIRLILSLVNNLNAYGGTAQYVRWAREEGGTNVSSS  185

Query  1196  NDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQ  1375
              DSFF +P ++ Y+K++VK V+TRKN+++G++Y ++P IFAWELINEPRC +  +   LQ
Sbjct  186   RDSFFTNPTVKAYYKSFVKAVVTRKNSISGVKYSEEPAIFAWELINEPRCESSSSAAALQ  245

Query  1376  DWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTID  1555
              WI EM+ FVKS+D+ HL+TVGLEGFYG +      +NP  WAA LG DFI NS +  ID
Sbjct  246   AWITEMAGFVKSLDQKHLVTVGLEGFYGVEKTGSFGVNPGKWAASLGVDFIENSAIDNID  305

Query  1556  FASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPY  1735
             F SVH YP  W +      K+ F   W+ SHI + E+ LKKP++FTE G    T++   +
Sbjct  306   FTSVHAYPHSWIQGINSDAKVNFLSHWVDSHISEAEKILKKPVLFTEVGFPSSTQKEGLH  365

Query  1736  QRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNH  1915
              R+ + K++ + +Y+SAK  K+GAG++ WQ LVE ME Y D+F  + W+  STY LI   
Sbjct  366   DRNIYLKIVYDKIYESAKKKKAGAGALVWQLLVEGMERYGDKFSFIAWKHPSTYKLIVEQ  425

Query  1916  SCRL  1927
             SCRL
Sbjct  426   SCRL  429



>gb|EYU27707.1| hypothetical protein MIMGU_mgv1a006272mg [Erythranthe guttata]
Length=450

 Score =   402 bits (1034),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 209/427 (49%), Positives = 272/427 (64%), Gaps = 24/427 (6%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGD-------LWVSYPEETLKLSFVERNGTQFYADGQ--  856
             R    YP++G  A    +Y+ F D       +W + P    ++ FV  N T+F   G+  
Sbjct  6     REKRLYPVLGICAIFFLLYVNFHDEFELPVLVW-NLP----RIGFVGVNHTRFVLIGEDG  60

Query  857   --------VFYVNGWNSYWFMEHAVDFGR-RPRVRTMLQAAAKMGMTVCRTWAFNDGA-Y  1006
                       YVNGWNSYW M+ +   G  R RV  ML+  ++MG+TVCRTWAF+DG   
Sbjct  61    NRESESESEVYVNGWNSYWLMDESAQLGSSRRRVSEMLKRGSQMGLTVCRTWAFSDGPDP  120

Query  1007  NALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGL  1186
             N+LQ+ PG F+ERVF+ALD V+ E+R+HGIRLIL LVNNL AYGGK QYV+WA + G+ +
Sbjct  121   NSLQLRPGVFNERVFKALDYVLVEARKHGIRLILSLVNNLDAYGGKAQYVRWAEEAGVDV  180

Query  1187  SPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGD  1366
             S S DSFF DP I+ Y++ YVK +L+RKN+ TG++Y ++P+IFAWELINEPRC +  +  
Sbjct  181   SSSTDSFFSDPTIKGYYRAYVKAILSRKNSFTGVKYSEEPSIFAWELINEPRCESVSSAP  240

Query  1367  TLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLS  1546
              LQ WI EM+ FVKS+DK HL+TVGLEGFY  K  +    NP  WAA LGSDFI NS + 
Sbjct  241   FLQSWITEMAAFVKSLDKKHLVTVGLEGFYASKSTENYGANPGEWAASLGSDFINNSAIK  300

Query  1547  TIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEV  1726
              IDFASVH YP  W      + K+K+   W  +HI D E  LKKP++FTE G     +  
Sbjct  301   DIDFASVHAYPHSWIPQADLEAKVKYLSNWADAHISDSENVLKKPLLFTEIGAPLSVQTD  360

Query  1727  EPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLI  1906
               Y RD   K++ + +YKSAK  ++GAG + WQ LVE +EEY D F +V  +  STY LI
Sbjct  361   GSYDRDILLKIVYDKVYKSAKKREAGAGVLIWQLLVEGVEEYRDRFSLVASKYPSTYKLI  420

Query  1907  TNHSCRL  1927
                SCRL
Sbjct  421   LEQSCRL  427



>sp|Q0DCM5.2|MAN6_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 6; AltName: Full=Beta-mannanase 
6; AltName: Full=Endo-beta-1,4-mannanase 6; 
AltName: Full=OsMAN6; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61770.1| putative endo-beta-1,4-mannanase [Oryza sativa Japonica Group]
Length=440

 Score =   402 bits (1033),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/395 (49%), Positives = 262/395 (66%), Gaps = 12/395 (3%)
 Frame = +2

Query  779   WVSYPEETL--KLSFVERNGTQFY-AD-GQVFYVNGWNSYWFMEHAVDFGRRPRVRT-ML  943
             WV  P   L  ++ F  R GT F  AD G   YVNGWNSYW +       R P +   ML
Sbjct  39    WVKLPVPWLQPRMPFAARRGTHFVDADTGSPLYVNGWNSYWLLP-----ARSPALAAEML  93

Query  944   QAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNN  1123
             +   +MG++VCRTWAF+DG   ALQISPG+F E VF+ LD VI E+RR+ IRLILCLVNN
Sbjct  94    RRGRRMGLSVCRTWAFSDGGPGALQISPGRFSEAVFQVLDYVIYEARRNHIRLILCLVNN  153

Query  1124  LKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDD  1303
             L   GGK QYV+WA   G  ++ S DSF+  P I+RY+K+YVK +LTR+N+ + + Y D+
Sbjct  154   LDNLGGKAQYVQWAQAAGANMTNSTDSFYSHPTIKRYYKDYVKAILTRRNSYSRIRYSDE  213

Query  1304  PTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLK  1483
             P IFAWEL+NEPRC+++ +G  LQ WI EM+ +VKS+D NHL+TVG EGFYGP   +RL 
Sbjct  214   PAIFAWELMNEPRCVSNSSGPYLQAWIAEMAAYVKSLDTNHLVTVGTEGFYGPGIAERLG  273

Query  1484  INPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGE  1663
             +NP  WAA L SDFI+NS +  IDFASVH YPD W    + ++K+++   W+ SH+ D E
Sbjct  274   VNPGEWAASLCSDFIQNSAVEHIDFASVHAYPDSWLPRASLEEKVRYLSNWVDSHLNDSE  333

Query  1664  RALKKPIMFTEFGLA--GETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVE  1837
             + LKKP++FTE G     +        RD   +++ + +Y SA+  ++G+G++ WQ +VE
Sbjct  334   QILKKPVLFTEVGYLQHSDANSNSTVDRDIILRIVYDKIYDSARKLQAGSGALIWQLMVE  393

Query  1838  RMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHG  1942
                 Y D F +V  +R STY+LITN SCRL  ++G
Sbjct  394   GTHMYGDNFSVVARDRPSTYSLITNQSCRLQRLYG  428



>ref|XP_008659494.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Zea mays]
Length=435

 Score =   401 bits (1031),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 259/382 (68%), Gaps = 8/382 (2%)
 Frame = +2

Query  806   KLSFVERNGTQFY--ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRT-MLQAAAKMGMTVC  976
             ++SFV R GT F     G   Y+NGWNSYW +       R P +   ML+   +MG+T+C
Sbjct  48    RMSFVGRAGTHFVDTLTGAPIYINGWNSYWLLS-----ARSPSLSVEMLRRGRRMGLTIC  102

Query  977   RTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYV  1156
             RTWAF+DG   ALQISPG+F E VF+ LD VI ESRR+ +RLILCLVNNL  +GGK QYV
Sbjct  103   RTWAFSDGGPGALQISPGRFSEPVFQMLDYVIYESRRNHVRLILCLVNNLDNFGGKAQYV  162

Query  1157  KWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINE  1336
             +WA   G+ ++ S DSFF+ P I+ Y+  YVK +LTR+NT +G++Y D+P IFAWEL+NE
Sbjct  163   QWAQAAGVNVTNSTDSFFFHPTIKGYYMEYVKAILTRRNTYSGIKYCDEPAIFAWELMNE  222

Query  1337  PRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLG  1516
             PRC+++ +G  +Q WIEEM+ ++KS+D+ HL+TVG EGFYGP   +RL +NP  WAA + 
Sbjct  223   PRCVSNSSGPYIQSWIEEMAAYIKSLDRKHLITVGTEGFYGPGRGERLGVNPGDWAASVC  282

Query  1517  SDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTE  1696
             SDFI+NS +  IDFASVH YPD W    + ++K+K+   W+ SH+ D E  L+KP++FTE
Sbjct  283   SDFIQNSAVKDIDFASVHAYPDSWLPKASMEEKVKYLSVWVDSHLNDSEYVLRKPVLFTE  342

Query  1697  FGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVP  1876
              G     +       D   K++ + +Y SAK  ++G+G++ WQ +VE  + Y+D+F +V 
Sbjct  343   VGYLQHAEANSTVDGDILLKVVYDKLYDSAKKLQAGSGALIWQLMVEGTQMYHDDFSMVA  402

Query  1877  WERASTYNLITNHSCRLAGVHG  1942
              +R STY L+   SCRL  ++G
Sbjct  403   RDRPSTYKLMKEQSCRLQSLYG  424



>ref|XP_002436944.1| hypothetical protein SORBIDRAFT_10g011830 [Sorghum bicolor]
 gb|EER88311.1| hypothetical protein SORBIDRAFT_10g011830 [Sorghum bicolor]
Length=438

 Score =   401 bits (1030),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/383 (49%), Positives = 256/383 (67%), Gaps = 8/383 (2%)
 Frame = +2

Query  806   KLSFVERNGTQFY--ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRT-MLQAAAKMGMTVC  976
             ++SFV R GT F     G   YVNGWNSYW +       R P +   ML+   +MG+TVC
Sbjct  49    RMSFVGRAGTHFVDAVTGAPIYVNGWNSYWLLS-----ARSPALSAEMLRRGRRMGLTVC  103

Query  977   RTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYV  1156
             RTWAF+DG   ALQISPG+F E VF+ LD VI E+RR+ +RLILCLVNNL  +GGK QYV
Sbjct  104   RTWAFSDGGPGALQISPGRFSEPVFQMLDYVIYEARRNHVRLILCLVNNLDNFGGKAQYV  163

Query  1157  KWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINE  1336
             +WA   G+ ++ S DSFF  P I+ Y+  YVK +LTR+N+ +G++Y D+P IFAWEL+NE
Sbjct  164   QWAQAAGVNVTNSMDSFFSHPTIKYYYMEYVKAILTRRNSYSGIKYCDEPAIFAWELMNE  223

Query  1337  PRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLG  1516
             PRC+++ +G  +Q WIEEMS ++KS+D  HL+TVG+EGFYGP    RL +NP  WAA L 
Sbjct  224   PRCVSNSSGPHIQAWIEEMSAYIKSLDTKHLITVGIEGFYGPGRGDRLGVNPGDWAASLC  283

Query  1517  SDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTE  1696
             SDFI+NS +  IDFASVH YPD W    + ++K+K+   W+ SH+ D E  L+KP++F+E
Sbjct  284   SDFIQNSAVKDIDFASVHAYPDSWLPKASMEEKVKYLSVWVDSHLNDSEYILRKPVLFSE  343

Query  1697  FGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVP  1876
              G     +       D   K++ + +Y SAK  ++G G++ WQ +VE M+ Y+D F +V 
Sbjct  344   VGYLQHAEADNTLDGDTLLKVVYDKLYNSAKKLQAGGGALIWQLMVEGMQMYHDNFSMVA  403

Query  1877  WERASTYNLITNHSCRLAGVHGV  1945
              +R STY LI   SCRL  ++G 
Sbjct  404   RDRPSTYKLINEQSCRLQRLYGT  426



>ref|XP_002520563.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF41796.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=440

 Score =   400 bits (1027),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/418 (49%), Positives = 278/418 (67%), Gaps = 11/418 (3%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLK--LSFVERNGTQF-----YADGQV-  859
             R    YP++G    L+ +Y  F +  +S+P    +  + FV  N TQF     Y D +  
Sbjct  6     REKRVYPVLGIFLLLSLLYFNFNNN-LSFPALLWQPNMGFVSTNSTQFIIISDYGDKEPS  64

Query  860   -FYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPGK  1033
               YVNGWNSYW ME +V    R +V  ML+  A+MG+TVCRTWAF+DG A NALQ+SPG 
Sbjct  65    PLYVNGWNSYWLMEESVWTPSRSKVSKMLKRGAQMGLTVCRTWAFSDGNAPNALQLSPGV  124

Query  1034  FDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFY  1213
             F+ERVF+ LD VI E+R++ IRLIL LVNNL A+GGK QYV+WA + G+ +S S+DSFF 
Sbjct  125   FNERVFQGLDYVIVEARKNRIRLILSLVNNLNAFGGKAQYVRWAQEAGVNVSSSDDSFFS  184

Query  1214  DPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEM  1393
             +P I+ Y+K Y+K ++ RKN+++ + Y ++P IFAWEL+NEPRC +  +   LQ WI EM
Sbjct  185   NPTIKEYYKAYIKAIVMRKNSISRVRYSEEPAIFAWELMNEPRCASSSSASVLQAWIIEM  244

Query  1394  STFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHV  1573
             + ++KS+DK HLLTVGLEGFYG     + ++NP  WAA LGSDFI+NS +  IDFASVH 
Sbjct  245   AAYIKSLDKKHLLTVGLEGFYGLNTTNKSEVNPGKWAALLGSDFIQNSAVDNIDFASVHA  304

Query  1574  YPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFF  1753
             YPD W  +  F+ K  +   W+ SH+ DG+  L+KP++FTE G      +     RD   
Sbjct  305   YPDSWIPDADFEAKADYLSLWMDSHVSDGDFVLRKPVLFTEVGSIWHVNKKGANDRDILL  364

Query  1754  KLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRL  1927
             K++ + +Y  AK  ++GAG++ WQ LVE +EEY+D+F IVPW+  +TY LI   S RL
Sbjct  365   KIVYDKIYDWAKKRQAGAGALIWQLLVEGVEEYSDQFSIVPWDYPATYKLIQEQSYRL  422



>ref|XP_004965323.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Setaria italica]
Length=438

 Score =   399 bits (1025),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 254/383 (66%), Gaps = 10/383 (3%)
 Frame = +2

Query  806   KLSFVERNGTQFYAD---GQVFYVNGWNSYWFMEHAVDFGRRPRVRT-MLQAAAKMGMTV  973
             ++SF  R GT F AD   G   YVNGWNSYW +       R P +   ML+   +MG+TV
Sbjct  49    RMSFTGRAGTHF-ADAETGAPLYVNGWNSYWLLS-----SRSPALAAEMLRRGRRMGLTV  102

Query  974   CRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQY  1153
             CRTWAF+DG   ALQISPG+F E VF+ LD VI E+RR+ IRLILCLVNNL  +GGK QY
Sbjct  103   CRTWAFSDGGPGALQISPGRFSEPVFQMLDYVIYEARRNHIRLILCLVNNLDNFGGKAQY  162

Query  1154  VKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELIN  1333
             V+WA   G  ++ S DSFF  P IR Y+K YVK +LTR+N+ +G++Y D+P IFAWEL+N
Sbjct  163   VQWAQAAGANVTNSTDSFFSHPTIRGYYKEYVKVILTRRNSYSGIKYCDEPAIFAWELMN  222

Query  1334  EPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADL  1513
             EPRC+++ +G  +Q WIEEM+ +VKS+D  HL+TVG+EGFYGP   +RL +NP  WAA L
Sbjct  223   EPRCVSNSSGPHIQAWIEEMAAYVKSLDTKHLVTVGIEGFYGPGRSERLGVNPGDWAASL  282

Query  1514  GSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFT  1693
              SDFI+NS +  IDFASVH YPD W    + ++K+K+   W+ SH+ D E  L+KP++F+
Sbjct  283   CSDFIQNSAVKDIDFASVHAYPDSWLPKASMEEKVKYLSNWVDSHLNDSEYILRKPVLFS  342

Query  1694  EFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIV  1873
             E G             D   KL+ + +Y SAK  ++G G++ WQ +VE    Y D F +V
Sbjct  343   EVGYLQHLGVNNMVNGDTILKLVYDKIYDSAKKLQAGGGALIWQLMVEGSHMYQDGFSMV  402

Query  1874  PWERASTYNLITNHSCRLAGVHG  1942
               ER STY LI   SCRL  ++G
Sbjct  403   AGERPSTYKLIKEQSCRLQRLYG  425



>ref|XP_006352360.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Solanum tuberosum]
Length=439

 Score =   399 bits (1025),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/427 (47%), Positives = 278/427 (65%), Gaps = 16/427 (4%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGDLW-VSYPEETLK---LSFVERNGTQFYADG------  853
             R+   YP +G       +YL+F D +  ++P+  L+   + FV  N T+F+         
Sbjct  6     RDKKLYPALGIFTIFFLLYLSFNDNFNFTFPQIFLRQPYMGFVGVNETRFFIKNENPKTQ  65

Query  854   ----QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAY-NALQ  1018
                 Q FY+NGWNSYW ME +V    R RV  ML+  A+MG++VCRTWAF+DG   N LQ
Sbjct  66    SLTFQEFYINGWNSYWLMEESVWVSSRFRVSKMLKRGAEMGLSVCRTWAFSDGGGPNDLQ  125

Query  1019  ISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSN  1198
             + PG F+ERVF+ LD VI E+R+H IRLIL LVNNLKAYGG  QY++WA + G  +S S 
Sbjct  126   LLPGVFNERVFKGLDFVIVEARKHNIRLILSLVNNLKAYGGTAQYMRWAREAGTNVSSSR  185

Query  1199  DSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQD  1378
             D+FF +P ++ Y+K++VK ++TRKN+++G++Y ++P IFAWELINEPRC +  +   LQ 
Sbjct  186   DAFFTNPTVKAYYKSFVKAIVTRKNSISGVKYSEEPAIFAWELINEPRCESSSSAAALQA  245

Query  1379  WIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDF  1558
             WI EM+ FVKS+D+ HL+T+GLEGFYG +    + +NP  WAA LG DFI NS +  IDF
Sbjct  246   WIAEMAGFVKSLDQKHLVTIGLEGFYGVEKTGNVGLNPGKWAASLGVDFIENSAIENIDF  305

Query  1559  ASVHVYPDHWFKNQTFQD-KLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPY  1735
              SVH YP  W K     D ++ F   W+ SHI + E+ LKKP++FTE G     ++   Y
Sbjct  306   TSVHAYPHSWIKGGINSDARVDFLSHWVDSHISEAEKILKKPVLFTEVGFPSSIQKNGLY  365

Query  1736  QRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNH  1915
              R+ F K++ + +Y+SAK  K+GAG++ WQ LVE ME Y D+F  + W+  STY L+   
Sbjct  366   DRNIFLKIVYDKIYESAKKKKAGAGALVWQLLVEGMERYGDQFSFIAWKHPSTYKLMVEQ  425

Query  1916  SCRLAGV  1936
             SCRL  +
Sbjct  426   SCRLLNI  432



>ref|XP_007033492.1| Mannan endo-1,4-beta-mannosidase 6 isoform 1 [Theobroma cacao]
 gb|EOY04418.1| Mannan endo-1,4-beta-mannosidase 6 isoform 1 [Theobroma cacao]
Length=480

 Score =   400 bits (1027),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 247/371 (67%), Gaps = 1/371 (0%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             VERNG QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TVCRTWAFND
Sbjct  82    VERNGNQFVVNGQPFYVNGFNTYWLMVFAADQSTRGKVSELFQQASSVGLTVCRTWAFND  141

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN  AYGGK QYVKW    G
Sbjct  142   GQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLVNNWDAYGGKAQYVKWGKAAG  201

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + L+ S+D FF    +R Y+K +VK VL R NTVT + Y+DDPTIFAWEL+NEPRC +DP
Sbjct  202   LNLT-SDDEFFSHQTLRSYYKAHVKAVLNRVNTVTNITYKDDPTIFAWELMNEPRCTSDP  260

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GDTLQ WI EM+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DF+RN 
Sbjct  261   SGDTLQSWIAEMAVYVKSLDAKHLVEIGLEGFYGPSAPARAQFNPNSYATQVGTDFVRNH  320

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
                 +DFASVH+Y D W         L+FTK W+ +HIED E+ L  P++F+EFG++ + 
Sbjct  321   QALGVDFASVHIYADSWISQTISDAHLQFTKSWMEAHIEDAEKYLGMPVIFSEFGVSTKD  380

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
                    RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST 
Sbjct  381   PGYNSSFRDTLISTVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMDDGYAIVLAKSPSTS  440

Query  1898  NLITNHSCRLA  1930
             N+I+ HS RLA
Sbjct  441   NIISLHSTRLA  451



>gb|KDO64139.1| hypothetical protein CISIN_1g012093mg [Citrus sinensis]
Length=416

 Score =   395 bits (1014),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  A D   R +V  +   A+  G+TVCRTWAFN
Sbjct  17    MVQKQGNQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVSELFHQASSAGLTVCRTWAFN  76

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD VI+E++++ IRLIL L NN  AYGGK QYVKW    
Sbjct  77    DGQWRALQTSPSVYDEEVFKALDFVISEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKAA  136

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF    ++ Y+K +VKTVL R NT T L Y++DPTIFAWEL+NEPRC +D
Sbjct  137   GLNLT-SDDEFFSHTTLKSYYKAHVKTVLNRVNTFTNLTYKNDPTIFAWELMNEPRCTSD  195

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GDTLQ WI+EM+ +VKSID  HL+ +GLEGFYGP  P R K NP  +A  +G+DFIRN
Sbjct  196   PSGDTLQSWIQEMAVYVKSIDAKHLVEIGLEGFYGPSAPDRAKFNPNSYATQVGTDFIRN  255

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         L+FTK W+ +HIED E+ L+ P++FTEFG++ +
Sbjct  256   HQTLGVDFASVHIYADSWISQTISDAHLQFTKSWMEAHIEDAEKYLRMPVLFTEFGVSAK  315

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  ND + IV  +  ST
Sbjct  316   DTGYNTSFRDTLISSVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMNDGYAIVLSKSPST  375

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              N+I+ HS R+A  + +  ++
Sbjct  376   SNIISLHSTRIATFNSLCSTK  396



>gb|KDO64137.1| hypothetical protein CISIN_1g012093mg [Citrus sinensis]
Length=426

 Score =   395 bits (1014),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  A D   R +V  +   A+  G+TVCRTWAFN
Sbjct  27    MVQKQGNQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVSELFHQASSAGLTVCRTWAFN  86

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD VI+E++++ IRLIL L NN  AYGGK QYVKW    
Sbjct  87    DGQWRALQTSPSVYDEEVFKALDFVISEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKAA  146

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF    ++ Y+K +VKTVL R NT T L Y++DPTIFAWEL+NEPRC +D
Sbjct  147   GLNLT-SDDEFFSHTTLKSYYKAHVKTVLNRVNTFTNLTYKNDPTIFAWELMNEPRCTSD  205

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GDTLQ WI+EM+ +VKSID  HL+ +GLEGFYGP  P R K NP  +A  +G+DFIRN
Sbjct  206   PSGDTLQSWIQEMAVYVKSIDAKHLVEIGLEGFYGPSAPDRAKFNPNSYATQVGTDFIRN  265

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         L+FTK W+ +HIED E+ L+ P++FTEFG++ +
Sbjct  266   HQTLGVDFASVHIYADSWISQTISDAHLQFTKSWMEAHIEDAEKYLRMPVLFTEFGVSAK  325

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  ND + IV  +  ST
Sbjct  326   DTGYNTSFRDTLISSVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMNDGYAIVLSKSPST  385

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              N+I+ HS R+A  + +  ++
Sbjct  386   SNIISLHSTRIATFNSLCSTK  406



>dbj|BAK00462.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   395 bits (1015),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 189/389 (49%), Positives = 252/389 (65%), Gaps = 8/389 (2%)
 Frame = +2

Query  770   GDLWVSYPEETLKLSFVERNGTQFY--ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRT-M  940
             G L +  P    ++SF  RNGT F   + G   YVNGWNSYW +       R P +   M
Sbjct  36    GGLKLPVPWLQPRMSFAGRNGTHFVDASTGAPLYVNGWNSYWLLS-----SRSPALAAEM  90

Query  941   LQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVN  1120
             L+   +MG+ VCRTWAF DG   ALQISPG+F+E VF+ LD +I E+RR+ IRLILCLVN
Sbjct  91    LRRGRRMGLGVCRTWAFIDGGPGALQISPGRFNEAVFQVLDYIIYEARRNHIRLILCLVN  150

Query  1121  NLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRD  1300
             NL  +GGK QYVKWA   G  L+ S DSFFY P I+ Y+K+YVK +LTR+N+ +G+ Y D
Sbjct  151   NLDNFGGKAQYVKWAQTAGANLTNSTDSFFYHPTIKGYYKDYVKAILTRRNSYSGIRYSD  210

Query  1301  DPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRL  1480
             +P IFAWEL+NEPRC+++ +G  LQ WI EM+ +VKS+D  HL+ VG+EGFYG    +RL
Sbjct  211   EPAIFAWELMNEPRCVSNSSGPHLQAWIVEMAAYVKSLDAKHLVAVGIEGFYGTGIAERL  270

Query  1481  KINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDG  1660
               NP  WAA L SDFI NS +  IDFASVH YPD W    + ++K+++   W+ SH+ D 
Sbjct  271   GYNPGDWAASLCSDFIENSAVENIDFASVHAYPDSWLPKASMEEKIRYLSNWVDSHVNDS  330

Query  1661  ERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVER  1840
             E  LKKP++F+E G            RD   +++ + +Y SA+  + G G++ WQ +VE 
Sbjct  331   EYILKKPVLFSEVGYLQHVDANSTVNRDILLRIVYDKIYDSARKLQVGGGALIWQLMVEG  390

Query  1841  MEEYNDEFGIVPWERASTYNLITNHSCRL  1927
                Y+D+F +V  +  STY LIT  SCRL
Sbjct  391   THMYHDDFSLVARDHPSTYKLITEQSCRL  419



>gb|KDO64138.1| hypothetical protein CISIN_1g012093mg [Citrus sinensis]
Length=471

 Score =   395 bits (1015),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  A D   R +V  +   A+  G+TVCRTWAFN
Sbjct  72    MVQKQGNQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVSELFHQASSAGLTVCRTWAFN  131

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD VI+E++++ IRLIL L NN  AYGGK QYVKW    
Sbjct  132   DGQWRALQTSPSVYDEEVFKALDFVISEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKAA  191

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF    ++ Y+K +VKTVL R NT T L Y++DPTIFAWEL+NEPRC +D
Sbjct  192   GLNLT-SDDEFFSHTTLKSYYKAHVKTVLNRVNTFTNLTYKNDPTIFAWELMNEPRCTSD  250

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GDTLQ WI+EM+ +VKSID  HL+ +GLEGFYGP  P R K NP  +A  +G+DFIRN
Sbjct  251   PSGDTLQSWIQEMAVYVKSIDAKHLVEIGLEGFYGPSAPDRAKFNPNSYATQVGTDFIRN  310

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         L+FTK W+ +HIED E+ L+ P++FTEFG++ +
Sbjct  311   HQTLGVDFASVHIYADSWISQTISDAHLQFTKSWMEAHIEDAEKYLRMPVLFTEFGVSAK  370

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  ND + IV  +  ST
Sbjct  371   DTGYNTSFRDTLISSVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMNDGYAIVLSKSPST  430

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              N+I+ HS R+A  + +  ++
Sbjct  431   SNIISLHSTRIATFNSLCSTK  451



>ref|XP_006481220.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Citrus sinensis]
Length=457

 Score =   394 bits (1012),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  A D   R +V  +   A+  G+TVCRTWAFN
Sbjct  58    MVQKQGNQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVSELFHQASSAGLTVCRTWAFN  117

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD VI+E++++ IRLIL + NN  AYGGK QYVKW    
Sbjct  118   DGQWRALQTSPSVYDEEVFKALDFVISEAKKYKIRLILSITNNWDAYGGKAQYVKWGKAA  177

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF    ++ Y+K +VKTVL R NT T L Y++DPTIFAWEL+NEPRC +D
Sbjct  178   GLNLT-SDDEFFSHTTLKSYYKAHVKTVLNRVNTFTNLTYKNDPTIFAWELMNEPRCTSD  236

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GDTLQ WI+EM+ +VKSID  HL+ +GLEGFYGP  P R K NP  +A  +G+DFIRN
Sbjct  237   PSGDTLQSWIQEMAVYVKSIDAKHLVEIGLEGFYGPSAPDRAKFNPNSYATQVGTDFIRN  296

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         L+FTK W+ +HIED E+ L+ P++FTEFG++ +
Sbjct  297   HQTLGVDFASVHIYADSWISQTISDAHLQFTKSWMEAHIEDAEKYLRMPVLFTEFGVSAK  356

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  ND + IV  +  ST
Sbjct  357   DTGYNTSFRDTLISSVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMNDGYAIVLSKSPST  416

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              N+I+ HS R+A  + +  ++
Sbjct  417   SNIISLHSTRIATFNSLCSTK  437



>ref|XP_006429615.1| hypothetical protein CICLE_v10011654mg [Citrus clementina]
 ref|XP_006481219.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Citrus sinensis]
 gb|ESR42855.1| hypothetical protein CICLE_v10011654mg [Citrus clementina]
Length=471

 Score =   394 bits (1012),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  A D   R +V  +   A+  G+TVCRTWAFN
Sbjct  72    MVQKQGNQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVSELFHQASSAGLTVCRTWAFN  131

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD VI+E++++ IRLIL + NN  AYGGK QYVKW    
Sbjct  132   DGQWRALQTSPSVYDEEVFKALDFVISEAKKYKIRLILSITNNWDAYGGKAQYVKWGKAA  191

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF    ++ Y+K +VKTVL R NT T L Y++DPTIFAWEL+NEPRC +D
Sbjct  192   GLNLT-SDDEFFSHTTLKSYYKAHVKTVLNRVNTFTNLTYKNDPTIFAWELMNEPRCTSD  250

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GDTLQ WI+EM+ +VKSID  HL+ +GLEGFYGP  P R K NP  +A  +G+DFIRN
Sbjct  251   PSGDTLQSWIQEMAVYVKSIDAKHLVEIGLEGFYGPSAPDRAKFNPNSYATQVGTDFIRN  310

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         L+FTK W+ +HIED E+ L+ P++FTEFG++ +
Sbjct  311   HQTLGVDFASVHIYADSWISQTISDAHLQFTKSWMEAHIEDAEKYLRMPVLFTEFGVSAK  370

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  ND + IV  +  ST
Sbjct  371   DTGYNTSFRDTLISSVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMNDGYAIVLSKSPST  430

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              N+I+ HS R+A  + +  ++
Sbjct  431   SNIISLHSTRIATFNSLCSTK  451



>ref|XP_002273230.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Vitis vinifera]
Length=471

 Score =   394 bits (1012),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 182/372 (49%), Positives = 248/372 (67%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V++ G QF  +G+ FYVNG+N+YW M  AVD   R +V  + Q AA +G+TVCRT AF
Sbjct  71    TMVQKKGNQFVVNGKPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQAASVGLTVCRTLAF  130

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN + YGGK QYVKW  +
Sbjct  131   NDGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLVNNWEGYGGKAQYVKWGKE  190

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K  VKTVL R NT T + Y++DPTIFAWEL+NEPRC +
Sbjct  191   AGLNLT-SDDDFFSHPTLRSYYKANVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTS  249

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DPTGD LQ WI+EM+ +VKS+D  HLL +GLEGFYGP  P ++++NP  +A  +G+DFIR
Sbjct  250   DPTGDKLQSWIQEMAVYVKSMDPKHLLEIGLEGFYGPSTPDKVQVNPNTYAQQVGTDFIR  309

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         L FT+ W+ +HIED E+ L  P++F EFG++ 
Sbjct  310   NHLVLGVDFASVHIYPDSWISQSITDAHLDFTRSWMQAHIEDSEKYLGMPVVFAEFGVSS  369

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             E        RD     + +++  S +   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  370   EDDGYNSSFRDTLISTVYKVLLNSTRKGGSGAGSLLWQLFPDGTDYMDDGYAIVLSKSPS  429

Query  1892  TYNLITNHSCRL  1927
             T N+I   S RL
Sbjct  430   TSNIIALQSTRL  441



>ref|XP_004250262.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 [Solanum lycopersicum]
Length=457

 Score =   393 bits (1009),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 202/450 (45%), Positives = 281/450 (62%), Gaps = 27/450 (6%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFG----------DLWVSYPEETLKLSFVERNGTQFYADG  853
             R+   YP  G       +YL+F            ++V+ P     + FV  N T+F+   
Sbjct  8     RDKKLYPAFGIFTIFFLLYLSFNDNFNFNFNFPQIFVTQP----YMGFVGVNETRFFIKN  63

Query  854   QV----------FYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGA  1003
             +            Y+NGWNSYW ME +V    R RV  ML+  A+MG++VCRTWAF+DG 
Sbjct  64    ENPKTQSLSFKDLYINGWNSYWLMEESVWVSSRFRVSKMLKRGAEMGLSVCRTWAFSDGG  123

Query  1004  Y-NALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGI  1180
               N LQ+ PG F+ERVF+ LD VI E+R+H IRLIL LVNNLKAYGG  QY++WA + G 
Sbjct  124   GPNDLQLLPGVFNERVFKGLDFVIVEARKHNIRLILSLVNNLKAYGGTAQYMRWAREAGT  183

Query  1181  GLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPT  1360
              +S S D+FF +P ++ Y+K++VK ++TRKN+++G++Y ++P IFAWELINEPRC +  +
Sbjct  184   NVSSSRDAFFTNPTVKAYYKSFVKAIVTRKNSLSGVKYSEEPAIFAWELINEPRCESSSS  243

Query  1361  GDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSN  1540
                LQ WI EM+ FVKS+D+ HL+T+GLEGFYG +  + + +NP  WA  LG DFI NS 
Sbjct  244   AAALQVWIAEMAGFVKSLDQKHLVTIGLEGFYGAEKTENVGLNPGKWAESLGVDFIENSA  303

Query  1541  LSTIDFASVHVYPDHWFKNQTFQD-KLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
             +  IDF SVH YP  W K     D +L F   W+ SHI + E+ LKKP++FTE G     
Sbjct  304   IENIDFTSVHAYPHSWIKGGINSDARLDFLSHWVDSHISEAEKILKKPVLFTEVGFPSSI  363

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
             ++   Y R+ F K++ E +Y+SAK  K+GAG++ WQ LVE ME Y D+F  + W+  STY
Sbjct  364   QKNGLYDRNIFLKIVYEKIYESAKKKKAGAGALVWQLLVEGMERYGDQFSFIAWKHPSTY  423

Query  1898  NLITNHSCRLAGVHGV-LPSQQEHLKSFCS  1984
              L+   SCRL  +    L  ++ + K+ CS
Sbjct  424   KLMVEQSCRLLNISSQGLTDKKLNQKNHCS  453



>gb|KDP21853.1| hypothetical protein JCGZ_00640 [Jatropha curcas]
Length=464

 Score =   392 bits (1008),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/372 (49%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  + Q FYVNG+N+YW M  A D   R +V  + Q A+ +G+TVCRTWAFN
Sbjct  65    MVGKKGNQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQQASSLGLTVCRTWAFN  124

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             D  + ALQ SPG +DE VF+ALD V++E+R+  IRLIL L NN +AYGGK QYVKW    
Sbjct  125   DAQWRALQKSPGVYDEDVFKALDFVVSEARKFKIRLILSLSNNWEAYGGKAQYVKWGKAA  184

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT+T L Y+DDPTIFAWEL+NEPRC +D
Sbjct  185   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTLTNLTYKDDPTIFAWELMNEPRCTSD  243

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ ++K +D  HL+ +GLEGFYGP  P+R + NP  +A  +G+DFIRN
Sbjct  244   PSGDKLQSWIQEMAVYIKGMDAKHLVEIGLEGFYGPSAPERTQFNPNSYATQVGTDFIRN  303

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         ++FTK W+ +HIED E+ L+ P++F EFG++ +
Sbjct  304   HQTLGVDFASVHIYADSWISQTISDAHIEFTKSWMEAHIEDAEKYLRMPVIFAEFGVSAK  363

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD  F  + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  364   DPGYNSSFRDTLFNTVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMDDGYAIVISKAPST  423

Query  1895  YNLITNHSCRLA  1930
              N+I+ HS RLA
Sbjct  424   SNIISLHSTRLA  435



>gb|KHG08771.1| Mannan endo-1,4-beta-mannosidase 6 -like protein [Gossypium arboreum]
Length=454

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 246/371 (66%), Gaps = 1/371 (0%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             V+  G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TVCRTWAFND
Sbjct  56    VQAKGNQFVVNGQPFYVNGFNTYWLMVFAADQSTRGKVSELFQQASSVGLTVCRTWAFND  115

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN  AYGGK QYVKW    G
Sbjct  116   GQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLVNNWNAYGGKAQYVKWGNASG  175

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + L+ S+D FF  P +R Y+K++VK VL R NT T + Y++DPTIFAWEL+NEPRC +DP
Sbjct  176   LNLT-SDDEFFSHPALRSYYKSHVKAVLNRVNTFTNITYKNDPTIFAWELMNEPRCTSDP  234

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GDTLQ WI EM+ +VKS+D  H++ +GLEGFYGP  P R + NP  +A  +G+DFIRN 
Sbjct  235   SGDTLQSWIAEMAAYVKSLDAKHMVEIGLEGFYGPSAPARTQFNPNSYATQVGTDFIRNH  294

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
                 +DFASVH+Y D W         L+FTK W+ +HIED E+ L  P++F+EFG++ + 
Sbjct  295   QALGVDFASVHIYADSWISPSISDAHLEFTKSWMEAHIEDAEKYLGMPVIFSEFGVSRKD  354

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
                    RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST 
Sbjct  355   PGYNSSYRDTLINTVYKTLLNSTKKGGSGAGSLLWQLFPDGTDYMDDGYAIVLAKSPSTS  414

Query  1898  NLITNHSCRLA  1930
             NLI+ HS R+A
Sbjct  415   NLISLHSTRVA  425



>ref|XP_010653331.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X3 
[Vitis vinifera]
Length=410

 Score =   389 bits (999),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V++ G QF  + + FYVNG+N+YW M  AVD   R +V  + Q AA +G+TVCRTWAF
Sbjct  10    TMVQKKGNQFVVNDKPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQAASVGLTVCRTWAF  69

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN + YGGK QYVKW  +
Sbjct  70    NDGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLSNNWEGYGGKAQYVKWGKE  129

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K  VKTVL R NT T + Y++DPTIFAWEL+NEPRC +
Sbjct  130   AGLNLT-SDDDFFSHPTLRSYYKANVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTS  188

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DPTGD LQ WI+EM  +VKS+D  HLL +GLEGFYGP  P +++ NP  +A  +G+DFIR
Sbjct  189   DPTGDKLQSWIQEMVIYVKSMDPKHLLEIGLEGFYGPSTPDKVQFNPNTYAQQVGTDFIR  248

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W      +  L FTK W+ +HIED E+ L  P++F EFG++ 
Sbjct  249   NHQVLGVDFASVHIYTDSWISQSITEAHLDFTKSWMQAHIEDSEKYLGMPVVFGEFGVSS  308

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD F   + +I+  S K   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  309   KDNGYNSSFRDTFISTVYKILLNSTKKGGSGAGSLLWQLFPDGADYMDDGYAIVLSKSPS  368

Query  1892  TYNLITNHSCRL  1927
             T N+I   S RL
Sbjct  369   TSNVIALQSTRL  380



>ref|XP_010928140.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Elaeis guineensis]
Length=438

 Score =   390 bits (1001),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 263/376 (70%), Gaps = 6/376 (2%)
 Frame = +2

Query  806   KLSFVERNGTQF--YADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCR  979
             ++ F+ RNGTQF    +G   Y+NGWNSYW M       +R  V  ML+   +MG+TVCR
Sbjct  48    RMGFIGRNGTQFVDLENGLPVYINGWNSYWLMSSE----KRTWVSEMLRRGREMGLTVCR  103

Query  980   TWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVK  1159
             TWAF+DG   ALQ+ PG +DE++F+ALD VI E+RR+ +RLILCL+NNL A+GGK QYV+
Sbjct  104   TWAFSDGGPKALQLFPGHYDEQMFQALDYVIYEARRNNVRLILCLLNNLNAFGGKDQYVR  163

Query  1160  WAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEP  1339
             WA + G  ++ S+D+FF    IR YFK+Y+K ++TR+N+ +G+ Y D+P IFAWEL+NEP
Sbjct  164   WAQEAGFNVTTSSDAFFSFDVIRGYFKDYIKAIVTRRNSYSGVRYYDEPAIFAWELMNEP  223

Query  1340  RCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGS  1519
             RC++  +   LQDWI +MS+ +KS+DK HL+T+GLEGFYGP   +RL++NP  WAA  GS
Sbjct  224   RCVSKSSAPILQDWIIDMSSHIKSLDKKHLVTIGLEGFYGPGRTERLRVNPGEWAATFGS  283

Query  1520  DFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEF  1699
             DF++NS    IDFASVH YPD W    + ++K+K+   W+ SH+ D +  LKKP++F EF
Sbjct  284   DFLQNSADEHIDFASVHAYPDSWIPRASLEEKVKYLSSWVDSHVNDSQNVLKKPVLFLEF  343

Query  1700  GLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPW  1879
             G     K+   Y+++    ++ + +Y+SAK  ++GAG++ WQ +VE M+ Y DEF ++ W
Sbjct  344   GSNLRAKKNGTYEKNVLLNVVYDKVYESAKKGQAGAGALIWQLMVEGMQNYRDEFSLIAW  403

Query  1880  ERASTYNLITNHSCRL  1927
             E  STY LI   SCRL
Sbjct  404   ENPSTYKLIVQQSCRL  419



>gb|EYU42036.1| hypothetical protein MIMGU_mgv1a005847mg [Erythranthe guttata]
Length=467

 Score =   391 bits (1004),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 252/372 (68%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             S V++NG QF  +GQ FYVNG+N+YW M  AVD   R +V  + Q A+ +G++VCRTWAF
Sbjct  67    SMVQKNGNQFTVNGQPFYVNGFNTYWLMVFAVDASTRGKVTEVFQQASSVGLSVCRTWAF  126

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL  VNN +AYGGK+QYVKW   
Sbjct  127   NDGQWRALQKSPSLYDEDVFKALDFVVSEAKKYKIRLILSFVNNWEAYGGKSQYVKWGKA  186

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P I+ Y+K++V TVL R NTVT + Y+DDPTIFAWEL+NEPRC +
Sbjct  187   AGLNLT-SDDDFFSHPTIKSYYKSHVNTVLNRMNTVTNITYKDDPTIFAWELMNEPRCES  245

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ+WIEEM+ +VKSID  HL+ +GLEGFYGP  P +L+ NP  +A  +G+DFIR
Sbjct  246   DPSGDKLQNWIEEMAVYVKSIDPKHLVEIGLEGFYGPSTPNKLQNNPNTYAQQVGTDFIR  305

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W    T + ++ FTK WI SHI+D E  L  P++F+EFG++ 
Sbjct  306   NHQVLGVDFASVHIYPDSWISQPTAEAQVAFTKSWIQSHIDDAENFLGMPVVFSEFGVST  365

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        R+     +   +  S K    G G++ WQ   E  +  +D + +V  +  S
Sbjct  366   KDPNYTITFRNTLISTVYNTVLNSTKRGGGGGGTLLWQLFPEGTDYMDDGYAVVLSKSPS  425

Query  1892  TYNLITNHSCRL  1927
             T N+I+  S RL
Sbjct  426   TSNIISIQSNRL  437



>gb|EYU42035.1| hypothetical protein MIMGU_mgv1a005847mg [Erythranthe guttata]
Length=468

 Score =   391 bits (1004),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 252/372 (68%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             S V++NG QF  +GQ FYVNG+N+YW M  AVD   R +V  + Q A+ +G++VCRTWAF
Sbjct  68    SMVQKNGNQFTVNGQPFYVNGFNTYWLMVFAVDASTRGKVTEVFQQASSVGLSVCRTWAF  127

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL  VNN +AYGGK+QYVKW   
Sbjct  128   NDGQWRALQKSPSLYDEDVFKALDFVVSEAKKYKIRLILSFVNNWEAYGGKSQYVKWGKA  187

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P I+ Y+K++V TVL R NTVT + Y+DDPTIFAWEL+NEPRC +
Sbjct  188   AGLNLT-SDDDFFSHPTIKSYYKSHVNTVLNRMNTVTNITYKDDPTIFAWELMNEPRCES  246

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ+WIEEM+ +VKSID  HL+ +GLEGFYGP  P +L+ NP  +A  +G+DFIR
Sbjct  247   DPSGDKLQNWIEEMAVYVKSIDPKHLVEIGLEGFYGPSTPNKLQNNPNTYAQQVGTDFIR  306

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W    T + ++ FTK WI SHI+D E  L  P++F+EFG++ 
Sbjct  307   NHQVLGVDFASVHIYPDSWISQPTAEAQVAFTKSWIQSHIDDAENFLGMPVVFSEFGVST  366

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        R+     +   +  S K    G G++ WQ   E  +  +D + +V  +  S
Sbjct  367   KDPNYTITFRNTLISTVYNTVLNSTKRGGGGGGTLLWQLFPEGTDYMDDGYAVVLSKSPS  426

Query  1892  TYNLITNHSCRL  1927
             T N+I+  S RL
Sbjct  427   TSNIISIQSNRL  438



>emb|CBI18019.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   391 bits (1004),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V++ G QF  + + FYVNG+N+YW M  AVD   R +V  + Q AA +G+TVCRTWAF
Sbjct  71    TMVQKKGNQFVVNDKPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQAASVGLTVCRTWAF  130

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN + YGGK QYVKW  +
Sbjct  131   NDGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLSNNWEGYGGKAQYVKWGKE  190

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K  VKTVL R NT T + Y++DPTIFAWEL+NEPRC +
Sbjct  191   AGLNLT-SDDDFFSHPTLRSYYKANVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTS  249

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DPTGD LQ WI+EM  +VKS+D  HLL +GLEGFYGP  P +++ NP  +A  +G+DFIR
Sbjct  250   DPTGDKLQSWIQEMVIYVKSMDPKHLLEIGLEGFYGPSTPDKVQFNPNTYAQQVGTDFIR  309

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W      +  L FTK W+ +HIED E+ L  P++F EFG++ 
Sbjct  310   NHQVLGVDFASVHIYTDSWISQSITEAHLDFTKSWMQAHIEDSEKYLGMPVVFGEFGVSS  369

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD F   + +I+  S K   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  370   KDNGYNSSFRDTFISTVYKILLNSTKKGGSGAGSLLWQLFPDGADYMDDGYAIVLSKSPS  429

Query  1892  TYNLITNHSCRL  1927
             T N+I   S RL
Sbjct  430   TSNVIALQSTRL  441



>ref|XP_010653330.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Vitis vinifera]
Length=479

 Score =   390 bits (1003),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V++ G QF  + + FYVNG+N+YW M  AVD   R +V  + Q AA +G+TVCRTWAF
Sbjct  79    TMVQKKGNQFVVNDKPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQAASVGLTVCRTWAF  138

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN + YGGK QYVKW  +
Sbjct  139   NDGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLSNNWEGYGGKAQYVKWGKE  198

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K  VKTVL R NT T + Y++DPTIFAWEL+NEPRC +
Sbjct  199   AGLNLT-SDDDFFSHPTLRSYYKANVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTS  257

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DPTGD LQ WI+EM  +VKS+D  HLL +GLEGFYGP  P +++ NP  +A  +G+DFIR
Sbjct  258   DPTGDKLQSWIQEMVIYVKSMDPKHLLEIGLEGFYGPSTPDKVQFNPNTYAQQVGTDFIR  317

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W      +  L FTK W+ +HIED E+ L  P++F EFG++ 
Sbjct  318   NHQVLGVDFASVHIYTDSWISQSITEAHLDFTKSWMQAHIEDSEKYLGMPVVFGEFGVSS  377

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD F   + +I+  S K   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  378   KDNGYNSSFRDTFISTVYKILLNSTKKGGSGAGSLLWQLFPDGADYMDDGYAIVLSKSPS  437

Query  1892  TYNLITNHSCRL  1927
             T N+I   S RL
Sbjct  438   TSNVIALQSTRL  449



>ref|XP_009410508.1| PREDICTED: mannan endo-1,4-beta-mannosidase 8 [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   389 bits (998),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/392 (46%), Positives = 251/392 (64%), Gaps = 10/392 (3%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             VER GT F   G+ F V+G+N+YW M  A D   R +V  + + AA  G+TVCRTWAFND
Sbjct  46    VERRGTHFVVQGRPFLVHGFNTYWLMVFAADPATRCKVSDVFKDAAAAGLTVCRTWAFND  105

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQISP  +DE VF+ LD V++E+R HG+RL+L L NN + YGGK QYV+W  + G
Sbjct  106   GGWRALQISPFVYDEEVFKGLDFVVSEARTHGMRLMLSLCNNWEDYGGKAQYVRWGKEAG  165

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + LS  +D FF DP ++ Y+K +VKTV+TR NT+T + Y+DDPTI AWELINEPRC +DP
Sbjct  166   VDLS-GDDDFFSDPTVKSYYKAFVKTVITRVNTITNVAYKDDPTIMAWELINEPRCPSDP  224

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GDTLQ W EEM+ +VKSID  HLL +G+EGFYGP  P+RL++NP   A D G+DFIRN 
Sbjct  225   SGDTLQAWFEEMAAYVKSIDPTHLLEIGVEGFYGPSTPERLQLNPNTCAGDAGTDFIRNH  284

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
              ++ +DFASVHVY D W  +      L+F + W+  H++D E+ L  P++F EFG++ + 
Sbjct  285   RVAGVDFASVHVYSDTWLPDPDSNAHLQFVRAWMHQHMDDAEKLLGMPVVFGEFGVSVKD  344

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
             +  E   R+ F + + + +  S      G G + WQ   E  E  +D + +V  +  ST 
Sbjct  345   ERFESRFRETFMETVYDTLLSSRMRRDVGGGCLVWQLFPEGTEHMDDGYAVVLADSPSTL  404

Query  1898  NLITNHSCRLAGVHGVLPSQQEHLKSFCSKTQ  1993
             ++++ HS  L         Q  H K  C  ++
Sbjct  405   DMLSQHSRNL---------QTHHSKGSCGSSE  427



>emb|CBI18021.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   387 bits (993),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 246/372 (66%), Gaps = 3/372 (1%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V++ G QF  +G+ FYVNG+N+YW M  AVD   R +V  + Q AA +G+TVCRT AF
Sbjct  10    TMVQKKGNQFVVNGKPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQAASVGLTVCRTLAF  69

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN + YGGK QYVKW  +
Sbjct  70    NDGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLVNNWEGYGGKAQYVKWGKE  129

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K    TVL R NT T + Y++DPTIFAWEL+NEPRC +
Sbjct  130   AGLNLT-SDDDFFSHPTLRSYYK--ANTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTS  186

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DPTGD LQ WI+EM+ +VKS+D  HLL +GLEGFYGP  P ++++NP  +A  +G+DFIR
Sbjct  187   DPTGDKLQSWIQEMAVYVKSMDPKHLLEIGLEGFYGPSTPDKVQVNPNTYAQQVGTDFIR  246

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         L FT+ W+ +HIED E+ L  P++F EFG++ 
Sbjct  247   NHLVLGVDFASVHIYPDSWISQSITDAHLDFTRSWMQAHIEDSEKYLGMPVVFAEFGVSS  306

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             E        RD     + +++  S +   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  307   EDDGYNSSFRDTLISTVYKVLLNSTRKGGSGAGSLLWQLFPDGTDYMDDGYAIVLSKSPS  366

Query  1892  TYNLITNHSCRL  1927
             T N+I   S RL
Sbjct  367   TSNIIALQSTRL  378



>ref|XP_002273389.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Vitis vinifera]
Length=461

 Score =   389 bits (1000),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V++ G QF  + + FYVNG+N+YW M  AVD   R +V  + Q AA +G+TVCRTWAF
Sbjct  61    TMVQKKGNQFVVNDKPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQAASVGLTVCRTWAF  120

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN + YGGK QYVKW  +
Sbjct  121   NDGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLSNNWEGYGGKAQYVKWGKE  180

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K  VKTVL R NT T + Y++DPTIFAWEL+NEPRC +
Sbjct  181   AGLNLT-SDDDFFSHPTLRSYYKANVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTS  239

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DPTGD LQ WI+EM  +VKS+D  HLL +GLEGFYGP  P +++ NP  +A  +G+DFIR
Sbjct  240   DPTGDKLQSWIQEMVIYVKSMDPKHLLEIGLEGFYGPSTPDKVQFNPNTYAQQVGTDFIR  299

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W      +  L FTK W+ +HIED E+ L  P++F EFG++ 
Sbjct  300   NHQVLGVDFASVHIYTDSWISQSITEAHLDFTKSWMQAHIEDSEKYLGMPVVFGEFGVSS  359

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD F   + +I+  S K   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  360   KDNGYNSSFRDTFISTVYKILLNSTKKGGSGAGSLLWQLFPDGADYMDDGYAIVLSKSPS  419

Query  1892  TYNLITNHSCRL  1927
             T N+I   S RL
Sbjct  420   TSNVIALQSTRL  431



>ref|XP_011018989.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X6 
[Populus euphratica]
Length=438

 Score =   388 bits (997),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 243/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V R G QF  + Q FYVNG+N+YW M  A D   R ++  + Q A+ +G+TVCRTWAFN
Sbjct  39    MVARKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKITEVFQQASSVGLTVCRTWAFN  98

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SPG +DE VF+ALD V++E++++ IRLIL L NN  AYGGK QYVKW    
Sbjct  99    DGQWRALQKSPGVYDEDVFKALDFVVSEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKAT  158

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +D
Sbjct  159   GLNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTLTNITYKDDPTIFAWELMNEPRCTSD  217

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIRN
Sbjct  218   PSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIRN  277

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W         ++F K W+ +HIED ER L  P++F EFG++ +
Sbjct  278   HQVLGVDFASVHIYADSWISQTISDSHIQFIKSWMEAHIEDAERYLGMPVVFAEFGVSSK  337

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  338   DPGYNSSFRDTMINTVYKTLLNSTKRGGSGAGSLLWQIFPDGTDYMDDGYAIVLSKSPST  397

Query  1895  YNLITNHSCRLA  1930
              N+I+ HS R+A
Sbjct  398   SNIISLHSARVA  409



>gb|KHN29491.1| Mannan endo-1,4-beta-mannosidase 6 [Glycine soja]
Length=462

 Score =   389 bits (999),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 182/372 (49%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + + FYVNG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  63    MVQKKGNQFVVNDKPFYVNGFNTYWLMVFAADESTRGKVTEVFKQASSVGMTVCRTWAFN  122

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  123   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLANNWEAYGGKAQYVKWGNAA  182

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  183   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  241

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  VK ID  HL+ VG+EGFYGP  P+R ++NP  +A  +G+DFIRN
Sbjct  242   PTGDKLQDWIQEMAFHVKKIDPKHLVEVGVEGFYGPSTPQRTQLNPNTYATQVGTDFIRN  301

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W   Q     + F K W+ +HIED ER L  P++F EFG++ +
Sbjct  302   HLVLGVDFASVHMYPDSWISQQIADTHIPFVKSWMEAHIEDAERYLGMPVVFAEFGVSSK  361

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQF  +  +  +D + IV  +  ST
Sbjct  362   DPGYNSSYRDTVISTVYSTILNSTKKGGSGAGSLLWQFFPDGTDNMDDGYAIVLSKSPST  421

Query  1895  YNLITNHSCRLA  1930
              ++I   S RLA
Sbjct  422   SSIIQLQSTRLA  433



>ref|XP_008775972.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Phoenix dactylifera]
Length=438

 Score =   388 bits (996),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/384 (49%), Positives = 263/384 (68%), Gaps = 6/384 (2%)
 Frame = +2

Query  782   VSYPEETLKLSFVERNGTQF--YADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAA  955
             ++ P    ++ F+ RNGTQ      G   YVNGWNSYW M       +R  V  +L+   
Sbjct  40    IAIPWLQPRMGFIGRNGTQLVDLESGSPVYVNGWNSYWLMSSE----KRTWVSEILRRGR  95

Query  956   KMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAY  1135
             +MG+TVCRTWAF+DG   ALQ+ PG +DE++F+ALD VI E+RR+ +RLILCL+NNL A+
Sbjct  96    EMGLTVCRTWAFSDGGPKALQLFPGHYDEQMFQALDYVIYEARRNNVRLILCLLNNLNAF  155

Query  1136  GGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIF  1315
             GGK QYV+WA + G  ++ S+D+FF    IR YFK+Y+K ++TR+N+ +G+ Y D+P IF
Sbjct  156   GGKDQYVRWAQEAGFNVTTSSDAFFSFDVIRGYFKDYIKAIVTRRNSYSGVRYYDEPAIF  215

Query  1316  AWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPE  1495
             AWEL+NEPRC++  +   LQDWI +MS+ +KS+DK HL+T+GLEGFYGP   +RL  NP 
Sbjct  216   AWELMNEPRCVSKSSAPILQDWIIDMSSHIKSLDKKHLVTIGLEGFYGPGRTERLNANPG  275

Query  1496  LWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALK  1675
              WAA  GSDF++NS    IDFASVH YPD W    + ++K+K+   W+ SH+ D +  LK
Sbjct  276   EWAATFGSDFLQNSADEHIDFASVHAYPDSWIPRASLEEKVKYLSSWVDSHVNDSQNILK  335

Query  1676  KPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYN  1855
             KP++F EFG     K+   Y+RD    ++ + +Y+SAK  ++GAG++ WQ +VE M++Y+
Sbjct  336   KPVLFLEFGSNLHAKKNGTYERDVLLNVVYDKVYESAKKGQAGAGALIWQLMVEGMQKYH  395

Query  1856  DEFGIVPWERASTYNLITNHSCRL  1927
             DEF +V WE  STY  I   SCRL
Sbjct  396   DEFSLVAWENPSTYESIVQQSCRL  419



>ref|XP_010913204.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Elaeis guineensis]
Length=442

 Score =   388 bits (996),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 190/376 (51%), Positives = 259/376 (69%), Gaps = 6/376 (2%)
 Frame = +2

Query  806   KLSFVERNGTQF--YADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCR  979
             ++ F+ RNGTQF     G   Y+NGWNSYW M       +R  V  ML    +MG+TVCR
Sbjct  52    RMGFIGRNGTQFIDLETGTPVYINGWNSYWLMSSE----KRKWVSEMLWRGREMGLTVCR  107

Query  980   TWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVK  1159
             TWAF+DG   ALQ+ PG +DE+VF+ALD  I E+RR+ IRLILCL+NNL A+GGK QYV+
Sbjct  108   TWAFSDGGPKALQLFPGHYDEQVFQALDYAIYEARRNHIRLILCLLNNLNAFGGKDQYVR  167

Query  1160  WAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEP  1339
             WA + G  ++ S+D+FF    IR YFK+Y+  +LTR+NT +G+ Y D+P IFAWEL+NEP
Sbjct  168   WAQEAGFNVNTSSDAFFSFDVIRGYFKDYIDAILTRRNTYSGVRYCDEPAIFAWELMNEP  227

Query  1340  RCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGS  1519
             RC+   +   LQDWI +MS+ +KSIDK HL+T+GLEGFYGP   +RL++NP  WAA  GS
Sbjct  228   RCVFKSSAPILQDWIIDMSSHIKSIDKKHLVTIGLEGFYGPGRTERLEVNPGEWAATFGS  287

Query  1520  DFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEF  1699
             DF++NS    IDFASVH YPD W    + ++K+K+   W+ SH+ D +  L KP++F EF
Sbjct  288   DFVKNSADEHIDFASVHAYPDSWIPTASLEEKVKYLSSWVDSHVNDSQNILNKPVLFLEF  347

Query  1700  GLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPW  1879
             G     K+   ++RD   K++ + +Y+SAK  ++GAG++ WQ +V  M++Y+DEF +V W
Sbjct  348   GSNLHVKKNGTFERDVLLKVVYDRVYESAKKGQAGAGALLWQLMVGGMQKYHDEFSLVAW  407

Query  1880  ERASTYNLITNHSCRL  1927
             E  STY LI   SCRL
Sbjct  408   EHPSTYKLIVQQSCRL  423



>ref|XP_010327704.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X3 [Solanum 
lycopersicum]
Length=408

 Score =   387 bits (993),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 248/372 (67%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G++VCRTWAF
Sbjct  8     TMVQKSGNQFVLNGQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQQASAVGLSVCRTWAF  67

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ +PG +DE VF+ALD V++E+++  IRLIL LVNN +AYGGK+QYVKW   
Sbjct  68    NDGQWRALQKTPGVYDEDVFKALDFVVSEAKKFKIRLILSLVNNWEAYGGKSQYVKWGKA  127

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+NEPRC +
Sbjct  128   AGLNLT-SDDDFFSHPTLKSYYKAHVKAVLNRVNTFTNITYKDDPTIFGWELMNEPRCES  186

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD L  WIEEM+ +VK+ID  HL+ +GLEGFYGP  P + +INP  +A  +G+DFIR
Sbjct  187   DPSGDKLHAWIEEMAVYVKTIDPKHLVQIGLEGFYGPSTPNKAQINPNSYAQQVGTDFIR  246

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W   +     + FTK W+ +HI+D E  L  P++F+EFG++ 
Sbjct  247   NHQVLGVDFASVHIYPDSWISQEISDAHIGFTKTWMQAHIDDAENYLNMPVVFSEFGVSA  306

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     +  ++  S K   +G GS+ WQ   E  +  +D + IV  +  S
Sbjct  307   KDPGYNSSFRDALISTVYTVLLNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIVLSKALS  366

Query  1892  TYNLITNHSCRL  1927
             T N+++ HS RL
Sbjct  367   TSNIVSLHSKRL  378



>ref|XP_003626672.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=462

 Score =   388 bits (997),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 250/378 (66%), Gaps = 1/378 (0%)
 Frame = +2

Query  797   ETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVC  976
             E  +   V++ G QF  + Q FYVNG+N+YW M  A D   R RV  + + A+ +GMTVC
Sbjct  57    EEAEWQMVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGRVTQVFKHASSVGMTVC  116

Query  977   RTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYV  1156
             RTWAFNDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK QYV
Sbjct  117   RTWAFNDGQWRALQKSPSLYDEVVFKALDFVVSEAKKYRIRLILSLVNNWEAYGGKAQYV  176

Query  1157  KWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINE  1336
             KW    G+ L+ S+D FF  P +R Y+K++VKTVL R NT+T + Y++DPTIFAWEL+NE
Sbjct  177   KWGNAAGLNLT-SDDDFFSHPTLRGYYKDHVKTVLNRVNTLTNITYKEDPTIFAWELMNE  235

Query  1337  PRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLG  1516
             PRC +D  GDTLQ+WI+EM+ +VKSID  HLL +GLEGFYGP  P+R + NP  +A  +G
Sbjct  236   PRCTSDSLGDTLQEWIKEMAFYVKSIDPKHLLEIGLEGFYGPSTPQRFQFNPNSYAQQVG  295

Query  1517  SDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTE  1696
             +DFIRN  +  +DFAS H+YPD W         + F K W+ +HI+D E+ L  P++F E
Sbjct  296   TDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPFVKSWMEAHIDDAEKYLGMPVVFGE  355

Query  1697  FGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVP  1876
             FG++ +        RD     + + +  S K   SGAGS+ WQF  +  +  +D + IV 
Sbjct  356   FGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSGAGSLLWQFFPDGTDYMDDGYAIVL  415

Query  1877  WERASTYNLITNHSCRLA  1930
              +  ST ++I+  S RLA
Sbjct  416   SKAPSTSSMISLQSTRLA  433



>ref|XP_011001681.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Populus euphratica]
Length=471

 Score =   389 bits (998),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 247/377 (66%), Gaps = 1/377 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  + Q FYVNG+N+YW M  A D   R +V  + Q A+ +G++VCRTWAFN
Sbjct  72    MVAKKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQKASSVGLSVCRTWAFN  131

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SPG +DE VF+ALD V++E++++ IRLIL L NN  AYGGK QYVKW    
Sbjct  132   DGQWRALQKSPGVYDEDVFKALDFVVSEAKQYKIRLILSLANNWDAYGGKAQYVKWGKAS  191

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +D
Sbjct  192   GLNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTITNITYKDDPTIFAWELMNEPRCTSD  250

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIRN
Sbjct  251   PSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIRN  310

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W         ++FTK W+ +HIED E+ L  P++F EFG++ +
Sbjct  311   HQVLGVDFASVHIYADSWISQTITDSHIQFTKSWMEAHIEDAEKYLGMPVVFAEFGVSSK  370

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  371   DPGYNSSFRDTLINTVYKTLLNSTKRGGSGAGSLLWQLFPDGTDYMDDGYAIVLSKSPST  430

Query  1895  YNLITNHSCRLAGVHGV  1945
              N+I+ HS R+A V+ +
Sbjct  431   SNIISLHSTRVAIVNSM  447



>gb|AET01148.2| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=462

 Score =   388 bits (997),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 250/378 (66%), Gaps = 1/378 (0%)
 Frame = +2

Query  797   ETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVC  976
             E  +   V++ G QF  + Q FYVNG+N+YW M  A D   R RV  + + A+ +GMTVC
Sbjct  57    EEAEWQMVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGRVTQVFKHASSVGMTVC  116

Query  977   RTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYV  1156
             RTWAFNDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK QYV
Sbjct  117   RTWAFNDGQWRALQKSPSLYDEVVFKALDFVVSEAKKYRIRLILSLVNNWEAYGGKAQYV  176

Query  1157  KWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINE  1336
             KW    G+ L+ S+D FF  P +R Y+K++VKTVL R NT+T + Y++DPTIFAWEL+NE
Sbjct  177   KWGNAAGLNLT-SDDDFFSHPTLRGYYKDHVKTVLNRVNTLTNITYKEDPTIFAWELMNE  235

Query  1337  PRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLG  1516
             PRC +D  GDTLQ+WI+EM+ +VKSID  HLL +GLEGFYGP  P+R + NP  +A  +G
Sbjct  236   PRCTSDSLGDTLQEWIKEMAFYVKSIDPKHLLEIGLEGFYGPSTPQRFQFNPNSYAQQVG  295

Query  1517  SDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTE  1696
             +DFIRN  +  +DFAS H+YPD W         + F K W+ +HI+D E+ L  P++F E
Sbjct  296   TDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPFVKSWMEAHIDDAEKYLGMPVVFGE  355

Query  1697  FGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVP  1876
             FG++ +        RD     + + +  S K   SGAGS+ WQF  +  +  +D + IV 
Sbjct  356   FGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSGAGSLLWQFFPDGTDYMDDGYAIVL  415

Query  1877  WERASTYNLITNHSCRLA  1930
              +  ST ++I+  S RLA
Sbjct  416   SKAPSTSSMISLQSTRLA  433



>ref|XP_011018982.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Populus euphratica]
Length=471

 Score =   388 bits (997),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 179/371 (48%), Positives = 243/371 (65%), Gaps = 1/371 (0%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             V R G QF  + Q FYVNG+N+YW M  A D   R ++  + Q A+ +G+TVCRTWAFND
Sbjct  73    VARKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKITEVFQQASSVGLTVCRTWAFND  132

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQ SPG +DE VF+ALD V++E++++ IRLIL L NN  AYGGK QYVKW    G
Sbjct  133   GQWRALQKSPGVYDEDVFKALDFVVSEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKATG  192

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +DP
Sbjct  193   LNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTLTNITYKDDPTIFAWELMNEPRCTSDP  251

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIRN 
Sbjct  252   SGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIRNH  311

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
              +  +DFASVH+Y D W         ++F K W+ +HIED ER L  P++F EFG++ + 
Sbjct  312   QVLGVDFASVHIYADSWISQTISDSHIQFIKSWMEAHIEDAERYLGMPVVFAEFGVSSKD  371

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
                    RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST 
Sbjct  372   PGYNSSFRDTMINTVYKTLLNSTKRGGSGAGSLLWQIFPDGTDYMDDGYAIVLSKSPSTS  431

Query  1898  NLITNHSCRLA  1930
             N+I+ HS R+A
Sbjct  432   NIISLHSARVA  442



>ref|XP_004249033.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X1 [Solanum 
lycopersicum]
Length=449

 Score =   387 bits (994),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 248/372 (67%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G++VCRTWAF
Sbjct  49    TMVQKSGNQFVLNGQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQQASAVGLSVCRTWAF  108

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ +PG +DE VF+ALD V++E+++  IRLIL LVNN +AYGGK+QYVKW   
Sbjct  109   NDGQWRALQKTPGVYDEDVFKALDFVVSEAKKFKIRLILSLVNNWEAYGGKSQYVKWGKA  168

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+NEPRC +
Sbjct  169   AGLNLT-SDDDFFSHPTLKSYYKAHVKAVLNRVNTFTNITYKDDPTIFGWELMNEPRCES  227

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD L  WIEEM+ +VK+ID  HL+ +GLEGFYGP  P + +INP  +A  +G+DFIR
Sbjct  228   DPSGDKLHAWIEEMAVYVKTIDPKHLVQIGLEGFYGPSTPNKAQINPNSYAQQVGTDFIR  287

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W   +     + FTK W+ +HI+D E  L  P++F+EFG++ 
Sbjct  288   NHQVLGVDFASVHIYPDSWISQEISDAHIGFTKTWMQAHIDDAENYLNMPVVFSEFGVSA  347

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     +  ++  S K   +G GS+ WQ   E  +  +D + IV  +  S
Sbjct  348   KDPGYNSSFRDALISTVYTVLLNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIVLSKALS  407

Query  1892  TYNLITNHSCRL  1927
             T N+++ HS RL
Sbjct  408   TSNIVSLHSKRL  419



>ref|XP_007140064.1| hypothetical protein PHAVU_008G081200g [Phaseolus vulgaris]
 gb|ESW12058.1| hypothetical protein PHAVU_008G081200g [Phaseolus vulgaris]
Length=462

 Score =   387 bits (995),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/372 (49%), Positives = 243/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + + FYVNG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  63    MVQKKGNQFVVNDKPFYVNGFNTYWLMVFAADESTRGKVTEVFKQASSVGMTVCRTWAFN  122

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  123   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLTNNWEAYGGKAQYVKWGNAA  182

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K++VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  183   GLNLT-SDDDFFSHPTLRSYYKSHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  241

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  VK ID  HL+ VGLEGFYGP  P+R + NP  +A  +G+DFIRN
Sbjct  242   PTGDKLQDWIQEMAFQVKKIDPKHLVEVGLEGFYGPSTPQRTQFNPNTYATQVGTDFIRN  301

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W   Q     L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  302   HQALGVDFASVHIYADSWISQQIADSHLSFIKSWMEAHIEDAEKHLGMPVVFAEFGVSSK  361

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQF  +  +  +D + IV  +  ST
Sbjct  362   DPGYNSSYRDTVISSVYNTILNSTKKGGSGAGSLLWQFFPDGTDNMDDGYAIVLSKSPST  421

Query  1895  YNLITNHSCRLA  1930
              ++I   S RLA
Sbjct  422   SSIIQLQSTRLA  433



>gb|AFX59322.1| endo-1,4-beta-mannanase [Populus trichocarpa]
Length=471

 Score =   388 bits (996),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 246/377 (65%), Gaps = 1/377 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  + Q FYVNG+N+YW M  A D   R +V  + Q A+ +G++VCRTWAFN
Sbjct  72    MVAKKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQKASSVGLSVCRTWAFN  131

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SPG +DE VF+ALD V++E+ ++ IRLIL L NN  AYGGK QYVKW    
Sbjct  132   DGQWRALQKSPGVYDEDVFKALDFVVSEANKYKIRLILSLANNWDAYGGKAQYVKWGKAS  191

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +D
Sbjct  192   GLNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTITNITYKDDPTIFAWELMNEPRCTSD  250

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIRN
Sbjct  251   PSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIRN  310

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W         ++FTK W+ +HIED E+ L  P++F EFG++ +
Sbjct  311   HQVLGVDFASVHIYADSWISQTITDSHIQFTKSWMEAHIEDAEKYLGMPVVFAEFGVSSK  370

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  371   DPGYNSSFRDTLINTVYKTLLNSTKRGGSGAGSLLWQLFPDGTDYMDDGYAIVLSKSPST  430

Query  1895  YNLITNHSCRLAGVHGV  1945
              N+I+ HS R+A V+ +
Sbjct  431   TNIISLHSTRVAIVNSM  447



>ref|XP_003626642.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=462

 Score =   387 bits (995),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 250/378 (66%), Gaps = 1/378 (0%)
 Frame = +2

Query  797   ETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVC  976
             E  +   V++ G QF  + Q FYVNG+N+YW M  A D   R RV  + + A+ +GMTVC
Sbjct  57    EEAEWQMVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGRVTQVFKHASSVGMTVC  116

Query  977   RTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYV  1156
             RTWAFNDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK QYV
Sbjct  117   RTWAFNDGQWRALQKSPSLYDEVVFKALDFVVSEAKKYRIRLILSLVNNWEAYGGKAQYV  176

Query  1157  KWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINE  1336
             KW    G+ L+ S+D FF  P +R Y+K++VKTVL R NT+T + Y++DPTIFAWEL+NE
Sbjct  177   KWGNAAGLNLT-SDDDFFSHPTLRGYYKDHVKTVLNRVNTLTNITYKEDPTIFAWELMNE  235

Query  1337  PRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLG  1516
             PRC +D  GDTLQ+WI+EM+ +VKSID  HLL +GLEGFYGP  P+R + NP  +A  +G
Sbjct  236   PRCTSDSLGDTLQEWIKEMAFYVKSIDPKHLLEIGLEGFYGPSTPQRFQFNPNSYAQQVG  295

Query  1517  SDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTE  1696
             +DFIRN  +  +DFAS H+YPD W         + F K W+ +HI+D E+ L  P++F E
Sbjct  296   TDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPFVKSWMEAHIDDAEKYLGMPVVFGE  355

Query  1697  FGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVP  1876
             FG++ +        RD     + + +  S K   SGAG++ WQF  +  +  +D + IV 
Sbjct  356   FGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSGAGTLLWQFFPDGTDYMDDGYAIVL  415

Query  1877  WERASTYNLITNHSCRLA  1930
              +  ST ++I+  S RLA
Sbjct  416   SKAPSTSSMISLQSTRLA  433



>ref|XP_003534636.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Glycine max]
Length=489

 Score =   388 bits (996),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/372 (49%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + + FYVNG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  90    MVQKKGNQFVVNDKPFYVNGFNTYWLMVFAADESTRGKVTEVFKQASSVGMTVCRTWAFN  149

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  150   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLANNWEAYGGKAQYVKWGNAA  209

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D F+  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  210   GLNLT-SDDDFYSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  268

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  VK ID  HL+ VG+EGFYGP  P+R ++NP  +A  +G+DFIRN
Sbjct  269   PTGDKLQDWIQEMAFHVKKIDPKHLVEVGVEGFYGPSTPQRTQLNPNTYATQVGTDFIRN  328

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W   Q     + F K W+ +HIED ER L  P++F EFG++ +
Sbjct  329   HLVLGVDFASVHMYPDSWISQQIADTHIPFVKSWMEAHIEDAERYLGMPVVFAEFGVSSK  388

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQF  +  +  +D + IV  +  ST
Sbjct  389   DPGYNSSYRDTVISTVYSTILNSTKKGGSGAGSLLWQFFPDGTDNMDDGYAIVLSKSPST  448

Query  1895  YNLITNHSCRLA  1930
              ++I   S RLA
Sbjct  449   SSIIQLQSTRLA  460



>gb|KHN42134.1| Mannan endo-1,4-beta-mannosidase 6 [Glycine soja]
Length=407

 Score =   385 bits (988),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  8     MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  67

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN +AYGGK QYVKW    
Sbjct  68    DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWEAYGGKPQYVKWGNAA  127

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  128   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  186

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P++ + NP  +A ++G+DFIRN
Sbjct  187   SSGDVLQDWIKEMAFYVKSIDPKHLVEIGLEGFYGPSTPQKYQFNPNSYAHEVGTDFIRN  246

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  247   HQVLGVDFASVHIYPDSWISQSVADSHLPFIKTWMEAHIEDAEKYLGMPVVFAEFGVSAK  306

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  307   APGYNSTYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIVLSKSPST  366

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  367   SSIISLQSTRLA  378



>ref|XP_008798844.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Phoenix dactylifera]
Length=436

 Score =   385 bits (990),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 201/443 (45%), Positives = 278/443 (63%), Gaps = 10/443 (2%)
 Frame = +2

Query  671   MVKSRRSKMLARNGMFYPIIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQF--Y  844
             M+K  R        +    +G+  + ++     G   V  P    ++ F+ RNGTQF   
Sbjct  1     MMKQERQAYAVLGALLLIAVGYMNWNSWGSSGGGGFRVPIPWLQPRMGFIGRNGTQFIDL  60

Query  845   ADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQIS  1024
               G   YVNGWNSYWFM      G R  V  ML+   +MG+TVCRTWAF+DG   ALQ+ 
Sbjct  61    ESGTPVYVNGWNSYWFMSS----GNRKWVSEMLRRGREMGLTVCRTWAFSDGGPKALQLF  116

Query  1025  PGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDS  1204
             PG +DE++F+ALD  I E+RR+G+RLILCL+NNL A+GGK QYV+WA + G  ++ S+D+
Sbjct  117   PGHYDEQMFQALDYAIYEARRNGVRLILCLLNNLNAFGGKDQYVRWAQEAGFNVNTSSDA  176

Query  1205  FFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWI  1384
             FF    IR YFK ++  +LTR+NT +G+ Y D+P IFAWEL+NEPRC+   +   LQDWI
Sbjct  177   FFSFDVIRGYFKTFIDVMLTRRNTYSGVRYCDEPAIFAWELMNEPRCVFKSSAPILQDWI  236

Query  1385  EEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFAS  1564
              +MS+ +KSIDK HL+T+GLEGFY     +RL +NP  WAA  GSDF++NS    IDF+S
Sbjct  237   VDMSSHIKSIDKKHLVTIGLEGFYESGRTERLGVNPGEWAATFGSDFVKNSADEHIDFSS  296

Query  1565  VHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRD  1744
             VH YPD W    + ++K+K+   W+ SH+ D +  LKKP++F EFG     K    Y+RD
Sbjct  297   VHAYPDSWMPMASLEEKIKYLSSWVDSHVNDSQNILKKPVLFLEFGSNLHVKRNGTYERD  356

Query  1745  RFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCR  1924
                K+I + +Y+SAK  ++GAG + WQ +   M EY D+F +V W+  STY LI   SCR
Sbjct  357   VQLKVIYDKVYESAKKGEAGAGVLLWQLMAGGMGEYLDDFSLVAWDHPSTYKLIVQQSCR  416

Query  1925  LAGVHGVLPSQQEHLKSFCSKTQ  1993
             L      L  +++++   CSK Q
Sbjct  417   LL----RLSQRKKNIGKPCSKLQ  435



>ref|XP_010327703.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Solanum 
lycopersicum]
Length=449

 Score =   386 bits (991),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 248/372 (67%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G++VCRTWAF
Sbjct  49    TMVQKSGNQFVLNGQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQQASAVGLSVCRTWAF  108

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ +PG +DE VF+ALD V++E+++  IRLIL LVNN +AYGGK+QYVKW   
Sbjct  109   NDGQWRALQKTPGVYDEDVFKALDFVVSEAKKFKIRLILSLVNNWEAYGGKSQYVKWGKA  168

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+NEPRC +
Sbjct  169   AGLNLT-SDDDFFSHPTLKSYYKAHVKAVLNRVNTFTNITYKDDPTIFGWELMNEPRCES  227

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD L  WIEEM+ +VK+ID  HL+ +GLEGFYGP  P + +INP  +A  +G+DFIR
Sbjct  228   DPSGDKLHAWIEEMAVYVKTIDPKHLVQIGLEGFYGPSTPNKAQINPNSYAQQVGTDFIR  287

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W   +     + FTK W+ +HI+D E  L  P++F+EFG++ 
Sbjct  288   NHQVLGVDFASVHIYPDSWISQEISDAHIGFTKTWMQAHIDDAENYLNMPVVFSEFGVSA  347

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     +  ++  S K   +G GS+ WQ   E  +  +D + IV  +  S
Sbjct  348   KDPGYNSSFRDALISTVYTVLLNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIVLSKALS  407

Query  1892  TYNLITNHSCRL  1927
             T N+++ HS RL
Sbjct  408   TSNIVSLHSKRL  419



>ref|XP_009614144.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X3 [Nicotiana 
tomentosiformis]
Length=429

 Score =   385 bits (988),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 185/411 (45%), Positives = 259/411 (63%), Gaps = 13/411 (3%)
 Frame = +2

Query  755   IYLTFGDLWVSYPE-ETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRV  931
             ++ T G L +   E E  + + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V
Sbjct  8     LFATIGSLKIERGEMEDGEWTMVQKSGNQFVVNGQPFYVNGFNTYWLMVFAADQSTRGKV  67

Query  932   RTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILC  1111
                 Q A+ +G++VCRTWAFNDG + ALQ +P  +DE VF+ALD V++E++++ IRLIL 
Sbjct  68    TETFQQASAVGLSVCRTWAFNDGQWRALQKTPSVYDEDVFKALDFVVSEAKKYKIRLILS  127

Query  1112  LVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLE  1291
             LVNN +AYGGK+QYVKW    G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + 
Sbjct  128   LVNNWEAYGGKSQYVKWGKAAGLNLT-SDDDFFSHPILKSYYKAHVKAVLNRVNTFTNIT  186

Query  1292  YRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDP  1471
             Y+DDPTIF WEL+NEPRC +DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFYG   P
Sbjct  187   YKDDPTIFGWELMNEPRCESDPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFYGLSTP  246

Query  1472  KRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHI  1651
              R ++NP  +A  +G+DFIRN  +  +DFASVH+YPD W         ++FTK W+ SHI
Sbjct  247   NRAQVNPNSYAQQVGTDFIRNHQVLGVDFASVHIYPDSWISKSISDAHVEFTKSWMQSHI  306

Query  1652  EDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFL  1831
             +D E  L  P++F EFG++ +        RD     + + +  S K   +G GS+ WQ  
Sbjct  307   DDAENYLNMPVIFAEFGVSAKDPGYNSTYRDTLIATVYKTILNSTKKGGAGGGSLLWQVF  366

Query  1832  VERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVLPSQQEHLKSFCS  1984
              E  +  +D + IV  +  ST N+++ HS +L               SFCS
Sbjct  367   PEGTDYMDDGYAIVLSKSLSTSNIVSLHSKKL-----------NTFNSFCS  406



>ref|XP_003522088.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Glycine max]
Length=438

 Score =   385 bits (989),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  39    MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  98

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN +AYGGK QYVKW    
Sbjct  99    DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWEAYGGKPQYVKWGNAA  158

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  159   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  217

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P++ + NP  +A ++G+DFIRN
Sbjct  218   SSGDVLQDWIKEMAFYVKSIDPKHLVEIGLEGFYGPSTPQKYQFNPNSYAHEVGTDFIRN  277

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  278   HQVLGVDFASVHIYPDSWISQSVADSHLPFIKTWMEAHIEDAEKYLGMPVVFAEFGVSAK  337

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  338   APGYNSTYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIVLSKSPST  397

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  398   SSIISLQSTRLA  409



>ref|XP_006576282.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X4 
[Glycine max]
Length=437

 Score =   385 bits (988),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 185/394 (47%), Positives = 254/394 (64%), Gaps = 5/394 (1%)
 Frame = +2

Query  761   LTFGDLWVSYPE----ETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPR  928
             +   D  +SY E    E  +   V+  G QF  + Q FYVNG+N+YW M  A D   R +
Sbjct  16    IDIADSILSYGELGDMEENEWQMVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGK  75

Query  929   VRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLIL  1108
             V  + + A+ +GM+VCRTWAFNDG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL
Sbjct  76    VTEVFKHASSVGMSVCRTWAFNDGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLIL  135

Query  1109  CLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGL  1288
              LVNN +AYGGK QYVKW    G+ L+ S+D FF  P +R Y+K +VKTVL R NT T +
Sbjct  136   SLVNNWEAYGGKPQYVKWGNAAGLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNI  194

Query  1289  EYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKD  1468
              Y++DPTIFAWEL+NEPRC +D +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  
Sbjct  195   TYKEDPTIFAWELMNEPRCTSDSSGDVLQDWIKEMAFYVKSIDPKHLVEIGLEGFYGPST  254

Query  1469  PKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSH  1648
             P++ + NP  +A ++G+DFIRN  +  +DFASVH+YPD W         L F K W+ +H
Sbjct  255   PQKYQFNPNSYAHEVGTDFIRNHQVLGVDFASVHIYPDSWISQSVADSHLPFIKTWMEAH  314

Query  1649  IEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQF  1828
             IED E+ L  P++F EFG++ +        RD     + + +  S K   SGAGS+ WQ 
Sbjct  315   IEDAEKYLGMPVVFAEFGVSAKAPGYNSTYRDNLINTVYKTILNSTKKGGSGAGSLVWQL  374

Query  1829  LVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
               +  +  +D + IV  +  ST ++I+  S RLA
Sbjct  375   FPDGTDYMDDGYAIVLSKSPSTSSIISLQSTRLA  408



>ref|XP_002528703.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF33692.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=473

 Score =   386 bits (991),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 178/372 (48%), Positives = 244/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + GTQF  + Q FYVNG+N+YW M  A D   R +V  + Q A+ +G+TVCRTWAFN
Sbjct  73    MVGKKGTQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVTELFQQASSVGLTVCRTWAFN  132

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SPG +DE VF+ALD V++E+R++ IRLIL L NN  AYGGK QYVKW    
Sbjct  133   DGQWRALQKSPGVYDEDVFKALDFVVSEARKYKIRLILSLANNWDAYGGKAQYVKWGKAA  192

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R N++T + Y+DDPTIFAWEL+NEPRC +D
Sbjct  193   GLNLT-SDDDFFSHPTLRNYYKVHVKTVLNRVNSLTNITYKDDPTIFAWELMNEPRCTSD  251

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ ++KS+D  HL+ +G EGFYGP  P R + NP  +A  +G+DFIR+
Sbjct  252   PSGDKLQSWIQEMAVYIKSMDAKHLVEIGSEGFYGPSAPDRAQFNPNSYATQVGTDFIRH  311

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  IDFASVH+Y D W         ++FT  W+ +HIED E+ L  P++F EFG++ +
Sbjct  312   HQTLGIDFASVHIYADSWISQTISDAHIQFTNSWMQAHIEDAEKYLGMPVIFAEFGVSTK  371

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + I+  +  ST
Sbjct  372   DPGYNSSFRDTLISTVYKNLLNSTKKGGSGAGSLLWQLFPDGTDYMDDGYAIILSKSPST  431

Query  1895  YNLITNHSCRLA  1930
              N+I+ HS R+A
Sbjct  432   SNIISLHSTRVA  443



>ref|XP_006362338.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Solanum tuberosum]
Length=449

 Score =   385 bits (989),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/378 (47%), Positives = 248/378 (66%), Gaps = 1/378 (0%)
 Frame = +2

Query  794   EETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTV  973
             E+    + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G++V
Sbjct  43    EDGAAWTMVQKSGDQFLLNGQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQQASAVGLSV  102

Query  974   CRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQY  1153
             CRTWAFNDG + ALQ +P  +DE VF+ALD V++E+++  IRLIL LVNN +AYGGK+QY
Sbjct  103   CRTWAFNDGQWRALQKTPAVYDEDVFKALDFVVSEAKKFKIRLILSLVNNWEAYGGKSQY  162

Query  1154  VKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELIN  1333
             VKW    G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+N
Sbjct  163   VKWGKAAGLNLT-SDDDFFSHPTLKSYYKAHVKAVLNRVNTFTNMTYKDDPTIFGWELMN  221

Query  1334  EPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADL  1513
             EPRC +DP+GD L  WIEEM+ +VK+ID  HL+ +GLEGFYGP  P + +INP  +A  +
Sbjct  222   EPRCESDPSGDKLHAWIEEMAVYVKTIDPKHLVQIGLEGFYGPSTPNKAQINPNSYAQQV  281

Query  1514  GSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFT  1693
             G+DFIRN  +  +DFAS H+YPD W   +     + FTK W+ +HI+D E  L  P++F+
Sbjct  282   GTDFIRNHQVLGVDFASAHIYPDSWISQEISDAHIGFTKTWMQAHIDDAENYLNMPVVFS  341

Query  1694  EFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIV  1873
             EFG++ +        RD     +  I+  S K   +G GS+ WQ   E  +  +D + IV
Sbjct  342   EFGVSAKDPGYNSTFRDSLISTVYTILLNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIV  401

Query  1874  PWERASTYNLITNHSCRL  1927
               +  ST N+++ HS RL
Sbjct  402   LSKALSTSNIVSLHSKRL  419



>ref|XP_010683461.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 [Beta vulgaris 
subsp. vulgaris]
Length=449

 Score =   385 bits (988),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 246/378 (65%), Gaps = 1/378 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + VE+   QF  +G+ FY NG+N+YW M  A D   R +V  + Q A+ +G++VCRTWAF
Sbjct  52    TMVEKKANQFIVNGKPFYFNGFNTYWLMVFAADQSTRGKVSEVFQQASAVGLSVCRTWAF  111

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG Y ALQ SP  +DE VF+ LD V++E++++ IRLIL LVNN   YGGK QYV+W   
Sbjct  112   NDGQYRALQKSPSIYDEDVFKGLDFVVSEAKKYNIRLILSLVNNWNDYGGKPQYVQWGKD  171

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ LS S D FF D  ++ Y+KN++KTVL R NT+T + Y++DPTIFAWEL+NEPRC  
Sbjct  172   SGMNLS-SEDDFFSDSTLKTYYKNHIKTVLNRVNTITNVTYKNDPTIFAWELMNEPRCTA  230

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WI+EM+ +VKSID  HLL +GLEGFYGP  P R + NP  +A  +G+DF+R
Sbjct  231   DPSGDKLQAWIQEMAAYVKSIDSKHLLEIGLEGFYGPSTPDRAQFNPNTYATQVGTDFVR  290

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W         L+F + W+ +HIED E+ L  P++F EFG++ 
Sbjct  291   NHQVPGVDFASVHIYADSWTSPSISDAHLQFYQSWLQAHIEDAEKVLGMPVVFAEFGVSV  350

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD  +  + + M  SAK   SGAGS+ WQ   +  E  ND + IV  +  S
Sbjct  351   KDPGYNSSFRDTTYNTVYKTMVNSAKTGGSGAGSLMWQLFPDGTEYMNDGYAIVLSKSQS  410

Query  1892  TYNLITNHSCRLAGVHGV  1945
               ++I+ +S RL  ++ V
Sbjct  411   ISDMISLNSARLELINSV  428



>ref|XP_010543149.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X3 [Tarenaya 
hassleriana]
Length=465

 Score =   385 bits (990),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R GTQF  +G+ FYVNG+N+YW M  A D   R +V  + Q A+  G+TVCRTWAFN
Sbjct  64    MVQRKGTQFGINGRPFYVNGFNTYWLMILAADNSTRGKVTELFQQASAAGLTVCRTWAFN  123

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R+H IRLIL LVNN  A+GGK+QYVKW    
Sbjct  124   DGQWRALQKSPSVYDEDVFQALDFVVSEARKHKIRLILSLVNNWDAFGGKSQYVKWGNSY  183

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ ++D FF  P ++ ++KN+V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  184   GLNLTSADD-FFSHPTLKSFYKNHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRCPSD  242

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GDTLQ WI+EM+ F+KSID  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIRN
Sbjct  243   PSGDTLQSWIQEMAVFLKSIDAKHLVEIGLEGFYGPSAPDRTRFNPNTYAVQVGTDFIRN  302

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  IDFASVH Y D W      +  L+FT++W+  HIED E  L  P++F EFG++ +
Sbjct  303   HQVLGIDFASVHTYADSWISPAISESHLEFTRRWMEGHIEDAETYLGMPVVFAEFGVSSK  362

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S +   + AGS+ WQ   E  E  +D + +      S 
Sbjct  363   DPGFNSSFRDTLLNTVYKTILNSTRKGGAAAGSLLWQVFPEGTEYMDDGYALYLTRAHSA  422

Query  1895  YNLITNHSCRLA  1930
              N+I+ HS RLA
Sbjct  423   SNIISLHSTRLA  434



>ref|XP_006576281.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X3 
[Glycine max]
Length=462

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  63    MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  122

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN +AYGGK QYVKW    
Sbjct  123   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWEAYGGKPQYVKWGNAA  182

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  183   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  241

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P++ + NP  +A ++G+DFIRN
Sbjct  242   SSGDVLQDWIKEMAFYVKSIDPKHLVEIGLEGFYGPSTPQKYQFNPNSYAHEVGTDFIRN  301

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  302   HQVLGVDFASVHIYPDSWISQSVADSHLPFIKTWMEAHIEDAEKYLGMPVVFAEFGVSAK  361

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  362   APGYNSTYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIVLSKSPST  421

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  422   SSIISLQSTRLA  433



>ref|XP_007134568.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
 gb|ESW06562.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
Length=462

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  63    MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  122

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK QYVKW    
Sbjct  123   DGQWRALQKSPSVYDEDVFKALDFVVSEAKKYKIRLILSLVNNWEAYGGKAQYVKWGNAA  182

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y++ +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  183   GLNLT-SDDDFFSHPTLRSYYQAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  241

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P+R ++NP  +A  +G+DFIRN
Sbjct  242   SSGDVLQDWIKEMAFYVKSIDTKHLVEIGLEGFYGPSTPQRYQLNPNAFAQQVGTDFIRN  301

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  302   HQVLGVDFASVHIYPDSWISQSIADSHLPFIKSWMEAHIEDAEKYLGMPVVFGEFGVSAK  361

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  362   APGFNSSYRDNLVNTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIVLSKSPST  421

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  422   SSIISLQSTRLA  433



>ref|XP_009774303.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X3 [Nicotiana 
sylvestris]
Length=408

 Score =   383 bits (984),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 249/391 (64%), Gaps = 12/391 (3%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V    Q A+ +G++VCRTWAF
Sbjct  7     TMVQKSGNQFVVNGQPFYVNGFNTYWLMVFAADQSTRGKVTETFQQASAVGLSVCRTWAF  66

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ +P  +DE VF+ALD V++E++++ IRLIL +VNN +AYGGK+QYVKW   
Sbjct  67    NDGQWRALQKTPAVYDEDVFKALDFVVSEAKKYKIRLILSIVNNWEAYGGKSQYVKWGKA  126

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+NEPRC +
Sbjct  127   AGLNLT-SDDDFFSHPTLKSYYKAHVKAVLNRVNTFTNITYKDDPTIFGWELMNEPRCES  185

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFYG   P R  INP  +A  +G+DFIR
Sbjct  186   DPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFYGLSTPNRAHINPNSYAQQVGTDFIR  245

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         ++FTK W+ SHI+D E  L  P++F EFG++ 
Sbjct  246   NHQVLGVDFASVHIYPDSWISQSISDAHVEFTKSWMQSHIDDAENYLNMPVIFAEFGVSA  305

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   +G GS+ WQ   E  +  +D + IV  +  S
Sbjct  306   KDPGYNSTYRDTLIATVYKTILNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIVLSKSLS  365

Query  1892  TYNLITNHSCRLAGVHGVLPSQQEHLKSFCS  1984
             T N+++ HS +L               SFCS
Sbjct  366   TSNIVSLHSKKL-----------NTFNSFCS  385



>ref|XP_004492573.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Cicer arietinum]
Length=463

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/381 (48%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  64    MVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKQASSVGMTVCRTWAFN  123

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  124   DGQWKALQKSPSVYDEDVFKALDFVVSEAKKYKIRLILSLANNWEAYGGKAQYVKWGKDA  183

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+  +D FF  P +R Y+K++VKTVL R NT+T + Y++DPTIFAWEL+NEPRC +D
Sbjct  184   GLNLTIDDD-FFSHPTLRSYYKSHVKTVLNRVNTLTNITYKEDPTIFAWELMNEPRCTSD  242

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              TGD LQDWI+EM+  VK ID  HL+ VGLEGFYGP  P+RL+ NP  +A  +G+DFIRN
Sbjct  243   STGDKLQDWIQEMAFHVKKIDPKHLVEVGLEGFYGPSTPQRLQFNPNTYAQQVGTDFIRN  302

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W   Q     L F K W+ +HIED E+ L  P++F+EFG++ +
Sbjct  303   HQVLGVDFASVHMYADSWISTQIADTHLPFVKSWMEAHIEDAEKYLGMPVIFSEFGISSK  362

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQ   E  +  +D + IV  +  ST
Sbjct  363   DPGYNSTYRDTLINTVYSSILNSTKKGGSGAGSLLWQVFPEGTDNMDDGYAIVLSKSPST  422

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              ++++  S RL   + +  S+
Sbjct  423   SSIVSLQSYRLGLFNSLCSSK  443



>ref|XP_007134569.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
 gb|ESW06563.1| hypothetical protein PHAVU_010G058300g [Phaseolus vulgaris]
Length=438

 Score =   384 bits (987),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  39    MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  98

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK QYVKW    
Sbjct  99    DGQWRALQKSPSVYDEDVFKALDFVVSEAKKYKIRLILSLVNNWEAYGGKAQYVKWGNAA  158

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y++ +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  159   GLNLT-SDDDFFSHPTLRSYYQAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  217

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P+R ++NP  +A  +G+DFIRN
Sbjct  218   SSGDVLQDWIKEMAFYVKSIDTKHLVEIGLEGFYGPSTPQRYQLNPNAFAQQVGTDFIRN  277

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  278   HQVLGVDFASVHIYPDSWISQSIADSHLPFIKSWMEAHIEDAEKYLGMPVVFGEFGVSAK  337

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  338   APGFNSSYRDNLVNTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIVLSKSPST  397

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  398   SSIISLQSTRLA  409



>ref|XP_006576280.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Glycine max]
Length=463

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  64    MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  123

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN +AYGGK QYVKW    
Sbjct  124   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWEAYGGKPQYVKWGNAA  183

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  184   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  242

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P++ + NP  +A ++G+DFIRN
Sbjct  243   SSGDVLQDWIKEMAFYVKSIDPKHLVEIGLEGFYGPSTPQKYQFNPNSYAHEVGTDFIRN  302

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  303   HQVLGVDFASVHIYPDSWISQSVADSHLPFIKTWMEAHIEDAEKYLGMPVVFAEFGVSAK  362

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  363   APGYNSTYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIVLSKSPST  422

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  423   SSIISLQSTRLA  434



>ref|XP_010043514.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Eucalyptus 
grandis]
Length=416

 Score =   383 bits (984),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/392 (47%), Positives = 255/392 (65%), Gaps = 3/392 (1%)
 Frame = +2

Query  776   LWVSYPEETLKLSF--VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQA  949
             ++ +YP +T   ++  V++ G QF  +   FYVNG+N+YW M  A D   R +V  + Q 
Sbjct  1     MFSAYPGDTEDDAWPMVQKKGNQFVVNDHPFYVNGFNTYWLMVFAADESTRGKVSEVFQQ  60

Query  950   AAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLK  1129
             A+ +G+TVCRTWAFNDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L+NN +
Sbjct  61    ASAVGLTVCRTWAFNDGQWRALQKSPSVYDEVVFKALDFVVSEAKKYKIRLILSLINNWE  120

Query  1130  AYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPT  1309
             AYGGK QYVKW    G+ L+ S+D FF  P ++ Y+K +VK +L R NT T + Y+DDPT
Sbjct  121   AYGGKAQYVKWGKAAGLNLT-SDDQFFSHPTLKSYYKAHVKNLLNRVNTFTNITYKDDPT  179

Query  1310  IFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKIN  1489
             IFAWELINEPRC  DP+GDTLQ WIEEM+ FVKSID  HL+ +G+EGFYG   P +++ N
Sbjct  180   IFAWELINEPRCTLDPSGDTLQAWIEEMAVFVKSIDPKHLVEIGMEGFYGLSTPNKVQYN  239

Query  1490  PELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERA  1669
             P  +A  +G+DFIRN     IDFASVH+Y D W         L+FTK W+ +HIED E  
Sbjct  240   PNTYAQQVGTDFIRNHLALGIDFASVHIYADSWISPSITDAHLQFTKSWMEAHIEDAEMY  299

Query  1670  LKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEE  1849
             L  P++F+EFG++          R+    L+ + +  S K   +GAGS+ WQ   E  + 
Sbjct  300   LGMPVLFSEFGVSANDPGYNSSFRNTLISLVYKTLLNSTKKGGAGAGSLLWQLFPEGTDY  359

Query  1850  YNDEFGIVPWERASTYNLITNHSCRLAGVHGV  1945
              +D + +V  +  ST N+++ HS RLA  + V
Sbjct  360   MDDGYAVVLSKSPSTSNIMSLHSTRLAIFNSV  391



>ref|XP_011018985.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X5 
[Populus euphratica]
 ref|XP_011018986.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X5 
[Populus euphratica]
 ref|XP_011018987.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X5 
[Populus euphratica]
 ref|XP_011018988.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X5 
[Populus euphratica]
Length=439

 Score =   384 bits (986),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/373 (48%), Positives = 243/373 (65%), Gaps = 2/373 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V R G QF  + Q FYVNG+N+YW M  A D   R ++  + Q A+ +G+TVCRTWAFN
Sbjct  39    MVARKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKITEVFQQASSVGLTVCRTWAFN  98

Query  995   DGAYNALQISPGKFDERVFR-ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             DG + ALQ SPG +DE VF+ ALD V++E++++ IRLIL L NN  AYGGK QYVKW   
Sbjct  99    DGQWRALQKSPGVYDEDVFKLALDFVVSEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKA  158

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +
Sbjct  159   TGLNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTLTNITYKDDPTIFAWELMNEPRCTS  217

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIR
Sbjct  218   DPSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIR  277

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W         ++F K W+ +HIED ER L  P++F EFG++ 
Sbjct  278   NHQVLGVDFASVHIYADSWISQTISDSHIQFIKSWMEAHIEDAERYLGMPVVFAEFGVSS  337

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  338   KDPGYNSSFRDTMINTVYKTLLNSTKRGGSGAGSLLWQIFPDGTDYMDDGYAIVLSKSPS  397

Query  1892  TYNLITNHSCRLA  1930
             T N+I+ HS R+A
Sbjct  398   TSNIISLHSARVA  410



>ref|XP_009614143.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Nicotiana 
tomentosiformis]
Length=436

 Score =   384 bits (985),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/397 (46%), Positives = 255/397 (64%), Gaps = 7/397 (2%)
 Frame = +2

Query  737   AAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFG  916
             AA    I  T G++      E  + + V+++G QF  +GQ FYVNG+N+YW M  A D  
Sbjct  16    AASFLLIVCTKGEM------EDGEWTMVQKSGNQFVVNGQPFYVNGFNTYWLMVFAADQS  69

Query  917   RRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGI  1096
              R +V    Q A+ +G++VCRTWAFNDG + ALQ +P  +DE VF+ALD V++E++++ I
Sbjct  70    TRGKVTETFQQASAVGLSVCRTWAFNDGQWRALQKTPSVYDEDVFKALDFVVSEAKKYKI  129

Query  1097  RLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNT  1276
             RLIL LVNN +AYGGK+QYVKW    G+ L+ S+D FF  P ++ Y+K +VK VL R NT
Sbjct  130   RLILSLVNNWEAYGGKSQYVKWGKAAGLNLT-SDDDFFSHPILKSYYKAHVKAVLNRVNT  188

Query  1277  VTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFY  1456
              T + Y+DDPTIF WEL+NEPRC +DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFY
Sbjct  189   FTNITYKDDPTIFGWELMNEPRCESDPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFY  248

Query  1457  GPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKW  1636
             G   P R ++NP  +A  +G+DFIRN  +  +DFASVH+YPD W         ++FTK W
Sbjct  249   GLSTPNRAQVNPNSYAQQVGTDFIRNHQVLGVDFASVHIYPDSWISKSISDAHVEFTKSW  308

Query  1637  ILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSV  1816
             + SHI+D E  L  P++F EFG++ +        RD     + + +  S K   +G GS+
Sbjct  309   MQSHIDDAENYLNMPVIFAEFGVSAKDPGYNSTYRDTLIATVYKTILNSTKKGGAGGGSL  368

Query  1817  FWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRL  1927
              WQ   E  +  +D + IV  +  ST N+++ HS +L
Sbjct  369   LWQVFPEGTDYMDDGYAIVLSKSLSTSNIVSLHSKKL  405



>gb|KEH23282.1| mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=458

 Score =   384 bits (987),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/381 (47%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  +GQ FY+NG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  59    MVGKKGNQFVVNGQPFYINGFNTYWLMMFAADDSTRGKVTEVFKQASSLGMTVCRTWAFN  118

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  119   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLANNWEAYGGKAQYVKWGKDA  178

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D F+    +R Y+K++VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  179   GLNLT-SDDDFYTHSTLRSYYKSHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCNSD  237

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  V  ID  HL+ +GLEGFYGP  P+RL+ NP  +A  +G+DFIRN
Sbjct  238   PTGDKLQDWIQEMAFHVNKIDPKHLVEIGLEGFYGPSTPQRLQFNPNTYAQQVGTDFIRN  297

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W   Q     + F K W+ +HIED E+ L  P++F+EFG++ +
Sbjct  298   HQVLGVDFASVHMYADSWVSPQIADTHISFVKSWMDAHIEDAEKYLGMPVVFSEFGVSSK  357

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQ   E  +  +D + IV  +  ST
Sbjct  358   DPGYNSTYRDTLISTVYSAVLNSTKKGGSGAGSLLWQVFPEGTDNMDDGYAIVFSKSPST  417

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              +++T  S RLA  + V  ++
Sbjct  418   SSIVTLQSTRLALFNSVCSTR  438



>ref|XP_009774302.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Nicotiana 
sylvestris]
Length=436

 Score =   384 bits (985),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V    Q A+ +G++VCRTWAF
Sbjct  35    TMVQKSGNQFVVNGQPFYVNGFNTYWLMVFAADQSTRGKVTETFQQASAVGLSVCRTWAF  94

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ +P  +DE VF+ALD V++E++++ IRLIL +VNN +AYGGK+QYVKW   
Sbjct  95    NDGQWRALQKTPAVYDEDVFKALDFVVSEAKKYKIRLILSIVNNWEAYGGKSQYVKWGKA  154

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+NEPRC +
Sbjct  155   AGLNLT-SDDDFFSHPTLKSYYKAHVKAVLNRVNTFTNITYKDDPTIFGWELMNEPRCES  213

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFYG   P R  INP  +A  +G+DFIR
Sbjct  214   DPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFYGLSTPNRAHINPNSYAQQVGTDFIR  273

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         ++FTK W+ SHI+D E  L  P++F EFG++ 
Sbjct  274   NHQVLGVDFASVHIYPDSWISQSISDAHVEFTKSWMQSHIDDAENYLNMPVIFAEFGVSA  333

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   +G GS+ WQ   E  +  +D + IV  +  S
Sbjct  334   KDPGYNSTYRDTLIATVYKTILNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIVLSKSLS  393

Query  1892  TYNLITNHSCRL  1927
             T N+++ HS +L
Sbjct  394   TSNIVSLHSKKL  405



>ref|XP_008456477.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 [Cucumis melo]
Length=477

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/373 (50%), Positives = 250/373 (67%), Gaps = 1/373 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             S VE    QF  DGQ FYVNG+N+YW M  A D   R +V  + + AA +G+TVCRTWAF
Sbjct  73    SMVETKQNQFVVDGQPFYVNGFNTYWLMIFAADQSTRGKVTEVFKQAASVGLTVCRTWAF  132

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ LD VI+E++++ IRLIL L NN +A+GGK QYVKW   
Sbjct  133   NDGQWRALQKSPSVYDEEVFKGLDFVISEAKKYKIRLILSLANNWEAFGGKAQYVKWGKA  192

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF DP +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +
Sbjct  193   AGLNLT-SDDDFFTDPTLRSYYKAHVKTVLNRVNTYTNVTYKEDPTIFAWELMNEPRCTS  251

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+G+TLQ WI+EM+ FVKS+D  HLL VGLEGFYGP  P R++ NP  +A  +G+DFIR
Sbjct  252   DPSGNTLQGWIQEMAVFVKSMDPKHLLEVGLEGFYGPSTPNRVQFNPNTYAQQVGTDFIR  311

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W         L+FTK W+ +HIED E+ L  P++F EFG++ 
Sbjct  312   NHKVLGVDFASVHIYADTWVSQAISDAHLQFTKSWMEAHIEDAEKYLGMPVIFAEFGVSS  371

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD++   + +++  S K   SG GS+ WQ   E  +  +D + IV  +  S
Sbjct  372   KDPGYNSTYRDKYLSSVYKMLLDSTKKGGSGGGSLVWQLFPEGTDYMDDGYAIVLSKSPS  431

Query  1892  TYNLITNHSCRLA  1930
             T N+I+ HS R++
Sbjct  432   TSNIISLHSTRMS  444



>gb|KEH23283.1| mannan endo-1,4-beta-mannosidase [Medicago truncatula]
Length=457

 Score =   384 bits (986),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/381 (47%), Positives = 248/381 (65%), Gaps = 1/381 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  +GQ FY+NG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  58    MVGKKGNQFVVNGQPFYINGFNTYWLMMFAADDSTRGKVTEVFKQASSLGMTVCRTWAFN  117

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  118   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLANNWEAYGGKAQYVKWGKDA  177

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D F+    +R Y+K++VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  178   GLNLT-SDDDFYTHSTLRSYYKSHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCNSD  236

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  V  ID  HL+ +GLEGFYGP  P+RL+ NP  +A  +G+DFIRN
Sbjct  237   PTGDKLQDWIQEMAFHVNKIDPKHLVEIGLEGFYGPSTPQRLQFNPNTYAQQVGTDFIRN  296

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W   Q     + F K W+ +HIED E+ L  P++F+EFG++ +
Sbjct  297   HQVLGVDFASVHMYADSWVSPQIADTHISFVKSWMDAHIEDAEKYLGMPVVFSEFGVSSK  356

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQ   E  +  +D + IV  +  ST
Sbjct  357   DPGYNSTYRDTLISTVYSAVLNSTKKGGSGAGSLLWQVFPEGTDNMDDGYAIVFSKSPST  416

Query  1895  YNLITNHSCRLAGVHGVLPSQ  1957
              +++T  S RLA  + V  ++
Sbjct  417   SSIVTLQSTRLALFNSVCSTR  437



>ref|XP_011018983.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X3 
[Populus euphratica]
Length=469

 Score =   384 bits (987),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/373 (48%), Positives = 243/373 (65%), Gaps = 2/373 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V R G QF  + Q FYVNG+N+YW M  A D   R ++  + Q A+ +G+TVCRTWAFN
Sbjct  69    MVARKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKITEVFQQASSVGLTVCRTWAFN  128

Query  995   DGAYNALQISPGKFDERVFR-ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             DG + ALQ SPG +DE VF+ ALD V++E++++ IRLIL L NN  AYGGK QYVKW   
Sbjct  129   DGQWRALQKSPGVYDEDVFKLALDFVVSEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKA  188

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +
Sbjct  189   TGLNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTLTNITYKDDPTIFAWELMNEPRCTS  247

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIR
Sbjct  248   DPSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIR  307

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W         ++F K W+ +HIED ER L  P++F EFG++ 
Sbjct  308   NHQVLGVDFASVHIYADSWISQTISDSHIQFIKSWMEAHIEDAERYLGMPVVFAEFGVSS  367

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  368   KDPGYNSSFRDTMINTVYKTLLNSTKRGGSGAGSLLWQIFPDGTDYMDDGYAIVLSKSPS  427

Query  1892  TYNLITNHSCRLA  1930
             T N+I+ HS R+A
Sbjct  428   TSNIISLHSARVA  440



>ref|XP_009774301.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X1 [Nicotiana 
sylvestris]
Length=439

 Score =   383 bits (984),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V    Q A+ +G++VCRTWAF
Sbjct  38    TMVQKSGNQFVVNGQPFYVNGFNTYWLMVFAADQSTRGKVTETFQQASAVGLSVCRTWAF  97

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ +P  +DE VF+ALD V++E++++ IRLIL +VNN +AYGGK+QYVKW   
Sbjct  98    NDGQWRALQKTPAVYDEDVFKALDFVVSEAKKYKIRLILSIVNNWEAYGGKSQYVKWGKA  157

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+NEPRC +
Sbjct  158   AGLNLT-SDDDFFSHPTLKSYYKAHVKAVLNRVNTFTNITYKDDPTIFGWELMNEPRCES  216

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFYG   P R  INP  +A  +G+DFIR
Sbjct  217   DPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFYGLSTPNRAHINPNSYAQQVGTDFIR  276

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         ++FTK W+ SHI+D E  L  P++F EFG++ 
Sbjct  277   NHQVLGVDFASVHIYPDSWISQSISDAHVEFTKSWMQSHIDDAENYLNMPVIFAEFGVSA  336

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   +G GS+ WQ   E  +  +D + IV  +  S
Sbjct  337   KDPGYNSTYRDTLIATVYKTILNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIVLSKSLS  396

Query  1892  TYNLITNHSCRL  1927
             T N+++ HS +L
Sbjct  397   TSNIVSLHSKKL  408



>ref|XP_011018984.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X4 
[Populus euphratica]
Length=468

 Score =   384 bits (986),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/373 (48%), Positives = 243/373 (65%), Gaps = 2/373 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V R G QF  + Q FYVNG+N+YW M  A D   R ++  + Q A+ +G+TVCRTWAFN
Sbjct  68    MVARKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKITEVFQQASSVGLTVCRTWAFN  127

Query  995   DGAYNALQISPGKFDERVFR-ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             DG + ALQ SPG +DE VF+ ALD V++E++++ IRLIL L NN  AYGGK QYVKW   
Sbjct  128   DGQWRALQKSPGVYDEDVFKLALDFVVSEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKA  187

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +
Sbjct  188   TGLNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTLTNITYKDDPTIFAWELMNEPRCTS  246

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIR
Sbjct  247   DPSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIR  306

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W         ++F K W+ +HIED ER L  P++F EFG++ 
Sbjct  307   NHQVLGVDFASVHIYADSWISQTISDSHIQFIKSWMEAHIEDAERYLGMPVVFAEFGVSS  366

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  S
Sbjct  367   KDPGYNSSFRDTMINTVYKTLLNSTKRGGSGAGSLLWQIFPDGTDYMDDGYAIVLSKSPS  426

Query  1892  TYNLITNHSCRLA  1930
             T N+I+ HS R+A
Sbjct  427   TSNIISLHSARVA  439



>gb|ACU19893.1| unknown [Glycine max]
Length=462

 Score =   384 bits (985),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 242/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G  F  + + FYVNG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  63    MVQKKGNHFVVNDKPFYVNGFNTYWLMVFAADESTRGKVTEVFKQASSVGMTVCRTWAFN  122

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  123   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLANNWEAYGGKAQYVKWGNAA  182

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  183   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  241

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  VK ID  HL+ VG+EGFYGP  P+R + NP  +A  +G+DFIRN
Sbjct  242   PTGDKLQDWIQEMAFHVKKIDPKHLVEVGVEGFYGPSTPQRTQFNPNTYATQVGTDFIRN  301

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D WF  Q     + F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  302   HLVLGVDFASVHIYADSWFSQQIADTHIPFIKSWMEAHIEDAEKYLGMPVVFAEFGVSSK  361

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQF  +  +  +D + IV  +  ST
Sbjct  362   DPGYNSSYRDTVISTVYSTILNSTKKGGSGAGSLLWQFFPDGTDNMDDGYAIVLSKSPST  421

Query  1895  YNLITNHSCRLA  1930
               +I   S RLA
Sbjct  422   SGIIQLQSTRLA  433



>ref|XP_003548330.2| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Glycine max]
Length=462

 Score =   384 bits (985),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/372 (48%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  63    MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  122

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN +AYGGK QYVKW    
Sbjct  123   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLANNWEAYGGKAQYVKWGNAA  182

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P++R Y+K + KTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  183   GLNLT-SDDEFFSHPSLRSYYKAHAKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  241

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P++ + NP  +A ++G+DFIRN
Sbjct  242   SSGDVLQDWIKEMAFYVKSIDPKHLVEIGLEGFYGPSTPQKYQFNPNSYAQEVGTDFIRN  301

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  302   HQVLGVDFASVHIYPDSWISQSIADSHLPFIKSWMEAHIEDAEKYLGMPVVFAEFGVSAK  361

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  362   APGYNSTYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYSIVLSKSPST  421

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  422   SSIISLQSTRLA  433



>ref|XP_006466833.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=436

 Score =   382 bits (982),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 263/409 (64%), Gaps = 11/409 (3%)
 Frame = +2

Query  728   IGFAAFLAFIY--LTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEH  901
             + FA FLAF     +F  L V   +      F+   G+ F  +G +++ NG+N+YW M  
Sbjct  6     LAFAIFLAFFIHRQSFNVLHVEAGD-----GFIRTRGSHFLLNGNLYFANGFNAYWLMYV  60

Query  902   AVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAES  1081
             A D  +R +V T    AA  G+TV RTWAF+DG Y  LQ SPG ++E++F+ LD VIAE+
Sbjct  61    ASDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEA  120

Query  1082  RRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVL  1261
             R++GI+LIL L NN  ++GGK QYV WA  +G  L+ S+D FF +P ++ Y+KN +KTVL
Sbjct  121   RKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLT-SDDDFFRNPVVKGYYKNLIKTVL  179

Query  1262  TRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVG  1441
              R NT TG+ Y+DDPTI AWEL+NEPRC +DP+G T+Q WI EM+++VKSID+NHLL  G
Sbjct  180   NRYNTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASYVKSIDRNHLLEAG  239

Query  1442  LEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLK  1621
             LEGFYG   P+R ++NP L   D+G+DFI N+ +  IDFA+VH YPD W  +   +D+L 
Sbjct  240   LEGFYGQSTPQRKRVNPNL---DIGTDFIANNLIPGIDFATVHSYPDQWLSSSNDRDQLS  296

Query  1622  FTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKS  1801
             F   W+ +HI+D E  L+KPI+  EFG + +      YQRD  F  +   +Y SAK   +
Sbjct  297   FLNNWLDTHIQDAEHILRKPILLAEFGKSRKDPGYSTYQRDVMFNTVYYKIYSSAKRGGA  356

Query  1802  GAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
              AG +FWQ L E M+ + D + IV  +  ST N+IT  + +L  +  + 
Sbjct  357   AAGGLFWQLLTEGMDAFRDGYEIVLSQSPSTANVITQQAHKLYQIRKIF  405



>ref|XP_011018981.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Populus euphratica]
Length=472

 Score =   384 bits (985),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 243/372 (65%), Gaps = 2/372 (1%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             V R G QF  + Q FYVNG+N+YW M  A D   R ++  + Q A+ +G+TVCRTWAFND
Sbjct  73    VARKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKITEVFQQASSVGLTVCRTWAFND  132

Query  998   GAYNALQISPGKFDERVFR-ALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             G + ALQ SPG +DE VF+ ALD V++E++++ IRLIL L NN  AYGGK QYVKW    
Sbjct  133   GQWRALQKSPGVYDEDVFKLALDFVVSEAKKYKIRLILSLTNNWDAYGGKAQYVKWGKAT  192

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VK VL R NT+T + Y+DDPTIFAWEL+NEPRC +D
Sbjct  193   GLNLT-SDDDFFSHPTLRSYYKAHVKAVLNRVNTLTNITYKDDPTIFAWELMNEPRCTSD  251

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIRN
Sbjct  252   PSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIRN  311

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W         ++F K W+ +HIED ER L  P++F EFG++ +
Sbjct  312   HQVLGVDFASVHIYADSWISQTISDSHIQFIKSWMEAHIEDAERYLGMPVVFAEFGVSSK  371

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  372   DPGYNSSFRDTMINTVYKTLLNSTKRGGSGAGSLLWQIFPDGTDYMDDGYAIVLSKSPST  431

Query  1895  YNLITNHSCRLA  1930
              N+I+ HS R+A
Sbjct  432   SNIISLHSARVA  443



>gb|KDO70993.1| hypothetical protein CISIN_1g013811mg [Citrus sinensis]
Length=436

 Score =   382 bits (981),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 187/409 (46%), Positives = 263/409 (64%), Gaps = 11/409 (3%)
 Frame = +2

Query  728   IGFAAFLAFIY--LTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEH  901
             + FA FLAF     +F  L V   +      F+   G+ F  +G +++ NG+N+YW M  
Sbjct  6     LAFAIFLAFFIHRQSFNVLHVEAGD-----GFIRTRGSHFLLNGNLYFANGFNAYWLMYV  60

Query  902   AVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAES  1081
             A D  +R +V T    AA  G+TV RTWAF+DG Y  LQ SPG ++E++F+ LD VIAE+
Sbjct  61    ASDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEA  120

Query  1082  RRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVL  1261
             R++GI+LIL L NN  ++GGK QYV WA  +G  L+ S+D FF +P ++ Y+KN +KTVL
Sbjct  121   RKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLT-SDDDFFRNPVVKGYYKNLIKTVL  179

Query  1262  TRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVG  1441
              R NT TG+ Y+DDPTI AWEL+NEPRC +DP+G T+Q WI EM+++VKSID+NHLL  G
Sbjct  180   NRYNTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASYVKSIDRNHLLEAG  239

Query  1442  LEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLK  1621
             LEGFYG   P+R ++NP L   D+G+DF+ N+ +  IDFA+VH YPD W  +   +D+L 
Sbjct  240   LEGFYGQSTPQRKRVNPNL---DIGTDFVANNLIPGIDFATVHSYPDQWLSSSNDRDQLS  296

Query  1622  FTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKS  1801
             F   W+ +HI+D E  L+KPI+  EFG + +      YQRD  F  +   +Y SAK   +
Sbjct  297   FLNNWLDTHIQDAEHILRKPILLAEFGKSRKDPGYSTYQRDVMFNTVYYKIYSSAKRGGA  356

Query  1802  GAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
              AG +FWQ L E M+ + D + IV  +  ST N+IT  + +L  +  + 
Sbjct  357   AAGGLFWQLLTEGMDAFRDGYEIVLSQSPSTANVITQQAHKLYQIRKIF  405



>ref|XP_011095154.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X1 [Sesamum 
indicum]
Length=477

 Score =   384 bits (985),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 251/372 (67%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  AVD   R +V  + Q A+ +G++VCRTWAF
Sbjct  77    TMVQKSGNQFIVNGQPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQASAVGLSVCRTWAF  136

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+ R+ IRLIL LVNN +AYGGK+QYVKW   
Sbjct  137   NDGQWRALQTSPSVYDEDVFKALDFVVSEAHRYKIRLILSLVNNWEAYGGKSQYVKWGKA  196

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +V TVL R NT+T + Y+DDPTIFAWEL+NEPRC +
Sbjct  197   AGLNLT-SDDDFFSHPTLKSYYKAHVHTVLNRVNTITNITYKDDPTIFAWELMNEPRCES  255

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFYGP  P +++ NP  +A  +G+DFIR
Sbjct  256   DPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFYGPSTPNKVQYNPNTYAQQVGTDFIR  315

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         ++FTK W+ +HI+D E  L  P++F+EFG++ 
Sbjct  316   NHQVLGVDFASVHIYPDSWISQSISDAHVEFTKSWMQAHIDDAENFLSMPVVFSEFGVST  375

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S +   SG GS+ WQ   E  +  +D + +V  + +S
Sbjct  376   KDPGYNATYRDTLISTVYKTLLNSTRKGGSGGGSLLWQLFPEGTDYMDDGYAVVLSKSSS  435

Query  1892  TYNLITNHSCRL  1927
             T N+I+  S RL
Sbjct  436   TSNIISLQSTRL  447



>ref|XP_010244546.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 [Nelumbo nucifera]
Length=493

 Score =   384 bits (986),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 181/371 (49%), Positives = 244/371 (66%), Gaps = 2/371 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  + Q FYVNG+N+YW M  A D   R +V  + Q A+ +G+TVCRTWAFN
Sbjct  96    MVGKKGKQFIVNDQPFYVNGFNTYWLMVLAADQSTRGKVTELFQQASSVGLTVCRTWAFN  155

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+++H IRLIL LVNN  AYGGK QYVKW    
Sbjct  156   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKHKIRLILPLVNNWDAYGGKAQYVKWGKDA  215

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ SND FF +P ++ Y+K +VKTVLTR NT+T + Y+DDPTIFAWEL+NEPRC +D
Sbjct  216   GLNLT-SNDDFFSNPTLKSYYKAHVKTVLTRVNTLTNVSYKDDPTIFAWELMNEPRCESD  274

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G+ LQ WI+EM+ +VKSID NHLL +G+EGFYGP  P R++ NP  +A  +G+DFIRN
Sbjct  275   PSGNKLQAWIQEMAVYVKSIDPNHLLEIGVEGFYGPSKPDRVQFNPNTYAQQVGTDFIRN  334

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         ++F K W+ +HIED E  L  P++F EFG++ +
Sbjct  335   HQALGVDFASVHIYADSWISQSISDAHIQFVKSWMQAHIEDAE-TLGMPVVFGEFGVSAK  393

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD F   + + +  S +   SG+G+  WQ   E  +  +D + IV     ST
Sbjct  394   DGGYNSSFRDTFISTVYKTVLDSTRKGGSGSGTFVWQLFPEGTDYMDDGYAIVLSRSPST  453

Query  1895  YNLITNHSCRL  1927
              N+I+  S RL
Sbjct  454   SNIISLQSTRL  464



>ref|XP_011095155.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Sesamum 
indicum]
Length=450

 Score =   382 bits (982),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 251/372 (67%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  AVD   R +V  + Q A+ +G++VCRTWAF
Sbjct  50    TMVQKSGNQFIVNGQPFYVNGFNTYWLMVFAVDQSTRGKVSEVFQQASAVGLSVCRTWAF  109

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD V++E+ R+ IRLIL LVNN +AYGGK+QYVKW   
Sbjct  110   NDGQWRALQTSPSVYDEDVFKALDFVVSEAHRYKIRLILSLVNNWEAYGGKSQYVKWGKA  169

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +V TVL R NT+T + Y+DDPTIFAWEL+NEPRC +
Sbjct  170   AGLNLT-SDDDFFSHPTLKSYYKAHVHTVLNRVNTITNITYKDDPTIFAWELMNEPRCES  228

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFYGP  P +++ NP  +A  +G+DFIR
Sbjct  229   DPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFYGPSTPNKVQYNPNTYAQQVGTDFIR  288

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         ++FTK W+ +HI+D E  L  P++F+EFG++ 
Sbjct  289   NHQVLGVDFASVHIYPDSWISQSISDAHVEFTKSWMQAHIDDAENFLSMPVVFSEFGVST  348

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S +   SG GS+ WQ   E  +  +D + +V  + +S
Sbjct  349   KDPGYNATYRDTLISTVYKTLLNSTRKGGSGGGSLLWQLFPEGTDYMDDGYAVVLSKSSS  408

Query  1892  TYNLITNHSCRL  1927
             T N+I+  S RL
Sbjct  409   TSNIISLQSTRL  420



>ref|XP_010921181.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Elaeis guineensis]
Length=434

 Score =   382 bits (980),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/370 (48%), Positives = 241/370 (65%), Gaps = 1/370 (0%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             VE+ G QF   GQ FY NG+N+YW M  AVD   R +V  + Q A  +G TVCRTWAFND
Sbjct  34    VEKKGNQFIVAGQPFYFNGFNTYWLMIFAVDQSTRRKVTEVFQEALSVGYTVCRTWAFND  93

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQ SP  +DE VF+ LD V++E+R++ IRLIL LVNN + YGGK QYVKW    G
Sbjct  94    GGWRALQKSPSVYDEEVFKGLDFVVSEARKYKIRLILSLVNNWEGYGGKAQYVKWGQAAG  153

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + L+ S+D FF D  ++ Y+K +VK +LTR NT T + Y+DDPTIFAWEL+NEPRC++D 
Sbjct  154   LNLT-SDDDFFSDATVKGYYKAHVKAILTRVNTYTNITYKDDPTIFAWELMNEPRCLSDS  212

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GD LQ WI+EM+  VKSID  HLL +G EGFYGP  P+RL++NP  +A  +G+DFIRN 
Sbjct  213   SGDKLQAWIQEMAFHVKSIDPVHLLEIGTEGFYGPSTPERLQLNPNTFAGQVGADFIRNH  272

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
                 IDFAS H+YPD W  N      ++F K W+ +H +D E  L  P++F EFGL+ + 
Sbjct  273   RALGIDFASAHMYPDSWVSNSISDAHIQFVKTWMQNHTDDAENVLGMPVVFGEFGLSSKD  332

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
              +     RD+F   +      S +   SGAG + WQ   E  +  +D + +VP +  ST 
Sbjct  333   DKFNLTFRDKFINTVFATQLNSLRRGGSGAGCLLWQLFPEGTDYMDDGYAVVPSKSPSTS  392

Query  1898  NLITNHSCRL  1927
             ++++ HS RL
Sbjct  393   SILSLHSRRL  402



>ref|XP_010043507.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X1 [Eucalyptus 
grandis]
 gb|KCW88388.1| hypothetical protein EUGRSUZ_A00780 [Eucalyptus grandis]
Length=469

 Score =   383 bits (983),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/384 (47%), Positives = 250/384 (65%), Gaps = 3/384 (1%)
 Frame = +2

Query  785   SYPEETLKLS--FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAK  958
             +YP +T   +   V++ G QF  +   FYVNG+N+YW M  A D   R +V  + Q A+ 
Sbjct  57    AYPGDTEDDAWPMVQKKGNQFVVNDHPFYVNGFNTYWLMVFAADESTRGKVSEVFQQASA  116

Query  959   MGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYG  1138
             +G+TVCRTWAFNDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L+NN +AYG
Sbjct  117   VGLTVCRTWAFNDGQWRALQKSPSVYDEVVFKALDFVVSEAKKYKIRLILSLINNWEAYG  176

Query  1139  GKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFA  1318
             GK QYVKW    G+ L+ S+D FF  P ++ Y+K +VK +L R NT T + Y+DDPTIFA
Sbjct  177   GKAQYVKWGKAAGLNLT-SDDQFFSHPTLKSYYKAHVKNLLNRVNTFTNITYKDDPTIFA  235

Query  1319  WELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPEL  1498
             WELINEPRC  DP+GDTLQ WIEEM+ FVKSID  HL+ +G+EGFYG   P +++ NP  
Sbjct  236   WELINEPRCTLDPSGDTLQAWIEEMAVFVKSIDPKHLVEIGMEGFYGLSTPNKVQYNPNT  295

Query  1499  WAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKK  1678
             +A  +G+DFIRN     IDFASVH+Y D W         L+FTK W+ +HIED E  L  
Sbjct  296   YAQQVGTDFIRNHLALGIDFASVHIYADSWISPSITDAHLQFTKSWMEAHIEDAEMYLGM  355

Query  1679  PIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYND  1858
             P++F+EFG++          R+    L+ + +  S K   +GAGS+ WQ   E  +  +D
Sbjct  356   PVLFSEFGVSANDPGYNSSFRNTLISLVYKTLLNSTKKGGAGAGSLLWQLFPEGTDYMDD  415

Query  1859  EFGIVPWERASTYNLITNHSCRLA  1930
              + +V  +  ST N+++ HS RLA
Sbjct  416   GYAVVLSKSPSTSNIMSLHSTRLA  439



>gb|KEH23290.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=410

 Score =   380 bits (977),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 243/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  + Q FY+NG+N+YW M  A D   R +V  + + A  +GMTVCRTWAF 
Sbjct  11    MVGKKGNQFVVNSQPFYINGFNAYWLMMFAADDSTRRKVTEVFKQATSLGMTVCRTWAFT  70

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG   ALQ SP  +D+ VF+ALD V++E++++ IRLIL L NN ++YGGK+QYVKW    
Sbjct  71    DGQRQALQKSPSVYDKEVFKALDFVVSEAKKYKIRLILSLANNWESYGGKSQYVKWGKDA  130

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D F+    +R Y+K++VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  131   GLNLT-SDDDFYTHSTLRSYYKSHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCNSD  189

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  VK ID  HL+ +GLEGFYGP  P+RL+ NP  +A  +G+DFIRN
Sbjct  190   PTGDKLQDWIQEMAFHVKKIDPKHLVEIGLEGFYGPSTPQRLQFNPNTYAQQVGTDFIRN  249

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W   Q     + F K W+ +HIED E+ L  P++F+EFG++ +
Sbjct  250   HQVLGVDFASVHMYADSWVSQQIADTHIPFVKSWMDAHIEDAEKYLGMPVIFSEFGVSSK  309

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQ   E M+  +D + IV  +  ST
Sbjct  310   DPGYNSTYRDTLISTVYSSILNSTKKGGSGAGSLLWQVFSEGMDNMDDGYAIVFSKSPST  369

Query  1895  YNLITNHSCRLA  1930
              +++T  S RLA
Sbjct  370   SSIVTLQSTRLA  381



>ref|XP_006599739.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Glycine max]
Length=495

 Score =   383 bits (984),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/372 (48%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  + Q FYVNG+N+YW M  A D   R +V  + + A+ +GM+VCRTWAFN
Sbjct  96    MVQTKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGKVTEVFKHASSVGMSVCRTWAFN  155

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN +AYGGK QYVKW    
Sbjct  156   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLANNWEAYGGKAQYVKWGNAA  215

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P++R Y+K + KTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  216   GLNLT-SDDEFFSHPSLRSYYKAHAKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  274

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +GD LQDWI+EM+ +VKSID  HL+ +GLEGFYGP  P++ + NP  +A ++G+DFIRN
Sbjct  275   SSGDVLQDWIKEMAFYVKSIDPKHLVEIGLEGFYGPSTPQKYQFNPNSYAQEVGTDFIRN  334

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+YPD W         L F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  335   HQVLGVDFASVHIYPDSWISQSIADSHLPFIKSWMEAHIEDAEKYLGMPVVFAEFGVSAK  394

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  395   APGYNSTYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYSIVLSKSPST  454

Query  1895  YNLITNHSCRLA  1930
              ++I+  S RLA
Sbjct  455   SSIISLQSTRLA  466



>ref|XP_004149910.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Cucumis sativus]
 ref|XP_004162544.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Cucumis sativus]
 gb|KGN47821.1| hypothetical protein Csa_6G405340 [Cucumis sativus]
Length=477

 Score =   382 bits (982),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 250/379 (66%), Gaps = 1/379 (0%)
 Frame = +2

Query  794   EETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTV  973
             +E+   S VE    QF  DGQ FYVNG+N+YW M  A D   R +V  + + AA +G+TV
Sbjct  67    KESDAWSMVETKQNQFVVDGQPFYVNGFNTYWLMIFAADQSTRGKVTEVFKQAASVGLTV  126

Query  974   CRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQY  1153
             CRTWAFNDG + ALQ SP  +DE VF+ LD VI+E+++  IRLIL L NN +A+GGK QY
Sbjct  127   CRTWAFNDGQWRALQKSPSVYDEEVFKGLDFVISEAKKFKIRLILSLANNWEAFGGKAQY  186

Query  1154  VKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELIN  1333
             VKW    G+ L+ S+D FF DP +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+N
Sbjct  187   VKWGKAAGLNLT-SDDDFFTDPTLRSYYKAHVKTVLNRVNTYTNVTYKEDPTIFAWELMN  245

Query  1334  EPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADL  1513
             EPRC +DP+G+TLQ WI+EM+ FVKS+D  HLL VGLEGFYGP  P R++ NP  +A  +
Sbjct  246   EPRCTSDPSGNTLQGWIQEMAVFVKSMDPKHLLEVGLEGFYGPSTPNRVQFNPNTYAQQV  305

Query  1514  GSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFT  1693
             G+DFIRN  +  +DFASVH+Y D W         L+FTK W+ +HIED E+ L  P++F 
Sbjct  306   GTDFIRNHKVLGVDFASVHIYADTWVSQAISDAHLQFTKSWMEAHIEDAEKYLGMPVIFA  365

Query  1694  EFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIV  1873
             EFG++ +        RD++   + + +  S K   SG GS+ WQ   E  +  +D + IV
Sbjct  366   EFGVSTKDPGYNSTYRDKYLSSVYKTLLDSTKKGGSGGGSLVWQLFPEGTDYMDDGYAIV  425

Query  1874  PWERASTYNLITNHSCRLA  1930
                  ST N+I+ HS R++
Sbjct  426   LSNSPSTSNIISLHSTRMS  444



>ref|XP_010921182.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X3 
[Elaeis guineensis]
Length=432

 Score =   381 bits (978),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/370 (48%), Positives = 241/370 (65%), Gaps = 1/370 (0%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             VE+ G QF   GQ FY NG+N+YW M  AVD   R +V  + Q A  +G TVCRTWAFND
Sbjct  32    VEKKGNQFIVAGQPFYFNGFNTYWLMIFAVDQSTRRKVTEVFQEALSVGYTVCRTWAFND  91

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQ SP  +DE VF+ LD V++E+R++ IRLIL LVNN + YGGK QYVKW    G
Sbjct  92    GGWRALQKSPSVYDEEVFKGLDFVVSEARKYKIRLILSLVNNWEGYGGKAQYVKWGQAAG  151

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + L+ S+D FF D  ++ Y+K +VK +LTR NT T + Y+DDPTIFAWEL+NEPRC++D 
Sbjct  152   LNLT-SDDDFFSDATVKGYYKAHVKAILTRVNTYTNITYKDDPTIFAWELMNEPRCLSDS  210

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GD LQ WI+EM+  VKSID  HLL +G EGFYGP  P+RL++NP  +A  +G+DFIRN 
Sbjct  211   SGDKLQAWIQEMAFHVKSIDPVHLLEIGTEGFYGPSTPERLQLNPNTFAGQVGADFIRNH  270

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
                 IDFAS H+YPD W  N      ++F K W+ +H +D E  L  P++F EFGL+ + 
Sbjct  271   RALGIDFASAHMYPDSWVSNSISDAHIQFVKTWMQNHTDDAENVLGMPVVFGEFGLSSKD  330

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
              +     RD+F   +      S +   SGAG + WQ   E  +  +D + +VP +  ST 
Sbjct  331   DKFNLTFRDKFINTVFATQLNSLRRGGSGAGCLLWQLFPEGTDYMDDGYAVVPSKSPSTS  390

Query  1898  NLITNHSCRL  1927
             ++++ HS RL
Sbjct  391   SILSLHSRRL  400



>ref|XP_009614142.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X1 [Nicotiana 
tomentosiformis]
Length=484

 Score =   382 bits (982),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/372 (47%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V    Q A+ +G++VCRTWAF
Sbjct  83    TMVQKSGNQFVVNGQPFYVNGFNTYWLMVFAADQSTRGKVTETFQQASAVGLSVCRTWAF  142

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ +P  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK+QYVKW   
Sbjct  143   NDGQWRALQKTPSVYDEDVFKALDFVVSEAKKYKIRLILSLVNNWEAYGGKSQYVKWGKA  202

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NT T + Y+DDPTIF WEL+NEPRC +
Sbjct  203   AGLNLT-SDDDFFSHPILKSYYKAHVKAVLNRVNTFTNITYKDDPTIFGWELMNEPRCES  261

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GD LQ WIEEM+ +VKSID  HL+ +GLEGFYG   P R ++NP  +A  +G+DFIR
Sbjct  262   DPSGDKLQAWIEEMAVYVKSIDPKHLVEIGLEGFYGLSTPNRAQVNPNSYAQQVGTDFIR  321

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         ++FTK W+ SHI+D E  L  P++F EFG++ 
Sbjct  322   NHQVLGVDFASVHIYPDSWISKSISDAHVEFTKSWMQSHIDDAENYLNMPVIFAEFGVSA  381

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   +G GS+ WQ   E  +  +D + IV  +  S
Sbjct  382   KDPGYNSTYRDTLIATVYKTILNSTKKGGAGGGSLLWQVFPEGTDYMDDGYAIVLSKSLS  441

Query  1892  TYNLITNHSCRL  1927
             T N+++ HS +L
Sbjct  442   TSNIVSLHSKKL  453



>gb|KDP44593.1| hypothetical protein JCGZ_22175 [Jatropha curcas]
Length=434

 Score =   380 bits (977),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/379 (47%), Positives = 252/379 (66%), Gaps = 4/379 (1%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             SF+   GT F+ +G  +Y NG+N+YW M  A D  +R +V +    AA  G++V RTWAF
Sbjct  29    SFIRTRGTHFFLNGNPYYANGFNAYWLMYIASDPSQRYKVSSAFHEAASHGLSVARTWAF  88

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             +DG Y  LQ SPG ++E++F+ LD VIAE+R++GI+LIL L NN +++GGK QYV WA  
Sbjct  89    SDGGYRPLQYSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYESFGGKKQYVNWAKN  148

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
             EG+ LS S+D FF  P ++ YFKN++KTVL R N+ TG+ Y+DDPTI AWEL+NEPRC +
Sbjct  149   EGLYLS-SDDDFFRHPVVKNYFKNHIKTVLNRYNSFTGIHYKDDPTIMAWELMNEPRCTS  207

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+G T+Q WI EM+ FVKSID+NHLL  GLEGFYG   P+R  +NP L   ++G+DFI 
Sbjct  208   DPSGRTIQAWIMEMAQFVKSIDRNHLLEAGLEGFYGHSTPQRKTLNPGL---EIGTDFIA  264

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N+ +  IDFA++H YPD W  +   Q +L F   W+ +HI+D +  L+KPI+ TEFG + 
Sbjct  265   NNRIPAIDFATLHSYPDQWLSSSNNQYQLSFLNNWLNAHIQDSQYILRKPILITEFGKSW  324

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +      Y+RD  F  +   +Y SAK   + AG +FWQ L E M+ + D + I+  E +S
Sbjct  325   KDPGFSTYERDEMFSTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDNFRDGYEIILGENSS  384

Query  1892  TYNLITNHSCRLAGVHGVL  1948
             T N+I   S +L  +  + 
Sbjct  385   TANVIAQQSHKLYQIRKIF  403



>ref|XP_003552321.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Glycine max]
Length=462

 Score =   382 bits (980),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 241/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G  F  + + FYVNG+N+YW M  A D   R +V  + + A+ +GMTVCRTWAFN
Sbjct  63    MVQKKGNHFVVNDKPFYVNGFNTYWLMVFAADESTRGKVTEVFKQASSVGMTVCRTWAFN  122

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E++++ IRLIL L NN +AYGGK QYVKW    
Sbjct  123   DGQWRALQKSPSVYDEEVFKALDFVVSEAKKYKIRLILSLANNWEAYGGKAQYVKWGNAA  182

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +VKTVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  183   GLNLT-SDDDFFSHPTLRSYYKAHVKTVLNRVNTFTNITYKEDPTIFAWELMNEPRCTSD  241

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             PTGD LQDWI+EM+  VK ID  HL+ VG+EGFYGP  P+R + NP  +A  +G+DFIRN
Sbjct  242   PTGDKLQDWIQEMAFHVKKIDPKHLVEVGVEGFYGPSTPQRTQFNPNTYATQVGTDFIRN  301

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W   Q     + F K W+ +HIED E+ L  P++F EFG++ +
Sbjct  302   HLVLGVDFASVHIYADSWISQQIADTHIPFIKSWMEAHIEDAEKYLGMPVVFAEFGVSSK  361

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     +   +  S K   SGAGS+ WQF  +  +  +D + IV  +  ST
Sbjct  362   DPGYNSSYRDTVISTVYSTILNSTKKGGSGAGSLLWQFFPDGTDNMDDGYAIVLSKSPST  421

Query  1895  YNLITNHSCRLA  1930
               +I   S RLA
Sbjct  422   SGIIQLQSTRLA  433



>ref|XP_010490492.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Camelina 
sativa]
Length=465

 Score =   381 bits (979),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 243/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              VER G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +GMTV RTWAFN
Sbjct  64    MVERKGMQFTQNGQPFYVNGFNTYWMMVLAADNSTRGKVTEVFQQASAVGMTVGRTWAFN  123

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN  AYGGK QYVKW    
Sbjct  124   DGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLVNNWDAYGGKAQYVKWGNAS  183

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R +++++V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  184   GLNLT-SDDDFFTNPTLRNFYQSHVRTVLNRVNTYTNITYKNDPTIFAWELMNEPRCPSD  242

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKSID  HL+ +GLEGFYGP  P R + NP  +AA +G+DFIRN
Sbjct  243   PSGDKLQSWIQEMAAFVKSIDAKHLVEIGLEGFYGPSAPARTRYNPNSYAAQVGTDFIRN  302

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             +    +DFA+VHVYPD W         L+FT  W+ SH+ED E  L  P++FTEFG++  
Sbjct  303   NQALGVDFATVHVYPDTWISTAVSNSFLEFTSSWMQSHVEDAEMYLGMPVLFTEFGVSAH  362

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  363   DPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  422

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  423   SKIISLQSKRLA  434



>gb|KEH17803.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=465

 Score =   381 bits (978),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 247/378 (65%), Gaps = 1/378 (0%)
 Frame = +2

Query  797   ETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVC  976
             E  +   V++ G QF  + Q FYVNG+N+YW M  A D   R RV  + + A+ +GMTVC
Sbjct  60    EEAEWQMVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGRVTQVFKHASSVGMTVC  119

Query  977   RTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYV  1156
             RTWAFNDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK QYV
Sbjct  120   RTWAFNDGQWRALQKSPSLYDEVVFKALDFVVSEAKKYRIRLILSLVNNWEAYGGKAQYV  179

Query  1157  KWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINE  1336
             KW    G+ L+ S+D FF  P +R Y+K++VK    R NT+T + Y++DPTIFAWEL+NE
Sbjct  180   KWGNAAGLNLT-SDDDFFSHPTLRGYYKDHVKASSLRFNTLTNITYKEDPTIFAWELMNE  238

Query  1337  PRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLG  1516
             PRC +D  GDTLQ+WI+EM+ +VKSID  HLL +GLEGFYGP  P+R + NP  +A  +G
Sbjct  239   PRCTSDSLGDTLQEWIKEMAFYVKSIDPKHLLEIGLEGFYGPSTPQRFQFNPNSYAQQVG  298

Query  1517  SDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTE  1696
             +DFIRN  +  +DFAS H+YPD W         + F K W+ +HI+D E+ L  P++F E
Sbjct  299   TDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPFVKSWMEAHIDDAEKYLGMPVVFGE  358

Query  1697  FGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVP  1876
             FG++ +        RD     + + +  S K   SGAGS+ WQF  +  +  +D + IV 
Sbjct  359   FGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSGAGSLLWQFFPDGTDYMDDGYAIVL  418

Query  1877  WERASTYNLITNHSCRLA  1930
              +  ST ++I+  S RLA
Sbjct  419   SKAPSTSSMISLQSTRLA  436



>ref|NP_195813.1| mannan endo-1,4-beta-mannosidase 6 [Arabidopsis thaliana]
 sp|Q9LZV3.1|MAN6_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 6; AltName: Full=Beta-mannanase 
6; AltName: Full=Endo-beta-1,4-mannanase 6; 
Short=AtMAN6; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB82763.1| (1-4)-beta-mannan endohydrolase-like protein [Arabidopsis thaliana]
 gb|AAO64766.1| At5g01930 [Arabidopsis thaliana]
 dbj|BAE99339.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90411.1| mannan endo-1,4-beta-mannosidase 6 [Arabidopsis thaliana]
Length=448

 Score =   380 bits (976),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 244/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +GMTV RTWAFN
Sbjct  47    MVQRKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTEVFQQASAVGMTVGRTWAFN  106

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN  AYGGK QYVKW    
Sbjct  107   DGQWRALQKSPSVYDEEVFKALDFVLSEARKYKIRLILSLVNNWDAYGGKAQYVKWGNAS  166

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R +++++V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  167   GLNLT-SDDDFFTNPTLRNFYQSHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRCPSD  225

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKS+D  HL+ +GLEGFYGP  P R + NP  +AA +G+DFIRN
Sbjct  226   PSGDKLQSWIQEMAVFVKSLDAKHLVEIGLEGFYGPSAPARTRFNPNPYAAQVGTDFIRN  285

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++  
Sbjct  286   NQVLGIDFASVHVYPDSWISPAVSNSFLEFTSSWMQAHVEDAEMYLGMPVLFTEFGVSAH  345

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  346   DPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  405

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  406   SKIISLQSKRLA  417



>ref|XP_010424015.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Camelina 
sativa]
Length=449

 Score =   380 bits (976),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 243/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              VER G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +GMTV RTWAFN
Sbjct  48    MVERKGMQFTQNGQPFYVNGFNTYWMMVLAADNSTRGKVTEVFQQASAVGMTVGRTWAFN  107

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN  AYGGK QYVKW    
Sbjct  108   DGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLVNNWDAYGGKAQYVKWGNAS  167

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R +++++V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  168   GLNLT-SDDDFFTNPTLRNFYQSHVRTVLNRVNTYTNITYKNDPTIFAWELMNEPRCPSD  226

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKSID  HL+ +GLEGFYGP  P R + NP  +AA +G+DFIRN
Sbjct  227   PSGDKLQSWIQEMAAFVKSIDAKHLVEIGLEGFYGPSAPARTRYNPNSYAAQVGTDFIRN  286

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             +    +DFA+VHVYPD W         L+FT  W+ SH+ED E  L  P++FTEFG++  
Sbjct  287   NQALGVDFATVHVYPDTWISPAVSNSFLEFTSSWMQSHVEDAEMYLGMPVLFTEFGVSAH  346

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  347   DPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  406

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  407   SKIISLQSKRLA  418



>ref|XP_010686734.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   379 bits (974),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 207/422 (49%), Positives = 267/422 (63%), Gaps = 12/422 (3%)
 Frame = +2

Query  704   RNGMFYPIIGFAAFLAFIYLTFGD--LWVSYPEE--TLKLSFVERNGTQFYA------DG  853
             ++   YPI+G       +YL F D    + +P      K+ FV  N T F        D 
Sbjct  8     KDKFMYPILGIGTIFTILYLNFNDHQFNIDFPIVFWQKKMDFVGVNSTHFVIIKDHDYDN  67

Query  854   QVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDG-AYNALQISPG  1030
             Q  YVNGWNSYW ME +V    R +V  ML+  A MG+ VCRTWAF+DG   N+LQISPG
Sbjct  68    QRMYVNGWNSYWLMEESVWGPSRSKVSKMLKRGALMGLNVCRTWAFSDGPGPNSLQISPG  127

Query  1031  KFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFF  1210
              F+ERV + LD VI E+R++GIRLIL LVNNL A+GGK QYVKWA + G+ +S S DSFF
Sbjct  128   LFNERVLKGLDYVIVEARKNGIRLILSLVNNLNAFGGKAQYVKWALEAGLNVSSSADSFF  187

Query  1211  YDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEE  1390
              D  I+ Y+K YVK ++TRKN++TG+ Y ++P IFAWELINEPRC  D +   LQDWI E
Sbjct  188   SDSTIKGYYKAYVKAIVTRKNSLTGVRYYEEPAIFAWELINEPRCDYDCSSSILQDWIVE  247

Query  1391  MSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVH  1570
             M  ++KS+D+ HL+T+GLEGFY   +   +  NP  WAA LG+DFI+NS +  IDFASVH
Sbjct  248   MVAYIKSLDQKHLVTIGLEGFYVAAESSGVT-NPGEWAASLGTDFIQNSAVDGIDFASVH  306

Query  1571  VYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRF  1750
              YPD W  +     KL F  +W+ SHI  G   LKKP++FTE G     K       D  
Sbjct  307   AYPDSWMPHANATTKLDFVFQWLDSHISFGVNILKKPVLFTEVGYPLHVKGEGGGYGDTL  366

Query  1751  FKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLA  1930
              +++ + +Y+SAK   +GAG++ WQ LVE MEEY D F +V W+  STY LI   SCRL 
Sbjct  367   LRIVYDRIYESAKKGGAGAGALIWQLLVEEMEEYGDRFSLVAWKYPSTYKLIVEQSCRLK  426

Query  1931  GV  1936
              +
Sbjct  427   SI  428



>ref|XP_006656920.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Oryza brachyantha]
Length=340

 Score =   376 bits (965),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/328 (51%), Positives = 230/328 (70%), Gaps = 0/328 (0%)
 Frame = +2

Query  959   MGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYG  1138
             MG++VCRTWAF+DG   ALQISPG+F E VF+ LD VI E+RR+ IRLILCLVNNL  +G
Sbjct  1     MGLSVCRTWAFSDGGPGALQISPGRFSEAVFQVLDYVIYEARRNNIRLILCLVNNLDQFG  60

Query  1139  GKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFA  1318
             GK QY +WA   G  ++ S DSFF  P I+RY+K+YVK +LTR+N+ +G+ Y D+P IFA
Sbjct  61    GKAQYFQWAQAAGANVTNSTDSFFSHPAIKRYYKDYVKAILTRRNSYSGIRYSDEPAIFA  120

Query  1319  WELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPEL  1498
             WEL+NEPRC+++ +G  +Q WI EM+ ++KS+D NHL+TVG EGFYGP   +R+ INP  
Sbjct  121   WELMNEPRCVSNSSGPYIQAWIAEMAAYIKSLDTNHLVTVGTEGFYGPGSAERMDINPGE  180

Query  1499  WAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKK  1678
             WAA L SDFI+NS +  IDFASVH YPD W    + ++K+++   W+ SH+ D E  LKK
Sbjct  181   WAASLCSDFIQNSVVEHIDFASVHAYPDSWLPKASLEEKVRYLSSWVDSHLNDSEHILKK  240

Query  1679  PIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYND  1858
             P++FTE G    +       +D   +++ + +Y SA+  ++G G++ WQ +VE    Y D
Sbjct  241   PVIFTEVGYLQHSDANSTVDKDIILRIVYDKIYDSARKLQAGGGALIWQLMVEGTHMYAD  300

Query  1859  EFGIVPWERASTYNLITNHSCRLAGVHG  1942
             +F IV  +R STY+LIT  SCRL  ++G
Sbjct  301   DFSIVARDRPSTYSLITEQSCRLQRMYG  328



>gb|AET01118.2| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=445

 Score =   380 bits (975),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 247/378 (65%), Gaps = 1/378 (0%)
 Frame = +2

Query  797   ETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVC  976
             E  +   V++ G QF  + Q FYVNG+N+YW M  A D   R RV  + + A+ +GMTVC
Sbjct  40    EEAEWQMVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADESTRGRVTQVFKHASSVGMTVC  99

Query  977   RTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYV  1156
             RTWAFNDG + ALQ SP  +DE VF+ALD V++E++++ IRLIL LVNN +AYGGK QYV
Sbjct  100   RTWAFNDGQWRALQKSPSLYDEVVFKALDFVVSEAKKYRIRLILSLVNNWEAYGGKAQYV  159

Query  1157  KWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINE  1336
             KW    G+ L+ S+D FF  P +R Y+K++VK    R NT+T + Y++DPTIFAWEL+NE
Sbjct  160   KWGNAAGLNLT-SDDDFFSHPTLRGYYKDHVKASSLRFNTLTNITYKEDPTIFAWELMNE  218

Query  1337  PRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLG  1516
             PRC +D  GDTLQ+WI+EM+ +VKSID  HLL +GLEGFYGP  P+R + NP  +A  +G
Sbjct  219   PRCTSDSLGDTLQEWIKEMAFYVKSIDPKHLLEIGLEGFYGPSTPQRFQFNPNSYAQQVG  278

Query  1517  SDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTE  1696
             +DFIRN  +  +DFAS H+YPD W         + F K W+ +HI+D E+ L  P++F E
Sbjct  279   TDFIRNHQVLGVDFASAHIYPDSWISQSVADSHIPFVKSWMEAHIDDAEKYLGMPVVFGE  338

Query  1697  FGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVP  1876
             FG++ +        RD     + + +  S K   SGAG++ WQF  +  +  +D + IV 
Sbjct  339   FGVSAKDPGYNSTYRDTLINTVYKTILNSTKKGGSGAGTLLWQFFPDGTDYMDDGYAIVL  398

Query  1877  WERASTYNLITNHSCRLA  1930
              +  ST ++I+  S RLA
Sbjct  399   SKAPSTSSMISLQSTRLA  416



>ref|XP_010921180.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Elaeis guineensis]
Length=476

 Score =   380 bits (977),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/370 (48%), Positives = 241/370 (65%), Gaps = 1/370 (0%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             VE+ G QF   GQ FY NG+N+YW M  AVD   R +V  + Q A  +G TVCRTWAFND
Sbjct  76    VEKKGNQFIVAGQPFYFNGFNTYWLMIFAVDQSTRRKVTEVFQEALSVGYTVCRTWAFND  135

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQ SP  +DE VF+ LD V++E+R++ IRLIL LVNN + YGGK QYVKW    G
Sbjct  136   GGWRALQKSPSVYDEEVFKGLDFVVSEARKYKIRLILSLVNNWEGYGGKAQYVKWGQAAG  195

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + L+ S+D FF D  ++ Y+K +VK +LTR NT T + Y+DDPTIFAWEL+NEPRC++D 
Sbjct  196   LNLT-SDDDFFSDATVKGYYKAHVKAILTRVNTYTNITYKDDPTIFAWELMNEPRCLSDS  254

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GD LQ WI+EM+  VKSID  HLL +G EGFYGP  P+RL++NP  +A  +G+DFIRN 
Sbjct  255   SGDKLQAWIQEMAFHVKSIDPVHLLEIGTEGFYGPSTPERLQLNPNTFAGQVGADFIRNH  314

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
                 IDFAS H+YPD W  N      ++F K W+ +H +D E  L  P++F EFGL+ + 
Sbjct  315   RALGIDFASAHMYPDSWVSNSISDAHIQFVKTWMQNHTDDAENVLGMPVVFGEFGLSSKD  374

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
              +     RD+F   +      S +   SGAG + WQ   E  +  +D + +VP +  ST 
Sbjct  375   DKFNLTFRDKFINTVFATQLNSLRRGGSGAGCLLWQLFPEGTDYMDDGYAVVPSKSPSTS  434

Query  1898  NLITNHSCRL  1927
             ++++ HS RL
Sbjct  435   SILSLHSRRL  444



>ref|NP_001280873.1| mannan endo-1,4-beta-mannosidase 7-like precursor [Malus domestica]
 gb|ACN78664.1| endo-beta-mannanase [Malus domestica]
Length=429

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 257/401 (64%), Gaps = 15/401 (4%)
 Frame = +2

Query  725   IIGFAAFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHA  904
             +I F A L FI+L  G +         +  FV+  G Q   +G  +Y NG+N+YW M  A
Sbjct  6     VIFFGALL-FIFLNHGVI--------AEDGFVKTRGVQLVLNGVPYYGNGFNAYWLMYMA  56

Query  905   VDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESR  1084
              D   R +V +  + A K G+T+ RTWAF DG Y ALQ SPG +DE+ F+ LD VIAE++
Sbjct  57    TDPSEREKVSSAFREATKNGLTIARTWAFADGGYRALQTSPGSYDEKTFQGLDFVIAEAK  116

Query  1085  RHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLT  1264
             ++GI+++L LVNN   +GGK QYV+WA  +G  LS S D FF +  ++ ++KN++KTVLT
Sbjct  117   KNGIKVMLSLVNNYDDFGGKKQYVEWARSQGQSLS-SEDDFFTNSVVKGFYKNHIKTVLT  175

Query  1265  RKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGL  1444
             R NT+TG+ Y+D+PTI AWEL+NEPRC +DP+G T+Q WI EM++++KSID NHLL VGL
Sbjct  176   RINTLTGVAYKDEPTIMAWELMNEPRCTSDPSGKTIQAWITEMASYLKSIDGNHLLEVGL  235

Query  1445  EGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKF  1624
             EGFYGP +P   K NP  +   +G+DF+ N+ +  IDFA+VH YPD W    +++D++ F
Sbjct  236   EGFYGPSNP---KTNPNYY--QIGTDFLANNQIPGIDFATVHSYPDQWLNGSSYEDQVSF  290

Query  1625  TKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSG  1804
                W+  HI D +  LKKP++F EFG + +       QRDR F  +   +Y SA+     
Sbjct  291   LNSWVNDHIHDAQNILKKPVLFAEFGRSLKESGYTINQRDRIFTTVYSGIYSSARGGGPA  350

Query  1805  AGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRL  1927
              G +FWQ L + M+ + D +G+V  E +ST  LI   S +L
Sbjct  351   VGGLFWQLLAQGMDSFQDGYGVVLSESSSTVGLIAEESQKL  391



>ref|XP_008782689.1| PREDICTED: mannan endo-1,4-beta-mannosidase 8-like [Phoenix dactylifera]
Length=435

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/371 (49%), Positives = 242/371 (65%), Gaps = 1/371 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R G QF   GQ FY NG+N+YW M  AVD   R +V  + Q A  +G TVCRTWAFN
Sbjct  34    MVQRKGNQFVVGGQPFYFNGFNTYWLMIFAVDQSTRRKVTEVFQEALSVGYTVCRTWAFN  93

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN + YGGK QYVKW    
Sbjct  94    DGGWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLTNNWEGYGGKAQYVKWGKAA  153

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF DP ++ Y+K +V+ +LTR NT T + Y+DDPTIFAWEL+NEPRC++D
Sbjct  154   GLNLT-SDDDFFSDPTVKGYYKAHVEAILTRVNTYTNITYKDDPTIFAWELMNEPRCLSD  212

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+  VKSID  HLL +G EGFYGP  P+RL++NP  +A  +G+DFIRN
Sbjct  213   PSGDKLQAWIQEMAFHVKSIDPLHLLEIGAEGFYGPSTPERLQLNPNTFAGKVGTDFIRN  272

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  IDFAS H+YPD W  N    + ++F K W+ +HI+D E  L  P++F EFG++ +
Sbjct  273   HRALGIDFASAHIYPDSWISNSITDEHIQFVKTWMQNHIDDSENVLGMPVIFGEFGVSSK  332

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD+F   +      S +   SG G + WQ   E  E  +D + +VP    ST
Sbjct  333   DDRFNLTFRDKFITTVCTTQLNSTRSGGSGGGCLLWQLFPEGAEYMDDGYAVVPSRSPST  392

Query  1895  YNLITNHSCRL  1927
              ++++ HS RL
Sbjct  393   SSILSLHSRRL  403



>ref|XP_002323680.2| hypothetical protein POPTR_0016s14550g [Populus trichocarpa]
 gb|EEF05441.2| hypothetical protein POPTR_0016s14550g [Populus trichocarpa]
Length=469

 Score =   379 bits (974),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 244/377 (65%), Gaps = 3/377 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V + G QF  + Q FYVNG+N+YW M  A D   R +V  + Q A+ +G++VCRTWAFN
Sbjct  72    MVAKKGNQFVINDQPFYVNGFNTYWLMVFAADQSTRGKVTEVFQKASSVGLSVCRTWAFN  131

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SPG +DE VF+ALD V++E+ ++ IRLIL L NN  AYGGK QYVKW    
Sbjct  132   DGQWRALQKSPGVYDEDVFKALDFVVSEANKYKIRLILSLANNWDAYGGKAQYVKWGKAS  191

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P +R Y+K +   VL R NT+T + Y+DDPTIFAWEL+NEPRC +D
Sbjct  192   GLNLT-SDDDFFSHPTLRSYYKAHA--VLNRVNTITNITYKDDPTIFAWELMNEPRCTSD  248

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI +M+ +VKS+D  HL+ +GLEGFYGP  P R + NP  +A  +G+DFIRN
Sbjct  249   PSGDKLQSWITDMAVYVKSMDAKHLVEIGLEGFYGPSAPDRAQFNPNSYATQVGTDFIRN  308

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W         ++FTK W+ +HIED E+ L  P++F EFG++ +
Sbjct  309   HQVLGVDFASVHIYADSWISQTITDSHIQFTKSWMEAHIEDAEKYLGMPVVFAEFGVSSK  368

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SGAGS+ WQ   +  +  +D + IV  +  ST
Sbjct  369   DPGYNSSFRDTLINTVYKTLLNSTKRGGSGAGSLLWQLFPDGTDYMDDGYAIVLSKSPST  428

Query  1895  YNLITNHSCRLAGVHGV  1945
              N+I+ HS R+A V+ +
Sbjct  429   TNIISLHSTRVAIVNSM  445



>ref|XP_006398561.1| hypothetical protein EUTSA_v10013730mg [Eutrema salsugineum]
 gb|ESQ40014.1| hypothetical protein EUTSA_v10013730mg [Eutrema salsugineum]
Length=399

 Score =   377 bits (967),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 242/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TV RTWAFN
Sbjct  1     MVQRKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTDVFQQASAVGLTVGRTWAFN  60

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN   YGGK QYVKW    
Sbjct  61    DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWNDYGGKAQYVKWGNAS  120

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R ++K +V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  121   GLNLT-SDDDFFTNPTLRDFYKAHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRCPSD  179

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKS+D  HL+ +GLEGFYGP  P R K NP  +AA +G+DFIRN
Sbjct  180   PSGDKLQSWIQEMAVFVKSLDAKHLVEIGLEGFYGPSAPARTKFNPNPYAAQVGTDFIRN  239

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++  
Sbjct  240   NQVLGIDFASVHVYPDSWISPAVSDSFLEFTSSWMQAHVEDAEMYLGMPVLFTEFGVSAH  299

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  300   DPGFNTSFRDMMLDTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  359

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  360   SKIISLQSKRLA  371



>ref|XP_002870892.1| hypothetical protein ARALYDRAFT_349416 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47151.1| hypothetical protein ARALYDRAFT_349416 [Arabidopsis lyrata subsp. 
lyrata]
Length=448

 Score =   379 bits (972),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 243/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +GMTV RTWAFN
Sbjct  47    MVQRKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTEVFQQASAVGMTVGRTWAFN  106

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN  AYGGK QYVKW    
Sbjct  107   DGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLVNNWDAYGGKAQYVKWGNAS  166

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R +++++V+TVL R NT T + Y+ DPTIFAWEL+NEPRC +D
Sbjct  167   GLNLT-SDDDFFTNPTLRNFYQSHVRTVLNRVNTFTNITYKKDPTIFAWELMNEPRCPSD  225

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKS+D  HL+ +GLEGFYGP  P R + NP  +AA +G+DFIRN
Sbjct  226   PSGDKLQSWIQEMAVFVKSLDAKHLVEIGLEGFYGPSAPVRTRFNPNPYAAQVGTDFIRN  285

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++  
Sbjct  286   NQVLGIDFASVHVYPDSWISPAVSNSFLEFTSSWMQAHVEDAEMYLGMPVLFTEFGVSAH  345

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  346   DPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  405

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  406   SKIISLQSKRLA  417



>ref|XP_006279332.1| hypothetical protein CARUB_v10012718mg [Capsella rubella]
 gb|EOA12230.1| hypothetical protein CARUB_v10012718mg [Capsella rubella]
Length=448

 Score =   378 bits (971),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 243/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +GMTV RTWAFN
Sbjct  47    MVQTKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTEVFQQASAVGMTVGRTWAFN  106

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN  AYGGK QYVKW    
Sbjct  107   DGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLVNNWDAYGGKAQYVKWGNAS  166

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R +++++V+ VL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  167   GLNLT-SDDDFFTNPTLRNFYQSHVRAVLNRVNTYTNITYKNDPTIFAWELMNEPRCPSD  225

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKS+D  HL+ +GLEGFYGP  P R + NP  +AA +G+DFIRN
Sbjct  226   PSGDKLQSWIQEMAVFVKSLDAKHLVEIGLEGFYGPSAPTRTRYNPNPYAAQVGTDFIRN  285

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++  
Sbjct  286   NQVLGIDFASVHVYPDSWISPAVSNSFLEFTSSWMQAHVEDAEMYLGMPVLFTEFGMSAH  345

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   + +E  +D + +      + 
Sbjct  346   DPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGVEFMDDGYAVYLTRAHTA  405

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  406   SKIISLQSKRLA  417



>gb|KHG22102.1| Mannan endo-1,4-beta-mannosidase 7 -like protein [Gossypium arboreum]
Length=434

 Score =   377 bits (968),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/378 (47%), Positives = 250/378 (66%), Gaps = 4/378 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             FV      F+ +G  ++ NG+N+YW M  A D  +RP+V    + AA  G+TV RTWAF+
Sbjct  30    FVRTRRVHFFLNGNPYFANGFNAYWLMYVASDPSQRPKVSAAFREAAAHGLTVARTWAFS  89

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQ +PG ++E++F+ LD VIAE+R++ I+LIL L NN +++GGK QYV WA  +
Sbjct  90    DGGYRPLQYAPGSYNEQMFKGLDFVIAEARKYRIKLILSLANNYESFGGKKQYVNWARSQ  149

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  L+ S+D FF +P ++ Y+KN+VKTVL R N+ TG+ Y+DDPTI AWEL+NEPRC +D
Sbjct  150   GQYLT-SDDDFFRNPVVKGYYKNHVKTVLNRYNSFTGMHYKDDPTIMAWELMNEPRCTSD  208

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G T+Q WI EM + VKSID+NHLL  GLEGFYG   P++ ++NP L   D+G+DFI N
Sbjct  209   PSGKTIQAWIMEMVSHVKSIDRNHLLEAGLEGFYGQSTPQKKRLNPSL---DIGTDFIAN  265

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFA+VH YPD W  + + Q +L F   W+ +HI D   AL+KPI+  EFG + +
Sbjct  266   NQIPGIDFATVHSYPDQWLSSSSEQYQLSFLNNWLDAHIRDARIALRKPILLAEFGKSWK  325

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                   YQRD+ F ++   +Y SAK     +G +FWQ L + ME + D + I+  ER+ST
Sbjct  326   DPGFNTYQRDQLFNIVYNKIYWSAKTGGPASGGLFWQLLAQGMESFRDGYEIILSERSST  385

Query  1895  YNLITNHSCRLAGVHGVL  1948
              N+I   S +L  +  + 
Sbjct  386   ANVIAQQSHKLDQIRKIF  403



>ref|XP_002974905.1| hypothetical protein SELMODRAFT_232427 [Selaginella moellendorffii]
 gb|EFJ23690.1| hypothetical protein SELMODRAFT_232427 [Selaginella moellendorffii]
Length=413

 Score =   376 bits (965),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 250/376 (66%), Gaps = 6/376 (2%)
 Frame = +2

Query  806   KLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTW  985
             ++S+V   G++F  D +  ++NG+N+YW   ++ +   RP V ++ + A+ +G+ V R W
Sbjct  36    QVSYVRARGSEFVLDDRPLFINGFNAYWVTYYSFELVTRPHVSSLFRDASALGLNVARVW  95

Query  986   AFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWA  1165
             AFNDG Y+A+Q +PG ++E  F+ LD VIAE++ +G+ LIL L NN  +YGGK QY +WA
Sbjct  96    AFNDGGYHAIQATPGAYNEEAFQGLDFVIAEAQSYGLMLILSLSNNYNSYGGKPQYAQWA  155

Query  1166  WQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRC  1345
              + G  +  S D FF    I+ Y+KNYVK VLTR NT+TG+ YRDDPTIFAWELINEPRC
Sbjct  156   QEAGHSVE-SEDDFFKHSVIKGYYKNYVKAVLTRVNTITGVAYRDDPTIFAWELINEPRC  214

Query  1346  MTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDF  1525
              +DP+GDTLQ WIEEMS FVKS+D NH+L VGLEGFY   D +R  +    W++DLG+DF
Sbjct  215   SSDPSGDTLQAWIEEMSAFVKSLDSNHMLEVGLEGFYCSSDLQRAGLGS--WSSDLGTDF  272

Query  1526  IRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGL  1705
             IRN+ + +IDFA+VH YPD W  ++ F+ +L F  +WI +HIED    L KP++F EFG 
Sbjct  273   IRNNAIPSIDFATVHSYPDLWLPDEDFEVQLSFLVQWIQNHIEDAAVRLNKPVLFAEFGK  332

Query  1706  AGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERM-EEYNDEFGIVPWE  1882
             +  T+     QRDRFF    E ++ S     + AG + WQ + E + +  +D + IVP  
Sbjct  333   SNRTRGFVVEQRDRFFAATYETIFSS--FPAAAAGGLLWQLVTEEIGDAIDDGYQIVPSR  390

Query  1883  RASTYNLITNHSCRLA  1930
               ST  +I+  S R++
Sbjct  391   NPSTVTVISTQSQRVS  406



>ref|XP_003612065.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES95023.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=438

 Score =   377 bits (967),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 244/371 (66%), Gaps = 2/371 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             FV   G  F  +G  +Y NG+N+YW M  A D  +R +V    + A   G+TV RTWAF+
Sbjct  31    FVRTRGIHFMLNGNPYYANGFNAYWLMYTASDPSQRFKVSNAFREATSHGLTVARTWAFS  90

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y+ LQ SPG ++E++F+ LD VI+E+R+HGI+LIL LVNN +++GGK QYV WA   
Sbjct  91    DGGYSPLQYSPGFYNEQMFKGLDFVISEARKHGIKLILSLVNNYESFGGKKQYVNWARSN  150

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
                   S+D FF +P ++ ++ N+VKTVL R N+ TG+ Y+DDPTI AWEL+NEPRC +D
Sbjct  151   NGQYLTSDDDFFRNPVVKGFYINHVKTVLNRYNSFTGIHYKDDPTIMAWELMNEPRCTSD  210

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G T+Q WI EM++ VKSID+NHLL  GLEGFYG   P+R K NP +   ++G+DFI N
Sbjct  211   PSGRTIQGWITEMASLVKSIDRNHLLEAGLEGFYGQSTPQRTKFNPTI--NNIGTDFIAN  268

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFA+VH YPD W ++   QD+L F   W+ +H  D + ALKKPI+  EFG + +
Sbjct  269   NRIPGIDFATVHCYPDQWVQSSNEQDQLSFLNNWLSAHFLDAQYALKKPILVAEFGKSFK  328

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                    QRD+ F  +   +Y SAK     +G++FWQ L E ME ++D +GI+  +  ST
Sbjct  329   DSGFSSNQRDQLFNTVYYKIYASAKRGGPASGALFWQLLTEGMESFDDGYGILLGQSTST  388

Query  1895  YNLITNHSCRL  1927
              N+I   S +L
Sbjct  389   ANVIAQQSHKL  399



>ref|XP_006425633.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
 gb|ESR38873.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
Length=436

 Score =   376 bits (966),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/409 (45%), Positives = 262/409 (64%), Gaps = 11/409 (3%)
 Frame = +2

Query  728   IGFAAFLAFIY--LTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEH  901
             + FA FLAF     +F  L V   +      F+   G+ F  +G +++ NG+N+YW M  
Sbjct  6     LAFAIFLAFFIHRQSFNVLHVEAGD-----GFIRTRGSHFLLNGNLYFANGFNAYWLMYV  60

Query  902   AVDFGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAES  1081
             A D  +R +V T    AA  G+TV RTWAF+DG Y  LQ SPG ++E++F+ LD VIAE+
Sbjct  61    ASDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEA  120

Query  1082  RRHGIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVL  1261
             R++GI+LIL L NN  ++GGK QYV WA  +G  L+ S+D FF +P ++ Y+KN +KTVL
Sbjct  121   RKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLT-SDDDFFRNPVVKGYYKNLIKTVL  179

Query  1262  TRKNTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVG  1441
              R NT TG+ Y+DDPTI AWEL+NEPRC +DP+G T+Q WI EM+++VKSID+NHLL  G
Sbjct  180   NRYNTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASYVKSIDRNHLLEAG  239

Query  1442  LEGFYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLK  1621
             LEGFYG   P+R ++NP L   D+G+DFI N+ +  IDFA+VH YPD W  +   + +L 
Sbjct  240   LEGFYGQSTPQRKRVNPNL---DIGTDFIANNLIPGIDFATVHSYPDQWLSSSNDRYQLS  296

Query  1622  FTKKWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKS  1801
             F   W+ +HI+D +  L+KPI+  EFG + +      YQRD  F  +   +Y SAK   +
Sbjct  297   FLNNWLDTHIQDAQHILRKPILLAEFGKSRKDPGYSTYQRDVMFNTVYYKIYSSAKRGGA  356

Query  1802  GAGSVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGVHGVL  1948
              AG +FWQ L E M+ + D + IV  +  ST N+IT  + +L  +  + 
Sbjct  357   AAGGLFWQLLTEGMDAFRDGYEIVLSQIPSTANVITQQAHKLYQIRKIF  405



>ref|XP_008370277.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Malus 
domestica]
Length=473

 Score =   377 bits (969),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  + D   R +V  + + AA +G+TVCRTWAFN
Sbjct  73    LVQKKGNQFVLNDQPFYVNGFNTYWLMVFSADQSTRGKVTDLFKQAASVGLTVCRTWAFN  132

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD VI+E+R++ IRLIL L NN  AYGGK QYVKW    
Sbjct  133   DGQWRALQKSPSVYDEEVFKALDFVISEARKYKIRLILSLTNNWDAYGGKAQYVKWGKAA  192

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P ++ Y+K +VKTVL R NT+T + Y+DDPT+FAWEL+NEPRC +D
Sbjct  193   GLNLT-SDDDFFTHPTLKSYYKAHVKTVLNRVNTLTNITYKDDPTVFAWELMNEPRCTSD  251

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G+ LQDWI+EM+ +VKS+D  HL+ +GLEGFYGP  P R++ NP  +A  +G+DFIRN
Sbjct  252   PSGNKLQDWIQEMAVYVKSVDPKHLVEIGLEGFYGPSAPARVQFNPNTYAQQVGTDFIRN  311

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFAS H+Y D W         L+FTK W+ +HIED E  L  P++F+EFG++  
Sbjct  312   HQVLGVDFASAHIYADSWISQSISDVHLQFTKSWMEAHIEDAEXYLGMPVVFSEFGISSN  371

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S +   SG GS+ WQ   +  +  +D + IV  +  ST
Sbjct  372   DPGYNSSFRDTLLSTVYKTILNSTRKGGSGGGSLLWQLFPDGTDYMDDGYAIVLSKSPST  431

Query  1895  YNLITNHSCRLA  1930
              N+IT HS RLA
Sbjct  432   ANIITLHSTRLA  443



>ref|XP_008370275.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X1 [Malus 
domestica]
Length=475

 Score =   377 bits (969),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 250/388 (64%), Gaps = 8/388 (2%)
 Frame = +2

Query  788   YPEETL-------KLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQ  946
             YP E L       +   V++ G QF  + Q FYVNG+N+YW M  + D   R +V  + +
Sbjct  59    YPVEELNDGMEDNEWQLVQKKGNQFVLNDQPFYVNGFNTYWLMVFSADQSTRGKVTDLFK  118

Query  947   AAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNL  1126
              AA +G+TVCRTWAFNDG + ALQ SP  +DE VF+ALD VI+E+R++ IRLIL L NN 
Sbjct  119   QAASVGLTVCRTWAFNDGQWRALQKSPSVYDEEVFKALDFVISEARKYKIRLILSLTNNW  178

Query  1127  KAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDP  1306
              AYGGK QYVKW    G+ L+ S+D FF  P ++ Y+K +VKTVL R NT+T + Y+DDP
Sbjct  179   DAYGGKAQYVKWGKAAGLNLT-SDDDFFTHPTLKSYYKAHVKTVLNRVNTLTNITYKDDP  237

Query  1307  TIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKI  1486
             T+FAWEL+NEPRC +DP+G+ LQDWI+EM+ +VKS+D  HL+ +GLEGFYGP  P R++ 
Sbjct  238   TVFAWELMNEPRCTSDPSGNKLQDWIQEMAVYVKSVDPKHLVEIGLEGFYGPSAPARVQF  297

Query  1487  NPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGER  1666
             NP  +A  +G+DFIRN  +  +DFAS H+Y D W         L+FTK W+ +HIED E 
Sbjct  298   NPNTYAQQVGTDFIRNHQVLGVDFASAHIYADSWISQSISDVHLQFTKSWMEAHIEDAEX  357

Query  1667  ALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERME  1846
              L  P++F+EFG++          RD     + + +  S +   SG GS+ WQ   +  +
Sbjct  358   YLGMPVVFSEFGISSNDPGYNSSFRDTLLSTVYKTILNSTRKGGSGGGSLLWQLFPDGTD  417

Query  1847  EYNDEFGIVPWERASTYNLITNHSCRLA  1930
               +D + IV  +  ST N+IT HS RLA
Sbjct  418   YMDDGYAIVLSKSPSTANIITLHSTRLA  445



>ref|XP_011015126.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   376 bits (965),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/378 (47%), Positives = 248/378 (66%), Gaps = 4/378 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             F+   G  F  +G  +Y NG+N+YW M  A D  +RP+V    + AA  G+TV RTWAF+
Sbjct  29    FIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVARTWAFS  88

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQ SPG ++E++F+ LD V+AE+R +GI+LIL   NN  ++GGK QYV WA   
Sbjct  89    DGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGGKKQYVNWARSR  148

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  LS S+D FF  P ++ Y+KN++KTVL R N+ TG+ Y+DDPTI AWEL+NEPRC +D
Sbjct  149   GQYLS-SDDDFFRHPVVKGYYKNHIKTVLYRYNSFTGIRYKDDPTIMAWELMNEPRCTSD  207

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G T+Q WI EM++FVKSID+NHLL  GLEGFYGP  P+R  +NP L    +G+DFI N
Sbjct  208   PSGRTIQAWIAEMASFVKSIDRNHLLEAGLEGFYGPSTPQRNSLNPGL---KIGTDFIAN  264

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  +DFA+VH YPD WF +   Q++L F   W+ +HI+D +  L+KPI+  EFG + +
Sbjct  265   NRIPGLDFATVHAYPDQWFSSSNDQNQLSFLNNWLDTHIQDAQNILRKPILIAEFGKSWK  324

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                   YQRD  F  +   +Y SAK   + AG +FWQ L E M+ + D + I+  + +ST
Sbjct  325   YPGFSTYQRDLLFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDNFRDGYEIILGQPSST  384

Query  1895  YNLITNHSCRLAGVHGVL  1948
              N+I+  + +L  +  + 
Sbjct  385   ANVISQQAHKLYQIRKIF  402



>ref|XP_006841534.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
 gb|ERN03209.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
Length=427

 Score =   375 bits (964),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 254/378 (67%), Gaps = 4/378 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             FV+  GT F  +G  FYVNG+N+YW  + A D   R +V ++ Q A+  G+TV RTWAF+
Sbjct  33    FVKTRGTHFMVNGSPFYVNGFNAYWLTQMASDPSTRGKVTSVFQQASSYGLTVARTWAFS  92

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQISPG ++E +F+ LD VI+E+RR+G+RLIL  VNN K  GG+ QYV+WA  +
Sbjct  93    DGGYRPLQISPGSYNEDMFKGLDFVISEARRYGVRLILSFVNNYKDLGGRPQYVQWARNQ  152

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  L+ S+D F+ +P ++ Y+KN+V++V++R N+++G+ Y+DDPTIFAWEL+NEPRC TD
Sbjct  153   GQSLN-SDDDFYTNPVVKGYYKNHVQSVISRVNSMSGVAYKDDPTIFAWELMNEPRCQTD  211

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +G  +Q+WI EM+  VKS+D NHLL  GLEGFYG   P+R + NP      +G+DFI N
Sbjct  212   LSGRPVQEWITEMAAHVKSLDSNHLLEAGLEGFYGDSSPQREQFNP---GYKVGTDFISN  268

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFA++H YPD W    + Q +L F + W+ +HIED    LKKP++FTEFG + +
Sbjct  269   NQIPGIDFATIHAYPDQWISGSSDQAQLSFLQSWVQAHIEDSNTVLKKPMLFTEFGKSSK  328

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
             T+   P  RD  F  +   +Y SA+   +GAG +FWQ L + M+ + D + ++  E  ST
Sbjct  329   TQGYTPGLRDTLFAAVYNSIYTSARSGGAGAGGLFWQLLDKDMDNFRDGYEVIMAESPST  388

Query  1895  YNLITNHSCRLAGVHGVL  1948
              N+I   S +++ ++ V 
Sbjct  389   ANVIAQQSHKVSSLNRVF  406



>dbj|BAJ34043.1| unnamed protein product [Thellungiella halophila]
Length=467

 Score =   377 bits (968),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/371 (48%), Positives = 242/371 (65%), Gaps = 1/371 (0%)
 Frame = +2

Query  818   VERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFND  997
             V+R G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TV RTWAFND
Sbjct  70    VQRKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTDVFQQASAVGLTVGRTWAFND  129

Query  998   GAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQEG  1177
             G + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN   YGGK QYVKW    G
Sbjct  130   GQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWNDYGGKAQYVKWGNASG  189

Query  1178  IGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTDP  1357
             + L+ S+D FF +P +R ++K +V+TVL R NT T + Y++DPTIFAWEL+NEPRC +DP
Sbjct  190   LNLT-SDDDFFTNPTLRDFYKAHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRCPSDP  248

Query  1358  TGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRNS  1537
             +GD LQ WI+EM+ FVKS+D  HL+ +GLEGFYGP  P R K NP  +AA +G+DFIRN+
Sbjct  249   SGDKLQSWIQEMAVFVKSLDAKHLVEIGLEGFYGPSAPARTKFNPNPYAAQVGTDFIRNN  308

Query  1538  NLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGET  1717
              +  IDFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++   
Sbjct  309   QVLGIDFASVHVYPDSWISPAVSDSFLEFTSSWMQAHVEDAEMYLGMPVLFTEFGVSAHD  368

Query  1718  KEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERASTY  1897
                    RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      +  
Sbjct  369   PGFNTSFRDMMLDTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTAS  428

Query  1898  NLITNHSCRLA  1930
              +I+  S RLA
Sbjct  429   KIISLQSKRLA  439



>ref|XP_009370900.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009370902.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X1 
[Pyrus x bretschneideri]
Length=475

 Score =   377 bits (968),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  + D   R +V  + + A+ +G+TVCRTWAFN
Sbjct  75    LVQKKGNQFVVNDQPFYVNGFNTYWLMVFSADQSTRGKVTDLFKQASLVGLTVCRTWAFN  134

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN  AYGGK QYVKW    
Sbjct  135   DGQWRALQKSPSVYDEEVFKALDFVLSEARKYKIRLILSLTNNWDAYGGKAQYVKWGKAA  194

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P ++ Y+K +VKTVL R NT+T   Y+DDPT+FAWEL+NEPRC +D
Sbjct  195   GLNLT-SDDDFFTHPTLKSYYKAHVKTVLNRVNTLTNRTYKDDPTVFAWELMNEPRCTSD  253

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G+ LQDWI+EM+ +VKS+D  HL+ +GLEGFYGP  P R++ NP  +A  +G+DFIRN
Sbjct  254   PSGNKLQDWIQEMAVYVKSVDPKHLVEIGLEGFYGPSAPARVQFNPNTYAQQVGTDFIRN  313

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         L+FTK W+ +HIED E+ L  P+MF+EFG++  
Sbjct  314   HQALGVDFASVHIYADSWISQSISDVHLQFTKSWMEAHIEDAEKYLGMPVMFSEFGISSN  373

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S +   SG GS+ WQ   +  +  +D + IV  +  ST
Sbjct  374   DPGYNSSFRDTLLSTVYKTILNSTRKGGSGGGSLLWQLFPDGTDYMDDGYAIVLSKSPST  433

Query  1895  YNLITNHSCRLA  1930
              N+IT HS RLA
Sbjct  434   ANIITLHSTRLA  445



>ref|XP_009370901.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009370903.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like isoform X2 
[Pyrus x bretschneideri]
Length=473

 Score =   377 bits (967),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  + D   R +V  + + A+ +G+TVCRTWAFN
Sbjct  73    LVQKKGNQFVVNDQPFYVNGFNTYWLMVFSADQSTRGKVTDLFKQASLVGLTVCRTWAFN  132

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L NN  AYGGK QYVKW    
Sbjct  133   DGQWRALQKSPSVYDEEVFKALDFVLSEARKYKIRLILSLTNNWDAYGGKAQYVKWGKAA  192

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P ++ Y+K +VKTVL R NT+T   Y+DDPT+FAWEL+NEPRC +D
Sbjct  193   GLNLT-SDDDFFTHPTLKSYYKAHVKTVLNRVNTLTNRTYKDDPTVFAWELMNEPRCTSD  251

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G+ LQDWI+EM+ +VKS+D  HL+ +GLEGFYGP  P R++ NP  +A  +G+DFIRN
Sbjct  252   PSGNKLQDWIQEMAVYVKSVDPKHLVEIGLEGFYGPSAPARVQFNPNTYAQQVGTDFIRN  311

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFASVH+Y D W         L+FTK W+ +HIED E+ L  P+MF+EFG++  
Sbjct  312   HQALGVDFASVHIYADSWISQSISDVHLQFTKSWMEAHIEDAEKYLGMPVMFSEFGISSN  371

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S +   SG GS+ WQ   +  +  +D + IV  +  ST
Sbjct  372   DPGYNSSFRDTLLSTVYKTILNSTRKGGSGGGSLLWQLFPDGTDYMDDGYAIVLSKSPST  431

Query  1895  YNLITNHSCRLA  1930
              N+IT HS RLA
Sbjct  432   ANIITLHSTRLA  443



>gb|KCW46726.1| hypothetical protein EUGRSUZ_K00548, partial [Eucalyptus grandis]
Length=380

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 252/374 (67%), Gaps = 3/374 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             FV  NG  F A+G+  Y+NG+N+YW M  A D   R +V ++ Q AAK GM + RTWAF+
Sbjct  8     FVGTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVASVFQEAAKNGMNMARTWAFS  67

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG   ALQISPG ++E +F+ LD VI+E+RR+G+ LI+ LVNN   +GGK QYV+WA   
Sbjct  68    DGVNRALQISPGIYNEDMFKGLDFVISEARRNGVYLIVSLVNNWNEFGGKNQYVRWARDS  127

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  L+ ++D FF +   R Y+KN+VK VLTR NTVTG+ Y+DDPTIFAWEL+NEP+C +D
Sbjct  128   GQSLN-NDDEFFTNSVTRGYYKNHVKAVLTRMNTVTGVAYKDDPTIFAWELMNEPQCKSD  186

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G +LQDW+ EM+ ++KSID NH+L VGLEGFYG   P + + NP   +  +G+DFI N
Sbjct  187   PSGKSLQDWVSEMAAYLKSIDSNHMLEVGLEGFYGQSVPGKQQNNPG--SVLVGTDFISN  244

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  +DFA++H+YPD W  + +  +++ F  KW+  HI+D    LKKPI+  EFG +  
Sbjct  245   NQVPQVDFATIHLYPDQWMPSASEGEQVAFADKWVQVHIQDSNTILKKPIILGEFGKSSN  304

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
             +      +RD +F  + + +Y SA +  SGAG++FWQ  V+ M+ + D + ++  +  ST
Sbjct  305   SSGYSVEKRDSYFGRLYDAIYTSASNQGSGAGALFWQLFVQGMDSFGDGYVVILKQSPST  364

Query  1895  YNLITNHSCRLAGV  1936
              ++I   S R++ +
Sbjct  365   ASVIARQSRRMSAL  378



>ref|XP_010424017.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X3 [Camelina 
sativa]
 ref|XP_010424018.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X3 [Camelina 
sativa]
Length=407

 Score =   374 bits (961),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/377 (48%), Positives = 243/377 (64%), Gaps = 6/377 (2%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              VER G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +GMTV RTWAFN
Sbjct  1     MVERKGMQFTQNGQPFYVNGFNTYWMMVLAADNSTRGKVTEVFQQASAVGMTVGRTWAFN  60

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN  AYGGK QYVKW    
Sbjct  61    DGQWRALQKSPSVYDEEVFKALDFVVSEARKYKIRLILSLVNNWDAYGGKAQYVKWGNAS  120

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R +++++V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  121   GLNLT-SDDDFFTNPTLRNFYQSHVRTVLNRVNTYTNITYKNDPTIFAWELMNEPRCPSD  179

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKSID  HL+ +GLEGFYGP  P R + NP  +AA +G+DFIRN
Sbjct  180   PSGDKLQSWIQEMAAFVKSIDAKHLVEIGLEGFYGPSAPARTRYNPNSYAAQVGTDFIRN  239

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDK-----LKFTKKWILSHIEDGERALKKPIMFTEF  1699
             +    +DFA+VHVYPD W              L+FT  W+ SH+ED E  L  P++FTEF
Sbjct  240   NQALGVDFATVHVYPDTWISPCRISPAVSNSFLEFTSSWMQSHVEDAEMYLGMPVLFTEF  299

Query  1700  GLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPW  1879
             G++          RD     + ++   S +   +GAGS+ WQ   +  E  +D + +   
Sbjct  300   GVSAHDPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLT  359

Query  1880  ERASTYNLITNHSCRLA  1930
                +   +I+  S RLA
Sbjct  360   RAHTASKIISLQSKRLA  376



>ref|XP_002988915.1| hypothetical protein SELMODRAFT_129038 [Selaginella moellendorffii]
 gb|EFJ09944.1| hypothetical protein SELMODRAFT_129038 [Selaginella moellendorffii]
Length=413

 Score =   374 bits (961),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 250/376 (66%), Gaps = 6/376 (2%)
 Frame = +2

Query  806   KLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTW  985
             ++S+V   G++F  D +  ++NG+N+YW   ++ +   RP V ++ + A+ +G+ V R W
Sbjct  36    QVSYVRARGSEFVLDDRPLFINGFNAYWVTYYSFELVTRPHVSSLFRDASALGLNVARVW  95

Query  986   AFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWA  1165
             AFNDG Y+ALQ +PG ++E  F+ LD VIAE++ +G+ LIL L NN  +YGGK QY +WA
Sbjct  96    AFNDGGYHALQATPGAYNEEAFQGLDFVIAEAQSYGLMLILSLSNNYNSYGGKPQYAQWA  155

Query  1166  WQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRC  1345
              + G  +  S D FF    I+ Y+K+YVK VLTR NT+TG+ YRDDPTIFAWELINEPRC
Sbjct  156   REAGHSVE-SEDDFFKHSVIKGYYKDYVKAVLTRVNTITGVAYRDDPTIFAWELINEPRC  214

Query  1346  MTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDF  1525
              +DP+GDTLQ WIEEMS FVKS+D NH+L VGLEGFY   D +R  +    W++DLG+DF
Sbjct  215   SSDPSGDTLQAWIEEMSAFVKSLDSNHMLEVGLEGFYCSSDLQRAGLGS--WSSDLGTDF  272

Query  1526  IRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGL  1705
             IRN+ + +IDFA+VH YPD W  ++ F+ +L F  +WI +HIED    L KP++F EFG 
Sbjct  273   IRNNAIPSIDFATVHSYPDLWLPDEDFEVQLSFLVQWIQNHIEDAAVRLNKPVLFAEFGK  332

Query  1706  AGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERM-EEYNDEFGIVPWE  1882
             +  T+     QRDRFF    E ++ S     + AG + WQ + E + +  +D + IVP  
Sbjct  333   SNRTRGFVVEQRDRFFAATYETIFSS--FPAAAAGGLLWQLVTEEIGDAIDDGYQIVPSR  390

Query  1883  RASTYNLITNHSCRLA  1930
               ST  +I+  S R++
Sbjct  391   NPSTVTVISTQSQRVS  406



>ref|XP_003553696.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=419

 Score =   375 bits (962),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 252/378 (67%), Gaps = 4/378 (1%)
 Frame = +2

Query  803   LKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRT  982
             L   F+ER+ T FY +G+  Y+NG+NSYW M  A D     +V    Q A++ G+ V RT
Sbjct  45    LHGGFIERSNTHFYLNGKPHYLNGFNSYWLMNVASDPSTSSKVSITFQEASQHGLNVART  104

Query  983   WAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKW  1162
             WAFNDG YNALQISPG ++E VF+ LD VI+E+ ++G+RLIL LVNN   YGGK+QYV+W
Sbjct  105   WAFNDGGYNALQISPGSYNENVFKGLDFVISEAGKNGVRLILSLVNNWNDYGGKSQYVQW  164

Query  1163  AWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPR  1342
             A + G  ++ ++D FF  P ++ Y+KN+VKT+LTRKNT+TGL Y++DPTIFAWEL+NEPR
Sbjct  165   ARERGQYVN-NDDDFFSHPIVKEYYKNHVKTMLTRKNTITGLTYQNDPTIFAWELMNEPR  223

Query  1343  CMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSD  1522
                D +G ++QDW+ EM+ +VKSID NHLL VGLEGFYG   P + + NP      +G+D
Sbjct  224   SQNDYSGKSIQDWVREMAAYVKSIDNNHLLEVGLEGFYGESMPDKKQFNP---GYQVGTD  280

Query  1523  FIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFG  1702
             FI N+ +  IDF ++H+YPD W  N     K  F  KW+ +HI+D    L KPI+FTEFG
Sbjct  281   FISNNQVPEIDFTTIHLYPDQWVSNSNESAKDDFVSKWVQAHIQDSNDILGKPILFTEFG  340

Query  1703  LAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWE  1882
              + ++      +RD +F+ I   ++ SA +    AG +FWQ + + M++ +D   I+  E
Sbjct  341   KSSKSSGYSVDKRDNYFEKIYNFIFNSASNGGPCAGGLFWQLMTQGMDDLHDGNEIICDE  400

Query  1883  RASTYNLITNHSCRLAGV  1936
               ST N+IT  S +++ +
Sbjct  401   NPSTANVITQQSKKMSNL  418



>ref|XP_011013722.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   375 bits (963),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 248/378 (66%), Gaps = 4/378 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             F+   G  F  +G  +Y NG+N+YW M  A D  +RP+V    + AA  G+TV RTWAF+
Sbjct  29    FIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVARTWAFS  88

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQ SPG ++E++F+ LD V+AE+R +GI+LIL   NN  ++GGK QYV WA   
Sbjct  89    DGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGGKKQYVNWARSR  148

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  LS S+D FF  P ++ Y+KN++KTVL R N+ TG+ Y+DDPTI AWEL+NEPRC +D
Sbjct  149   GQYLS-SDDDFFRHPVVKGYYKNHIKTVLYRYNSFTGIRYKDDPTIMAWELMNEPRCTSD  207

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G T+Q WI EM++FVKSID+NHLL  GLEGFYGP  P+R  +NP L    +G+DFI N
Sbjct  208   PSGRTIQAWIAEMASFVKSIDRNHLLEAGLEGFYGPSTPQRNSLNPGL---KIGTDFIAN  264

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  +DFA+VH YPD WF +   Q++L F   W+ +HI+D +  L+KPI+  EFG + +
Sbjct  265   NRIPGLDFATVHAYPDQWFSSSNDQNQLSFLNNWLDTHIQDAQNILRKPILIAEFGKSWK  324

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                   YQRD  F  +   +Y +AK   + AG +FWQ L E M+ + D + I+  + +ST
Sbjct  325   YPGFSTYQRDLLFNTVYYKIYSTAKRGGAAAGGLFWQLLTEGMDNFRDGYEIILGQPSST  384

Query  1895  YNLITNHSCRLAGVHGVL  1948
              N+I+  + +L  +  + 
Sbjct  385   ANVISQQAHKLYQIRKIF  402



>ref|XP_010113415.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC35442.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=436

 Score =   375 bits (962),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/396 (45%), Positives = 250/396 (63%), Gaps = 4/396 (1%)
 Frame = +2

Query  740   AFLAFIYLTFGDLWVSYPEETLKLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGR  919
             A L  + L    + +    E     F+   G  F  +G  +Y NG+N+YW M  A D  +
Sbjct  7     AILLVVILVHQQISLHSFVEARNDGFIRTWGHHFVLNGNPYYANGFNAYWLMYMASDPSQ  66

Query  920   RPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRHGIR  1099
             R  V   L+ A+  G+TV RTWAF+DG Y  LQ +PG ++E+ F+ LD V+AE+R+HGI+
Sbjct  67    RYLVSNALKEASSHGLTVARTWAFSDGGYRPLQYAPGSYNEQTFKGLDFVVAEARKHGIK  126

Query  1100  LILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTV  1279
             LIL LVNN + +GGK QYV WA   G  L+ S+D FF +  ++ Y+KN+V TVL R N+ 
Sbjct  127   LILSLVNNYENFGGKKQYVNWARSHGQYLT-SDDDFFRNSVVKGYYKNHVSTVLNRYNSF  185

Query  1280  TGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYG  1459
             TGL Y+DDPTI AWEL+NEPRC +D +G T+Q WI EM+  VKSID+NHLL  GLEGFYG
Sbjct  186   TGLHYKDDPTIMAWELMNEPRCTSDRSGRTIQAWIMEMAAHVKSIDRNHLLEAGLEGFYG  245

Query  1460  PKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWI  1639
                P+R  +NP     D+G+DFI N+ +  IDFA+VH YPD W  +   Q +L F   W+
Sbjct  246   QSTPQRKSLNPGF---DIGTDFIANNRIHGIDFATVHCYPDQWLSSSNDQKQLSFLNNWL  302

Query  1640  LSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVF  1819
              +HI+D ++ L+KP++ TEFG +G+      YQRD+ F  +   +Y SAK      GS+F
Sbjct  303   DTHIQDAQKILRKPLLLTEFGKSGKDPGFNTYQRDQLFNTVYYKIYSSAKRGGVAGGSLF  362

Query  1820  WQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRL  1927
             WQ L E M+ + D + I+  + +ST N+I+  S +L
Sbjct  363   WQLLTEGMDSFRDGYEIILSQSSSTANIISQQSHKL  398



>ref|XP_010038519.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=403

 Score =   374 bits (959),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/402 (44%), Positives = 260/402 (65%), Gaps = 8/402 (2%)
 Frame = +2

Query  746   LAFIYLTFGDLWVSYPEETL-----KLSFVERNGTQFYADGQVFYVNGWNSYWFMEHAVD  910
             L F+ L    L +    E       +  FV  NG  F A+G+  Y+NG+N+YW M  A D
Sbjct  3     LKFVVLALAALLIRENCEAAVDGVGRSGFVGTNGIHFVANGKPLYLNGFNAYWMMYMASD  62

Query  911   FGRRPRVRTMLQAAAKMGMTVCRTWAFNDGAYNALQISPGKFDERVFRALDLVIAESRRH  1090
                R +V ++ Q AAK GM + RTWAF+DG   ALQISPG ++E +F+ LD VI+E+RR+
Sbjct  63    PSTRDKVASVFQEAAKNGMNMARTWAFSDGVNRALQISPGIYNEDMFKGLDFVISEARRN  122

Query  1091  GIRLILCLVNNLKAYGGKTQYVKWAWQEGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRK  1270
             G+ LI+ LVNN   +GGK QYV+WA   G  L+ ++D FF +   R Y+KN+VK VLTR 
Sbjct  123   GVYLIVSLVNNWNEFGGKNQYVRWARDSGQSLN-NDDEFFTNSVTRGYYKNHVKAVLTRM  181

Query  1271  NTVTGLEYRDDPTIFAWELINEPRCMTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEG  1450
             NTVTG+ Y+DDPTIFAWEL+NEP+C +DP+G +LQDW+ EM+ ++KSID NH+L VGLEG
Sbjct  182   NTVTGVAYKDDPTIFAWELMNEPQCKSDPSGKSLQDWVSEMAAYLKSIDSNHMLEVGLEG  241

Query  1451  FYGPKDPKRLKINPELWAADLGSDFIRNSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTK  1630
             FYG   P + + NP   +  +G+DFI N+ +  +DFA++H+YPD W  + +  +++ F  
Sbjct  242   FYGQSVPGKQQNNPG--SVLVGTDFISNNQVPQVDFATIHLYPDQWMPSASEGEQVAFAD  299

Query  1631  KWILSHIEDGERALKKPIMFTEFGLAGETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAG  1810
             KW+  HI+D    LKKPI+  EFG +  +      +RD +F  + + +Y SA +  SGAG
Sbjct  300   KWVQVHIQDSNTILKKPIILGEFGKSSNSSGYSVEKRDSYFGRLYDAIYTSASNQGSGAG  359

Query  1811  SVFWQFLVERMEEYNDEFGIVPWERASTYNLITNHSCRLAGV  1936
             ++FWQ  V+ M+ + D + ++  +  ST ++I   S R++ +
Sbjct  360   ALFWQLFVQGMDSFGDGYVVILKQSPSTASVIARQSRRMSAL  401



>ref|XP_002466346.1| hypothetical protein SORBIDRAFT_01g006080 [Sorghum bicolor]
 gb|EER93344.1| hypothetical protein SORBIDRAFT_01g006080 [Sorghum bicolor]
Length=510

 Score =   377 bits (969),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/380 (48%), Positives = 251/380 (66%), Gaps = 8/380 (2%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+  G QF    + FY+NG+N+YW M  AVD   R +V  + Q AA +G+TVCRTW FN
Sbjct  91    MVKTRGNQFVVGDRPFYLNGFNAYWLMILAVDPSTRGKVTEVFQQAAAVGLTVCRTWGFN  150

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL L+NN   YGGK QYVKWA  +
Sbjct  151   DGGWRALQKSPSVYDEDVFKALDFVVSEARKYRIRLILSLINNWDGYGGKAQYVKWARDD  210

Query  1175  GIGL---SPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRC  1345
             G G      S+D+FF D  ++ YFKN+VK +LTR N+ T + Y+DDPTI AWEL+NEPRC
Sbjct  211   GGGGLINITSDDAFFSDQTVKGYFKNHVKNMLTRVNSYTSVMYKDDPTILAWELMNEPRC  270

Query  1346  MTDPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDF  1525
              +DPTG+TLQ+WI+EM+  VKSID +HLL VG EGFYGP  P RL  NP  +A ++G+DF
Sbjct  271   TSDPTGNTLQEWIQEMAFHVKSIDPDHLLEVGAEGFYGPSSPARLPANPNAYAGEVGTDF  330

Query  1526  IRNSNLSTIDFASVHVYPDHWFKN-QTFQDKLKFTKKWILSHIEDGERALKK-PIMFTEF  1699
             IRN  +  +DFASVH+YPD W     T + +LKF   W+ +HI DGE  L   P++FTEF
Sbjct  331   IRNHRVLGVDFASVHIYPDTWMSGAATLEAQLKFVASWMQAHIADGEGTLGGMPVVFTEF  390

Query  1700  GLAGETKEVEPYQ---RDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGI  1870
             G + + +    +    RD+F + +   +  S +   +GAG++ WQ   E  +  +D +G+
Sbjct  391   GASTKARSSAAFNATTRDQFIQAVYGHLLNSTRRGGAGAGALLWQVFPEGTDYMDDGYGV  450

Query  1871  VPWERASTYNLITNHSCRLA  1930
             V    A+T  +++ HS +LA
Sbjct  451   VLPRAAATARIMSAHSKKLA  470



>ref|XP_008244712.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 [Prunus mume]
Length=473

 Score =   376 bits (965),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 245/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V++ G QF  + Q FYVNG+N+YW M  A D   R +V    + A  +G+TVCRTWAFN
Sbjct  73    LVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADKSTRGKVTDTFKQAFSVGLTVCRTWAFN  132

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ LD VI+E+R++ IRLIL L NN  AYGGK+QYVKW    
Sbjct  133   DGQWRALQKSPSVYDEEVFKGLDFVISEARKYKIRLILSLTNNWDAYGGKSQYVKWGKAA  192

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF  P ++ Y+K +VKTVL R NT+T + Y+DDPT+FAWEL+NEPRC +D
Sbjct  193   GLNLT-SDDDFFSHPTLKSYYKAHVKTVLNRVNTLTNITYKDDPTVFAWELMNEPRCTSD  251

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQDWI+EM+ +VKS+D  HL+ +GLEGFYGP  P R++ NP  +A  +G+DFIRN
Sbjct  252   PSGDKLQDWIQEMAVYVKSLDPKHLVEIGLEGFYGPSAPGRVQFNPNTYAQQVGTDFIRN  311

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
               +  +DFASVH+Y D W         L+FTK W+ +HIED E+ L  P++F+EFG++ +
Sbjct  312   HQVLGVDFASVHIYADSWISQSISDLHLQFTKSWMEAHIEDAEKYLGMPVVFSEFGVSSK  371

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + + +  S K   SG GS+ WQ   E  +  +D + I+  +  ST
Sbjct  372   DPGYNSSFRDTLLSTVYKTILNSTKKGGSGGGSLLWQLFPEGTDYMDDGYAIILSKSPST  431

Query  1895  YNLITNHSCRLA  1930
              N+I  HS RLA
Sbjct  432   SNIIALHSTRLA  443



>ref|XP_001760262.1| predicted protein [Physcomitrella patens]
 gb|EDQ75018.1| predicted protein [Physcomitrella patens]
Length=420

 Score =   374 bits (960),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/375 (46%), Positives = 244/375 (65%), Gaps = 1/375 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             FV R G+    +G  FY NGWNSYW M  A +   RPRV  +LQ  A +G+TVCRTWAFN
Sbjct  8     FVMRLGSTLMLEGYPFYANGWNSYWLMVVASELSTRPRVDDILQDGAALGLTVCRTWAFN  67

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ+SPG +DE VF+ LD  I +++R+G+RL+L LVNN   YGGK +YV WA  E
Sbjct  68    DGTHLALQMSPGNYDENVFQGLDYAIYQAQRNGVRLLLSLVNNWHDYGGKAKYVAWAEAE  127

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  ++  +D FF +   R+Y++N+VK VLTR NT TG+ YRDDPTIF WEL+NEP C +D
Sbjct  128   GEDVADEDD-FFRNAKCRQYYRNHVKAVLTRVNTFTGVAYRDDPTIFGWELMNEPHCKSD  186

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G+TLQ WI EM+ +VK++D  HLLTVG EG+Y          NP  +   +G+DFIR+
Sbjct  187   PSGETLQRWIGEMAAYVKTLDNKHLLTVGTEGYYASDSIGCSSSNPHNYCGTMGTDFIRD  246

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
                  +DFA+VH YPD W   + + + L+F  +W+ +HI D ER L+ P++F EFGL+ +
Sbjct  247   HQSPYLDFATVHAYPDQWLSTEDYDEMLEFFDRWVRAHIVDAERVLRMPVLFAEFGLSDK  306

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                    + + F+ ++ +  Y+SA ++ +GAG++ WQ L   M ++ND + I P   +S 
Sbjct  307   NSGFTKEKLEVFYSVVYDQSYESALNHGAGAGALMWQLLPAEMSDWNDGYSIEPSCGSSI  366

Query  1895  YNLITNHSCRLAGVH  1939
              N++   S RL  +H
Sbjct  367   CNMMLLQSARLKALH  381



>gb|ACN78662.1| endo-beta-mannanase [Actinidia arguta]
Length=433

 Score =   374 bits (960),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 251/378 (66%), Gaps = 4/378 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             F+   GT F  +G  +Y NG+N+YW M  A D  +R +V    + A+  G++V RTWAF+
Sbjct  29    FIRTRGTHFMLNGSPYYANGFNAYWLMYFATDPSQRGKVSAAFREASNHGLSVARTWAFS  88

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQ SPG ++E+ F+ LD V+AE+RR+GI+L+L LVNN +++GGK QYV WA  +
Sbjct  89    DGGYRPLQFSPGYYNEQAFKGLDFVVAEARRYGIKLVLSLVNNYESFGGKKQYVNWARSQ  148

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  LS S+D FF +P ++ Y+KN+VKTVL R NT+TG+ Y++DPTI AWEL+NEPRC +D
Sbjct  149   GQYLS-SDDDFFRNPLVKGYYKNHVKTVLNRYNTMTGVIYKNDPTIMAWELMNEPRCTSD  207

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G T+Q WI EM+++VKSID+NHLL  GLEGFYG   P+R  +NP     ++G+DFI N
Sbjct  208   PSGRTIQAWIMEMASYVKSIDRNHLLEAGLEGFYGQTTPQRKSLNPGF---NIGTDFIAN  264

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFA+VH YPD W  +   Q++L F   W+ +HI+D +  L+KP++ TEFG + +
Sbjct  265   NRVPWIDFATVHSYPDQWLTSSNEQNQLSFLNNWLDTHIQDAQFVLRKPLLLTEFGKSWK  324

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                   YQRD  F  +   +Y SAK   + AG +FWQ L E M+ + D + IV  E  ST
Sbjct  325   DPGYSTYQRDLLFNTVYYKIYSSAKRGGAAAGGLFWQLLTEGMDSFRDGYDIVLSESPST  384

Query  1895  YNLITNHSCRLAGVHGVL  1948
              N+I   S RL  +  + 
Sbjct  385   ANVIAQQSHRLYQIRKIF  402



>ref|XP_011011941.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   374 bits (961),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 249/378 (66%), Gaps = 4/378 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             F+   G QF  +G  +Y NG+N+YW M  A D  +R +V    + AA  G+TV RTWAF+
Sbjct  29    FIRARGVQFLLNGSPYYANGFNAYWLMYTASDPSQRSKVSAAFREAASHGLTVARTWAFS  88

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQ SPG ++E++F+ LD V+AE+R +GI+LIL   NN  ++GGK QYV WA   
Sbjct  89    DGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGGKKQYVNWARSR  148

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  LS S+D FF  P ++ Y+KN++KTVL R N+ TG+ Y+DDPTI AWEL+NEPRC +D
Sbjct  149   GQYLS-SDDDFFRHPVVKGYYKNHIKTVLYRYNSFTGIRYKDDPTIMAWELMNEPRCTSD  207

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+G T+Q WI EM++FVKSID+NHLL  GLEGFYGP  P+R ++NP L    +G+DFI N
Sbjct  208   PSGRTIQAWIAEMASFVKSIDRNHLLEAGLEGFYGPSTPQRNRLNPGL---KIGTDFIAN  264

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  +DFA+VH YPD WF +   Q++L F   W+ +HI+D +  L+KPI+  EFG + +
Sbjct  265   NRIPGLDFATVHAYPDQWFSSSNDQNQLSFLNNWLDTHIQDAQNILRKPILIAEFGKSWK  324

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                   YQRD  F  +   +Y +AK   + AG +FWQ L E M+ + D + I+  + +ST
Sbjct  325   YPGFSTYQRDLLFNTVYYKIYSTAKRGGAAAGGLFWQLLTEGMDNFRDGYEIILGQPSST  384

Query  1895  YNLITNHSCRLAGVHGVL  1948
              N+I+  + +L  +  + 
Sbjct  385   ANVISQQAHKLYQIRKIF  402



>ref|XP_007046870.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046871.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046872.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046873.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91027.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91028.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91029.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91030.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=433

 Score =   374 bits (960),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 247/371 (67%), Gaps = 4/371 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             F+   G  F  +G  +Y NG+N+YW M  A D  +RP+V    + AA  G+TV RTWAF+
Sbjct  29    FIRTRGVHFLLNGNPYYANGFNAYWLMYVASDPSQRPKVSASFREAAAHGLTVARTWAFS  88

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQ +PG ++E++F+ LD VIAE+RR+ I+LIL L NN +++GGK QYV WA  +
Sbjct  89    DGGYRPLQYAPGSYNEQMFKGLDFVIAEARRYRIKLILSLANNYESFGGKKQYVNWARSQ  148

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  L+ S+D FF +P ++ Y+KN+VKTVL R N+ TG+ Y+DDPTI AWEL+NEPRC +D
Sbjct  149   GQYLT-SDDDFFRNPVVKGYYKNHVKTVLNRYNSFTGMHYKDDPTIMAWELMNEPRCTSD  207

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +G T+Q WI EM++ VKSID+NHLL  GLEGFYG    +++++NP L   ++G+DFI N
Sbjct  208   SSGRTIQAWIMEMASHVKSIDRNHLLEAGLEGFYGQSTAQKMRLNPNL---NIGTDFIAN  264

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFA+VH YPD W  +   Q +L F  KW+ +HI+D +  L+KP++ TEFG + +
Sbjct  265   NQIPGIDFATVHSYPDQWLSSSNDQYQLSFLNKWLDAHIQDAQFILRKPVLLTEFGKSWK  324

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                   Y+RD+ F  +   +Y SAK     AG +FWQ L E M+ + D + IV  E  ST
Sbjct  325   DPGFSTYKRDQLFNTVYYKIYSSAKRGGPAAGGLFWQLLSEGMDSFRDGYDIVLSESPST  384

Query  1895  YNLITNHSCRL  1927
              N I+  S +L
Sbjct  385   ANAISQQSHKL  395



>emb|CDY11173.1| BnaA03g00090D [Brassica napus]
Length=442

 Score =   374 bits (960),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 242/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TV RTWAFN
Sbjct  40    MVQRKGQQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTDVFQQASAVGLTVGRTWAFN  99

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN   YGGK QYVKW    
Sbjct  100   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWNDYGGKAQYVKWGNAS  159

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R ++K++V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  160   GLNLT-SDDDFFTNPTLRDFYKSHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRCPSD  218

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKS+D  H++ +GLEGFYGP  P R K NP  +AA +G+DFIRN
Sbjct  219   PSGDKLQSWIQEMAVFVKSLDAKHMVEIGLEGFYGPSAPARTKFNPNPYAAQVGTDFIRN  278

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             +    +DFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++  
Sbjct  279   NQALGVDFASVHVYPDAWISPAVSDTFLEFTNSWMQAHVEDAEMYLGMPVLFTEFGVSAH  338

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  339   DPGFNTSFRDMMLNTVYKMSLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  398

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  399   SKIISLQSKRLA  410



>ref|XP_006841527.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
 gb|ERN03202.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
Length=427

 Score =   373 bits (958),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/375 (46%), Positives = 252/375 (67%), Gaps = 4/375 (1%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
             FV+  G  F  +G  FYVNG+N+YW M+ A D   R +V ++ Q A+  G+TV RTWAF+
Sbjct  33    FVKTKGIHFIVNGSPFYVNGFNAYWLMQMASDPSTRGKVTSVFQQASSYGLTVARTWAFS  92

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG Y  LQISPG ++E +F  LD VI+E+RR+G+RLIL  VNN K  GG+ QYV+WA  +
Sbjct  93    DGGYRPLQISPGSYNEDMFNGLDFVISEARRYGVRLILSFVNNYKDLGGRPQYVQWAGNQ  152

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G  L+ S+D F+ +P ++ Y+KN+VK+V++R N+++G+ Y+DDPTIFAWEL+NEPRC TD
Sbjct  153   GQSLN-SDDDFYTNPVVKGYYKNHVKSVISRVNSMSGVAYKDDPTIFAWELMNEPRCQTD  211

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
              +G  +Q+WI EM+  VKS+D +HLL  GLEG+YG   P+R + NP      +G+DFI N
Sbjct  212   LSGRPVQEWITEMAAHVKSLDSSHLLEAGLEGYYGDSSPQRQQFNP---GYKVGTDFIFN  268

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             + +  IDFA++H YPD W    + Q +L F + W+ +HIED    LKKP++FTEFG + +
Sbjct  269   NQIPGIDFATIHAYPDQWIPGSSDQAQLSFLQSWVQAHIEDSNTVLKKPMLFTEFGKSSK  328

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
             T+   P  RD  F  +   +Y SA+   +GAG +FWQ L + M+ + D + ++  E  ST
Sbjct  329   TQGYTPGLRDTLFATVYNSIYTSARSGGAGAGGLFWQLLDKDMDNFRDGYDVIMAESPST  388

Query  1895  YNLITNHSCRLAGVH  1939
              N+I   S +L+ ++
Sbjct  389   ANVIAQQSHKLSSLN  403



>ref|XP_009130619.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Brassica 
rapa]
 ref|XP_009130620.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X2 [Brassica 
rapa]
Length=456

 Score =   374 bits (961),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 242/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TV RTWAFN
Sbjct  54    MVQRKGQQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTDVFQQASAVGLTVGRTWAFN  113

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN   YGGK QYVKW    
Sbjct  114   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWNDYGGKAQYVKWGNAS  173

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R ++K++V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  174   GLNLT-SDDDFFTNPTLRDFYKSHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRCPSD  232

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKS+D  H++ +GLEGFYGP  P R K NP  +AA +G+DFIRN
Sbjct  233   PSGDKLQSWIQEMAVFVKSLDAKHMVEIGLEGFYGPSAPARTKFNPNPYAAQVGTDFIRN  292

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             +    +DFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++  
Sbjct  293   NQALGVDFASVHVYPDAWISPAVSDTFLEFTNSWMQAHVEDAEMYLGMPVLFTEFGVSAH  352

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  353   DPGFNTSFRDMMLNTVYKMSLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  412

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  413   SKIISLQSKRLA  424



>emb|CDP06381.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   375 bits (962),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 246/372 (66%), Gaps = 1/372 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V+++G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TVCRTWAF
Sbjct  68    TMVQKHGNQFMVNGQPFYVNGFNTYWLMVFAADQSTRAKVTEVFQQASSVGLTVCRTWAF  127

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE+VF+ALD VI+E+++  IRLIL LVNN +AYGGK+QYVKW   
Sbjct  128   NDGQWRALQKSPAVYDEQVFQALDFVISEAKKFKIRLILSLVNNWEAYGGKSQYVKWGKA  187

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VK VL R NTV  + Y+DDPTIFAWEL+NEPRC +
Sbjct  188   AGLNLT-SDDDFFSHPTLKGYYKAHVKMVLDRVNTVNNVTYKDDPTIFAWELMNEPRCES  246

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+G+ LQ W+EEM+ +VKSID  HLL +G+EGFYGP    R++ NP  +A  +G+DFIR
Sbjct  247   DPSGNKLQAWLEEMAVYVKSIDPKHLLEIGVEGFYGPSTLNRVQFNPNTYAQQVGTDFIR  306

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+YPD W         + FTK W+ SHI+D E  L  P++F EFG++ 
Sbjct  307   NHQILGVDFASVHIYPDSWISQSISDAHIDFTKAWMQSHIDDAENFLGMPVVFGEFGVSA  366

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD F   + + +  S K    G GS+ WQ   E  +  +D + +V  +  S
Sbjct  367   KDPGYNSTYRDTFLNTVYKTLLNSTKMGGGGGGSLLWQLFPEGTDYMDDGYAVVLSKSPS  426

Query  1892  TYNLITNHSCRL  1927
             T ++++  S RL
Sbjct  427   TSDIVSLQSRRL  438



>ref|XP_004302566.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6-like [Fragaria 
vesca subsp. vesca]
Length=409

 Score =   372 bits (956),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/373 (48%), Positives = 247/373 (66%), Gaps = 1/373 (0%)
 Frame = +2

Query  812   SFVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAF  991
             + V++ G QF  + Q FYVNG+N+YW M  A D   R +V  + + AA +G+T+CRTWAF
Sbjct  10    AMVQKKGNQFVVNDQPFYVNGFNTYWLMVFAADQSTRGKVTDVFKQAASVGLTICRTWAF  69

Query  992   NDGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQ  1171
             NDG + ALQ SP  +DE VF+ALD VI+E++++ IRLIL L NN  AYGGK QY+KW   
Sbjct  70    NDGQWRALQKSPAVYDEEVFKALDFVISEAKKYKIRLILSLTNNWDAYGGKPQYIKWGKA  129

Query  1172  EGIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMT  1351
              G+ L+ S+D FF  P ++ Y+K +VKTVL R NT+T + Y+DDPT+FAWEL+NEPRC +
Sbjct  130   AGLNLT-SDDDFFSHPTLKSYYKAHVKTVLNRVNTLTNITYKDDPTVFAWELMNEPRCTS  188

Query  1352  DPTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIR  1531
             DP+GDTLQ+WI+EM+ FVKS+D  HL+ +GLEGFYGP    R++ NP  +A  +G+DFIR
Sbjct  189   DPSGDTLQEWIQEMAVFVKSVDPKHLVEIGLEGFYGPSTLDRVQFNPNTYAQQVGTDFIR  248

Query  1532  NSNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAG  1711
             N  +  +DFASVH+Y D W         L+FT+ WI +HI+D E+ L  P++F EFG++ 
Sbjct  249   NHQVLGVDFASVHIYADSWISQSISDVHLQFTESWIKAHIDDAEKYLGMPVVFAEFGVST  308

Query  1712  ETKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAS  1891
             +        RD     + + +  S K   SG GS+ WQ   +  +  +D + IV  +  S
Sbjct  309   KDPGYNTSFRDTVINTVYKTLLNSTKKGGSGGGSLLWQLFPDGTDYMDDGYAIVLSKAPS  368

Query  1892  TYNLITNHSCRLA  1930
             T N+I  HS RLA
Sbjct  369   TSNIIALHSTRLA  381



>ref|XP_009130618.1| PREDICTED: mannan endo-1,4-beta-mannosidase 6 isoform X1 [Brassica 
rapa]
Length=466

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 242/372 (65%), Gaps = 1/372 (0%)
 Frame = +2

Query  815   FVERNGTQFYADGQVFYVNGWNSYWFMEHAVDFGRRPRVRTMLQAAAKMGMTVCRTWAFN  994
              V+R G QF  +GQ FYVNG+N+YW M  A D   R +V  + Q A+ +G+TV RTWAFN
Sbjct  64    MVQRKGQQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTDVFQQASAVGLTVGRTWAFN  123

Query  995   DGAYNALQISPGKFDERVFRALDLVIAESRRHGIRLILCLVNNLKAYGGKTQYVKWAWQE  1174
             DG + ALQ SP  +DE VF+ALD V++E+R++ IRLIL LVNN   YGGK QYVKW    
Sbjct  124   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWNDYGGKAQYVKWGNAS  183

Query  1175  GIGLSPSNDSFFYDPNIRRYFKNYVKTVLTRKNTVTGLEYRDDPTIFAWELINEPRCMTD  1354
             G+ L+ S+D FF +P +R ++K++V+TVL R NT T + Y++DPTIFAWEL+NEPRC +D
Sbjct  184   GLNLT-SDDDFFTNPTLRDFYKSHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRCPSD  242

Query  1355  PTGDTLQDWIEEMSTFVKSIDKNHLLTVGLEGFYGPKDPKRLKINPELWAADLGSDFIRN  1534
             P+GD LQ WI+EM+ FVKS+D  H++ +GLEGFYGP  P R K NP  +AA +G+DFIRN
Sbjct  243   PSGDKLQSWIQEMAVFVKSLDAKHMVEIGLEGFYGPSAPARTKFNPNPYAAQVGTDFIRN  302

Query  1535  SNLSTIDFASVHVYPDHWFKNQTFQDKLKFTKKWILSHIEDGERALKKPIMFTEFGLAGE  1714
             +    +DFASVHVYPD W         L+FT  W+ +H+ED E  L  P++FTEFG++  
Sbjct  303   NQALGVDFASVHVYPDAWISPAVSDTFLEFTNSWMQAHVEDAEMYLGMPVLFTEFGVSAH  362

Query  1715  TKEVEPYQRDRFFKLILEIMYKSAKHNKSGAGSVFWQFLVERMEEYNDEFGIVPWERAST  1894
                     RD     + ++   S +   +GAGS+ WQ   +  E  +D + +      + 
Sbjct  363   DPGFNTSFRDMMLNTVYKMSLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYLTRAHTA  422

Query  1895  YNLITNHSCRLA  1930
               +I+  S RLA
Sbjct  423   SKIISLQSKRLA  434



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7111009506740