BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33957_g1_i1 len=987 path=[965:0-986]

Length=987
                                                                      Score     E

emb|CDP11892.1|  unnamed protein product                                228   5e-69   
emb|CDP11890.1|  unnamed protein product                                226   2e-68   
emb|CDP11889.1|  unnamed protein product                                222   1e-66   
ref|XP_009350432.1|  PREDICTED: myb-related protein Myb4-like           217   5e-65   
ref|XP_008341938.1|  PREDICTED: myb-related protein Myb4-like           216   1e-64   
emb|CDP11893.1|  unnamed protein product                                215   2e-64   
ref|XP_011047493.1|  PREDICTED: myb-related protein 308-like            213   2e-63   
ref|XP_002325683.2|  hypothetical protein POPTR_0019s14120g             208   1e-61   Populus trichocarpa [western balsam poplar]
gb|KDP24725.1|  hypothetical protein JCGZ_26464                         207   6e-61   
ref|XP_009353213.1|  PREDICTED: myb-related protein Myb4-like           204   4e-60   
gb|KDP21585.1|  hypothetical protein JCGZ_03738                         204   6e-60   
ref|NP_001280912.1|  myb-related protein Myb4-like                      202   2e-59   
ref|XP_010268949.1|  PREDICTED: myb-related protein 308-like            202   6e-59   
ref|XP_002276962.1|  PREDICTED: transcription factor MYB114             201   1e-58   Vitis vinifera
ref|XP_011091328.1|  PREDICTED: myb-related protein Myb4-like           201   1e-58   
ref|XP_007132613.1|  hypothetical protein PHAVU_011G109800g             199   3e-58   
ref|XP_002319935.1|  hypothetical protein POPTR_0013s14560g             200   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_006447414.1|  hypothetical protein CICLE_v10017677mg             199   3e-58   
gb|EYU24837.1|  hypothetical protein MIMGU_mgv1a018138mg                199   4e-58   
gb|AGN52096.1|  MYB-related transcription factor                        198   4e-58   
ref|XP_011100426.1|  PREDICTED: myb-related protein 308-like            199   4e-58   
ref|XP_004243792.1|  PREDICTED: myb-related protein Myb4-like           197   6e-58   
ref|XP_011048477.1|  PREDICTED: transcription factor WER-like           198   6e-58   
gb|AGN52090.1|  MYB-related transcription factor                        196   1e-57   
gb|EYU24839.1|  hypothetical protein MIMGU_mgv1a020124mg                197   1e-57   
ref|XP_011048479.1|  PREDICTED: myb-related protein Myb4-like           198   1e-57   
ref|XP_009766826.1|  PREDICTED: myb-related protein Myb4-like iso...    197   1e-57   
ref|XP_007149916.1|  hypothetical protein PHAVU_005G109800g             197   1e-57   
gb|AGN52147.1|  MYB-related transcription factor                        197   2e-57   
ref|XP_008230195.1|  PREDICTED: myb-related protein Myb4-like           198   2e-57   
gb|EYU24838.1|  hypothetical protein MIMGU_mgv1a025340mg                197   2e-57   
ref|XP_007216710.1|  hypothetical protein PRUPE_ppa026553mg             198   2e-57   
ref|XP_002325682.1|  hypothetical protein POPTR_0019s14130g             197   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_007043432.1|  Myb domain protein 15, putative                    199   3e-57   
ref|XP_011100326.1|  PREDICTED: myb-related protein Myb4-like           198   4e-57   
gb|KDO55821.1|  hypothetical protein CISIN_1g042846mg                   196   5e-57   
ref|XP_004513559.1|  PREDICTED: myb-related protein Myb4-like iso...    197   5e-57   
ref|XP_009624516.1|  PREDICTED: myb-related protein Myb4-like           196   6e-57   
ref|XP_007043431.1|  Myb domain protein 15, putative                    197   7e-57   
ref|XP_009800099.1|  PREDICTED: myb-related protein Myb4-like           195   7e-57   
gb|ABH02922.1|  MYB transcription factor MYB122                         192   7e-57   Glycine max [soybeans]
ref|XP_004513558.1|  PREDICTED: myb-related protein Myb4-like iso...    197   8e-57   
ref|XP_003526305.2|  PREDICTED: myb-related protein Myb4-like           195   1e-56   
gb|KHN41179.1|  Myb-related protein Myb4                                195   1e-56   
ref|XP_006446589.1|  hypothetical protein CICLE_v10018311mg             194   1e-56   
gb|AGN52037.1|  MYB-related transcription factor                        196   1e-56   
ref|XP_002325681.1|  hypothetical protein POPTR_0019s14140g             195   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_006446590.1|  hypothetical protein CICLE_v10017435mg             194   2e-56   
ref|XP_007216491.1|  hypothetical protein PRUPE_ppa025095mg             193   3e-56   
gb|KHN22879.1|  Myb-related protein Myb4                                197   3e-56   
ref|XP_003540870.1|  PREDICTED: myb-related protein Myb4 isoform X1     196   3e-56   
gb|EYU23537.1|  hypothetical protein MIMGU_mgv1a021445mg                193   3e-56   
ref|XP_010095861.1|  Myb-related protein Myb4                           196   4e-56   
ref|XP_007132610.1|  hypothetical protein PHAVU_011G109500g             193   4e-56   
ref|XP_006470240.1|  PREDICTED: myb-related protein Myb4-like           193   4e-56   
ref|XP_008448223.1|  PREDICTED: transcription repressor MYB6-like       194   5e-56   
ref|XP_003541925.1|  PREDICTED: myb-related protein Myb4-like           193   5e-56   
ref|XP_010277889.1|  PREDICTED: myb-related protein Myb4-like           194   5e-56   
emb|CDP11876.1|  unnamed protein product                                194   5e-56   
ref|XP_010095860.1|  Myb-related protein Myb4                           194   8e-56   
gb|KHN41177.1|  Myb-related protein Myb4                                195   9e-56   
ref|XP_003526303.1|  PREDICTED: myb-related protein Myb4                195   1e-55   
gb|AAN17830.1|  Myb-like protein P                                      193   1e-55   Saussurea medusa
ref|XP_011047495.1|  PREDICTED: myb-related protein Myb4-like           193   1e-55   
ref|XP_006447415.1|  hypothetical protein CICLE_v10016303mg             192   2e-55   
ref|XP_003526304.1|  PREDICTED: myb-related protein Myb4-like           194   2e-55   
ref|XP_011047494.1|  PREDICTED: myb-related protein Myb4-like           192   2e-55   
ref|XP_004295360.1|  PREDICTED: myb-related protein Hv1-like            193   2e-55   
gb|KDO55822.1|  hypothetical protein CISIN_1g024860mg                   192   3e-55   
gb|KHN41176.1|  Myb-related protein Myb4                                191   5e-55   
ref|XP_008230194.1|  PREDICTED: myb-related protein Myb4-like           191   7e-55   
gb|AGN52126.1|  MYB-related transcription factor                        187   1e-54   
dbj|BAI49720.1|  putative MYB transcription factor                      190   2e-54   Diospyros kaki [Japanese persimmon]
ref|XP_003527470.1|  PREDICTED: myb-related protein Myb4-like           189   2e-54   
ref|XP_003597081.1|  MYB transcription factor                           189   3e-54   
ref|XP_010051469.1|  PREDICTED: myb-related protein Myb4-like           188   5e-54   
gb|KEH17564.1|  myb-related transcription factor                        190   5e-54   
gb|KEH16274.1|  myb-related transcription factor                        189   5e-54   
gb|KHN41175.1|  Myb-related protein Myb4                                187   7e-54   
ref|XP_004137010.1|  PREDICTED: transcription repressor MYB4-like       189   7e-54   
ref|XP_010069815.1|  PREDICTED: myb-related protein Myb4-like           187   7e-54   
ref|XP_004140052.1|  PREDICTED: transcription repressor MYB4-like       187   8e-54   
gb|AHM25911.1|  transcription factor mybp                               187   1e-53   
ref|XP_008455365.1|  PREDICTED: transcription factor WER-like           188   1e-53   
gb|KGN46680.1|  hypothetical protein Csa_6G121970                       188   1e-53   
gb|AGN52213.1|  MYB-related transcription factor                        187   1e-53   
ref|XP_002272704.1|  PREDICTED: myb-related protein Myb4                187   1e-53   Vitis vinifera
ref|XP_004243413.1|  PREDICTED: myb-related protein Myb4-like           187   1e-53   
ref|XP_007132612.1|  hypothetical protein PHAVU_011G109700g             189   2e-53   
gb|KEH17561.1|  myb-related transcription factor                        187   2e-53   
emb|CAN72480.1|  hypothetical protein VITISV_019320                     188   2e-53   Vitis vinifera
ref|XP_009800612.1|  PREDICTED: myb-related protein Myb4-like           186   3e-53   
ref|XP_010277888.1|  PREDICTED: myb-related protein 308-like            187   3e-53   
ref|XP_007132609.1|  hypothetical protein PHAVU_011G109400g             186   4e-53   
ref|XP_008342092.1|  PREDICTED: myb-related protein Myb4-like           187   4e-53   
gb|AIT13037.1|  myb-related transcription factor                        186   4e-53   
ref|XP_007132611.1|  hypothetical protein PHAVU_011G109600g             188   4e-53   
gb|AGN52103.1|  MYB-related transcription factor                        186   6e-53   
ref|XP_006360585.1|  PREDICTED: myb-related protein Myb4-like           186   6e-53   
gb|KHN22881.1|  Myb-related protein Myb4                                185   7e-53   
ref|XP_009779987.1|  PREDICTED: myb-related protein Myb4-like           185   1e-52   
ref|XP_007149915.1|  hypothetical protein PHAVU_005G109700g             187   2e-52   
dbj|BAC07544.1|  myb-related transcription factor VlMYBB1-2             184   2e-52   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AFK38645.1|  unknown                                                 184   3e-52   
ref|XP_006467925.1|  PREDICTED: myb-related protein Myb4-like           185   4e-52   
ref|XP_009351440.1|  PREDICTED: myb-related protein Myb4-like           187   4e-52   
ref|XP_009594011.1|  PREDICTED: myb-related protein Myb4-like           183   4e-52   
ref|XP_004497845.1|  PREDICTED: myb-related protein Myb4-like           184   4e-52   
ref|XP_004495379.1|  PREDICTED: myb-related protein Myb4-like           184   5e-52   
ref|XP_004289939.1|  PREDICTED: myb-related protein Myb4-like           184   6e-52   
gb|EPS66172.1|  hypothetical protein M569_08609                         179   7e-52   
ref|XP_003540874.1|  PREDICTED: myb-related protein Myb4-like           182   7e-52   
ref|XP_007035114.1|  Myb domain protein 13, putative                    185   8e-52   
gb|AES67329.2|  myb transcription factor                                188   1e-51   
gb|KHN22878.1|  Myb-related protein Myb4                                182   1e-51   
ref|XP_004243822.1|  PREDICTED: transcription factor WER-like           182   1e-51   
ref|XP_003540869.2|  PREDICTED: myb-related protein Myb4-like           182   1e-51   
gb|ABR28344.1|  MYB transcription factor MYB70                          182   1e-51   
emb|CCA29106.1|  putative MYB transcription factor                      182   2e-51   
ref|XP_003590026.1|  MYB-like protein                                   182   2e-51   
gb|AFK39973.1|  unknown                                                 182   2e-51   
gb|ABR28339.1|  MYB transcription factor MYB51                          182   2e-51   
ref|XP_003590028.1|  Myb-related protein P                              182   2e-51   
ref|XP_007145850.1|  hypothetical protein PHAVU_007G273400g             182   2e-51   
ref|XP_010268905.1|  PREDICTED: myb-related protein Myb4-like           182   2e-51   
gb|ACJ84928.1|  unknown                                                 182   2e-51   Medicago truncatula
ref|XP_006360526.1|  PREDICTED: myb-related protein Myb4-like           181   2e-51   
emb|CDO99233.1|  unnamed protein product                                182   2e-51   
gb|KHN00260.1|  Myb-related protein Myb4                                182   3e-51   
gb|KEH17558.1|  myb transcription factor                                181   3e-51   
ref|XP_008807658.1|  PREDICTED: myb-related protein Myb4-like           182   4e-51   
ref|XP_004507244.1|  PREDICTED: myb-related protein 315-like            181   4e-51   
ref|XP_006345888.1|  PREDICTED: myb-related protein Myb4-like           180   4e-51   
ref|XP_009631826.1|  PREDICTED: myb-related protein Myb4-like           181   5e-51   
ref|XP_008235684.1|  PREDICTED: myb-related protein Myb4                181   5e-51   
ref|XP_009629052.1|  PREDICTED: myb-related protein Myb4-like           182   5e-51   
ref|XP_003518022.1|  PREDICTED: myb-related protein Myb4-like           181   5e-51   
ref|XP_004252033.1|  PREDICTED: myb-related protein Myb4-like           180   5e-51   
dbj|BAA81732.1|  GmMYB29A2                                              181   6e-51   Glycine max [soybeans]
ref|XP_010906538.1|  PREDICTED: myb-related protein Myb4-like           181   7e-51   
gb|KDO75677.1|  hypothetical protein CISIN_1g037956mg                   180   1e-50   
gb|KHN00294.1|  Myb-related protein Myb4                                180   1e-50   
gb|ACJ84573.1|  unknown                                                 180   1e-50   Medicago truncatula
ref|XP_003535693.1|  PREDICTED: myb-related protein Myb4                180   1e-50   
ref|XP_006449185.1|  hypothetical protein CICLE_v10017679mg             176   1e-50   
ref|XP_006442693.1|  hypothetical protein CICLE_v10022057mg             179   1e-50   
gb|ACU23862.1|  unknown                                                 180   1e-50   Glycine max [soybeans]
ref|XP_007199224.1|  hypothetical protein PRUPE_ppa021921mg             180   1e-50   
gb|ABR28338.1|  MYB transcription factor MYB50                          180   2e-50   
ref|XP_010934323.1|  PREDICTED: myb-related protein Myb4-like           179   2e-50   
ref|XP_010920477.1|  PREDICTED: myb-related protein Myb4                179   2e-50   
ref|XP_008785342.1|  PREDICTED: myb-related protein Myb4-like           180   2e-50   
ref|NP_001064861.1|  Os10g0478300                                       180   2e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009765014.1|  PREDICTED: myb-related protein Myb4-like           179   2e-50   
ref|XP_006664815.1|  PREDICTED: myb-related protein Myb4-like           180   2e-50   
ref|XP_007149917.1|  hypothetical protein PHAVU_005G109900g             178   2e-50   
gb|AEV91156.1|  R2R3-MYB protein                                        179   2e-50   
ref|XP_011036293.1|  PREDICTED: myb-related protein Myb4-like           177   2e-50   
gb|KEH16942.1|  myb transcription factor                                178   3e-50   
gb|AFK45056.1|  unknown                                                 179   4e-50   
ref|XP_004507232.1|  PREDICTED: transcription factor MYB12-like         178   4e-50   
ref|XP_002311670.1|  hypothetical protein POPTR_0008s16660g             179   5e-50   Populus trichocarpa [western balsam poplar]
gb|KHN41181.1|  Myb-related protein Myb4                                178   5e-50   
ref|XP_006358196.1|  PREDICTED: myb-related protein Myb4-like           178   6e-50   
ref|XP_009398450.1|  PREDICTED: myb-related protein Myb4-like           178   6e-50   
ref|XP_002464484.1|  hypothetical protein SORBIDRAFT_01g019270          179   6e-50   Sorghum bicolor [broomcorn]
ref|XP_009762172.1|  PREDICTED: myb-related protein Myb4-like           179   6e-50   
ref|XP_004235197.1|  PREDICTED: transcription factor WER-like           178   7e-50   
ref|XP_004240193.1|  PREDICTED: myb-related protein Myb4-like           177   7e-50   
ref|XP_003540332.2|  PREDICTED: myb-related protein Myb4-like           179   8e-50   
ref|XP_004234040.1|  PREDICTED: myb-related protein Myb4                177   8e-50   
gb|KDP44603.1|  hypothetical protein JCGZ_19745                         177   9e-50   
ref|XP_009392095.1|  PREDICTED: myb-related protein Myb4-like           177   9e-50   
ref|XP_008791593.1|  PREDICTED: myb-related protein Myb4                178   9e-50   
ref|XP_007143866.1|  hypothetical protein PHAVU_007G108500g             178   1e-49   
ref|XP_001768811.1|  predicted protein                                  174   1e-49   
gb|AGN52150.1|  MYB-related transcription factor                        176   1e-49   
gb|KHN04301.1|  Myb-related protein Zm1                                 179   1e-49   
ref|XP_004982863.1|  PREDICTED: myb-related protein Myb4-like           178   1e-49   
ref|XP_009606766.1|  PREDICTED: myb-related protein Myb4-like           176   1e-49   
gb|ABI84253.1|  transcription factor Myb1                               173   1e-49   Arachis hypogaea [goober]
gb|AEV91155.1|  R2R3-MYB protein                                        177   1e-49   
ref|XP_003597078.1|  MYB transcription factor                           182   2e-49   
gb|EMT21544.1|  Myb-related protein Myb4                                177   2e-49   
dbj|BAG71001.1|  myb-related transcription factor                       177   2e-49   Musa balbisiana [starchy banana]
ref|XP_007221832.1|  hypothetical protein PRUPE_ppa020190mg             177   2e-49   
gb|EMT19219.1|  Myb-related protein Myb4                                176   2e-49   
gb|EAY78934.1|  hypothetical protein OsI_34037                          177   2e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010102236.1|  Myb-related protein Myb4                           177   2e-49   
ref|XP_010274769.1|  PREDICTED: myb-related protein Myb4-like           177   3e-49   
ref|XP_009383020.1|  PREDICTED: myb-related protein Myb4-like           176   3e-49   
ref|XP_009766825.1|  PREDICTED: myb-related protein Myb4-like           172   3e-49   
ref|XP_004293474.1|  PREDICTED: transcription factor MYB28-like         176   3e-49   
gb|EMS55339.1|  Myb-related protein Myb4                                175   3e-49   
ref|XP_010069126.1|  PREDICTED: myb-related protein Myb4                177   4e-49   
ref|XP_009601374.1|  PREDICTED: myb-related protein Myb4-like           177   4e-49   
ref|XP_010111921.1|  Myb-related protein Myb4                           177   4e-49   
gb|KDP26537.1|  hypothetical protein JCGZ_17695                         176   4e-49   
gb|KHN04302.1|  Myb-related protein Myb4                                176   4e-49   
ref|XP_002285193.1|  PREDICTED: myb-related protein Myb4                176   4e-49   Vitis vinifera
ref|XP_011028802.1|  PREDICTED: myb-related protein Myb4-like           176   4e-49   
ref|XP_003539518.1|  PREDICTED: myb-related protein Myb4-like           176   5e-49   
ref|XP_006487722.1|  PREDICTED: myb-related protein Myb4-like           175   5e-49   
ref|XP_010660228.1|  PREDICTED: myb-related protein Myb4-like           174   5e-49   
gb|AEW23186.1|  MYB73                                                   176   6e-49   
ref|XP_004296369.1|  PREDICTED: myb-related protein Myb4-like           175   7e-49   
ref|XP_004151985.1|  PREDICTED: transcription repressor MYB6-like       175   7e-49   
ref|NP_001241018.1|  uncharacterized protein LOC100807569               176   7e-49   
gb|KDO74266.1|  hypothetical protein CISIN_1g045387mg                   175   8e-49   
ref|XP_004162391.1|  PREDICTED: myb-related protein Myb4-like           175   8e-49   
emb|CAA74603.1|  R2R3-MYB transcription factor                          176   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170585.1|  putative MYB DNA-binding domain superfamily ...    176   9e-49   Zea mays [maize]
ref|XP_008224356.1|  PREDICTED: myb-related protein Myb4-like           175   9e-49   
ref|XP_009785075.1|  PREDICTED: transcription factor MYB114-like        172   9e-49   
ref|XP_006354484.1|  PREDICTED: myb-related protein Myb4-like           175   9e-49   
ref|XP_009779489.1|  PREDICTED: myb-related protein Myb4-like           174   9e-49   
ref|XP_004976230.1|  PREDICTED: myb-related protein Myb4-like           175   1e-48   
ref|XP_011029827.1|  PREDICTED: myb-related protein Myb4-like           176   1e-48   
gb|AGN52040.1|  MYB-related transcription factor                        173   1e-48   
gb|ACB30359.1|  myb-related transcription factor                        175   1e-48   Capsicum annuum
gb|KFK40183.1|  hypothetical protein AALP_AA3G341200                    175   1e-48   
ref|XP_009401945.1|  PREDICTED: myb-related protein Myb4-like           175   1e-48   
dbj|BAC07543.1|  myb-related transcription factor VlMYBB1-1             174   1e-48   Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_003571882.1|  PREDICTED: myb-related protein Myb4-like           174   2e-48   
ref|XP_010262320.1|  PREDICTED: myb-related protein Myb4                175   2e-48   
gb|ADN96004.1|  MYB1                                                    174   2e-48   
ref|XP_009770485.1|  PREDICTED: myb-related protein Myb4-like           175   2e-48   
ref|XP_006841861.1|  hypothetical protein AMTR_s00003p00271440          177   2e-48   
ref|XP_004247733.1|  PREDICTED: myb-related protein Myb4-like           174   2e-48   
dbj|BAE54312.1|  transcription factor DcMYB1                            174   2e-48   Daucus carota [carrots]
ref|XP_008447428.1|  PREDICTED: myb-related protein Myb4-like           174   2e-48   
ref|NP_188966.1|  myb domain protein 15                                 175   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AGN52093.1|  MYB-related transcription factor                        173   2e-48   
ref|XP_008438526.1|  PREDICTED: myb-related protein Myb4-like           174   2e-48   
gb|ABH02919.1|  MYB transcription factor MYB117                         173   2e-48   Glycine max [soybeans]
ref|XP_010512224.1|  PREDICTED: myb-related protein Myb4-like           175   2e-48   
ref|XP_007030431.1|  Myb domain protein 15, putative                    173   2e-48   
ref|XP_002883414.1|  AtMYB15/AtY19/MYB15                                175   2e-48   
ref|XP_008441942.1|  PREDICTED: transcription factor MYB86-like         177   2e-48   
ref|XP_006283783.1|  hypothetical protein CARUB_v10004873mg             178   3e-48   
ref|XP_010087464.1|  Transcription factor                               178   3e-48   
ref|XP_002302045.1|  GmMYB29 family protein                             174   3e-48   Populus trichocarpa [western balsam poplar]
gb|KDP40332.1|  hypothetical protein JCGZ_02330                         174   3e-48   
ref|XP_009629473.1|  PREDICTED: protein ODORANT1-like                   177   3e-48   
gb|AGN52057.1|  MYB-related transcription factor                        173   3e-48   
ref|XP_002306849.2|  hypothetical protein POPTR_0005s24550g             174   4e-48   Populus trichocarpa [western balsam poplar]
gb|ADI24681.1|  Myb3                                                    173   4e-48   
ref|XP_011025983.1|  PREDICTED: myb-related protein Myb4-like           174   4e-48   
ref|XP_010469752.1|  PREDICTED: myb-related protein Myb4-like           173   4e-48   
ref|XP_011091315.1|  PREDICTED: myb-related protein Myb4-like           173   4e-48   
gb|KDP20873.1|  hypothetical protein JCGZ_21344                         176   4e-48   
ref|XP_010935898.1|  PREDICTED: myb-related protein Myb4 isoform X1     174   4e-48   
gb|KHN30570.1|  Myb-related protein Myb4                                174   5e-48   
ref|XP_004157697.1|  PREDICTED: transcription repressor MYB5-like       173   5e-48   
ref|NP_001241360.1|  MYB29 protein                                      174   5e-48   
ref|XP_008645950.1|  PREDICTED: myb-related protein Myb4                173   5e-48   
ref|XP_010488375.1|  PREDICTED: myb-related protein Myb4-like           174   5e-48   
gb|AGN52074.1|  MYB-related transcription factor                        173   5e-48   
emb|CAA62032.1|  Y19                                                    169   5e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006464660.1|  PREDICTED: transcription factor MYB39-like         176   5e-48   
ref|XP_010466641.1|  PREDICTED: myb-related protein Myb4-like iso...    174   5e-48   
gb|ADI24680.1|  Myb7 protein                                            172   5e-48   
ref|XP_009399470.1|  PREDICTED: myb-related protein Myb4-like           173   5e-48   
ref|XP_010679296.1|  PREDICTED: myb-related protein Myb4                174   6e-48   
gb|EMT29840.1|  Myb-related protein Myb4                                172   6e-48   
ref|XP_009369487.1|  PREDICTED: myb-related protein Myb4-like           173   6e-48   
emb|CDO99644.1|  unnamed protein product                                175   6e-48   
ref|XP_008224916.1|  PREDICTED: myb-related protein Myb4-like           172   7e-48   
ref|XP_006593053.1|  PREDICTED: myb-related protein Myb4-like           174   7e-48   
ref|XP_009802252.1|  PREDICTED: myb-related protein Myb4-like           173   7e-48   
dbj|BAJ99860.1|  predicted protein                                      172   7e-48   
gb|EPS74409.1|  hypothetical protein M569_00345                         169   8e-48   
ref|XP_008457683.1|  PREDICTED: myb-related protein 308-like            172   8e-48   
ref|XP_006357551.1|  PREDICTED: protein ODORANT1-like                   174   9e-48   
ref|XP_002319387.1|  hypothetical protein POPTR_0013s14480g             175   9e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006452016.1|  hypothetical protein CICLE_v10009050mg             174   9e-48   
emb|CAA78387.1|  protein 2                                              173   9e-48   Petunia x hybrida [garden petunia]
ref|XP_002454197.1|  hypothetical protein SORBIDRAFT_04g026480          172   9e-48   Sorghum bicolor [broomcorn]
gb|ABU53925.1|  myb-related transcription factor                        173   9e-48   Datura metel
ref|XP_009396976.1|  PREDICTED: myb-related protein Myb4-like           172   9e-48   
gb|KHG20140.1|  Myb-related Myb4                                        169   1e-47   
gb|KDP23708.1|  hypothetical protein JCGZ_23541                         171   1e-47   
gb|AGN52050.1|  MYB-related transcription factor                        174   1e-47   
ref|XP_010323706.1|  PREDICTED: transcription factor WER-like           172   1e-47   
ref|XP_002305647.1|  putative MYB transcription factor family pro...    176   1e-47   
ref|XP_002272561.1|  PREDICTED: transcription factor MYB39              174   1e-47   
gb|AEX92834.1|  MYB46                                                   172   1e-47   
ref|XP_003575391.1|  PREDICTED: myb-related protein Myb4-like           172   1e-47   
emb|CDY47723.1|  BnaA10g04120D                                          172   1e-47   
ref|XP_009137761.1|  PREDICTED: transcription repressor MYB6-like...    173   1e-47   
ref|XP_004146632.1|  PREDICTED: uncharacterized protein LOC101216901    174   1e-47   
ref|XP_009801248.1|  PREDICTED: protein ODORANT1-like                   175   1e-47   
emb|CDY10182.1|  BnaC05g04250D                                          172   1e-47   
ref|XP_009119084.1|  PREDICTED: myb-related protein Myb4                172   1e-47   
gb|AGN52049.1|  MYB-related transcription factor                        172   1e-47   
ref|XP_010510229.1|  PREDICTED: myb-related protein Myb4-like           172   2e-47   
ref|XP_006655921.1|  PREDICTED: transcription factor MYB39-like         174   2e-47   
ref|XP_009600051.1|  PREDICTED: myb-related protein 308                 174   2e-47   
ref|XP_006299575.1|  hypothetical protein CARUB_v10015750mg             172   2e-47   
gb|EYU17914.1|  hypothetical protein MIMGU_mgv1a012084mg                172   2e-47   
ref|NP_001280969.1|  uncharacterized protein LOC103420593               172   2e-47   
gb|AFW63053.1|  putative MYB DNA-binding domain superfamily protein     172   2e-47   
emb|CBI18519.3|  unnamed protein product                                171   2e-47   
ref|XP_002264563.2|  PREDICTED: myb-related protein Myb4                172   2e-47   
ref|XP_009354945.1|  PREDICTED: myb-related protein Myb4-like           172   2e-47   
ref|NP_001152064.1|  myb-related protein Myb4                           171   2e-47   
ref|XP_004243304.1|  PREDICTED: protein ODORANT1-like                   174   2e-47   
ref|XP_006350689.1|  PREDICTED: myb-related protein Myb4-like           172   2e-47   
ref|XP_007211464.1|  hypothetical protein PRUPE_ppa007438mg             174   2e-47   
ref|XP_009764351.1|  PREDICTED: transcription factor MYB39-like         173   2e-47   
ref|XP_003521771.1|  PREDICTED: myb-related protein Myb4                170   2e-47   
gb|EMT13107.1|  Transcription factor MYB39                              173   2e-47   
ref|XP_009793776.1|  PREDICTED: myb-related protein Myb4-like           172   2e-47   
ref|XP_010414171.1|  PREDICTED: myb-related protein Myb4-like           171   2e-47   
emb|CAC01841.1|  putative transcription factor (MYB9)                   173   2e-47   
ref|XP_006416812.1|  hypothetical protein EUTSA_v10008436mg             172   2e-47   
ref|XP_006347152.1|  PREDICTED: transcription factor MYB86-like         174   2e-47   
ref|XP_006594633.1|  PREDICTED: protein ODORANT1                        174   2e-47   
ref|XP_007025822.1|  MYB-like 102                                       174   2e-47   
ref|XP_007212471.1|  hypothetical protein PRUPE_ppa015081mg             170   2e-47   
dbj|BAJ96650.1|  predicted protein                                      173   2e-47   
gb|AAS10096.1|  MYB transcription factor                                173   2e-47   
ref|XP_009761686.1|  PREDICTED: protein ODORANT1-like                   173   3e-47   
ref|XP_009593145.1|  PREDICTED: transcription factor MYB39-like         174   3e-47   
ref|XP_011001151.1|  PREDICTED: protein ODORANT1                        174   3e-47   
ref|XP_006376533.1|  hypothetical protein POPTR_0013s14550g             172   3e-47   
ref|NP_001281023.1|  protein ODORANT1-like                              174   3e-47   
ref|XP_010277911.1|  PREDICTED: transcription factor MYB39              174   3e-47   
ref|XP_009348003.1|  PREDICTED: protein ODORANT1-like                   174   3e-47   
gb|EMS50780.1|  Transcription factor MYB39                              173   3e-47   
ref|XP_009380857.1|  PREDICTED: myb-related protein 308                 173   3e-47   
ref|XP_009400813.1|  PREDICTED: myb-related protein Myb4-like           171   3e-47   
ref|XP_009339621.1|  PREDICTED: myb-related protein Myb4-like           171   3e-47   
ref|XP_009374421.1|  PREDICTED: transcription factor RAX2               174   3e-47   
ref|XP_009774387.1|  PREDICTED: transcription factor MYB34-like         173   3e-47   
ref|XP_004232789.1|  PREDICTED: transcription factor MYB39              174   3e-47   
ref|XP_007018775.1|  Myb domain protein 93                              173   3e-47   
ref|NP_197179.2|  myb domain protein 9                                  173   3e-47   
ref|XP_002892910.1|  AtMYB58                                            171   3e-47   
ref|XP_010533288.1|  PREDICTED: myb-related protein Myb4                172   3e-47   
ref|XP_010686260.1|  PREDICTED: protein ODORANT1-like                   175   3e-47   
gb|KDP38959.1|  hypothetical protein JCGZ_00716                         173   3e-47   
ref|XP_008224927.1|  PREDICTED: transcription repressor MYB6-like       174   4e-47   
ref|XP_009589203.1|  PREDICTED: protein ODORANT1-like                   172   4e-47   
ref|XP_006597393.1|  PREDICTED: protein ODORANT1-like                   174   4e-47   
ref|XP_011090566.1|  PREDICTED: transcription factor MYB39-like         172   4e-47   
gb|AAS55703.1|  MYB1                                                    167   4e-47   
ref|XP_007050304.1|  Myb domain protein 13, putative                    171   4e-47   
ref|XP_004953959.1|  PREDICTED: transcription factor MYB39-like         172   4e-47   
ref|XP_003535378.1|  PREDICTED: myb-related protein Myb4-like           169   4e-47   
gb|AHB59594.1|  putative R2R3 MYB protein 6                             171   4e-47   
gb|EMS62386.1|  Myb-related protein Myb4                                170   4e-47   
ref|XP_009798928.1|  PREDICTED: myb-related protein Myb4-like           171   5e-47   
ref|XP_006447404.1|  hypothetical protein CICLE_v10017668mg             173   5e-47   
gb|AFK48781.1|  unknown                                                 170   5e-47   
ref|XP_004147038.1|  PREDICTED: myb-related protein 308-like            171   5e-47   
ref|XP_010448029.1|  PREDICTED: transcription factor MYB39-like         171   5e-47   
gb|KDO55797.1|  hypothetical protein CISIN_1g035629mg                   173   5e-47   
ref|XP_011080041.1|  PREDICTED: myb-related protein Myb4-like           170   5e-47   
ref|XP_010433260.1|  PREDICTED: transcription factor MYB39-like         171   5e-47   
ref|XP_008669188.1|  PREDICTED: myb-related protein Myb4                171   5e-47   
ref|XP_009137762.1|  PREDICTED: transcription repressor MYB6-like...    171   5e-47   
ref|XP_006410249.1|  hypothetical protein EUTSA_v10017136mg             170   5e-47   
gb|AID56313.1|  MYB1                                                    170   5e-47   
ref|XP_004293589.1|  PREDICTED: transcription factor MYB75-like         173   5e-47   
emb|CDY68230.1|  BnaCnng58140D                                          171   5e-47   
emb|CDX92979.1|  BnaA03g37010D                                          171   5e-47   
ref|XP_006294854.1|  hypothetical protein CARUB_v10023905mg             170   5e-47   
ref|XP_011096186.1|  PREDICTED: protein ODORANT1-like                   174   6e-47   
ref|XP_007131513.1|  hypothetical protein PHAVU_011G019200g             172   6e-47   
tpg|DAA63102.1|  TPA: putative MYB DNA-binding domain superfamily...    173   6e-47   
gb|AHB59590.1|  putative R2R3 MYB protein 2                             169   6e-47   
ref|XP_002266049.1|  PREDICTED: protein ODORANT1                        173   6e-47   
ref|XP_011079047.1|  PREDICTED: transcription factor MYB39-like         172   6e-47   
ref|XP_009391307.1|  PREDICTED: myb-related protein Hv1-like            172   6e-47   
ref|XP_009383106.1|  PREDICTED: transcription factor MYB34-like         172   6e-47   
ref|XP_006356065.1|  PREDICTED: myb-related protein Myb4-like           170   6e-47   
ref|XP_006286241.1|  hypothetical protein CARUB_v10007810mg             171   6e-47   
ref|XP_010240896.1|  PREDICTED: transcription factor MYB39-like         173   6e-47   
ref|XP_010671094.1|  PREDICTED: transcription factor MYB39              173   7e-47   
ref|NP_194540.1|  myb domain protein 41                                 171   7e-47   
ref|XP_006412992.1|  hypothetical protein EUTSA_v10027463mg             171   7e-47   
ref|XP_004248359.1|  PREDICTED: transcription factor MYB3-like          172   7e-47   
ref|XP_007162544.1|  hypothetical protein PHAVU_001G161000g             171   7e-47   
emb|CDY40088.1|  BnaC02g00420D                                          172   7e-47   
ref|XP_006406061.1|  hypothetical protein EUTSA_v10022110mg             171   7e-47   
ref|XP_010095853.1|  Transcription factor                               172   8e-47   
emb|CBI40862.3|  unnamed protein product                                172   8e-47   
gb|AHN16572.1|  MYB1                                                    170   8e-47   
ref|NP_001140890.1|  MYB transcription factor                           171   8e-47   
gb|AID23891.1|  R2R3-MYB                                                170   8e-47   
ref|XP_004235434.2|  PREDICTED: transcription factor WER-like           170   8e-47   
ref|XP_006358201.1|  PREDICTED: myb-related protein Myb4-like           169   8e-47   
ref|XP_002316936.1|  hypothetical protein POPTR_0011s12750g             172   8e-47   
ref|XP_002284142.1|  PREDICTED: transcription factor MYB39              172   8e-47   
gb|AEO21928.1|  MYB33                                                   169   8e-47   
ref|XP_010671030.1|  PREDICTED: myb-related protein Myb4-like           171   9e-47   
ref|XP_004159214.1|  PREDICTED: uncharacterized LOC101213017            172   9e-47   
ref|XP_008805219.1|  PREDICTED: myb-related protein Myb4                171   9e-47   
ref|NP_001106008.1|  transcription factor MYB39                         170   9e-47   
ref|XP_004289866.1|  PREDICTED: myb-related protein 308-like            170   9e-47   
ref|XP_010420379.1|  PREDICTED: transcription factor MYB39-like         172   9e-47   
emb|CDO99983.1|  unnamed protein product                                170   9e-47   
ref|XP_010453844.1|  PREDICTED: transcription factor MYB39-like         172   9e-47   
ref|XP_006469819.1|  PREDICTED: transcription factor RAX2-like          172   9e-47   
gb|AAL78372.1|  myb protein                                             167   9e-47   
ref|XP_006647539.1|  PREDICTED: myb-related protein Myb4-like           169   9e-47   
ref|XP_008653224.1|  PREDICTED: transcription factor MYB39              173   9e-47   
ref|XP_009596250.1|  PREDICTED: myb-related protein 315                 172   1e-46   
ref|XP_010457744.1|  PREDICTED: myb-related protein Myb4-like           170   1e-46   
gb|ABZ89193.1|  putative protein                                        170   1e-46   
ref|XP_002448188.1|  hypothetical protein SORBIDRAFT_06g022660          170   1e-46   
ref|XP_008358698.1|  PREDICTED: LOW QUALITY PROTEIN: protein ODOR...    172   1e-46   
ref|XP_007021241.1|  MYB-like 102, putative                             173   1e-46   
ref|XP_009384655.1|  PREDICTED: myb-related protein Myb4-like           171   1e-46   
ref|XP_006449197.1|  hypothetical protein CICLE_v10015729mg             172   1e-46   
ref|XP_004164066.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    172   1e-46   
emb|CDY08989.1|  BnaC01g31020D                                          170   1e-46   
ref|NP_567626.1|  R2R3 family MYB transcription factor                  172   1e-46   
gb|AAM64808.1|  myb-related protein M4                                  172   1e-46   
gb|KEH24596.1|  myb transcription factor                                168   1e-46   
ref|XP_010267736.1|  PREDICTED: transcription factor MYB39-like         172   1e-46   
ref|XP_008670489.1|  PREDICTED: snRNA-activating protein complex ...    172   1e-46   
ref|XP_008345730.1|  PREDICTED: transcription factor MYB39-like         172   1e-46   
ref|XP_009796309.1|  PREDICTED: myb-related protein 315-like            172   1e-46   
sp|P81393.1|MYB08_ANTMA  RecName: Full=Myb-related protein 308          169   1e-46   
ref|XP_010492603.1|  PREDICTED: transcription factor MYB39-like         171   1e-46   
ref|XP_009117764.1|  PREDICTED: myb-related protein Myb4                170   1e-46   
ref|XP_002444838.1|  hypothetical protein SORBIDRAFT_07g028990          171   1e-46   
ref|XP_011100331.1|  PREDICTED: transcription factor MYB39-like         172   1e-46   
ref|XP_004293617.1|  PREDICTED: myb-related protein Zm1-like            169   1e-46   
ref|XP_003575392.1|  PREDICTED: myb-related protein Myb4-like           169   1e-46   
ref|XP_002307080.2|  hypothetical protein POPTR_0005s07590g             172   1e-46   
gb|KFK28725.1|  hypothetical protein AALP_AA7G039100                    167   1e-46   
gb|ABQ51227.1|  R2R3-MYB transcription factor MYB11                     175   1e-46   
emb|CDY35519.1|  BnaA01g23930D                                          169   1e-46   
ref|XP_011031021.1|  PREDICTED: myb-related protein 308-like            172   1e-46   
ref|XP_009376958.1|  PREDICTED: myb-related protein 308-like            169   1e-46   
ref|XP_004137011.1|  PREDICTED: uncharacterized protein LOC101213017    171   1e-46   
gb|KEH43718.1|  myb transcription factor MIXTA-like protein             170   2e-46   
ref|XP_002867465.1|  AtMYB41                                            170   2e-46   
gb|AIU39726.1|  MYB transcription factor 15                             170   2e-46   
gb|AID56314.1|  MYB2                                                    169   2e-46   
ref|XP_010087606.1|  Transcription factor                               171   2e-46   
ref|XP_008460645.1|  PREDICTED: myb-related protein Myb4-like           170   2e-46   
emb|CDY15424.1|  BnaC04g41990D                                          168   2e-46   
dbj|BAK02388.1|  predicted protein                                      169   2e-46   
gb|KDP46819.1|  hypothetical protein JCGZ_24028                         171   2e-46   
ref|XP_008679513.1|  PREDICTED: myb-related protein Zm38-like           169   2e-46   
gb|KDP24203.1|  hypothetical protein JCGZ_25860                         171   2e-46   
emb|CDX85769.1|  BnaA02g00440D                                          171   2e-46   
emb|CDX77536.1|  BnaA07g06740D                                          170   2e-46   
ref|XP_007025853.1|  MYB21, putative                                    169   2e-46   
dbj|BAM71805.1|  R2R3-MYB transcription factor                          169   2e-46   
gb|AAP92750.1|  myb-related protein                                     169   2e-46   
ref|XP_009370698.1|  PREDICTED: transcription factor MYB39-like         171   2e-46   
ref|XP_009108088.1|  PREDICTED: myb-related protein Myb4-like           170   2e-46   
ref|XP_006657827.1|  PREDICTED: transcription factor MYB39-like         172   2e-46   
ref|XP_010529388.1|  PREDICTED: transcription factor MYB3-like          171   2e-46   
gb|AFW78196.1|  putative MYB DNA-binding domain superfamily protein     169   2e-46   
ref|XP_009135852.1|  PREDICTED: myb-related protein Myb4-like           170   2e-46   
ref|NP_001053318.1|  Os04g0517100                                       169   2e-46   
ref|XP_010939659.1|  PREDICTED: transcription repressor MYB6-like       171   2e-46   
ref|XP_004958010.1|  PREDICTED: uncharacterized protein LOC101782226    172   2e-46   
ref|XP_011097564.1|  PREDICTED: transcription factor MYB39-like         170   2e-46   
ref|XP_009790391.1|  PREDICTED: myb-related protein 315-like            171   2e-46   
ref|XP_002889589.1|  hypothetical protein ARALYDRAFT_470636             168   2e-46   
emb|CDP01059.1|  unnamed protein product                                171   2e-46   
ref|XP_008363293.1|  PREDICTED: myb-related protein 308-like            169   2e-46   
ref|XP_009125309.1|  PREDICTED: transcription factor MYB39-like         171   2e-46   
emb|CDY51002.1|  BnaA09g56310D                                          169   2e-46   
gb|AGN52100.1|  MYB-related transcription factor                        168   2e-46   
emb|CDY57089.1|  BnaA04g28770D                                          169   2e-46   
ref|XP_007159239.1|  hypothetical protein PHAVU_002G221000g             172   2e-46   
ref|XP_006361074.1|  PREDICTED: transcription factor MYB39-like         171   2e-46   
ref|XP_009102644.1|  PREDICTED: myb-related protein Myb4                169   2e-46   
gb|EMS60842.1|  Protein ODORANT1                                        165   2e-46   
ref|XP_009594598.1|  PREDICTED: transcription factor MYB39-like         171   2e-46   
ref|XP_008236005.1|  PREDICTED: myb-related protein 308-like            169   2e-46   
ref|XP_006433987.1|  hypothetical protein CICLE_v10003958mg             171   2e-46   
ref|XP_003580139.1|  PREDICTED: myb-related protein Myb4-like           169   2e-46   
ref|XP_009774352.1|  PREDICTED: myb-related protein 330-like            171   2e-46   
ref|XP_009141138.1|  PREDICTED: myb-related protein Myb4                169   2e-46   
ref|XP_006284274.1|  hypothetical protein CARUB_v10005438mg             169   2e-46   
gb|ADG46002.1|  MYB4                                                    168   2e-46   
ref|XP_009598490.1|  PREDICTED: myb-related protein Myb4-like           169   2e-46   
ref|XP_006286654.1|  hypothetical protein CARUB_v10002573mg             171   2e-46   
ref|XP_009594710.1|  PREDICTED: transcription factor WER-like           169   2e-46   
gb|KHG22733.1|  Transcription factor MYB39 -like protein                171   2e-46   
ref|XP_008377747.1|  PREDICTED: myb-related protein 308-like            169   2e-46   
ref|NP_172108.1|  myb domain protein 13                                 168   2e-46   
ref|XP_006467911.1|  PREDICTED: myb-related protein 3R-1-like           171   2e-46   
emb|CAA90748.1|  MYB-related protein                                    168   3e-46   
emb|CBI18520.3|  unnamed protein product                                166   3e-46   
gb|KFK42945.1|  hypothetical protein AALP_AA1G059100                    169   3e-46   
ref|XP_008795437.1|  PREDICTED: transcription factor MYB39              171   3e-46   
ref|XP_003532563.1|  PREDICTED: transcription factor MYB3-like          171   3e-46   
ref|XP_010052407.1|  PREDICTED: myb-related protein Hv1                 171   3e-46   
gb|AAL32697.1|  myb-related protein M4                                  171   3e-46   
ref|NP_001234262.1|  myb-related transcription factor                   169   3e-46   



>emb|CDP11892.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 163/267 (61%), Gaps = 19/267 (7%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PSVDKNG+KKGAWSEEED+KLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRAPSVDKNGVKKGAWSEEEDNKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG++RG ++ +E+++IIKLH++ GN+WSAIA KLPGR+DN+IKNHWH HLKK  +  Q
Sbjct  61   LKPGVRRGKYTIEEEDLIIKLHEQYGNRWSAIAAKLPGRTDNDIKNHWHTHLKKRNKQTQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
                      ++E +     ++  ++        S  D         S+++     + IS
Sbjct  121  ----------LSERSQNMDDADQNEQSSAMSTSGSSTDQKREMDPNASAADSLDAYTDIS  170

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFMSPT  805
                     +   W   +     +S +S  E F+ FW +    D SFS   S   ++  T
Sbjct  171  SLSCDSTLFDCVDWVADDSN---SSVESLTEPFESFWTEPFALDTSFSNYISVDPWLPST  227

Query  806  SQVEEEFTLPYSLFGEDDVNF---LNN  877
               EEEF  P+S F +D ++    LNN
Sbjct  228  ---EEEFLYPFSSFLDDGIDCFHELNN  251



>emb|CDP11890.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 166/270 (61%), Gaps = 32/270 (12%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PSVDKNG+KKGAWSEEED+KLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRAPSVDKNGMKKGAWSEEEDNKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG++RG ++ +E+++IIKLH++ GN+WSAIA KLP R+DN+IKNHWH HLKK  + K+
Sbjct  61   LKPGVRRGKYTIEEEDLIIKLHEQYGNRWSAIAAKLPARTDNDIKNHWHTHLKK--RYKE  118

Query  446  DP-----KIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessc  610
             P     + I    +  +++A + S  +T +    +  +S  D++  Y+  +        
Sbjct  119  SPICEGSQHIDDADQNEQSSAMFTSGSSTDQKTEVDPTTSASDSLDAYTDIS--------  170

Query  611  lssisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGG  790
                          +   W   +     +S +S  E F+ FW +    D SF+       
Sbjct  171  -----SLSCDSTLFDGVDWAADDSN---SSVESLTEPFESFWTEPFALDTSFN-----NW  217

Query  791  FMSPTSQVEEEFTLPYSLFGEDDVNFLNNF  880
            F S    +EEEF  P+S F +D  ++ + F
Sbjct  218  FPS----MEEEFMHPFSSFLDDSFDWFHEF  243



>emb|CDP11889.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 174/277 (63%), Gaps = 27/277 (10%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR   +DK+GLKKGAWSEEED+KLRAYVLRYGHWNW+QLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTTGIDKSGLKKGAWSEEEDNKLRAYVLRYGHWNWQQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRGSFS +E+E+I+KLHKELGN+WSAI  +LPGR+DNE+KN+WH HL+K  +TKQ
Sbjct  61   LRPGVKRGSFSEEEEELILKLHKELGNRWSAITARLPGRTDNEVKNYWHTHLRK--RTKQ  118

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
            D K    + KI +T      SE +Q ++   D++    AIS +   T  +         +
Sbjct  119  DSK---PKDKIEQT------SERSQPMESDADQNKESSAISIFHSTTDQNRSGLETEIAA  169

Query  626  isksldlsc-----------NTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSP  772
            +  +                +   W   +     +S +S  E+F+ FW +    D S+S 
Sbjct  170  VPAADTNCELSPLSCGSKHFDGGDWFGEDSN---SSVESLPESFESFWSEPFALDTSYSN  226

Query  773  SESEGGFMSPTSQVEEEFTLPYSLFGEDDVNFLNNFM  883
             +       P   VEEEFT P+S F ++D+++ +  +
Sbjct  227  LKVINYDWLPP--VEEEFTYPFSSFLDEDMDWFHELI  261



>ref|XP_009350432.1| PREDICTED: myb-related protein Myb4-like [Pyrus x bretschneideri]
Length=258

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 157/264 (59%), Gaps = 15/264 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKG W+ +ED KL AYV RYG+WNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPDEDRKLIAYVTRYGYWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG++S +E+E I+KLH++LGN+WSAIA +LPGR+DNEIKNHWH +LKK    KQ
Sbjct  61   LRPNIKRGNYSKEEEETIVKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRTNNKQ  120

Query  446  DPKIIRSELKINETTAEYGSSETT-----QKVKIGEDESSFYDAISRYSQGTssseessc  610
                  S    +E T  Y S E       +K      ES+    +++ +     +     
Sbjct  121  CNSSFSSSATNSEETPSYSSLEAAVDQPIKKAIFPNTESTVTSQVTQKTDDRVDNSSQLS  180

Query  611  lssisisksldlscNTTGWTVPEEGVMMTSSQSFGET--FDCFWDDLLFADASFSPSESE  784
             S    S  +        W    E +  TS +++ ++   D FW +   AD S+ PS   
Sbjct  181  PSPQPSSSEVSSMSADNNWVNYVEDINATSMEAYADSQFIDDFWTEPFLADNSYIPS---  237

Query  785  GGFMSPTSQVEEEFTLPYSLFGED  856
             GF +P   ++ EF   YSLFG D
Sbjct  238  -GFYTPL--MDSEFV--YSLFGGD  256



>ref|XP_008341938.1| PREDICTED: myb-related protein Myb4-like [Malus domestica]
Length=258

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 155/264 (59%), Gaps = 15/264 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKG W+ +ED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPDEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG++S +E+E I+KLH++LGN+WSAIA +LPGR+DNEIKNHWH +LKK    KQ
Sbjct  61   LRPNIKRGNYSTEEEETIVKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRTNNKQ  120

Query  446  DPKIIRSELKINETTAEYGSSETT-----QKVKIGEDESSFYDAISRYSQGTssseessc  610
                  S     E T  Y S E       +K      ES+    +++ +     +     
Sbjct  121  CNSSFSSSATNTEETPSYSSLEAAVDQPIKKAIFPNAESTVTPQVTQKTDDRVDNSSQLS  180

Query  611  lssisisksldlscNTTGWTVPEEGVMMTSSQSFGET--FDCFWDDLLFADASFSPSESE  784
             S    S  +        W    E + +TS +++ ++   D FW +   AD S+ PS   
Sbjct  181  PSPQPSSSEVSSMSADNNWVNYVEDINVTSMEAYADSQFIDDFWTEPFLADNSYIPS---  237

Query  785  GGFMSPTSQVEEEFTLPYSLFGED  856
             GF +P   ++ EF  P  LFG D
Sbjct  238  -GFYTPL--MDSEFVYP--LFGGD  256



>emb|CDP11893.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 153/247 (62%), Gaps = 23/247 (9%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P +DK GLKKGAWSE+ED+KLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRSPYIDKKGLKKGAWSEDEDNKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRG+++ +E+++IIKLH++LGN+WSAIAGKLPGRSDNE+KN WH  L+K +   Q
Sbjct  61   LRPGLKRGNYTVEEEDLIIKLHEQLGNRWSAIAGKLPGRSDNEVKNFWHTRLRKRIN--Q  118

Query  446  DPKIIRSELKINETTAE-YGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssi  622
            DP   RS   I +T+ +  G      ++K+           +  S   S+ +     +  
Sbjct  119  DP---RSTKIIKQTSDQKTGHMHDANQIKLS----------AGISDSDSNEKREMEPNIA  165

Query  623  sisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADAS-------FSPSES  781
            + +   D   ++            +   SF E+F+ FW      DAS         P E 
Sbjct  166  AAAPVADTKMSSLICDSSLSDSNSSVEYSFAESFESFWTQPFILDASHNSNVLALPPMEE  225

Query  782  EGGFMSP  802
            E  F+SP
Sbjct  226  EFTFLSP  232



>ref|XP_011047493.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=262

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+   VDKNGL+KGAWS+EEDDKLR YV +YGHWNWRQLP+FAGLSRCGKSCRLRWMNY
Sbjct  1    MVKTTLVDKNGLRKGAWSKEEDDKLRVYVQKYGHWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+FS +ED +II++H+ELGNKWS IAGKLPGR+DNEIKNHWH +L K ++  Q
Sbjct  61   LRPDVKRGNFSEEEDNLIIQMHEELGNKWSIIAGKLPGRTDNEIKNHWHTNLSKRVKQSQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVK  529
                + SEL   E ++E   SE  Q  K
Sbjct  121  S---VSSELVNKEQSSETSQSEDGQAEK  145



>ref|XP_002325683.2| hypothetical protein POPTR_0019s14120g [Populus trichocarpa]
 gb|EEF00065.2| hypothetical protein POPTR_0019s14120g [Populus trichocarpa]
Length=262

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 3/129 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+   VDKNGL+KGAWS+EEDDKLR YV +YGHWNWRQLP+FAGLSRCGKSCRLRWMNY
Sbjct  1    MVKATLVDKNGLRKGAWSKEEDDKLRVYVQKYGHWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+FS++ED +II++H+ELGNKWS IAGKLPGR+DNEIKNHWH +L K ++  Q
Sbjct  61   LRPDVKRGNFSDEEDNLIIQMHEELGNKWSIIAGKLPGRTDNEIKNHWHTNLSKRVKQSQ  120

Query  446  DPKIIRSEL  472
                + SEL
Sbjct  121  S---VSSEL  126



>gb|KDP24725.1| hypothetical protein JCGZ_26464 [Jatropha curcas]
 gb|AIT52287.1| MYB family protein [Jatropha curcas]
Length=257

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNGLKKGAWS+EEDDKLRAYV RYGHWNWR+LPKFAGLSRCGKSCRLRW+NY
Sbjct  1    MVRAPFFDKNGLKKGAWSQEEDDKLRAYVQRYGHWNWRELPKFAGLSRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+PG+K G++S +E+++II+LH++ GNKWS IA KLPGR+DNEIKN+WH+HLK+
Sbjct  61   LRPGVKHGNYSKEEEDLIIRLHEQFGNKWSKIAAKLPGRTDNEIKNYWHSHLKR  114



>ref|XP_009353213.1| PREDICTED: myb-related protein Myb4-like [Pyrus x bretschneideri]
Length=253

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 147/257 (57%), Gaps = 13/257 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKG W+ EED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG++S +E+E I+KLH++LGN+WSAIA +LPGR+DNEIKNHWH +LKK    KQ
Sbjct  61   LRPNIKRGNYSKEEEETIVKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRTNKKQ  120

Query  446  DPKIIRSELKINETTA-----EYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessc  610
                  S     E T      E    +  +K      ES+    +++ S     +     
Sbjct  121  CNSSFSSSATNTEETPSSSNLEAAVDQPIKKAIFPNAESTTALQVTQKSDDRVDNSSQLS  180

Query  611  lssisisksldlscNTTGWTVPEEGVMMTSSQSFGET--FDCFWDDLLFADASFSPSESE  784
             S    S  +        W    E   ++S  ++ +    D FW +   AD S+ PS   
Sbjct  181  SSPQPSSSEVSSMSADDNWVNFVEDFNLSSMDAYADNQFIDDFWTEPFLADNSYIPS---  237

Query  785  GGFMSPTSQVEEEFTLP  835
             GF +P   ++ EF  P
Sbjct  238  -GFYTPL--MDSEFLYP  251



>gb|KDP21585.1| hypothetical protein JCGZ_03738 [Jatropha curcas]
 gb|AIT52286.1| MYB family protein [Jatropha curcas]
Length=242

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/273 (44%), Positives = 159/273 (58%), Gaps = 45/273 (16%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR  SVDKNGLKKGAWS EEDDKLRAY+++ GH NWR+LPKFAGLSRCGKSCRLRW+NY
Sbjct  1    MVRTASVDKNGLKKGAWSREEDDKLRAYIMKRGHCNWRELPKFAGLSRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL--QT  439
            L+PG+K G+FS +E+ +II+LH+ELGNKWS IA KLPGR+DNEIKNHWH  LKK L  QT
Sbjct  61   LRPGVKHGNFSEEEENLIIQLHQELGNKWSRIAMKLPGRTDNEIKNHWHTRLKKLLLEQT  120

Query  440  KQDPKIIR---SELKINETT-AEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseess  607
            +   + ++   SE+  ++   AE      T  + I  + S   + IS YS          
Sbjct  121  QVATEQVKEQSSEIPPSQNIEAESVDIAVTPSLPIILESSPLSNEISDYS----------  170

Query  608  clssisisksldlscNTTGWTVPEEGVMMTSSQS-FGETFDCFWDDLLFADASFSPSESE  784
                         S  T+   V E+    TS    F ET + FW      D  ++     
Sbjct  171  -------------SVQTSSNCVAEDAHSFTSMMGIFEETGEDFWTAPFVEDHIYN-----  212

Query  785  GGFMSPTSQVEEEFTLPYSLFGEDDVNFLNNFM  883
                      ++ +   YSL+ +D+++F++  M
Sbjct  213  ----------QDFYASSYSLYYDDNMDFIHQVM  235



>ref|NP_001280912.1| myb-related protein Myb4-like [Malus domestica]
 gb|ADL36759.1| MYB domain class transcription factor [Malus domestica]
Length=253

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 145/257 (56%), Gaps = 13/257 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKG W+ EED KL  YV RYG WNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIVYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG++S +E+E IIKLH++LGN+WSAIA +LPGR+DNEIKNHWH +LKK    KQ
Sbjct  61   LRPNIKRGNYSKEEEETIIKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRTNKKQ  120

Query  446  DPKIIRSELKINETTA-----EYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessc  610
                  S     E T      E    +  +K      ES+    + + S     +     
Sbjct  121  CNSSFSSSATNTEETPSSSNLEAAVDQPIKKAIFPNAESTTALQVIKKSDDRVDNSSQLS  180

Query  611  lssisisksldlscNTTGWTVPEEGVMMTSSQSFGET--FDCFWDDLLFADASFSPSESE  784
             S    S  +        W    E   ++S +++ +    D FW     AD S+ PS   
Sbjct  181  SSPQPSSSEVSSMSADDNWVNFVEDFNLSSVEAYADNQFIDDFWTKPFLADNSYIPS---  237

Query  785  GGFMSPTSQVEEEFTLP  835
             GF +P   ++ EF  P
Sbjct  238  -GFYTPL--MDSEFLYP  251



>ref|XP_010268949.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=265

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 114/148 (77%), Gaps = 2/148 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M    S  K  LKKGAW+ EED+KL AY+ RYGHWNWR+LP+FAGLSRCGKSCRLRW+NY
Sbjct  3    MKSADSQQKTELKKGAWTPEEDEKLTAYIRRYGHWNWRELPRFAGLSRCGKSCRLRWVNY  62

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PGIKRG+FS +EDE+II LH+ LGNKW+AI+ +LPGR+DNE+KN+WH+HLKK L  KQ
Sbjct  63   LRPGIKRGNFSAEEDEIIINLHQSLGNKWAAISAQLPGRTDNEVKNYWHSHLKKRL--KQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVK  529
            DP     E   +E  ++Y  +ET    K
Sbjct  121  DPTASTKEKLQSEEISDYSKAETNDNFK  148



>ref|XP_002276962.1| PREDICTED: transcription factor MYB114 [Vitis vinifera]
 emb|CBI18002.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 151/231 (65%), Gaps = 12/231 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK G KKGAWS EED+KLRAYV RYGHWNWR+LP+FAGLSRCGKSCRLRW+NY
Sbjct  1    MVRNPCYDKYGRKKGAWSPEEDEKLRAYVQRYGHWNWRELPRFAGLSRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG++S  E+E I KLH+ELGNKWSAIA KLPGR+DNEIKN+WH HLKK  + +Q
Sbjct  61   LRPNVKRGNYSKAEEETIKKLHEELGNKWSAIAKKLPGRTDNEIKNYWHTHLKK--RERQ  118

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRY---SQGTssseesscls  616
            +P   +   +   T+   G     QK ++ E E+   DA S Y   S  TS   ESS   
Sbjct  119  NPAKSQVVRQPPGTSKREGDD---QKREL-ESENIHADAPSHYILESFSTSPESESSSSE  174

Query  617  sisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFS  769
              ++S     + N   W   +EG+   SS++F E  + FW +    D S++
Sbjct  175  ISTLSFDYTPAVNEMNWFA-DEGI--ASSETFAEPNENFWTEPFLTDDSYT  222



>ref|XP_011091328.1| PREDICTED: myb-related protein Myb4-like [Sesamum indicum]
Length=262

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR   VD+ GL+KGAWSEEED+KLRAY+LRYGHWNWR LP+FAGL RCGKSCRLRW+NY
Sbjct  1    MVRAARVDEKGLRKGAWSEEEDNKLRAYILRYGHWNWRLLPRFAGLDRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLK  424
            LKPG+KRGS++ +E ++I+KLH ELGNKWSAIA KLPGRSDNEIKN+WH H +
Sbjct  61   LKPGLKRGSYTKEEQDLIVKLHDELGNKWSAIAAKLPGRSDNEIKNYWHTHFE  113



>ref|XP_007132613.1| hypothetical protein PHAVU_011G109800g [Phaseolus vulgaris]
 gb|ESW04607.1| hypothetical protein PHAVU_011G109800g [Phaseolus vulgaris]
Length=224

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DKNGLKKGAWS EEDDKLRAYV  YGH NWRQLPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRTPSYDKNGLKKGAWSREEDDKLRAYVQIYGHSNWRQLPKFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +K G+++ +E+E IIKLH+E GN+WS IA KLPGR+DNE+KN+WH+HLKK L++ +
Sbjct  61   LRPNLKHGNYTTEEEETIIKLHQEFGNRWSLIAEKLPGRTDNEVKNYWHSHLKKSLKSNE  120

Query  446  DPKIIRSELK  475
               +  SELK
Sbjct  121  ---MTPSELK  127



>ref|XP_002319935.1| hypothetical protein POPTR_0013s14560g [Populus trichocarpa]
 gb|EEE95858.1| hypothetical protein POPTR_0013s14560g [Populus trichocarpa]
Length=256

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 158/266 (59%), Gaps = 16/266 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKGAW+ EED KL AYV RYG WNWRQLPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKTGLKKGAWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLQRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG++S +E+E II LH+ +GN+WSAIA +LPGR+DNEIKNHWH +LKK L+ K 
Sbjct  61   LRPNIKRGNYSKEEEETIISLHETMGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRLRKK-  119

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
                  S L+  E +++   S+  +  +   +E+     IS  +  TS+    S  S++S
Sbjct  120  ------SVLEAKEMSSDDDLSQDDKNQEKDTEETD----ISTQNPATSNEIIESPSSTMS  169

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDC----FWDDLLFADASFSPSESEGGF  793
               S             +  ++  ++ +F E ++     FW +   +D  F P++     
Sbjct  170  PQASSSDISTIDNVAATDWDLISDNNFAFLEAYEAPSGNFWTEPFLSDDYFMPNDFMAPL  229

Query  794  MSPTSQ-VEEEFTLPYSLFGEDDVNF  868
            + P S   + EF+ P++    +D N 
Sbjct  230  VDPDSPFFDGEFSSPFAFIDMEDCNL  255



>ref|XP_006447414.1| hypothetical protein CICLE_v10017677mg [Citrus clementina]
 gb|ESR60654.1| hypothetical protein CICLE_v10017677mg [Citrus clementina]
Length=243

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P+ D+NG+KKGAWS+EEDDKLRAY+L+YGHWNWR++PKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWREIPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IK GS++ +E++ II+L ++ GNKWS IA KLPGR+DNEIKN+WH HLKK  +  +
Sbjct  61   LRPDIKHGSYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKK--RKNK  118

Query  446  DP  451
            DP
Sbjct  119  DP  120



>gb|EYU24837.1| hypothetical protein MIMGU_mgv1a018138mg, partial [Erythranthe 
guttata]
Length=247

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (74%), Gaps = 10/168 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWSEEED+KLRAY+ RYGH NWR LP FAGL+RCGKSCRLRW+NY
Sbjct  1    MVRPPCFDKNGMKKGAWSEEEDNKLRAYIRRYGHPNWRLLPVFAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+KRG F+ DE+++IIKLH +LG KWSAIA KLPGR+DNE+KN+WHAH+ K  + K+
Sbjct  61   LKPGLKRGRFTEDEEDLIIKLHDQLGTKWSAIAAKLPGRTDNEVKNYWHAHINK--RNKR  118

Query  446  DPKIIR--------SELKINETTAEYGSSETTQKVKIGEDESSFYDAI  565
            +  I +        SEL+ + +   +G   + +  K  +D  +F D+ 
Sbjct  119  NGTITKVMHGNQSMSELEEHVSEDVFGKDLSVENPKNFDDLDTFVDSF  166



>gb|AGN52096.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52206.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=216

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +2

Query  89   VRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYL  268
            +R PSVDKNG+KKGAWSEEED+KLR+Y+LRYGHWNWR LPKFAGL+RCGKSCRLRW+NYL
Sbjct  1    MRKPSVDKNGVKKGAWSEEEDNKLRSYILRYGHWNWRLLPKFAGLARCGKSCRLRWVNYL  60

Query  269  KPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            KPG+KRG F+ +E+ +I KLH ELGNKWSA+A  +PGR+DNEIKN WH HLKK
Sbjct  61   KPGLKRGGFTIEEENLIAKLHDELGNKWSAMAAIIPGRTDNEIKNFWHTHLKK  113



>ref|XP_011100426.1| PREDICTED: myb-related protein 308-like [Sesamum indicum]
Length=246

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 3/142 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS D +G+KKGAWSE+ED+KLRA+V RYGH NWR LP FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSFDSHGIKKGAWSEDEDNKLRAHVERYGHPNWRLLPIFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRG+F+ +E+++IIKLH +LGN+WSAIA KLPGR+DNE+KN+WHAH+KK   +K+
Sbjct  61   LRPGLKRGNFTKNEEDLIIKLHAQLGNRWSAIAAKLPGRTDNEVKNYWHAHIKKR-SSKR  119

Query  446  DPKIIRSELKINETTAEYGSSE  511
            D +  R  +K  ET  E  SSE
Sbjct  120  D-RATRKAIK-PETAQELRSSE  139



>ref|XP_004243792.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=216

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P +DKNG+K+GAWSE+ED+KLRA++ ++GH NWRQLPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPFIDKNGIKRGAWSEDEDNKLRAFIQKFGHPNWRQLPKYAGLMRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+PG+K+G++S++E+++IIKLH +LGN+WS IA KLPGRSDN++KNHWHAHLKK
Sbjct  61   LRPGLKKGNYSHEEEQLIIKLHNKLGNRWSEIAAKLPGRSDNDVKNHWHAHLKK  114



>ref|XP_011048477.1| PREDICTED: transcription factor WER-like [Populus euphratica]
Length=243

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+   +DKNG +KG+WS EED+KLR Y+ +YGHWNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVKSAYIDKNGHRKGSWSVEEDEKLRVYIQKYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+FS +ED +II++H+ELGNKWS I+ KLPGR+DNEIKNHWH +L K ++  Q
Sbjct  61   LRPDVKRGNFSEEEDNLIIQMHEELGNKWSIISSKLPGRTDNEIKNHWHTNLSKRVKQNQ  120



>gb|AGN52090.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52200.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=201

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+   VDK+GLKKGAWSEEED+KLR+Y++RYGHWNWR LPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVKAAYVDKDGLKKGAWSEEEDNKLRSYIVRYGHWNWRLLPKFAGLQRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+KRG F+ +E ++I KLH+ELGNKWS IA KLPGR+DN+IKN+W  +L+K  ++ +
Sbjct  61   LKPGVKRGEFNQEEKDLIAKLHQELGNKWSGIAAKLPGRTDNDIKNYWMTNLQKRDKSNK  120

Query  446  DPKI  457
              +I
Sbjct  121  STEI  124



>gb|EYU24839.1| hypothetical protein MIMGU_mgv1a020124mg, partial [Erythranthe 
guttata]
Length=212

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 8/145 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWSEEED+KL+AY+LRYGHWNWR LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRAPFYDKNGVKKGAWSEEEDNKLKAYILRYGHWNWRLLPKFAGLERCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+K+G+FS  E+++I++LH +LG +WS IA KLPGR+DN+IKN WH  ++     K+
Sbjct  61   LKPGVKKGNFSKQEEDLIVELHAQLGKRWSVIAAKLPGRTDNDIKNFWHTRIR-----KR  115

Query  446  DPKIIRSELKI---NETTAEYGSSE  511
            +PK   +E+ I   + TT E  S E
Sbjct  116  EPKNPTAEIIITNPSSTTTELASCE  140



>ref|XP_011048479.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=256

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKGAW+ EED KL AYV RYG WNWRQLPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKTGLKKGAWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLQRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK  442
            L+P IKRG++S +E+E II LH+ LGN+WSAIA +LPGR+DNEIKNHWH +LKK L+ K
Sbjct  61   LRPNIKRGNYSKEEEETIISLHETLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRLRNK  119



>ref|XP_009766826.1| PREDICTED: myb-related protein Myb4-like isoform X1 [Nicotiana 
sylvestris]
Length=235

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PSVDKNG+K+GAWSEEED+KL+A+V R+GH NWRQLPK AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPSVDKNGIKRGAWSEEEDNKLKAFVERFGHPNWRQLPKHAGLMRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+K+G++S +E+E+IIKLHKE GN+WS IA +LPGRSDN++KN WHAHLKK  +T  
Sbjct  61   LRPGLKKGNYSLEEEELIIKLHKEHGNRWSVIAARLPGRSDNDVKNQWHAHLKKRAKTNT  120

Query  446  D  448
            +
Sbjct  121  N  121



>ref|XP_007149916.1| hypothetical protein PHAVU_005G109800g [Phaseolus vulgaris]
 gb|ESW21910.1| hypothetical protein PHAVU_005G109800g [Phaseolus vulgaris]
Length=227

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (71%), Gaps = 14/175 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DKNGLKKG+W+ EED KL AYV +YGHWNWR LPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MARTPCCDKNGLKKGSWTREEDKKLIAYVTKYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+FS++E+E+I++LH++LGN+WS IA +LPGR+DNEIKNHWH  LKK  + K 
Sbjct  61   LRPDVKRGNFSDEEEEIIVRLHEKLGNRWSTIAAELPGRTDNEIKNHWHTVLKKRFEQKA  120

Query  446  DPKI-IRSELKIN---ETTAE-YGSSETTQKVKIG---------EDESSFYDAIS  568
            + K  I  E  I+   ET +E Y   + T    +          +D  SF+DA S
Sbjct  121  EAKSGIGKESSISRSFETVSENYSDPDATNASPVAPAAATNHESDDGLSFFDAYS  175



>gb|AGN52147.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=259

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS+D NG+KKGAWSE+ED+KLRAY+ RYGHWNWR LPK+AGL RCGKSCRLRW+NY
Sbjct  1    MVRPPSIDSNGMKKGAWSEDEDEKLRAYINRYGHWNWRLLPKYAGLKRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            LKPG+KRG FS +E E+++KLH ELGNKWSAIA +LPGR+DNEIKN WH  +++
Sbjct  61   LKPGVKRGDFSKEEKEIVVKLHAELGNKWSAIAEQLPGRTDNEIKNFWHTRIER  114



>ref|XP_008230195.1| PREDICTED: myb-related protein Myb4-like [Prunus mume]
Length=279

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKG W+ EED KL AYV RYG WNWRQLP+FAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG++S +E+E IIKLH++LGN+WSAIA +LPGR+DNEIKNHWH +LKK +  K 
Sbjct  61   LRPNIKRGNYSQEEEETIIKLHQQLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRMNNKH  120



>gb|EYU24838.1| hypothetical protein MIMGU_mgv1a025340mg [Erythranthe guttata]
Length=251

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 6/164 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWSEEED+KLRAY+ RYGH NWR LP FAGL+RCGKSCRLRW+NY
Sbjct  1    MVRPPCFDKNGMKKGAWSEEEDNKLRAYICRYGHPNWRLLPVFAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+KRG F+  E ++IIKLH +LG KWSAIA KLPGR+DNE+KN+WHAH+ K  +TK+
Sbjct  61   LKPGLKRGKFTEYEKDLIIKLHDQLGTKWSAIAAKLPGRTDNEVKNYWHAHINK--RTKR  118

Query  446  DPKIIR----SELKINETTAEYGSSETTQKVKIGEDESSFYDAI  565
            +  I +    S L+ + +   +G   + +  K  +D  +F D+ 
Sbjct  119  NDTITKEQSVSGLEEHVSEDVFGKDLSVENPKNLDDLDTFVDSF  162



>ref|XP_007216710.1| hypothetical protein PRUPE_ppa026553mg [Prunus persica]
 gb|EMJ17909.1| hypothetical protein PRUPE_ppa026553mg [Prunus persica]
Length=279

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKG W+ EED KL AYV RYG WNWRQLP+FAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG++S +E+E IIKLH++LGN+WSAIA +LPGR+DNEIKNHWH +LKK +  K 
Sbjct  61   LRPNIKRGNYSQEEEETIIKLHQQLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRMNNKH  120



>ref|XP_002325682.1| hypothetical protein POPTR_0019s14130g [Populus trichocarpa]
 gb|EEF00064.1| hypothetical protein POPTR_0019s14130g [Populus trichocarpa]
Length=263

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWSEEEDDKLR ++ +YG WNWR++PKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGVKKGAWSEEEDDKLREHIEKYGLWNWREIPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +K G+++ +E+++I+KLH++ GNKWS IA KLPGR+DNE+KN+WHAHLKK    KQ
Sbjct  61   LRPDVKHGNYTKEEEDLILKLHEKHGNKWSIIAAKLPGRTDNEVKNYWHAHLKKRTVEKQ  120

Query  446  DPKIIR  463
            +  +++
Sbjct  121  NTLVLK  126



>ref|XP_007043432.1| Myb domain protein 15, putative [Theobroma cacao]
 gb|EOX99263.1| Myb domain protein 15, putative [Theobroma cacao]
Length=341

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWS EED KLR+Y+ RYGHWNWR+LPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPFYDKNGMKKGAWSAEEDHKLRSYIQRYGHWNWRELPKFAGLKRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P +K G+++ +ED +I+KLH+ELGN+WS IA +LPGR+DN+IKNHWH HLKK
Sbjct  61   LQPQVKHGNYTEEEDALIMKLHEELGNRWSTIAARLPGRTDNDIKNHWHTHLKK  114



>ref|XP_011100326.1| PREDICTED: myb-related protein Myb4-like [Sesamum indicum]
Length=289

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P VD NGLKKGAWS++ED+KLRAYV RYGHWNWR LPK+AGL+RCGKSCRLRW+NY
Sbjct  1    MVRPPYVDSNGLKKGAWSDDEDNKLRAYVQRYGHWNWRLLPKYAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            LKPG+KRG+FS +E+ +++KLH +LGNKWSAIA  LPGR+DNEIKN WH  +++
Sbjct  61   LKPGVKRGNFSKEEEALVVKLHNQLGNKWSAIAANLPGRTDNEIKNFWHTRIER  114



>gb|KDO55821.1| hypothetical protein CISIN_1g042846mg [Citrus sinensis]
Length=243

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P+ D+NG+KKGAWS+EEDDKLRAY+L+YGHWNW +LPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IK G+++ +E++ II+L ++ GNKWS IA KLPGR+DNEIKN+WH HLKK  +  +
Sbjct  61   LRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKK--RKNK  118

Query  446  DP  451
            DP
Sbjct  119  DP  120



>ref|XP_004513559.1| PREDICTED: myb-related protein Myb4-like isoform X2 [Cicer arietinum]
Length=283

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 112/141 (79%), Gaps = 4/141 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R PS DK+G++KG W+ EED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MARTPSCDKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK----HL  433
            L+P IKRG+F+ DE+E+IIK+HK++GNKWS IA +LPGR+DNE+KNHWH  LKK    + 
Sbjct  61   LRPNIKRGNFTQDEEELIIKMHKKMGNKWSTIAAELPGRTDNEVKNHWHTSLKKRAEDNT  120

Query  434  QTKQDPKIIRSELKINETTAE  496
            +T Q+ +  +S+    E+T E
Sbjct  121  KTNQETQTSKSKDINMESTQE  141



>ref|XP_009624516.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=248

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 151/256 (59%), Gaps = 26/256 (10%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS D+NG KKG W+ EED KL AYV +YG WNWRQLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSYDENGKKKGTWTPEEDRKLAAYVTKYGCWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+++ +ED++I+KLH +LGN+WS IAG LPGRSDNEIKNHWH  LKK      
Sbjct  61   LRPNIKRGNYTKEEDDIILKLHAQLGNRWSIIAGHLPGRSDNEIKNHWHTSLKKR-ANHY  119

Query  446  DPKIIRSELK-INETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssi  622
             P    SE K IN+ ++    S   Q      +    Y+ +   S  ++    S  LSS 
Sbjct  120  APNSSDSESKSINQDSSTRRKSVENQNAISPNNCMRSYETVLESSHMSAKQSSSEELSSY  179

Query  623  sisksldlscNTTGWTV-PEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFMS  799
                       TT + V  EE ++M +S S       FW +    D+SFS   S   ++ 
Sbjct  180  -----------TTDYQVFQEEAILMENSGS-------FWTEPFLVDSSFS---SRTDYVV  218

Query  800  PTSQVEEEFTLPYSLF  847
            P+  ++ E   P S F
Sbjct  219  PS--IDCELVCPPSPF  232



>ref|XP_007043431.1| Myb domain protein 15, putative [Theobroma cacao]
 gb|EOX99262.1| Myb domain protein 15, putative [Theobroma cacao]
Length=293

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/260 (43%), Positives = 151/260 (58%), Gaps = 12/260 (5%)
 Frame = +2

Query  65   KKRGEIKMVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSC  244
            ++R E  MVR P  DK+GL+KG W+ EED KL AYV RYG WNWRQLPK+AGL+RCGKSC
Sbjct  22   ERRREGNMVRTPCCDKSGLRKGTWTPEEDRKLSAYVTRYGCWNWRQLPKYAGLARCGKSC  81

Query  245  RLRWMNYLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLK  424
            RLRWMNYL+P IKRG++S +E+E II+LH+  GN+WSAIA +LPGR+DNEIKNHWH  LK
Sbjct  82   RLRWMNYLRPNIKRGNYSKEEEETIIRLHESQGNRWSAIAAQLPGRTDNEIKNHWHTTLK  141

Query  425  KHLQTKQDPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTsssees  604
            K    K  P + ++E        + G+S+ T      E E+   + +   S       ES
Sbjct  142  KRF--KHKPSVPKNEKDNPRDPIKRGTSKET------EFETKLDNHLLINSTSPPLILES  193

Query  605  sclssisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDC----FWDDLLFADASFSP  772
            S  S    S   + S  T    V  +  +  ++++  E ++     FW +  F+D+ F  
Sbjct  194  SLSSPQPASSDQNSSITTDNTVVSSKDSVHINNKALLEAYEANSGNFWTEPFFSDSCFMS  253

Query  773  SESEGGFMSPTSQVEEEFTL  832
            S+     M P      EF  
Sbjct  254  SDMLLPMMDPARYEAHEFPF  273



>ref|XP_009800099.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=226

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 8/170 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS++KNG K+GA SEEE +KLRA++ ++GH NWRQLPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPSIEKNGRKRGARSEEEYNKLRAFLEKHGHPNWRQLPKYAGLMRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+K+G++S +E+E+IIKLH ELGN+WSAIA K PGRSDN+IKN WHAHLKK + T  
Sbjct  61   LRPGLKKGNYSLEEEELIIKLHNELGNRWSAIAAKFPGRSDNDIKNQWHAHLKKRVNTNT  120

Query  446  DPKI-----IRSELKI---NETTAEYGSSETTQKVKIGEDESSFYDAISR  571
            +  I       S L +   N+ ++ Y  SE      + E  S+  D I R
Sbjct  121  NSSISTEQFTESSLSVESQNDHSSNYKVSEHEADNDMKELSSASTDPIDR  170



>gb|ABH02922.1| MYB transcription factor MYB122 [Glycine max]
Length=155

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+G +KG W+ EED KL AYV RYG WNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGTRKGTWTPEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P +KRG+F+  EDE II++HK+LGNKWSAIA +LPGR+DNEIK+HWH  LKK  Q
Sbjct  61   LRPNVKRGNFTQQEDECIIRMHKKLGNKWSAIAAELPGRTDNEIKDHWHTTLKKWSQ  117



>ref|XP_004513558.1| PREDICTED: myb-related protein Myb4-like isoform X1 [Cicer arietinum]
Length=309

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 112/141 (79%), Gaps = 4/141 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R PS DK+G++KG W+ EED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MARTPSCDKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK----HL  433
            L+P IKRG+F+ DE+E+IIK+HK++GNKWS IA +LPGR+DNE+KNHWH  LKK    + 
Sbjct  61   LRPNIKRGNFTQDEEELIIKMHKKMGNKWSTIAAELPGRTDNEVKNHWHTSLKKRAEDNT  120

Query  434  QTKQDPKIIRSELKINETTAE  496
            +T Q+ +  +S+    E+T E
Sbjct  121  KTNQETQTSKSKDINMESTQE  141



>ref|XP_003526305.2| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=230

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DKNG+KKG W+ EED KL  Y+ RYGHWNWR LPKFAGL+RCGKSCRLRW+NY
Sbjct  2    MVRTPSCDKNGVKKGTWTPEEDKKLVEYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  61

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P +KRG+++ +E+E IIKLH+ LGN+WSAIA ++PGR+DNEIKNHWH +LKK  Q
Sbjct  62   LRPNLKRGNYTKEEEETIIKLHRHLGNRWSAIAARMPGRTDNEIKNHWHTNLKKRSQ  118



>gb|KHN41179.1| Myb-related protein Myb4 [Glycine soja]
Length=229

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DKNG+KKG W+ EED KL  Y+ RYGHWNWR LPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRTPSCDKNGVKKGTWTPEEDKKLVEYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P +KRG+++ +E+E IIKLH+ LGN+WSAIA ++PGR+DNEIKNHWH +LKK  Q
Sbjct  61   LRPNLKRGNYTKEEEETIIKLHRHLGNRWSAIAARMPGRTDNEIKNHWHTNLKKRSQ  117



>ref|XP_006446589.1| hypothetical protein CICLE_v10018311mg [Citrus clementina]
 gb|ESR59829.1| hypothetical protein CICLE_v10018311mg [Citrus clementina]
Length=218

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 111/148 (75%), Gaps = 12/148 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P+ D+ G+K+GAWS+EEDDKLRAY+LRYGHWNW QLPKFAGLSR GKSCRLRWMNY
Sbjct  1    MVRAPTYDEKGMKRGAWSKEEDDKLRAYILRYGHWNWTQLPKFAGLSRSGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK------  427
            L+P IK G+++ +E++ IIK  ++ GNKW+ IA KLPGR+DNEIKN+WH HLKK      
Sbjct  61   LRPDIKHGNYTKEEEDTIIKTRQQHGNKWALIAAKLPGRTDNEIKNYWHTHLKKKIDKKT  120

Query  428  ------HLQTKQDPKIIRSELKINETTA  493
                  H +T Q  +  R E+ +  TT+
Sbjct  121  DSADQEHEETSQSDQAERQEINLAATTS  148



>gb|AGN52037.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=259

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS+D +G+KKGAWSE+ED+KLRAY+ RYGHWNWR LPK+AGL RCGKSCRLRW+NY
Sbjct  1    MVRPPSIDSSGMKKGAWSEDEDEKLRAYIHRYGHWNWRLLPKYAGLKRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            LKPG+KRG FS +E E+++KLH ELGNKWSAIA +LPGR+DNEIKN WH  +++
Sbjct  61   LKPGVKRGDFSKEEKEIVVKLHAELGNKWSAIAEQLPGRTDNEIKNFWHTRIER  114



>ref|XP_002325681.1| hypothetical protein POPTR_0019s14140g [Populus trichocarpa]
 gb|EEF00063.1| hypothetical protein POPTR_0019s14140g [Populus trichocarpa]
Length=250

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 148/266 (56%), Gaps = 22/266 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DK  LKKGAW+ EED KL AYV RYG WNWRQLPK+AGL RCGKSCRLRW+NY
Sbjct  1    MARTPCCDKTELKKGAWTPEEDMKLMAYVTRYGSWNWRQLPKYAGLQRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+++ +E+E+II LH+ LGN+WSAIA +LPGR+DNEIKNHWH +LKK L  K 
Sbjct  61   LRPNIKRGNYTKEEEEIIISLHETLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRLSEKS  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
                        E T      +  Q+   GE E      +++     S+    S  S++S
Sbjct  121  -----------VEATRSCSDDDKGQEKDTGETE------VNKQIPANSAQIIESSSSALS  163

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDC----FWDDLLFADASFSPSESEGGF  793
               S      T         ++     SF E ++     FW +   +D  F P++     
Sbjct  164  PQASSGDFSTTDNIAATNMDLVSDDDLSFLEAYEIPSGNFWTEPFLSDDYFMPNDFLAPL  223

Query  794  MSPTSQV-EEEFTLPYSLFGEDDVNF  868
            ++P S + + E + P++    +D N 
Sbjct  224  VNPDSPIFDGEISSPFAFINTEDYNL  249



>ref|XP_006446590.1| hypothetical protein CICLE_v10017435mg [Citrus clementina]
 gb|ESR59830.1| hypothetical protein CICLE_v10017435mg [Citrus clementina]
Length=217

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P+ D+ G+K+GAWS+EEDDKLRAY+LRYGHWNW QLPKFAGLSR GKSCRLRWMNY
Sbjct  1    MVRAPTYDEKGMKRGAWSKEEDDKLRAYILRYGHWNWTQLPKFAGLSRSGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IK G+++ +E++ IIK  ++ GNKW+ IA KLPGR+DNEIKN+WH HLKK +  K 
Sbjct  61   LRPDIKHGNYTKEEEDTIIKTRQQHGNKWALIAAKLPGRTDNEIKNYWHTHLKKKIDKKT  120

Query  446  D  448
            D
Sbjct  121  D  121



>ref|XP_007216491.1| hypothetical protein PRUPE_ppa025095mg, partial [Prunus persica]
 gb|EMJ17690.1| hypothetical protein PRUPE_ppa025095mg, partial [Prunus persica]
Length=210

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 3/159 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+GLKKGAWS EEDD LRAY+  +GH NWR LPKFAG+SRCGKSCRLRW NY
Sbjct  1    MVRAPFYDKSGLKKGAWSPEEDDTLRAYIEEHGHLNWRSLPKFAGISRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRG+++  ED++I+KLH+E GNKWS IA KLPGR+DNEIKNHW+   KK   T+Q
Sbjct  61   LRPGVKRGNYTQAEDDLILKLHEEFGNKWSMIATKLPGRTDNEIKNHWNTRFKK--LTEQ  118

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDA  562
            +P   +S  K      E   + T+Q  ++G      +DA
Sbjct  119  NPTSSQS-AKEQPCNHESSPTVTSQNTELGAQSGPKFDA  156



>gb|KHN22879.1| Myb-related protein Myb4 [Glycine soja]
Length=323

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 115/147 (78%), Gaps = 6/147 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+G++KG W+ EED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTPEEDMKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ---  436
            L+P +KRG+F+ +E+E II++HK+LGN+WSAIA +LPGR+DNEIKNHWH  LKK  Q   
Sbjct  61   LRPNLKRGNFTQEEEECIIRMHKKLGNRWSAIAAELPGRTDNEIKNHWHTTLKKRSQQNT  120

Query  437  -TKQDPKIIRSELKINETTAEYGSSET  514
             T ++ ++ +S  K NE+    G + T
Sbjct  121  VTIEETRVSKS--KNNESVPNKGVTVT  145



>ref|XP_003540870.1| PREDICTED: myb-related protein Myb4 isoform X1 [Glycine max]
 gb|KHN22880.1| Myb-related protein Myb4 [Glycine soja]
Length=305

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+G +KG W+ EED KL AYV RYG WNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGTRKGTWTPEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ---  436
            L+P +KRG+F+  EDE II++HK+LGNKWSAIA +LPGR+DNEIKNHWH  LKK  Q   
Sbjct  61   LRPNVKRGNFTQQEDECIIRMHKKLGNKWSAIAAELPGRTDNEIKNHWHTTLKKWSQQNA  120

Query  437  -TKQDPKIIRSELKI  478
             T ++ +  +S+ K+
Sbjct  121  ITNEEARTSKSKDKV  135



>gb|EYU23537.1| hypothetical protein MIMGU_mgv1a021445mg [Erythranthe guttata]
Length=223

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 113/143 (79%), Gaps = 5/143 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR  S D+NG+KKGAWSE+ED+KLR+Y+LRYGHWNWR LPK+AGL+RCGKSCRLRW+NY
Sbjct  1    MVRKGSYDRNGIKKGAWSEDEDNKLRSYILRYGHWNWRLLPKYAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHL-KKHLQTK  442
            LKPG+ +G+F+  E+ +I++LH +LG KWS+IA  LPGR+DN+IKN WH  + K+     
Sbjct  61   LKPGVIKGNFTKQEENLIVELHSQLGPKWSSIAANLPGRTDNDIKNFWHTRIHKRRPNRN  120

Query  443  QDPKIIRSELKINETTAEYGSSE  511
            Q PKII S +    TTAE  SS+
Sbjct  121  QIPKIITSPI----TTAELASSK  139



>ref|XP_010095861.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXB62329.1| Myb-related protein Myb4 [Morus notabilis]
Length=296

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKG W+ EED KL AYV RYG WNWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRTPYCDQNGMKKGTWTPEEDRKLVAYVTRYGCWNWRQLPKFAGLKRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P +KRG++S +E+E II LH+ LGN+WS IA +LPGR+DNE+KNHWH HLKK ++
Sbjct  61   LRPNLKRGNYSKEEEETIIGLHESLGNRWSTIAAQLPGRTDNEVKNHWHTHLKKRVK  117



>ref|XP_007132610.1| hypothetical protein PHAVU_011G109500g [Phaseolus vulgaris]
 gb|ESW04604.1| hypothetical protein PHAVU_011G109500g [Phaseolus vulgaris]
Length=229

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 104/121 (86%), Gaps = 2/121 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DKNGLKKG W+ EED KL  Y+ RYGHWNWR LPKFAGL+RCGKSCRLRW+NY
Sbjct  2    MVRTPSSDKNGLKKGTWTPEEDQKLVDYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  61

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG++S +E+E IIKLH+ LGN+WSAIA ++PGR+DNEIKN+WH +LKK  +++Q
Sbjct  62   LRPNLKRGNYSEEEEETIIKLHRHLGNRWSAIAARIPGRTDNEIKNYWHTNLKK--RSEQ  119

Query  446  D  448
            D
Sbjct  120  D  120



>ref|XP_006470240.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
Length=216

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P+ D  G+K+GAWS+EEDDKLRAY+LRYGHWNW QLP+FAGLSR GKSCRLRWMNY
Sbjct  1    MVRAPTYDGKGMKRGAWSKEEDDKLRAYILRYGHWNWTQLPRFAGLSRSGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IK G+++ +E++ IIK  ++ GNKWS IA KLPGR+DNEIKN+WH HLKK +  K 
Sbjct  61   LRPDIKHGNYTKEEEDTIIKTRQQHGNKWSLIAAKLPGRTDNEIKNYWHTHLKKKIDKKT  120

Query  446  D  448
            D
Sbjct  121  D  121



>ref|XP_008448223.1| PREDICTED: transcription repressor MYB6-like [Cucumis melo]
Length=272

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +2

Query  65   KKRGEIKMVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSC  244
            ++R    MVR P VDK+G+K+GAWS EED KLRAY+ +YG W WR++P  AGL RCGKSC
Sbjct  22   QRRNNNIMVRAPVVDKDGVKRGAWSLEEDQKLRAYIEKYGPWKWREVPTLAGLMRCGKSC  81

Query  245  RLRWMNYLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLK  424
            RLRW+NYL+PG+KRG+++N+E+E+I KLH++ GN+WS IA KLPGR+DNE+KNHW+AHLK
Sbjct  82   RLRWLNYLRPGLKRGNYTNEENELICKLHQKYGNRWSTIAAKLPGRTDNEVKNHWNAHLK  141

Query  425  KHLQTKQDPKIIRSELKINE  484
            K ++ K +   I+ E K  E
Sbjct  142  KQVKPKTESSTIKHEGKPKE  161



>ref|XP_003541925.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=227

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 116/171 (68%), Gaps = 14/171 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNGLKKG W+ EED KL  YV +YGHWNWR LPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKNGLKKGPWTPEEDRKLIDYVTKYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+FS++E+E I++LH++LGN+WSAIA +LPGR+DNEIKNHWH  LKK  + K 
Sbjct  61   LRPDVKRGNFSHEEEETIVRLHEKLGNRWSAIAAELPGRTDNEIKNHWHTALKKRFERK-  119

Query  446  DPKIIRS------------ELKINETTAEYGSSETTQKVKIGEDESSFYDA  562
             PK  R             E  + E  +EY    T     I   E+S  + 
Sbjct  120  -PKAKRRTEKEGNVVSKSMERVVLENCSEYAVITTDAAAAITNHENSVLEG  169



>ref|XP_010277889.1| PREDICTED: myb-related protein Myb4-like [Nelumbo nucifera]
Length=276

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 152/291 (52%), Gaps = 50/291 (17%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+ P  ++ GLKKG W+ EED KL AY+ RYGHWNW QLPK+AGLSRCGKSCRLRWMNY
Sbjct  1    MVKSPCCERIGLKKGTWTLEEDQKLIAYIKRYGHWNWLQLPKYAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL-QTK  442
            L+P IKRG++S +E+E II LH++LGNKW+AIA +LPGR+DNEIKNHWH HLKK + Q +
Sbjct  61   LRPDIKRGNYSREEEEAIINLHEKLGNKWTAIAARLPGRTDNEIKNHWHTHLKKRVGQNQ  120

Query  443  QDPKIIRSEL-------KINETTAEYGSSETTQKV----------KIGEDESSFYDA--I  565
             + KI   EL       K  E  A Y S   + K           ++   ES  YD+   
Sbjct  121  MEAKIHPVELSYCEANQKAAELEANYASIHKSPKRPKLETCSSNDRVSPKESCEYDSGRN  180

Query  566  SRYSQGTssseessclssisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDL  745
            S +S G   +                        T  EE V    + +  E    FW   
Sbjct  181  SNFSLGIGKN------------------------TSKEESVGSPKAVAELELDGSFWAKQ  216

Query  746  L-----FADASFSPSESEGGFMSPTSQVE-EEFTLPYSLFGEDDVNFLNNF  880
                  F   SF    +  GFM P S V  EE    Y    +D V F  N 
Sbjct  217  FSMAESFYQESFGTFFAGDGFMLPVSPVSLEEIVYSYGSNRDDRVEFEFNL  267



>emb|CDP11876.1| unnamed protein product [Coffea canephora]
Length=266

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+GL+KG W+ EED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKSGLRKGTWTPEEDRKLTAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++ +EDE+IIKLH+ LGN+WSAIA  LPGR+DNEIKNHWH  L K   TKQ
Sbjct  61   LRPNLKRGNYTKEEDELIIKLHESLGNRWSAIAAHLPGRTDNEIKNHWHTTLNK--STKQ  118

Query  446  DPK  454
            + +
Sbjct  119  ESR  121



>ref|XP_010095860.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXB62328.1| Myb-related protein Myb4 [Morus notabilis]
Length=277

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 2/130 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+K+GAWS EEDDKLRAYV RYG+WNWR+LPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRAPFYDENGIKRGAWSSEEDDKLRAYVERYGYWNWRELPKYAGLQRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P ++RG+++ +E+ +IIKLH+E GNKWS IA  LPGR+DNEIKN+WH  LKK     +
Sbjct  61   LRPDVRRGNYTAEEESLIIKLHEEHGNKWSLIAANLPGRTDNEIKNYWHTRLKKRKTHNK  120

Query  446  DPKIIRSELK  475
             P   +S+L+
Sbjct  121  TP--TKSQLR  128



>gb|KHN41177.1| Myb-related protein Myb4 [Glycine soja]
Length=318

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 109/135 (81%), Gaps = 4/135 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+G++KG W+ EED KL AYV RYG WNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTLEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ---  436
            L+P +KRG+F+  E+E II++HK+LGN+WS IA +LPGR+DNEIKNHWH  LKK  Q   
Sbjct  61   LRPDVKRGNFTQQEEEFIIRMHKKLGNRWSTIAAELPGRTDNEIKNHWHTTLKKRSQQNT  120

Query  437  -TKQDPKIIRSELKI  478
             TK++ +  +S+ K+
Sbjct  121  LTKEEARASKSKDKV  135



>ref|XP_003526303.1| PREDICTED: myb-related protein Myb4 [Glycine max]
Length=318

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 109/135 (81%), Gaps = 4/135 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+G++KG W+ EED KL AYV RYG WNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTLEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ---  436
            L+P +KRG+F+  E+E II++HK+LGN+WS IA +LPGR+DNEIKNHWH  LKK  Q   
Sbjct  61   LRPDVKRGNFTQQEEEFIIRMHKKLGNRWSTIAAELPGRTDNEIKNHWHTTLKKRSQQNT  120

Query  437  -TKQDPKIIRSELKI  478
             TK++ +  +S+ K+
Sbjct  121  LTKEEARASKSKDKV  135



>gb|AAN17830.1| Myb-like protein P [Saussurea medusa]
Length=256

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+G+K+GAWS+EED+KLRA++ R GH NWRQLPK AGLSRCGKSCRLRW+NY
Sbjct  1    MVRAPCFDKHGIKRGAWSQEEDNKLRAHIQRSGHSNWRQLPKLAGLSRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IK G+F+ DE ++++ LH +LGNKWSAIA +LPGRSDNEIKN+WH HLK   QT Q
Sbjct  61   LRPTIKHGNFTKDEKDVVVALHNKLGNKWSAIAARLPGRSDNEIKNYWHTHLKNRAQTDQ  120



>ref|XP_011047495.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=249

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/266 (40%), Positives = 148/266 (56%), Gaps = 22/266 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DK  LKKG+W+ EED KL AYV RYG WNWRQLPK+AGL RCGKSCRLRW+NY
Sbjct  1    MARTPCCDKTELKKGSWTPEEDMKLMAYVTRYGSWNWRQLPKYAGLQRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+++ +E+E+II LH+ LGN+WSAIA +LPGR+DNEIKNHWH +LKK L+ K 
Sbjct  61   LRPNIKRGNYTKEEEEIIISLHETLGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRLRNKS  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
                        E T      +  Q+   GE +      ++  +   ++    S  S++S
Sbjct  121  -----------VEATPSCSDDDKGQEKDTGETD------VNTLTPANTAQIIESSSSALS  163

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDC----FWDDLLFADASFSPSESEGGF  793
               S      T         ++     SF E ++     FW +   +D  F P++     
Sbjct  164  PHASSADFSTTDNIAATNMDLVSDDDFSFLEAYEIPSGNFWTEPFLSDDYFMPNDFFAPL  223

Query  794  MSPTSQ-VEEEFTLPYSLFGEDDVNF  868
            ++P S   + E + P++    +D N 
Sbjct  224  VNPDSPFFDGEISSPFAFINTEDYNL  249



>ref|XP_006447415.1| hypothetical protein CICLE_v10016303mg [Citrus clementina]
 ref|XP_006469810.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
 gb|ESR60655.1| hypothetical protein CICLE_v10016303mg [Citrus clementina]
Length=261

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ EED KL AYV +YG+WNWRQLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+++ +E+++II+LH+ LGN+WSAIA +LPGR+DNEIKNHWH  LKK L+
Sbjct  61   LRPNIKRGNYTKEEEDIIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLK  117



>ref|XP_003526304.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
 gb|KHN41178.1| Myb-related protein Myb4 [Glycine soja]
Length=324

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+G++KG W+ EED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTPEEDMKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ---  436
            L+P IKRG+F+  E+E II++HK+LGN+WSAIA +LPGR+DNEIKNHWH  LKK  Q   
Sbjct  61   LRPNIKRGNFTQQEEECIIRMHKKLGNRWSAIAVELPGRTDNEIKNHWHTALKKRSQQNT  120

Query  437  -TKQDPKIIRSELK  475
               ++ K I+S+ K
Sbjct  121  LINEETKAIKSKNK  134



>ref|XP_011047494.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=263

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWS+EEDDKLR ++ +YG WNWR++PKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSQEEDDKLREHIEKYGLWNWREIPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +K G+++ +E+++I+KLH++ GNKWS IA KLPGR+DNE+KN+WHAHLKK     Q
Sbjct  61   LRPDVKHGNYTKEEEDLILKLHEKHGNKWSIIAAKLPGRTDNEVKNYWHAHLKKRTVKNQ  120

Query  446  D  448
            +
Sbjct  121  N  121



>ref|XP_004295360.1| PREDICTED: myb-related protein Hv1-like [Fragaria vesca subsp. 
vesca]
Length=289

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+G+KKGAW  EEDDKLR+Y+  YGHWNWRQLPK+AG+SRCGKSCRLRW NY
Sbjct  1    MVRAPFYDKSGVKKGAWDAEEDDKLRSYIQSYGHWNWRQLPKYAGISRCGKSCRLRWKNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+PG+K G ++ +E+ +IIKLH++LGN+WS IA KLPGR+DNEIKN+WH H+KK
Sbjct  61   LQPGVKHGDYTEEEEALIIKLHEQLGNRWSMIASKLPGRTDNEIKNYWHTHMKK  114



>gb|KDO55822.1| hypothetical protein CISIN_1g024860mg [Citrus sinensis]
Length=261

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ EED KL AYV +YG+WNWRQLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+++ +E++ II+LH+ LGN+WSAIA +LPGR+DNEIKNHWH  LKK L+
Sbjct  61   LRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLK  117



>gb|KHN41176.1| Myb-related protein Myb4 [Glycine soja]
Length=246

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNGLKKGAWS EED+KL AYV R+GH NWRQLPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRAPFYDKNGLKKGAWSREEDEKLTAYVKRHGHSNWRQLPKFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P +K G+++ +E+++IIKLH+E GNKWS IA KLPGR+DNE+KN+WH HLKK
Sbjct  61   LRPNLKHGNYTLEEEKIIIKLHQEFGNKWSLIAEKLPGRTDNEVKNYWHGHLKK  114



>ref|XP_008230194.1| PREDICTED: myb-related protein Myb4-like [Prunus mume]
Length=252

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+GLKKGAWS EEDD LR Y+  +GH NWR LPKFAG+SRCGKSCRLRW NY
Sbjct  1    MVRAPFYDKSGLKKGAWSPEEDDTLRVYIEEHGHVNWRSLPKFAGISRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRG+++  ED++I+KLH+E GNKWS IA KLPGR+DNEIKNHW+   KK    KQ
Sbjct  61   LRPGVKRGNYTQQEDDLILKLHQEFGNKWSMIAAKLPGRTDNEIKNHWNTRFKK--LAKQ  118

Query  446  DPKIIRSEL-KINETTAEYGSSETTQKVKIGEDESSFYDA  562
            +P    S+L K      E   + T+Q  ++G      +DA
Sbjct  119  NP--TSSQLAKEQPCKHESSPTVTSQNTELGAQSGPKFDA  156



>gb|AGN52126.1| MYB-related transcription factor, partial [Salvia miltiorrhiza]
 gb|AGN52236.1| MYB-related transcription factor, partial [Salvia miltiorrhiza]
Length=163

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 106/135 (79%), Gaps = 10/135 (7%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P+ D NG+KKGAWS+EEDD+LRA V R+GH NWR+LP  AGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPTFDSNGIKKGAWSKEEDDRLRAQVERFGHDNWRRLPSLAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK------  427
            LKPG+KRG F+  E+E IIKLH +LGNKWSA+A KL GRSDNEIKN+WHAH+KK      
Sbjct  61   LKPGLKRGKFTKIEEEHIIKLHDQLGNKWSAMAAKLHGRSDNEIKNYWHAHIKKRGRCHN  120

Query  428  ----HLQTKQDPKII  460
                HL  ++D K I
Sbjct  121  DSDHHLHEERDEKNI  135



>dbj|BAI49720.1| putative MYB transcription factor [Diospyros kaki]
Length=255

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR   VD+NG+KKGAW+ EED+KLRAY+ RYGHWNWRQLPKFAGLSRCGKSCRLRWMNY
Sbjct  1    MVRAARVDENGMKKGAWTPEEDEKLRAYIQRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++ +E+E+II+LH++LGNKWS +AGKLPGR+DN+IK+HWH +LKK  +  Q
Sbjct  61   LRPNVKRGAYTKEEEEIIIELHQQLGNKWSIMAGKLPGRTDNDIKDHWHTNLKKRARRNQ  120

Query  446  DPK  454
              K
Sbjct  121  SAK  123



>ref|XP_003527470.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=235

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWS EED +L AYV RYGH NWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSVEEDKRLIAYVERYGHPNWRQLPKFAGLQRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++  E+++I  LHK+ GNKWS IA  LPGR+DNEIKN+WH+HLKK L+  +
Sbjct  61   LRPNLKRGNYTQKEEQIITDLHKKHGNKWSLIAENLPGRTDNEIKNYWHSHLKKFLKDNE  120

Query  446  DPKIIRSELKINE  484
            +      ELK +E
Sbjct  121  NTPFDDDELKSSE  133



>ref|XP_003597081.1| MYB transcription factor [Medicago truncatula]
 gb|AES67332.1| myb transcription factor [Medicago truncatula]
Length=250

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNGL+KG W+ EED KL AYV RYG WNWRQLPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRTPYCDKNGLRKGTWTPEEDKKLIAYVTRYGCWNWRQLPKFAGLERCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRGSFS++E+E IIKLH++LGN+W+ I+  LPGR+DNEIKN+WH  +KK L
Sbjct  61   LRPDIKRGSFSHEEEETIIKLHEKLGNRWTMISANLPGRTDNEIKNYWHTTIKKTL  116



>ref|XP_010051469.1| PREDICTED: myb-related protein Myb4-like [Eucalyptus grandis]
 gb|KCW89469.1| hypothetical protein EUGRSUZ_A01767 [Eucalyptus grandis]
Length=242

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DKNG+KKG W+ EED KL+AYV +YG WNWRQLPK+AGLSRCGKSCRLRWMNY
Sbjct  1    MARTPGRDKNGMKKGTWTPEEDRKLKAYVSKYGFWNWRQLPKYAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+++ +E++ I++L   LGNKWSAIA +LPGR+DNE+KNHWH +LKK L    
Sbjct  61   LRPDIKRGNYTKEEEDTIVRLQGLLGNKWSAIASQLPGRTDNEVKNHWHTNLKKRLNQNT  120

Query  446  DP  451
             P
Sbjct  121  QP  122



>gb|KEH17564.1| myb-related transcription factor [Medicago truncatula]
Length=291

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 5/139 (4%)
 Frame = +2

Query  86   MVRGPSVDK-NGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMN  262
            M R PS DK +G++KG W+ EED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRW+N
Sbjct  1    MARTPSCDKISGMRKGTWTAEEDRKLIAYVTRYGFWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  263  YLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK----H  430
            YL+P I+RG+F+ DE+E+II++HK+LGNKWS IA +LPGR+DNE+KNHWH  LKK    +
Sbjct  61   YLRPNIRRGNFTKDEEELIIRMHKKLGNKWSTIAAELPGRTDNEVKNHWHTSLKKRAIDN  120

Query  431  LQTKQDPKIIRSELKINET  487
            + T ++ K  +S+  I  T
Sbjct  121  IVTNEETKSTKSKDIIEST  139



>gb|KEH16274.1| myb-related transcription factor [Medicago truncatula]
Length=272

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +2

Query  86   MVRGPSVDK-NGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMN  262
            M R PS DK +G++KG W+ EED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRW+N
Sbjct  1    MARTPSCDKKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  263  YLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK  442
            YL+P IKRG+F+ +E+E+II++HK LGN+WS IA +LPGR+DNE+KN+WH  LKK ++  
Sbjct  61   YLRPNIKRGNFTQEEEELIIRMHKNLGNRWSTIAAELPGRTDNEVKNYWHTSLKKRVEHN  120

Query  443  QDPKIIRSELKINETTAE  496
            Q   I  ++ K  E+T +
Sbjct  121  QITNIEETKSKDIESTQD  138



>gb|KHN41175.1| Myb-related protein Myb4 [Glycine soja]
Length=235

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWS EED +L AYV RYGH NWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSVEEDKRLIAYVERYGHPNWRQLPKFAGLQRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++  E+++I  LHK+ GNKWS IA  LPGR+DNEIKN+WH+HLKK L+  +
Sbjct  61   LRPNLKRGNYTQKEEQIITDLHKKHGNKWSLIAENLPGRTDNEIKNYWHSHLKKFLKDNE  120

Query  446  DPKIIRSELKINE  484
            +      EL+ +E
Sbjct  121  NTPFDDDELESSE  133



>ref|XP_004137010.1| PREDICTED: transcription repressor MYB4-like [Cucumis sativus]
Length=271

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKGAWS EED+KLRAYV  YGH NWR+LP++AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPFYDENGIKKGAWSAEEDEKLRAYVQEYGHCNWRELPRYAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P +KRG++S +E+++I++LH++ GNKWS IA KLPGR+DNEIKN+WH HLKK
Sbjct  61   LRPDVKRGNYSKEEEQLILQLHQQYGNKWSMIATKLPGRTDNEIKNYWHTHLKK  114



>ref|XP_010069815.1| PREDICTED: myb-related protein Myb4-like [Eucalyptus grandis]
 gb|KCW89468.1| hypothetical protein EUGRSUZ_A01766 [Eucalyptus grandis]
Length=239

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DKNG+KKG W+ EED KLRAYV RYG+WNWR+LPK+AGLSRCGKSCRLRWMNY
Sbjct  1    MARTPGRDKNGMKKGTWTPEEDKKLRAYVSRYGYWNWRKLPKYAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG+++ +E++ II+L   LGNKWSAIA  LPGR+DNE+KNHWH +L+K L
Sbjct  61   LRPDIKRGNYTKEEEDTIIRLQGLLGNKWSAIASHLPGRTDNEVKNHWHTNLRKRL  116



>ref|XP_004140052.1| PREDICTED: transcription repressor MYB4-like [Cucumis sativus]
 ref|XP_004173677.1| PREDICTED: transcription repressor MYB4-like [Cucumis sativus]
Length=243

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 116/153 (76%), Gaps = 12/153 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P VDK+G+K+GAWS EED KLRAY+ +YG W WR++P+ AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPVVDKDGVKRGAWSLEEDQKLRAYIEKYGPWKWREVPRLAGLMRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRG+++N+E+E+I KLH+  GN+WS IA KLPGR+DNE+KN+W+AHLKK ++ K 
Sbjct  61   LRPGLKRGNYTNEENELICKLHQTHGNRWSTIAAKLPGRTDNEVKNYWNAHLKKQVKPKT  120

Query  446  D--------PKIIR----SELKINETTAEYGSS  508
            +        PK +      E K ++  AEY SS
Sbjct  121  ESSTKHEGKPKDLSLSHVYEAKTSKDFAEYCSS  153



>gb|AHM25911.1| transcription factor mybp [Salvia miltiorrhiza f. alba]
Length=244

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+ P+ D NG+K+GAWS+EEDD+LRA+V  +GH NWR LP  AGL+RCGKSCRLRW+NY
Sbjct  1    MVKPPTFDSNGMKRGAWSKEEDDRLRAFVSEFGHNNWRLLPLLAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+KR  F+  E+++IIKLH +LGNKWSAIAGKLPGR+DNEIKN+WHAH+KK  + ++
Sbjct  61   LKPGLKREKFTKHEEDLIIKLHNQLGNKWSAIAGKLPGRTDNEIKNYWHAHIKK--RGRR  118

Query  446  DPKIIRSELKINETTAE  496
                IR+    ++ +AE
Sbjct  119  GKNSIRAPSMAHDNSAE  135



>ref|XP_008455365.1| PREDICTED: transcription factor WER-like [Cucumis melo]
Length=271

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWS EED+KLRAYV  +GH NWR+LP++AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPFYDKNGIKKGAWSAEEDEKLRAYVQEHGHCNWRELPRYAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P +KRG++S +E+++I++LH++ GNKWS IA KLPGR+DNEIKN+WH HLKK
Sbjct  61   LRPDVKRGNYSKEEEQLILQLHQQYGNKWSMIATKLPGRTDNEIKNYWHTHLKK  114



>gb|KGN46680.1| hypothetical protein Csa_6G121970 [Cucumis sativus]
Length=269

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 116/153 (76%), Gaps = 12/153 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P VDK+G+K+GAWS EED KLRAY+ +YG W WR++P+ AGL RCGKSCRLRW+NY
Sbjct  27   MVRAPVVDKDGVKRGAWSLEEDQKLRAYIEKYGPWKWREVPRLAGLMRCGKSCRLRWLNY  86

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRG+++N+E+E+I KLH+  GN+WS IA KLPGR+DNE+KN+W+AHLKK ++ K 
Sbjct  87   LRPGLKRGNYTNEENELICKLHQTHGNRWSTIAAKLPGRTDNEVKNYWNAHLKKQVKPKT  146

Query  446  D--------PKIIR----SELKINETTAEYGSS  508
            +        PK +      E K ++  AEY SS
Sbjct  147  ESSTKHEGKPKDLSLSHVYEAKTSKDFAEYCSS  179



>gb|AGN52213.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=245

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+ P+ D NG+K+GAWS+EEDD+LRA+V  +GH NWR LP  AGL+RCGKSCRLRW+NY
Sbjct  1    MVKPPTFDSNGMKRGAWSKEEDDRLRAFVSEFGHNNWRLLPLLAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+KR  F+  E+++IIKLH +LGNKWSAIAGKLPGR+DNEIKN+WHAH+KK  + ++
Sbjct  61   LKPGLKREKFTKHEEDLIIKLHNQLGNKWSAIAGKLPGRTDNEIKNYWHAHIKK--RGRR  118

Query  446  DPKIIRSELKINETTAE  496
                IR+    ++  AE
Sbjct  119  GKNSIRAPSMAHDNNAE  135



>ref|XP_002272704.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera]
 emb|CBI18001.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+GLKKG W+ EED KL AY+ RYG WNWR+LPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKSGLKKGTWTPEEDHKLVAYITRYGCWNWRRLPKYAGLMRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG++S +E++ IIKLH  LGN+WSAIA +LPGR+DNEIKN+WH +LKK L
Sbjct  61   LRPNIKRGNYSKEEEDTIIKLHASLGNRWSAIAAQLPGRTDNEIKNYWHTNLKKRL  116



>ref|XP_004243413.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=251

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 107/156 (69%), Gaps = 20/156 (13%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG KKG W+ EED KL AY+ +YG WNWRQLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGRKKGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++ +EDE+I+ LH +LGNKWSAIA  LPGRSDNEIKNHWH  LKK      
Sbjct  61   LRPNVKRGNYTKEEDEIILNLHAQLGNKWSAIAIHLPGRSDNEIKNHWHTTLKKR-----  115

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSF  553
                           A Y SSE ++K      ES+ 
Sbjct  116  ---------------AHYNSSEVSKKCNKKRSESNI  136



>ref|XP_007132612.1| hypothetical protein PHAVU_011G109700g [Phaseolus vulgaris]
 gb|ESW04606.1| hypothetical protein PHAVU_011G109700g [Phaseolus vulgaris]
Length=324

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+GL+KG W+ EED KL AYV RYG WNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSWDKSGLRKGTWTPEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+F+  E+E II++ K+LGN+WSAIA +LPGR+DNEIKNHWH  LKK  +   
Sbjct  61   LRPNVKRGNFTPQEEECIIRMLKKLGNRWSAIAAELPGRTDNEIKNHWHTTLKKRSEINI  120

Query  446  DP  451
             P
Sbjct  121  LP  122



>gb|KEH17561.1| myb-related transcription factor [Medicago truncatula]
Length=272

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MVRGPSVDK-NGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMN  262
            M R PS DK +G++KG W+ EED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRW+N
Sbjct  1    MARTPSCDKKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  263  YLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            YL+P IKRG+F+ +E+E+II++HK+LGN+WS IA +LPGR+DNE+KNHWH  LKK
Sbjct  61   YLRPNIKRGNFTQEEEELIIRMHKKLGNRWSTIAAELPGRTDNEVKNHWHTSLKK  115



>emb|CAN72480.1| hypothetical protein VITISV_019320 [Vitis vinifera]
Length=284

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+GLKKG W+ EED KL AY+ RYG WNWR+LPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKSGLKKGTWTPEEDHKLVAYITRYGCWNWRRLPKYAGLMRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG++S +E++ IIKLH  LGN+WSAIA +LPGR+DNEIKN+WH +LKK L
Sbjct  61   LRPNIKRGNYSKEEEDTIIKLHASLGNRWSAIAAQLPGRTDNEIKNYWHTNLKKRL  116



>ref|XP_009800612.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=242

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 153/266 (58%), Gaps = 32/266 (12%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR  S D+NG KKG W+ EED KL AYV +YG WNWRQLPK AGL+RCGKSCRLRWMNY
Sbjct  1    MVRTTSYDENGKKKGTWTPEEDRKLAAYVTKYGCWNWRQLPKHAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+++ +ED++I+KLH +LGN+WS IA  LPGRSDNEIKNHWH  LKK      
Sbjct  61   LRPNIKRGNYTKEEDDIILKLHAQLGNRWSTIAAHLPGRSDNEIKNHWHTSLKKRANYYA  120

Query  446  DPKIIRSELK-INETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssi  622
             P    SE K +NE +     S   Q            +AIS      ++ E SS +S  
Sbjct  121  -PNSSDSESKSMNEASGTRRKSVENQ------------NAIS-----PTNLELSSQMSPK  162

Query  623  sisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFMSP  802
              S        T    + EEG++M +S S       FW +    D SFS   ++  ++ P
Sbjct  163  QSSSEQLSCYTTDYQVIQEEGILMENSGS-------FWTEPFLVDTSFSSRSTD--YVVP  213

Query  803  TSQVEEEFTLPYSLFGEDDVNFLNNF  880
            +  ++ E   P S F   +  FL++F
Sbjct  214  S--IDWELVCPPSPFIGHE--FLSSF  235



>ref|XP_010277888.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=269

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 134/227 (59%), Gaps = 3/227 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M +    +K GLKKG W+ EED KL AY+ RYGHWNWR+LP+FAGL+RCGKSCRLRW+NY
Sbjct  1    MAKTGYCEKTGLKKGTWTPEEDMKLTAYIKRYGHWNWRELPRFAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG FS +EDE+I+K+H  LGN+W+ IA KLPGR+DNEIKNHWH +LKK L  + 
Sbjct  61   LRPDIKRGHFSPEEDEIIMKMHASLGNRWTRIATKLPGRTDNEIKNHWHTNLKKRLNREP  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
                   ++  NE  +E   SE     K  E  +   D      + + S+ + S     S
Sbjct  121  TTASSNDKMHHNEELSE-CKSEGNNNTKESEPGTCLSDDPMDEIRSSPSTSQQSFGDLSS  179

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASF  766
             S         T W+   + V   S ++F E    FW + L A  S+
Sbjct  180  PSIDYSSVITDTNWSKAADNV--ASPENFAEPVCSFWTEPLLAGNSY  224



>ref|XP_007132609.1| hypothetical protein PHAVU_011G109400g [Phaseolus vulgaris]
 gb|ESW04603.1| hypothetical protein PHAVU_011G109400g [Phaseolus vulgaris]
Length=257

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 99/122 (81%), Gaps = 5/122 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAG-----LSRCGKSCRL  250
            MVR P  DK+GLKKG W+ EED KL AYV  +GH NWRQLPKFAG     +SRCGKSCRL
Sbjct  1    MVRTPYCDKSGLKKGTWTPEEDWKLIAYVTTHGHKNWRQLPKFAGNRSAPVSRCGKSCRL  60

Query  251  RWMNYLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKH  430
            RWMNYL+PGIKRG+++ +E+E I+KLHK LGN+WS IA  LPGRSDNEIKNHWHAHLKK 
Sbjct  61   RWMNYLRPGIKRGNYTYEEEERIVKLHKILGNRWSVIASHLPGRSDNEIKNHWHAHLKKR  120

Query  431  LQ  436
             Q
Sbjct  121  FQ  122



>ref|XP_008342092.1| PREDICTED: myb-related protein Myb4-like [Malus domestica]
Length=279

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 6/158 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG KKGAWS EED+ L+AYV ++GH NWR LPK AGL+RCGKSCRLRW NY
Sbjct  1    MVRAPFYDKNGQKKGAWSPEEDNMLKAYVDKHGHKNWRALPKLAGLARCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+KRG++S +E+ +IIKLH+E GNKWS IA KLPGR+DN+IKNHWH + KK   TKQ
Sbjct  61   LQPGVKRGNYSQEENNLIIKLHEEFGNKWSMIAAKLPGRTDNDIKNHWHTYFKK--LTKQ  118

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYD  559
            +   +    +  E +++   S T+Q  ++G   +  +D
Sbjct  119  NSTALS---QTTEQSSD-APSVTSQNTELGAQSAPKHD  152



>gb|AIT13037.1| myb-related transcription factor [Vitis amurensis]
Length=253

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 135/229 (59%), Gaps = 28/229 (12%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ +ED  L AYVL++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQNLTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E++ II+LH++LGNKWSAIA  LPGR+DNEIKN WH HLKK L  K 
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHTHLKKRLTKKL  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVK---IGEDESSFYDAISRYSQGTssseesscls  616
                 +       +T +  S  ++ K+       + SSF D+ +R  +            
Sbjct  121  ATPDSKGHFTAAASTCDSDSFNSSGKMSPQPSSSEFSSFTDSSTRTME------------  168

Query  617  sisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADAS  763
                        ++TG  V  E +   S++SF E  + FW D L +D S
Sbjct  169  -----------THSTG--VKNEQMEEYSTESFPEIDESFWSDALSSDNS  204



>ref|XP_007132611.1| hypothetical protein PHAVU_011G109600g [Phaseolus vulgaris]
 gb|ESW04605.1| hypothetical protein PHAVU_011G109600g [Phaseolus vulgaris]
Length=323

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DK+GL+KG W+ EED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGLRKGTWTPEEDMKLVAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P +KRG+F+  E+E II++ K+ GN+WSAIA +LPGR+DNEIKNHWH  LKK  Q
Sbjct  61   LRPNLKRGNFTPQEEECIIRMLKKHGNRWSAIAAELPGRTDNEIKNHWHTTLKKRSQ  117



>gb|AGN52103.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=245

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+ P+ D NG+K+GAWS+EEDD+LRA+V  +GH NWR LP  AGL+RCGKSCRLRW+NY
Sbjct  1    MVKPPTFDSNGMKRGAWSKEEDDRLRAFVSEFGHNNWRLLPLLAGLARCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            LKPG+KR  F+  E+++IIKLH +LGN+WSAIAGKLPGR+DNEIKN+WHAH+KK
Sbjct  61   LKPGLKREKFTKHEEDLIIKLHNQLGNEWSAIAGKLPGRTDNEIKNYWHAHIKK  114



>ref|XP_006360585.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=245

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG KKG W+ EED KL AY+ +YG WNWRQLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGRKKGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L P +KRG+++ +EDE+I+ LH +LGNKWSAIA  LPGRSDNEIKNHWH  LKK
Sbjct  61   LSPNVKRGNYTKEEDEIILNLHAQLGNKWSAIAVHLPGRSDNEIKNHWHTALKK  114



>gb|KHN22881.1| Myb-related protein Myb4 [Glycine soja]
Length=234

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWSEEED +L AYV R+GH NWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSEEEDKRLMAYVERHGHPNWRQLPKFAGLQRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++  E+++I  LHK+ GNKWS IA  LPGR+DNEIKN+WH+HLKK L+  +
Sbjct  61   LRPNLKRGNYTQKEEQIIKDLHKKHGNKWSLIAENLPGRTDNEIKNYWHSHLKKFLKGNE  120

Query  446  D  448
            +
Sbjct  121  N  121



>ref|XP_009779987.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=245

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R    DK+GLKKG W+ +ED KL AYV +YG WNWRQLPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MARTRCYDKSGLKKGTWTPDEDRKLAAYVSKYGCWNWRQLPKFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P IKRG+++ +EDE+I+KLH E+GNKWS IA  LPGRSDN+IKNHWH  LKK
Sbjct  61   LQPNIKRGNYTKEEDEIIMKLHAEIGNKWSVIAAHLPGRSDNDIKNHWHTSLKK  114



>ref|XP_007149915.1| hypothetical protein PHAVU_005G109700g [Phaseolus vulgaris]
 gb|ESW21909.1| hypothetical protein PHAVU_005G109700g [Phaseolus vulgaris]
Length=326

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  89   VRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYL  268
            +R PS D +GLKKG W++EED KL AYV RYG WNWRQLP+FAGL+RCGKSCRLRW+NYL
Sbjct  1    MRTPSWDSSGLKKGTWTQEEDRKLVAYVTRYGTWNWRQLPRFAGLTRCGKSCRLRWLNYL  60

Query  269  KPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK  442
            +P IKRG+F+  E+E IIKLH+ELGNKWS IA  LPGR+DNEIKN WH  LKK    K
Sbjct  61   RPNIKRGNFTEKEEETIIKLHEELGNKWSVIATHLPGRTDNEIKNQWHTTLKKRFGKK  118



>dbj|BAC07544.1| myb-related transcription factor VlMYBB1-2 [Vitis labrusca x 
Vitis vinifera]
Length=253

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 134/229 (59%), Gaps = 28/229 (12%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ +ED  L AYVL++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQILTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E++ II+LH++LGNKWSAIA  LPGR+DNEIKN WH HLKK L  K 
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHTHLKKRLTKKL  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKI---GEDESSFYDAISRYSQGTssseesscls  616
                 +       +T +  S  ++ K+       + SSF D+ +R  +            
Sbjct  121  ATPDSKGHFTAAASTCDSDSFNSSGKMSPQPSSSEFSSFTDSSTRTME------------  168

Query  617  sisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADAS  763
                        ++TG  V  E +   S +SF E  + FW D L +D S
Sbjct  169  -----------THSTG--VKNEQMEEYSPESFPEIDESFWSDALSSDNS  204



>gb|AFK38645.1| unknown [Medicago truncatula]
Length=272

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MVRGPSVDK-NGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMN  262
            M R PS DK +G++KG W+ EED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRW+N
Sbjct  1    MARTPSCDKKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  263  YLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            YL+P IKRG+F+ +E+E+II++HK+LGN+WS IA +LPGR+DNE KNHWH  LKK
Sbjct  61   YLRPNIKRGNFTQEEEELIIRMHKKLGNRWSTIAAELPGRTDNEEKNHWHTSLKK  115



>ref|XP_006467925.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
Length=292

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 111/150 (74%), Gaps = 5/150 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+ P  +K  L+KG+W+ EED KL AY+ RYG WNW ++PK+AGL RCGKSCRLRWMNY
Sbjct  1    MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK-  442
            L+P I+RG+F+ +EDE IIKLH++LGN+WSAIA +LP R+DNEIKNHWH  L K   TK 
Sbjct  61   LRPDIRRGNFTQEEDETIIKLHEQLGNRWSAIASRLPRRTDNEIKNHWHTRLSKKRLTKN  120

Query  443  ---QDPKIIRSELKINETTAEYGSSETTQK  523
               Q P +I S L+  +T A +G  E  ++
Sbjct  121  NQQQVPSVIES-LQETQTAAIFGFDEANKQ  149



>ref|XP_009351440.1| PREDICTED: myb-related protein Myb4-like [Pyrus x bretschneideri]
Length=369

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNGLKKGAWS EED  L+AYV ++GH NWR LPK +GL+RCGKSCRLRWMNY
Sbjct  1    MVRAPFYDKNGLKKGAWSPEEDSMLKAYVDKHGHKNWRALPKLSGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+PG+K+G++S +E+ +IIKLH+E GNKWS IA KLPGR+DN+IKNHWH + KK   TKQ
Sbjct  61   LQPGVKKGNYSQEENNLIIKLHEEFGNKWSTIATKLPGRTDNDIKNHWHTYFKK--LTKQ  118

Query  446  D  448
            +
Sbjct  119  N  119



>ref|XP_009594011.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=247

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R    DK+GLKKG W+ +ED KL AYV +YG WNWRQLPKFAGLSRCGKSCRLRW+NY
Sbjct  1    MARTRCYDKSGLKKGTWTPDEDRKLAAYVSKYGCWNWRQLPKFAGLSRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P IKRG+++ +EDE+I+KLH E+GNKWS IA  LPGR+DN IKNHWH  LKK
Sbjct  61   LQPNIKRGNYTKEEDEIIMKLHAEIGNKWSVIAAHLPGRTDNGIKNHWHTSLKK  114



>ref|XP_004497845.1| PREDICTED: myb-related protein Myb4-like [Cicer arietinum]
Length=272

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 114/150 (76%), Gaps = 7/150 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W++EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTQEEDEILISYIQKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL---Q  436
            L+P IKRG+F+N+E+E+IIK+H+ LGN+WS IA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFTNEEEEIIIKMHELLGNRWSVIAAKLPGRTDNEIKNVWHTHLKKKLLKTN  120

Query  437  TKQDPKIIR--SELKINETTAEYGSSETTQ  520
            ++Q+   I+  S+ KIN T +   SS  TQ
Sbjct  121  SQQNSNTIKRVSKPKINRTNS--NSSTLTQ  148



>ref|XP_004495379.1| PREDICTED: myb-related protein Myb4-like [Cicer arietinum]
Length=276

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 8/136 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G WS +ED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLDEDQILTSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL----  433
            LKP IKRG+F+N+E+E IIKLH++LGN+WSAIA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LKPDIKRGNFTNEEEETIIKLHEKLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKKLTKTN  120

Query  434  ----QTKQDPKIIRSE  469
                +  + PKI RS+
Sbjct  121  SETKRVTKKPKIKRSD  136



>ref|XP_004289939.1| PREDICTED: myb-related protein Myb4-like [Fragaria vesca subsp. 
vesca]
Length=272

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHVLVSYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E+E II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L  KQ
Sbjct  61   LRPDIKRGNFSREEEEAIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKKLNIKQ  120

Query  446  DPKIIRSELKINE  484
             P    +  +++E
Sbjct  121  SPTTPEALGQVSE  133



>gb|EPS66172.1| hypothetical protein M569_08609, partial [Genlisea aurea]
Length=119

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+   V  +G+KKGAW+EEED+KLRAY+ RYGHWNW  LPK+AGL+RCGKSCRLRW+NY
Sbjct  1    MVKTSYVGHDGVKKGAWTEEEDEKLRAYIQRYGHWNWNLLPKYAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            LKPG+KRG+F+ +E+++II+LH +LGNKWS IA + PGR+DN+IKN WH  + K ++
Sbjct  61   LKPGVKRGNFTKEEEDLIIQLHDQLGNKWSTIAAQFPGRTDNDIKNFWHTTIAKRIE  117



>ref|XP_003540874.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=234

 Score =   182 bits (462),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWSEEED +L AYV R+GH NWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSEEEDKRLMAYVERHGHPNWRQLPKFAGLQRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++  E+++I  LHK+ GNKWS IA  LPGR+DNEIKN+WH++LKK L+  +
Sbjct  61   LRPNLKRGNYTQKEEQIIKDLHKKHGNKWSLIAENLPGRTDNEIKNYWHSNLKKFLKGNE  120

Query  446  D  448
            +
Sbjct  121  N  121



>ref|XP_007035114.1| Myb domain protein 13, putative [Theobroma cacao]
 gb|EOY06040.1| Myb domain protein 13, putative [Theobroma cacao]
Length=335

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK G+KKG W+ EED  L +YV +YGH NWR LPK AGLSRCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKMGMKKGPWTPEEDQILISYVQKYGHANWRALPKQAGLSRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+++E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTSEEEETIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKQYQ  120



>gb|AES67329.2| myb transcription factor [Medicago truncatula]
Length=451

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 107/141 (76%), Gaps = 5/141 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D NGL+KG+W+ EED KL AYV RYG WNWRQLP+FAGL RCGKSCRLRWMNY
Sbjct  1    MVRTP-CDNNGLRKGSWTHEEDKKLIAYVTRYGCWNWRQLPRFAGLERCGKSCRLRWMNY  59

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLK----KHL  433
            L+P +KRG+F+  E+E+IIKLH++LGN+W+ IA   PGR+DNEIKNHWH  LK    K++
Sbjct  60   LRPDVKRGNFNQQEEELIIKLHEKLGNRWTVIASNFPGRTDNEIKNHWHTTLKKRFVKNI  119

Query  434  QTKQDPKIIRSELKINETTAE  496
            ++K+  +I +     N  T E
Sbjct  120  KSKRGTRIAKDSNSNNHPTLE  140



>gb|KHN22878.1| Myb-related protein Myb4 [Glycine soja]
Length=233

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DKNGLKKG W+ EED KL  Y+ RYGHWNWR LPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRTPSCDKNGLKKGTWTAEEDKKLVDYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P +KRG+++ +E+E IIKLH+ LGN+WS IA ++PGR+DNEIKNHWH +LKK  Q
Sbjct  61   LRPNLKRGNYTEEEEETIIKLHRRLGNRWSTIAARMPGRTDNEIKNHWHTNLKKRSQ  117



>ref|XP_004243822.1| PREDICTED: transcription factor WER-like [Solanum lycopersicum]
Length=249

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 107/156 (69%), Gaps = 20/156 (13%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D++G KKG W+ EED KL AY+ +YG WNWRQLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCHDEHGRKKGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++ +EDE+I+ LH +LGNKWS IA  LPGRSDNEIKNHWH  +KK      
Sbjct  61   LRPNVKRGNYTKEEDEIILNLHAQLGNKWSTIASHLPGRSDNEIKNHWHTTVKKR-----  115

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSF  553
                           A+Y SSE ++K    + ES  
Sbjct  116  ---------------ADYNSSEGSKKCNNKKSESDI  136



>ref|XP_003540869.2| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=234

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR PS DKNGLKKG W+ EED KL  Y+ RYGHWNWR LPKFAGL+RCGKSCRLRW+NY
Sbjct  2    MVRTPSCDKNGLKKGTWTAEEDKKLVDYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  61

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P +KRG+++ +E+E IIKLH+ LGN+WS IA ++PGR+DNEIKNHWH +LKK  Q
Sbjct  62   LRPNLKRGNYTEEEEETIIKLHRRLGNRWSTIAARMPGRTDNEIKNHWHTNLKKRSQ  118



>gb|ABR28344.1| MYB transcription factor MYB70 [Medicago truncatula]
Length=255

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPYCDKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            LKP IKRG+F+N+E+E IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRL  116



>emb|CCA29106.1| putative MYB transcription factor [Rosa rugosa]
Length=272

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHVLVSYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E+E II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L  KQ
Sbjct  61   LRPDIKRGNFSREEEEAIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKKLSIKQ  120

Query  446  D  448
            +
Sbjct  121  N  121



>ref|XP_003590026.1| MYB-like protein [Medicago truncatula]
 gb|AES60277.1| myb-related transcription factor LBM1 [Medicago truncatula]
Length=254

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 113/152 (74%), Gaps = 8/152 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKDAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+  IKRG+FSN+E+++IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L   +
Sbjct  61   LRTDIKRGNFSNEEEQIIIKMHELLGNRWSAIAAKLPGRTDNEIKNMWHTHLKKRLLNTK  120

Query  446  D--------PKIIRSELKINETTAEYGSSETT  517
            +         ++ + ++KI+++ A   S ETT
Sbjct  121  NNQPHSNTKKRVSKQKIKISDSNANSNSMETT  152



>gb|AFK39973.1| unknown [Medicago truncatula]
 gb|KEH42768.1| myb-related transcription factor LBM1 [Medicago truncatula]
Length=258

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 9/137 (7%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G WS EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLEEDEILTSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL-QTK  442
            L+P IKRG+F+N+E+E IIKLH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L QT 
Sbjct  61   LRPDIKRGNFTNEEEENIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKKLNQTN  120

Query  443  QD--------PKIIRSE  469
             +        PKI RS+
Sbjct  121  SEAKKKAISKPKIKRSD  137



>gb|ABR28339.1| MYB transcription factor MYB51 [Medicago truncatula]
Length=255

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            LKP IKRG+F+N+E+E IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRL  116



>ref|XP_003590028.1| Myb-related protein P [Medicago truncatula]
 gb|AES60279.1| myb-related transcription factor LBM1 [Medicago truncatula]
Length=255

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            LKP IKRG+F+N+E+E IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRL  116



>ref|XP_007145850.1| hypothetical protein PHAVU_007G273400g [Phaseolus vulgaris]
 gb|ESW17844.1| hypothetical protein PHAVU_007G273400g [Phaseolus vulgaris]
Length=254

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W++EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTQEEDQTLISYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKP IKRG+FS++E+++IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L   +
Sbjct  61   LKPDIKRGNFSSEEEDIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKKLLNSE  120

Query  446  -----DPKIIRSE  469
                 +PKI RS+
Sbjct  121  PKRVSNPKIKRSD  133



>ref|XP_010268905.1| PREDICTED: myb-related protein Myb4-like [Nelumbo nucifera]
Length=253

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+    +K GLKKGAW+ +ED+KL  Y+ +YGHWNWR+LP+FAGL RCGKSCRLRW+NY
Sbjct  1    MVKTGYCEKTGLKKGAWTPDEDEKLTDYIKKYGHWNWRELPRFAGLKRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P I+RG FS  EDE+I+ LH+ LGNKW+AIA KLPGR+DNE+KNHWH +LKK L+   
Sbjct  61   LRPNIRRGLFSEGEDELIMNLHESLGNKWAAIAAKLPGRTDNEVKNHWHTNLKKRLKQMS  120

Query  446  DPKIIRSEL  472
            +  +   E+
Sbjct  121  ENNLHSHEI  129



>gb|ACJ84928.1| unknown [Medicago truncatula]
Length=258

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 9/137 (7%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G WS EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLEEDEILTSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL-QTK  442
            L+P IKRG+F+N+E+E IIKLH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L QT 
Sbjct  61   LRPDIKRGNFTNEEEENIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKKLNQTN  120

Query  443  QD--------PKIIRSE  469
             +        PKI RS+
Sbjct  121  SEAKKKAISKPKIKRSD  137



>ref|XP_006360526.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=245

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG KKG W+ EED KL  Y+ +YG WNWRQLPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGRKKGTWTPEEDRKLADYITKYGSWNWRQLPKYAGLERCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P +KRG+++ +EDE+I+ LH +LGNKWSAI+  LPGRSDNEIKNHWH  LKK
Sbjct  61   LRPNVKRGNYTKEEDEIILNLHAQLGNKWSAISVHLPGRSDNEIKNHWHTALKK  114



>emb|CDO99233.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/266 (41%), Positives = 149/266 (56%), Gaps = 8/266 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +++ + GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQVLVSHIQKNGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E++ IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFSKEEEDTIIKLHETLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKNHQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
                   ++K   T  +     T  K+    DES+F D         ++S   + +S   
Sbjct  121  ---ATSQDIKKQSTQVQRSDPRTPVKIDDQPDESNFTDDHHHRDGKVTTSLGCAPVSPQH  177

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFMSPT  805
             S  L          + +E   M S + F +  + FW +    D +   S    G    T
Sbjct  178  SSSELSTVTENDSAAIKQE--KMDSPEYFPQIDESFWSEEFPVDNANVQSGIHDGLA--T  233

Query  806  SQVEEEFTLPYSLFGEDDVN-FLNNF  880
            + ++ +F L      ++DVN +++NF
Sbjct  234  NDMQFQFPLSPVAASDEDVNAYISNF  259



>gb|KHN00260.1| Myb-related protein Myb4 [Glycine soja]
Length=263

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 117/167 (70%), Gaps = 3/167 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS++E+E+IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L   +
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLLNSE  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGT  586
              K + S+ +I  + +   SS  TQ        ++     S +S+GT
Sbjct  121  IQKRV-SKPRIKRSDS--NSSTLTQLEPTSSACTTSLSDFSSFSEGT  164



>gb|KEH17558.1| myb transcription factor [Medicago truncatula]
Length=231

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG KKGAWS+EED++L A++ R+GH NWRQLP+ AGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGTKKGAWSKEEDERLIAHIERHGHPNWRQLPRVAGLARCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P +KRG+++  E++MI++LHK+ GNKWS IA  LPGRSDNEIKN+WH+HL+K   +K 
Sbjct  61   LRPNLKRGNYTQKEEQMIMELHKKHGNKWSLIAENLPGRSDNEIKNYWHSHLQKF--SKC  118

Query  446  DPKIIRSELKINETTAEYGSSET  514
            +   +  E++  +TT+E  S ++
Sbjct  119  NDSKLTQEIESPKTTSEVVSVDS  141



>ref|XP_008807658.1| PREDICTED: myb-related protein Myb4-like [Phoenix dactylifera]
Length=272

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 148/264 (56%), Gaps = 12/264 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED+ L +Y+  YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDEILVSYIRSYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL---Q  436
            L+P IKRG+F+ +E+E IIK H+ LGN+WSAIA  LPGR+DNEIKN WH HLKK +   Q
Sbjct  61   LRPDIKRGNFTKEEEETIIKWHEMLGNRWSAIAAMLPGRTDNEIKNVWHTHLKKRVNPNQ  120

Query  437  TKQDPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseesscls  616
            + Q+PK  R      +T  E G ++  Q + +     + +  +   SQ   S  +S    
Sbjct  121  SAQNPK--RKAQSGVKTVMEVGPTK-LQAIPL-----AAHPKLENPSQDLVSPSQSCSEI  172

Query  617  sisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFM  796
            S S + +             +EG M  SS+   +    FW + L  D    P +      
Sbjct  173  SSSAATNASTMTGEINDAGIKEGCMQ-SSEELLKIDASFWSEALSIDDCGMPMDCNMSAG  231

Query  797  SPTSQVEEEFTLPYSLFGEDDVNF  868
             P + + + F+   S F  DD+NF
Sbjct  232  PPPTSLGDPFSSSPSNFDNDDINF  255



>ref|XP_004507244.1| PREDICTED: myb-related protein 315-like [Cicer arietinum]
Length=241

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+NG+KKGAWSEEED KL AY+ R+GH NWRQLPK+AGLSRCGKSCRLRWMNY
Sbjct  1    MVRAPYFDENGIKKGAWSEEEDHKLIAYIERHGHPNWRQLPKYAGLSRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P +KRG ++  E++MI++LHK+ GNKWS IA  L GR+DNEIKN+WH+HLK+
Sbjct  61   LRPNLKRGKYTPMEEQMIMELHKKHGNKWSMIAENLVGRTDNEIKNYWHSHLKR  114



>ref|XP_006345888.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=220

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W++EED  L  ++ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTQEEDQILITFIQKYGHENWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E+++IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+ KQ
Sbjct  61   LRPDIKRGNFSEEEEQIIIKLHQLLGNRWSAIASRLPGRTDNEIKNFWHTHLKKRLELKQ  120



>ref|XP_009631826.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=256

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 148/270 (55%), Gaps = 30/270 (11%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG WS EED  L +Y+ R GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MVRAPCCDKMGLKKGPWSPEEDQILISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L P IKRG+F+ +E++ II LH++LGN+WSAIA +L GR+DNEIKN WH HLKK L+  Q
Sbjct  61   LSPDIKRGNFTKEEEDTIIHLHEKLGNRWSAIASRLQGRTDNEIKNIWHTHLKKRLKNYQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
             P+   S+   N   +++ +S   +    G   +S   + S  S  T+ S          
Sbjct  121  PPR--NSKRHYNTVNSDFSTSIQHEINSFGHPPNSPQISTSEVSTVTADSSSII------  172

Query  626  isksldlscNTTGWTVPEEGV----MMTSSQSFGETFDCFWDDLLFADASFSPSESEGGF  793
                      T   T  ++ +    ++ SS+ F E  +  W + L  D S         F
Sbjct  173  ----------TPATTDDQKAIKLEEIIDSSEYFTEMHESLWTNELAIDDS-------SNF  215

Query  794  MSPTSQVEEEFTLPYSLFGEDDVNFLNNFM  883
            ++   +  +   + ++   EDD++FL NF 
Sbjct  216  VTVAGEEFQSLDM-FNTTMEDDMDFLFNFF  244



>ref|XP_008235684.1| PREDICTED: myb-related protein Myb4 [Prunus mume]
Length=264

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 108/156 (69%), Gaps = 8/156 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHILVTYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E++ II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFSREEEDAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKQNQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSF  553
                       +ET A + S++T Q+ ++ E   S 
Sbjct  121  --------TTTSETRAHFFSTKTEQEPELSEKSESL  148



>ref|XP_009629052.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
 dbj|BAA88221.1| myb-related transcription factor LBM1 [Nicotiana tabacum]
Length=281

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 152/271 (56%), Gaps = 17/271 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+   GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILVSYIQTNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E++ II+LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKNYQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
             P+  +   K N  +    +S+T        + S  +  I     G  +   S   SS  
Sbjct  121  PPQNSKRHSKNNLDSKAPSTSQTF-------NNSDNFSNIQEDINGPVTGPNSPQRSSSE  173

Query  626  isksldlscNTTGWTVPEEGVM-----MTSSQSFGETFD-CFW-DDLLFADASFSPSESE  784
            +S     S   T  T+ ++ +      M SS++F    D  FW DDL  +D S    E  
Sbjct  174  MSTVTVDSTAMTTITIDDQNMFKQLDEMDSSENFIPEIDESFWTDDLSTSDNSTFGMEGT  233

Query  785  GGFMS---PTSQVEEEFTLPYSLFGEDDVNF  868
            GG +    P S V++E         EDD++F
Sbjct  234  GGELQVQFPFSSVKQESMDMVGAKLEDDMDF  264



>ref|XP_003518022.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=264

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 114/173 (66%), Gaps = 15/173 (9%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK-  442
            L+P IKRG+FS++E+E+IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLLNSD  120

Query  443  -----QDPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGT  586
                   P+I RS         +  SS  TQ        ++     S +S+GT
Sbjct  121  IQKRVSKPRIKRS---------DSNSSTLTQLEPTSSACTTSLSDFSSFSEGT  164



>ref|XP_004252033.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=233

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  86   MVRGPSVDK-NGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMN  262
            M R    DK +GLKKG W+ EED KL AYV +YG WNWRQLPKFAGLSRCGKSCRLRW+N
Sbjct  1    MARIRCYDKKSGLKKGTWTLEEDKKLAAYVNKYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  263  YLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            YL+P IKRG+++ +ED++I+KLH E+GNKWSAIA  LPGRSDNEIKNHWH  LKK
Sbjct  61   YLRPNIKRGNYTREEDQIIMKLHAEIGNKWSAIAIHLPGRSDNEIKNHWHTSLKK  115



>dbj|BAA81732.1| GmMYB29A2 [Glycine max]
Length=264

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 116/167 (69%), Gaps = 3/167 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS++E+E+IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLLNSD  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGT  586
              K + S+ +I  + +   SS  TQ        ++     S +S+GT
Sbjct  121  IQKRV-SKPRIKRSDS--NSSTLTQLEPTSSACTTSLSDFSSFSEGT  164



>ref|XP_010906538.1| PREDICTED: myb-related protein Myb4-like [Elaeis guineensis]
Length=270

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 105/264 (40%), Positives = 138/264 (52%), Gaps = 14/264 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ RYGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDRILVSYIHRYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK +    
Sbjct  61   LRPDIKRGNFTKEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRVNPNH  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
              +  + +++ +  T      E  Q + I       Y      S                
Sbjct  121  AVQNSKPKVQSDVKTVMAVRPEKLQSIPIAGHPKLEYLNPHPVSPS-----------QSC  169

Query  626  isksldlscNTTGWTVPEEGV---MMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFM  796
               S   + +T    +   G+    M SS+   E    FW + L+ +   +P +      
Sbjct  170  SEISSASNSSTITGDISHAGIKEGCMNSSEELLEIDASFWSEELWGEDCGTPMDCSMLAG  229

Query  797  SPTSQVEEEFTLPYSLFGEDDVNF  868
             P   + + F    S F +DD NF
Sbjct  230  PPPRSLGDPFPFSPSNFYDDDTNF  253



>gb|KDO75677.1| hypothetical protein CISIN_1g037956mg, partial [Citrus sinensis]
Length=245

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 5/150 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+    +K  L+KG+W+ EED KL AY+ RYG WNW ++PK+AGL RCGKSCRLRWMNY
Sbjct  1    MVKAGGSEKPSLRKGSWTPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK-  442
            L+P I+RG+F+ +EDE IIKLH++LGN+WSAIA +LPGR+DNEIKNHWH+ L K   TK 
Sbjct  61   LRPDIRRGNFTQEEDETIIKLHEQLGNRWSAIASRLPGRTDNEIKNHWHSRLSKKRLTKN  120

Query  443  ---QDPKIIRSELKINETTAEYGSSETTQK  523
               Q P + +S L+  +T A +   E  ++
Sbjct  121  NQQQVPSVTKS-LQETQTAAIFEFDEANKQ  149



>gb|KHN00294.1| Myb-related protein Myb4 [Glycine soja]
Length=264

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS++E+E+IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLMNSD  120

Query  446  D------PKIIRSE  469
                   P+I RS+
Sbjct  121  TNKRVSKPRIKRSD  134



>gb|ACJ84573.1| unknown [Medicago truncatula]
 gb|AFK39421.1| unknown [Medicago truncatula]
 gb|AFK45867.1| unknown [Medicago truncatula]
Length=255

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            LKP IKRG+F+N+E+E IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKK  114



>ref|XP_003535693.1| PREDICTED: myb-related protein Myb4 [Glycine max]
 dbj|BAA81730.1| GmMYB29A1 [Glycine max]
 dbj|BAA81731.1| GmMYB29A1 [Glycine max]
Length=264

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS++E+E+IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLMNSD  120

Query  446  D------PKIIRSE  469
                   P+I RS+
Sbjct  121  TNKRVSKPRIKRSD  134



>ref|XP_006449185.1| hypothetical protein CICLE_v10017679mg, partial [Citrus clementina]
 gb|ESR62425.1| hypothetical protein CICLE_v10017679mg, partial [Citrus clementina]
Length=124

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+ P  +K  L+KG+W+ EED KL AY+ RYG WNW ++PK+AGL RCGKSCRLRWMNY
Sbjct  1    MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P I+RG+F+ +EDE IIKLH++LGN+WSAIA +LP R+DNEIKNHWH  L K   TK 
Sbjct  61   LRPDIRRGNFTQEEDETIIKLHQQLGNRWSAIASRLPRRTDNEIKNHWHTRLSKKRLTKD  120

Query  446  D  448
            +
Sbjct  121  N  121



>ref|XP_006442693.1| hypothetical protein CICLE_v10022057mg [Citrus clementina]
 gb|ESR55933.1| hypothetical protein CICLE_v10022057mg [Citrus clementina]
Length=231

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +++ RYGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCEKMGLKKGPWTPEEDQILISFIQRYGHGNWRALPKQAGLMRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ---  436
            L+P IKRG+FS DE+E I+KLH+ LGN+WS IA +LPGR+DNEIKN+WH+HLKK L+   
Sbjct  61   LRPDIKRGNFSKDEEETILKLHRVLGNRWSTIAARLPGRTDNEIKNYWHSHLKKRLKQNL  120

Query  437  --TKQDPKIIRSEL  472
               KQ   I+++ L
Sbjct  121  ISPKQQCDIVQALL  134



>gb|ACU23862.1| unknown [Glycine max]
Length=268

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS++E+E+IIK+H+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLMNSD  120

Query  446  D------PKIIRSE  469
                   P+I RS+
Sbjct  121  TNKRVSKPRIKRSD  134



>ref|XP_007199224.1| hypothetical protein PRUPE_ppa021921mg [Prunus persica]
 gb|EMJ00423.1| hypothetical protein PRUPE_ppa021921mg [Prunus persica]
Length=258

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 107/156 (69%), Gaps = 8/156 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHVLVTYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E++ II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFSREEEDAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKQNQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSF  553
                       +ET A + S++T Q+ +  E   S 
Sbjct  121  --------TTTSETRAHFFSTKTEQEPEPSEKSESL  148



>gb|ABR28338.1| MYB transcription factor MYB50 [Medicago truncatula]
Length=258

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 9/137 (7%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G WS EED+ L +Y+ ++ H NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLEEDEILTSYIQKHDHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL-QTK  442
            L+P IKRG+F+N+E+E IIKLH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L QT 
Sbjct  61   LRPDIKRGNFTNEEEENIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKKLNQTN  120

Query  443  QD--------PKIIRSE  469
             +        PKI RS+
Sbjct  121  SEAKKKAISKPKIKRSD  137



>ref|XP_010934323.1| PREDICTED: myb-related protein Myb4-like [Elaeis guineensis]
Length=255

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L AY+ RYGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKVGLKKGPWTSEEDQILIAYIQRYGHANWRALPKQAGLFRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ---  436
            L+P IKRG+F+ +E+E II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK ++   
Sbjct  61   LRPNIKRGNFTKEEEETIITLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRVKPNL  120

Query  437  TKQDPK  454
              Q PK
Sbjct  121  AAQKPK  126



>ref|XP_010920477.1| PREDICTED: myb-related protein Myb4 [Elaeis guineensis]
Length=257

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L AY+ RYGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILIAYIQRYGHGNWRALPKQAGLLRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E II LH++LGN+WSAIA +LPGR+DNEIKN WH HLKK ++  Q
Sbjct  61   LRPDIKRGNFTQEEEETIINLHEKLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRVKPNQ  120



>ref|XP_008785342.1| PREDICTED: myb-related protein Myb4-like [Phoenix dactylifera]
Length=259

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 98/127 (77%), Gaps = 3/127 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+ RYGH NWR LPK AGLSRCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTSEEDQILITYIQRYGHANWRALPKQAGLSRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL---Q  436
            L+P IKRG+F+ +E+E II LH+ +GN+WSAIA +LPGR+DNEIKN WH  LKK +   Q
Sbjct  61   LRPDIKRGNFTKEEEETIISLHEMIGNRWSAIAARLPGRTDNEIKNVWHTRLKKRVKPNQ  120

Query  437  TKQDPKI  457
              Q+PKI
Sbjct  121  VAQEPKI  127



>ref|NP_001064861.1| Os10g0478300 [Oryza sativa Japonica Group]
 gb|AAG13574.1|AC037425_5 myb factor [Oryza sativa Japonica Group]
 emb|CAA72185.1| myb factor [Oryza sativa Japonica Group]
 gb|AAP54284.1| Myb-related protein Myb4, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26775.1| Os10g0478300 [Oryza sativa Japonica Group]
 dbj|BAG98586.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GL++GAWS EEDD+L AY+ R+GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKEGLRRGAWSPEEDDRLVAYIRRHGHPNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ DE+++I++LH  LGN+WSAIA ++PGR+DNEIKN WH HLKK L  ++
Sbjct  61   LRPDIKRGNFTADEEDLIVRLHNSLGNRWSAIAAQMPGRTDNEIKNVWHTHLKKRLDDER  120



>ref|XP_009765014.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=257

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG WS EED+ L +Y+ R GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MVRAPCCEKMGLKKGPWSPEEDEILISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L P IKRG+F+ +E++ II LH++ GN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LSPDIKRGNFTKEEEDTIIHLHEKFGNRWSAIASRLPGRTDNEIKNIWHTHLKKRLKNYQ  120

Query  446  DPK  454
             P+
Sbjct  121  PPQ  123



>ref|XP_006664815.1| PREDICTED: myb-related protein Myb4-like [Oryza brachyantha]
Length=278

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GL++GAWS EEDD+L AY+ R+GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKEGLRRGAWSPEEDDRLVAYIRRHGHPNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG+F+ DE+ +I+ LH  LGN+WSAIA +LPGR+DNEIKN WH HLKK L
Sbjct  61   LRPDIKRGNFTADEEALIVSLHHSLGNRWSAIAAQLPGRTDNEIKNVWHTHLKKRL  116



>ref|XP_007149917.1| hypothetical protein PHAVU_005G109900g [Phaseolus vulgaris]
 gb|ESW21911.1| hypothetical protein PHAVU_005G109900g [Phaseolus vulgaris]
Length=232

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+    +K+ L+KG W+ EED KL AYV RYGHWNW  LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVKCTFSEKSRLRKGTWTPEEDKKLSAYVTRYGHWNWNLLPKFAGLERCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+++ +EDE IIKL + LGN+WS IA +LPGR+DNEIKN+WH +LKK  Q
Sbjct  61   LRPNIKRGNYTKEEDETIIKLLQSLGNRWSVIAAQLPGRTDNEIKNYWHTNLKKRFQ  117



>gb|AEV91156.1| R2R3-MYB protein [Triticum urartu]
Length=263

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K+GLK+GAWS EED +L  Y+ R+GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKDGLKRGAWSPEEDQRLADYIARHGHPNWRALPKHAGLLRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L P IKRG+F+ DE+++II+LH+ LGN+WS IA +LPGR+DNEIKN WH+HLKK L+   
Sbjct  61   LSPDIKRGNFTADEEDLIIRLHQTLGNRWSVIAAQLPGRTDNEIKNVWHSHLKKRLEDGL  120

Query  446  DP  451
             P
Sbjct  121  KP  122



>ref|XP_011036293.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=206

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +  GLKKG W+ EED  L +Y+  YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEMMGLKKGPWTPEEDQILVSYIRSYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+PGIKRG+FSN+E++ IIKLH+ LGN+WSAIA +LPGR+DNEIKN+WH+HLKK  Q
Sbjct  61   LRPGIKRGNFSNEEEDTIIKLHQILGNRWSAIAARLPGRTDNEIKNYWHSHLKKRFQ  117



>gb|KEH16942.1| myb transcription factor, partial [Medicago truncatula]
Length=224

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNG+KKGAWS +ED +L  Y+ ++GH NWRQLPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPFYDKNGVKKGAWSRDEDTRLSDYIQKHGHSNWRQLPKLAGLLRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKP +K G+++++E+E+IIKLH +LGNKWS IA KLPGR+D+EIKN+WH++LK   ++K 
Sbjct  61   LKPNLKHGNYTSEEEEIIIKLHYQLGNKWSLIAEKLPGRTDHEIKNYWHSYLKTCSKSKN  120

Query  446  DPKIIRSELK  475
              + I SELK
Sbjct  121  YKETI-SELK  129



>gb|AFK45056.1| unknown [Lotus japonicus]
Length=277

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWAAEEDEILTSYIQKHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL----  433
            L+P IKRG+F+ +E+E IIKLH+ LGN+WS IA KLPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFTAEEEESIIKLHEMLGNRWSVIAAKLPGRTDNEIKNVWHTHLKKKLPKTE  120

Query  434  ---QTKQDPKIIRSELKINETTAEYGSSETTQ  520
               Q    PKI  S+ KI  + +   SS  TQ
Sbjct  121  HQQQPSSKPKIRVSKSKIKRSDS--NSSTITQ  150



>ref|XP_004507232.1| PREDICTED: transcription factor MYB12-like [Cicer arietinum]
Length=249

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DKNGLKKG WS EED+KL AY+ ++GH NWRQLPK A L RCGKSCRLRW+NY
Sbjct  1    MVRAPFYDKNGLKKGEWSREEDEKLSAYIQKHGHSNWRQLPKQADLKRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P +K GS+S++E+EMIIKLH   GNKWS IA KLPGR+D+EIKN+WH++LKK
Sbjct  61   LRPNLKHGSYSSEEEEMIIKLHHRHGNKWSLIAEKLPGRTDHEIKNYWHSYLKK  114



>ref|XP_002311670.1| hypothetical protein POPTR_0008s16660g [Populus trichocarpa]
 gb|EEE89037.1| hypothetical protein POPTR_0008s16660g [Populus trichocarpa]
Length=287

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L +YV +YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTPEEDQILISYVQKYGHSNWRALPKQAGLQRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HL K L+   
Sbjct  61   LRPDIKRGNFSKEEEEAIIKLHEILGNRWSAIASRLPGRTDNEIKNVWHTHLLKRLKQNG  120

Query  446  DPK  454
            +PK
Sbjct  121  EPK  123



>gb|KHN41181.1| Myb-related protein Myb4 [Glycine soja]
Length=242

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 110/162 (68%), Gaps = 6/162 (4%)
 Frame = +2

Query  86   MVRGPSVDK-NGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMN  262
            MV+ P  DK +GLKKG W+ EED KL A+V  +GH NWRQLPK AGL+RCGKSCRLRW+N
Sbjct  1    MVKTPYCDKKSGLKKGTWTPEEDWKLIAHVNAHGHKNWRQLPKLAGLARCGKSCRLRWVN  60

Query  263  YLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK  442
            YL+PGIKRG+++++E+E IIKL   LGN+WS IA  LPGRSDNEIKNHWHAHLKK  Q  
Sbjct  61   YLRPGIKRGNYTHEEEETIIKLRTSLGNRWSVIASHLPGRSDNEIKNHWHAHLKKRFQHD  120

Query  443  Q--DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDA  562
            +   PK+    L   E+  E   S             + YDA
Sbjct  121  EASTPKL---HLSTVESIQENNYSVEVDPSPFQNSSPATYDA  159



>ref|XP_006358196.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=253

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  119  LKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYLKPGIKRGSFS  298
            +KKGAWS EED KLR Y+++YG WNW+Q+PKFAGLSR GKSCRLRWMNYL+P ++RG F+
Sbjct  18   IKKGAWSPEEDQKLRGYIMKYGIWNWKQMPKFAGLSRTGKSCRLRWMNYLRPDVRRGPFT  77

Query  299  NDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQDPKIIRS  466
             +E E++IK ++ELGN WSAIA KLPGR+DNE+KN +HAHLKKHL  K    ++++
Sbjct  78   MEEVEIVIKTYQELGNSWSAIAAKLPGRTDNEVKNFFHAHLKKHLGLKNHDALLKT  133



>ref|XP_009398450.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L AY+ RYGH NWR LP+ AGL RCGKSCRLRWMNY
Sbjct  1    MVRSPCCEKMGLKKGPWTTEEDQILVAYIKRYGHANWRALPRQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P IKRG+ + +E+E II+LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK
Sbjct  61   LRPDIKRGNLTKEEEETIIRLHERLGNRWSAIAARLPGRTDNEIKNVWHTHLKK  114



>ref|XP_002464484.1| hypothetical protein SORBIDRAFT_01g019270 [Sorghum bicolor]
 gb|EER91482.1| hypothetical protein SORBIDRAFT_01g019270 [Sorghum bicolor]
Length=296

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GL++GAWS EED +L AY+ + GH NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKEGLRRGAWSPEEDQRLVAYIQQNGHPNWRALPRQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS DE+ +I++LH+ELGN+WSAIA +LPGR+DNEIKN WH H+KK L+   
Sbjct  61   LRPDIKRGNFSADEEALIVRLHRELGNRWSAIAAQLPGRTDNEIKNVWHTHIKKRLEDGD  120

Query  446  D  448
            D
Sbjct  121  D  121



>ref|XP_009762172.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
 dbj|BAA88224.1| myb-related transcription factor LBM4 [Nicotiana tabacum]
Length=281

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 150/271 (55%), Gaps = 17/271 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+   GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQVLVSYIQTNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E++ II+LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKNYQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
             P+  +   K N  +    +S+T        + S  +  I     G  +   S   SS  
Sbjct  121  PPQNSKKHSKNNLDSKAPSTSQTF-------NNSDNFSNIQEDINGPVTGPNSPQRSSSE  173

Query  626  isksldlscNTTGWTVPEEGVM-----MTSSQSFGETFD-CFW-DDLLFADASFSPSESE  784
            +S     S   T  T+ ++ +      M SS+SF    D  FW +DL   D S    E  
Sbjct  174  MSTVTADSTAMTTITIDDQNMFKQLDEMNSSESFIPEIDESFWTNDLSTGDNSNFDMEGT  233

Query  785  GGFMS---PTSQVEEEFTLPYSLFGEDDVNF  868
            G  +    P S V++E         EDD++F
Sbjct  234  GEELQVQFPFSSVKQESMDMVGTKLEDDMDF  264



>ref|XP_004235197.1| PREDICTED: transcription factor WER-like [Solanum lycopersicum]
Length=253

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  119  LKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYLKPGIKRGSFS  298
            +KKGAWS EED KLR Y+++YG WNWRQ+PKFAGLSR GKSCRLRWMNYL+P +KRG F+
Sbjct  18   IKKGAWSPEEDQKLRGYIMKYGIWNWRQMPKFAGLSRTGKSCRLRWMNYLRPDVKRGPFT  77

Query  299  NDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK  442
             +E E++IK ++ELGN WSAIA KLPGR+DNE+KN +H HLKKHL  K
Sbjct  78   TEEVEIVIKTYQELGNSWSAIAAKLPGRTDNEVKNFFHTHLKKHLGLK  125



>ref|XP_004240193.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=218

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W++EED  L  ++ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTQEEDQILINFIQKYGHENWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+FS +E+++IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+
Sbjct  61   LRPDIKRGNFSEEEEQIIIKLHQLLGNRWSAIASRLPGRTDNEIKNFWHTHLKKRLE  117



>ref|XP_003540332.2| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=313

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 5/147 (3%)
 Frame = +2

Query  89   VRGPSVD-KNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            +R PS   K+GL KG W+ EED KL AY+ RYG WNWRQLP+FAGL+RCGKSCRLRW+NY
Sbjct  1    MRTPSSSHKSGLNKGTWTPEEDAKLIAYITRYGSWNWRQLPRFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+++ +E+E+II+LH++LGNKWS IA  LPGR+DNEIKNHWH  LKK      
Sbjct  61   LRPNIKRGNYTKEEEEIIIRLHEKLGNKWSVIATHLPGRTDNEIKNHWHTTLKKRFGKNT  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKV  526
                +    K+  T +    S+  QKV
Sbjct  121  ----VHPNKKVKATKSNSSGSKEIQKV  143



>ref|XP_004234040.1| PREDICTED: myb-related protein Myb4 [Solanum lycopersicum]
Length=251

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 106/152 (70%), Gaps = 8/152 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R PS +K  LKKG+W  EED  L +Y+ + GH NWR LP+ AGL RCGKSCRLRWMNY
Sbjct  1    MDRAPSCEKTSLKKGSWDHEEDQILISYINKNGHGNWRALPRQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L P IKRG+F+ +E++ II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LSPHIKRGNFTKEEEDNIINLHEILGNRWSAIAARLPGRTDNEIKNIWHTHLKKRLKNCQ  120

Query  446  DPKIIRSELKINE--------TTAEYGSSETT  517
             P+  +   KIN+         + E  SSET+
Sbjct  121  SPRSFKRHKKINQINNCMHAPNSPEISSSETS  152



>gb|KDP44603.1| hypothetical protein JCGZ_19745 [Jatropha curcas]
 gb|AIT52290.1| MYB family protein [Jatropha curcas]
Length=233

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK+GLKKG WS EED KL  Y+ R G WNWRQLPK+AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKSGLKKGTWSPEEDRKLMDYISRNGCWNWRQLPKYAGLLRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+FS +E++ II+LH  LGN+WSAIA +LPGR+DN+IKN WH+ LKK  +
Sbjct  61   LRPNIKRGNFSKEEEDAIIRLHDSLGNRWSAIAAQLPGRTDNDIKNLWHSILKKRAE  117



>ref|XP_009392095.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=251

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L AY+ ++GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQVLVAYIQQHGHENWRALPKRAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK ++  Q
Sbjct  61   LRPDIKRGNFTKEEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRVKPNQ  120



>ref|XP_008791593.1| PREDICTED: myb-related protein Myb4 [Phoenix dactylifera]
Length=263

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/270 (42%), Positives = 148/270 (55%), Gaps = 22/270 (8%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLKKG W+ EED  L A++ RYGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDQILTAHIRRYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E II LH++LGN+WSAIA KLPGR+DNEIKN WH HLKK +   Q
Sbjct  61   LRPDIKRGNFTKEEEETIIHLHEKLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRVNPNQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
              +  + + ++ +   E  S  T  ++  G     F D         S     S +S  +
Sbjct  121  VAQESKKKTQV-DAMIEKESKHTPTQLNSGLTHPRFDDP---RLPPVSPERSYSDISCTA  176

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFMSPT  805
               S     NT   +V EE     SS+ F    + FW + L  D     +  EG    P 
Sbjct  177  TDSSTISRENTCNVSVKEESF---SSEEFPVIDESFWSETLSMDF----TALEGPTFGPL  229

Query  806  SQVEEEFTLPYSLFG---EDDVNF-LNNFM  883
             +       P+  FG   +DD++F L  FM
Sbjct  230  GE-------PFGSFGASNDDDMDFWLRVFM  252



>ref|XP_007143866.1| hypothetical protein PHAVU_007G108500g [Phaseolus vulgaris]
 gb|ESW15860.1| hypothetical protein PHAVU_007G108500g [Phaseolus vulgaris]
Length=267

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWAPEEDQILTSYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            LKP IKRG+F+++E+E+I+KLH+ LGN+WSAIA KLPGR+DNEIKN WH +LKK L
Sbjct  61   LKPDIKRGNFTSEEEEIILKLHETLGNRWSAIAAKLPGRTDNEIKNVWHTNLKKRL  116



>ref|XP_001768811.1| predicted protein [Physcomitrella patens]
 gb|EDQ66364.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ EED KL  Y+ R+GH +WR LPK AGLSRCGKSCRLRW NY
Sbjct  1    MVRAPCCDKMGLKKGPWTPEEDQKLVDYIQRFGHGSWRALPKHAGLSRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKH-LQTK  442
            L+P IKRG FS +E+++II LH  LGN+WSAIA  LPGR+DNEIKNHW+ HLKK  LQ  
Sbjct  61   LRPDIKRGQFSFEEEQVIIHLHGLLGNRWSAIAAYLPGRTDNEIKNHWNTHLKKRLLQMG  120

Query  443  QDP  451
             DP
Sbjct  121  IDP  123



>gb|AGN52150.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=210

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+   VDKNG +KGAW+EEED KLRAYV R+GH NWR LP  AGL+RCGKSCRLRWMN+
Sbjct  1    MVKRTYVDKNGTRKGAWTEEEDHKLRAYVERFGHSNWRLLPNSAGLNRCGKSCRLRWMNH  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+KRG F+ +E ++I KLH + GNKWSAIA +LPGR+D+EIKN+WHAH K +    +
Sbjct  61   LKPGLKRGGFTQEEKDLIEKLHHQHGNKWSAIAAELPGRTDHEIKNYWHAHHKNYRDQSK  120

Query  446  DPKIIRSEL  472
              K    EL
Sbjct  121  PSKSSDQEL  129



>gb|KHN04301.1| Myb-related protein Zm1 [Glycine soja]
Length=313

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +2

Query  89   VRGPSVD-KNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            +R PS   K+GL KG W+ EED KL AY+ RYG WNWRQLP+FAGL+RCGKSCRLRW+NY
Sbjct  1    MRTPSSSHKSGLNKGTWTPEEDAKLIAYITRYGSWNWRQLPRFAGLARCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG+++ +E+E+II+LH++LGNKWS IA  LPGR+DNEIKNHWH  LKK  
Sbjct  61   LRPNIKRGNYTKEEEEIIIRLHEKLGNKWSVIATHLPGRTDNEIKNHWHTTLKKRF  116



>ref|XP_004982863.1| PREDICTED: myb-related protein Myb4-like [Setaria italica]
Length=284

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GL++GAWS EED +L AY+ ++GH NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKEGLRRGAWSPEEDQRLVAYIRQHGHPNWRALPRQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+FS DE+ +I++LH ELGN+WSAIA +LPGR+DNEIKN WH H+KK L+
Sbjct  61   LRPDIKRGNFSADEEALIVRLHLELGNRWSAIAAQLPGRTDNEIKNVWHTHIKKRLE  117



>ref|XP_009606766.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=236

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  ++ GLKKG W+ EED  L +++ RYGH NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCERMGLKKGPWTAEEDQILISFIQRYGHENWRALPRQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P IKRG+FS +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK
Sbjct  61   LRPDIKRGNFSEEEEETIIKLHQVLGNRWSAIASRLPGRTDNEIKNFWHTHLKK  114



>gb|ABI84253.1| transcription factor Myb1 [Arachis hypogaea]
Length=143

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQILISYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L
Sbjct  61   LRPDIKRGNFTIEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRL  116



>gb|AEV91155.1| R2R3-MYB protein [Aegilops tauschii]
Length=244

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L A++ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDMTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F++DE+E II++H  LGN+WS IA +LPGR+DNEIKN WH HLKK L++  
Sbjct  61   LRPDIKRGNFTSDEEEAIIQVHAMLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLESSS  120

Query  446  DP  451
             P
Sbjct  121  KP  122



>ref|XP_003597078.1| MYB transcription factor [Medicago truncatula]
Length=455

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 9/145 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAG----LSRCGKSCRLR  253
            MVR P  D NGL+KG+W+ EED KL AYV RYG WNWRQLP+FAG    L RCGKSCRLR
Sbjct  1    MVRTP-CDNNGLRKGSWTHEEDKKLIAYVTRYGCWNWRQLPRFAGIRKGLERCGKSCRLR  59

Query  254  WMNYLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLK---  424
            WMNYL+P +KRG+F+  E+E+IIKLH++LGN+W+ IA   PGR+DNEIKNHWH  LK   
Sbjct  60   WMNYLRPDVKRGNFNQQEEELIIKLHEKLGNRWTVIASNFPGRTDNEIKNHWHTTLKKRF  119

Query  425  -KHLQTKQDPKIIRSELKINETTAE  496
             K++++K+  +I +     N  T E
Sbjct  120  VKNIKSKRGTRIAKDSNSNNHPTLE  144



>gb|EMT21544.1| Myb-related protein Myb4 [Aegilops tauschii]
Length=263

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K+GLK+GAWS EED +L  Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKDGLKRGAWSPEEDQRLADYIAQHGHSNWRALPKHAGLLRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L P IKRG+F+ DE++ II+LH+ LGN+WS IA +LPGR+DNEIKN WH+HLKK L+   
Sbjct  61   LSPDIKRGNFTADEEDRIIRLHQALGNRWSVIAAQLPGRTDNEIKNVWHSHLKKRLEDGL  120

Query  446  DP  451
             P
Sbjct  121  KP  122



>dbj|BAG71001.1| myb-related transcription factor [Musa balbisiana]
Length=249

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L AY+ ++GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQVLIAYIQQHGHENWRALPKRAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK ++  Q
Sbjct  61   LRPDIKRGNFTKEEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRVKPNQ  120



>ref|XP_007221832.1| hypothetical protein PRUPE_ppa020190mg [Prunus persica]
 gb|EMJ23031.1| hypothetical protein PRUPE_ppa020190mg [Prunus persica]
Length=264

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +++ +YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTSEEDQILVSFIQKYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK  442
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+ K
Sbjct  61   LRPDIKRGNFTREEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKDK  119



>gb|EMT19219.1| Myb-related protein Myb4 [Aegilops tauschii]
Length=244

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L A++ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDMTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L P IKRG+F++DE+E II+LH  LGN+WS IA +LPGR+DNEIKN WH HLKK L++  
Sbjct  61   LCPDIKRGNFTSDEEEAIIQLHAMLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLESSS  120

Query  446  DP  451
             P
Sbjct  121  KP  122



>gb|EAY78934.1| hypothetical protein OsI_34037 [Oryza sativa Indica Group]
Length=280

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  89   VRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYL  268
             + P  +K GL++GAWS EEDD+L AY+ R+GH NWR LPK AGL RCGKSCRLRW+NYL
Sbjct  6    TKAPFCEKEGLRRGAWSPEEDDRLVAYIRRHGHPNWRALPKQAGLLRCGKSCRLRWINYL  65

Query  269  KPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            +P IKRG+F+ DE+++I++LH  LGN+WSAIA ++PGR+DNEIKN WH HLKK L
Sbjct  66   RPDIKRGNFTADEEDLIVRLHNSLGNRWSAIAAQMPGRTDNEIKNVWHTHLKKRL  120



>ref|XP_010102236.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXB93179.1| Myb-related protein Myb4 [Morus notabilis]
Length=280

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  89   VRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYL  268
            +R P  +K GLKKG W+ EED  L +++ +YGH NWR LPK AGL RCGKSCRLRW+NYL
Sbjct  1    MRTPCCEKMGLKKGPWTPEEDHILISFIQQYGHGNWRALPKQAGLLRCGKSCRLRWINYL  60

Query  269  KPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            +P IKRGSFS DE+E I KLH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK LQ
Sbjct  61   RPDIKRGSFSKDEEETITKLHQLLGNRWSAIAAKLPGRTDNEIKNFWHTHLKKKLQ  116



>ref|XP_010274769.1| PREDICTED: myb-related protein Myb4-like [Nelumbo nucifera]
Length=277

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K G+KKG W+ EED  L  Y+ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGMKKGPWTPEEDQILINYIRQYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTKEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLRQYQ  120



>ref|XP_009383020.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=235

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P   K GLKKG WS EED  L  Y+ R GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCQKVGLKKGPWSPEEDQLLMDYIQRNGHANWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+  E++ II LH+ELGNKWSAIA +LPGR+DNEIKN WH HLKK    ++
Sbjct  61   LRPDIKRGNFTEAEEDAIIGLHRELGNKWSAIAARLPGRTDNEIKNVWHTHLKKRANPEE  120

Query  446  DPKIIRSELKIN-ETTAEYGSSETTQKVKIGEDESSF  553
              +  + ++K N + ++E    E  Q     E+E  F
Sbjct  121  ATQESKRKMKRNAKASSESEQEEDLQPASPKEEEDGF  157



>ref|XP_009766825.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=127

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  83   KMVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMN  262
            KMVR PS+DKNG+KKGAWSEEED+KLRA+V ++GH NW QLPK+AG  RCGKSCRLRWMN
Sbjct  8    KMVRTPSIDKNGMKKGAWSEEEDNKLRAFVEKHGHSNWLQLPKYAGQMRCGKSCRLRWMN  67

Query  263  YLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDN  391
            YL+PG+K+G++S++E+E+IIKLH ELGN+WS IA +LPGRSDN
Sbjct  68   YLRPGLKKGNYSHEEEELIIKLHNELGNRWSVIAEQLPGRSDN  110



>ref|XP_004293474.1| PREDICTED: transcription factor MYB28-like [Fragaria vesca subsp. 
vesca]
Length=266

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  D+ G+KKG W+ EED KL AYV RYG WNWRQLPKFAGLSRCGKSCRLRW+NY
Sbjct  1    MVRTPCCDERGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+++ +E+E+II LH++LGNKWSAIA +L GR+DNE+KNHWH +LKK L   +
Sbjct  61   LRPNIKRGNYTTEEEEIIITLHEKLGNKWSAIAAQLEGRTDNEVKNHWHTNLKKRLMMNK  120



>gb|EMS55339.1| Myb-related protein Myb4 [Triticum urartu]
Length=232

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K+GLK+GAWS EED +L  Y+ R+GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  27   MGRAPCCEKDGLKRGAWSPEEDQRLADYIARHGHPNWRALPKHAGLLRCGKSCRLRWVNY  86

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L P IKRG+F+ DE+++II+LH+ LGN+WS IA +LPGR+DNEIKN WH+HLKK L    
Sbjct  87   LSPDIKRGNFTADEEDLIIRLHQTLGNRWSVIAAQLPGRTDNEIKNVWHSHLKKRLGDGL  146

Query  446  DP  451
             P
Sbjct  147  KP  148



>ref|XP_010069126.1| PREDICTED: myb-related protein Myb4 [Eucalyptus grandis]
Length=275

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 3/144 (2%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ +ED  L +Y+ R GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTPDEDQVLISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+++E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFNSEEEETIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKQNQ  120

Query  446  DPKIIRSELKINETTAEYGSSETT  517
               +  +    N  +    SSE T
Sbjct  121  ---VTPATTTTNNKSFNLDSSEPT  141



>ref|XP_009601374.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
 gb|AAB41101.1| transcription factor Myb1 [Nicotiana tabacum]
 dbj|BAA88223.1| myb-related transcription factor LBM3 [Nicotiana tabacum]
Length=278

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 152/266 (57%), Gaps = 11/266 (4%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W  EED  L +++   GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWIPEEDQILISFIQTNGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E II+LH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L+  +
Sbjct  61   LRPDIKRGNFTKEEEETIIQLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKKLKDYK  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
             P+  +   K    +  + S   T        + +  +   ++      +  S  +SS +
Sbjct  121  PPQNSKRHSK----SKNHDSKGPTTSESSNNSDLTIINT-QKHIDSPVLAPNSPQISSST  175

Query  626  isksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFMSPT  805
               ++ L  +     + +E  +M SS+ F E  + FW D L  D ++S   S    M   
Sbjct  176  EMSTVTLVDDHQMVVIKQE--VMESSEYFPEIDESFWTDELTTDNNWS---STDHVMVAA  230

Query  806  SQVEEEFTLPYSLFGEDDVNFLNNFM  883
            +Q E +  LP+S F E++V+ L   M
Sbjct  231  NQ-ELQVQLPFSSFKEENVDILATKM  255



>ref|XP_010111921.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXC31955.1| Myb-related protein Myb4 [Morus notabilis]
Length=281

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ RYGH NWR LP  AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILISYIQRYGHANWRALPTQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG+FS +E+E I KLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L
Sbjct  61   LRPDIKRGNFSTEEEETIFKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRL  116



>gb|KDP26537.1| hypothetical protein JCGZ_17695 [Jatropha curcas]
 gb|AIT52249.1| MYB family protein [Jatropha curcas]
Length=277

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHILINYIQQYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+F+ DE+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+
Sbjct  61   LRPDIKRGNFTRDEEETIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLK  117



>gb|KHN04302.1| Myb-related protein Myb4 [Glycine soja]
Length=251

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+    DK+G +KG W+ EED KL AY+ RYGHWNW  LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVKNTYSDKSGHRKGTWTPEEDKKLIAYITRYGHWNWNLLPKFAGLERCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P IKRG+++ +EDE IIK+ + LGN+WS IA +LPGR+DNEIKN+WH +LKK
Sbjct  61   LRPNIKRGNYTQEEDETIIKMVQRLGNRWSLIAAQLPGRTDNEIKNYWHTNLKK  114



>ref|XP_002285193.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera]
 emb|CAN63580.1| hypothetical protein VITISV_029015 [Vitis vinifera]
 emb|CBI23645.3| unnamed protein product [Vitis vinifera]
 gb|AHA83524.1| R2R3 MYB15 transcription factor [Vitis vinifera]
Length=253

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 136/229 (59%), Gaps = 28/229 (12%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ +ED  L AYVL++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQILTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E++ II+LH++LGNKWSAIA  LPGR+DNEIKN WH HLKK L+ K 
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHTHLKKRLKKKL  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKI---GEDESSFYDAISRYSQGTssseesscls  616
                 +       +T +  S  ++ K+       + SSF D+ +R  +            
Sbjct  121  ATPDSKGHFTAAASTCDSDSFNSSGKMSPQPSSSEFSSFTDSSTRTME------------  168

Query  617  sisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADAS  763
                        ++TG  V  E +   S++SF E  + FW D L +D S
Sbjct  169  -----------THSTG--VKNEQMEEYSTESFPEIDESFWSDALSSDNS  204



>ref|XP_011028802.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=272

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 140/265 (53%), Gaps = 33/265 (12%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L  ++  YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDRILINHIQLYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL-QTK  442
            L+P IKRG+FS +E++ IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L Q  
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKQNH  120

Query  443  QDPKIIRSELKINETTAEYGSS----ETTQKVKIGEDESSFYDAISRYSQGTssseessc  610
              P+I    + ++    E  +      ++  V  G D+S  +  IS     +  S     
Sbjct  121  VAPEINGRSVDVSRFNHELKTGPEIVSSSNVVAAGCDQSQEHRPISPQQCSSDVSSV---  177

Query  611  lssisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGG  790
                           TT  T       +  S  F E  + FW ++L AD S         
Sbjct  178  ---------------TTVDTSKNLCTKVAESDDFLEMDESFWSEVLSADNS--------S  214

Query  791  FMSPTSQV--EEEFTLPYSLFGEDD  859
             MS  S +  E +   P+S    DD
Sbjct  215  MMSDYSAISTEPQLQFPFSPLMIDD  239



>ref|XP_003539518.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=251

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+    DK+G +KG W+ EED KL AY+ RYGHWNW  LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVKNTYSDKSGHRKGTWTPEEDKKLIAYITRYGHWNWNLLPKFAGLERCGKSCRLRWLNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P IKRG+++ +EDE IIK+ + LGN+WS IA +LPGR+DNEIKN+WH +LKK
Sbjct  61   LRPNIKRGNYTQEEDETIIKMVQRLGNRWSLIAAQLPGRTDNEIKNYWHTNLKK  114



>ref|XP_006487722.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
Length=231

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 9/157 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K G KKG W+ EED  L +++ R+GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCEKMGSKKGPWTPEEDQILISFIQRFGHGNWRALPKQAGLMRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL-QTK  442
            L+P IKRG+FS DE+E I+KLH+ LGN+WS IA +LPGR+DNEIKN+WH+HLKK L Q  
Sbjct  61   LRPDIKRGNFSKDEEETILKLHRVLGNRWSTIAARLPGRTDNEIKNYWHSHLKKRLKQNL  120

Query  443  QDPK--------IIRSELKINETTAEYGSSETTQKVK  529
              PK        +I S+   N T  +   + T Q ++
Sbjct  121  ISPKQQCDIVQALIHSDHNSNATVHKPVCNSTHQGIQ  157



>ref|XP_010660228.1| PREDICTED: myb-related protein Myb4-like [Vitis vinifera]
Length=205

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +  GLKKG+W+ EED  L +++ R+GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRTPCCESMGLKKGSWTPEEDQILVSHIQRHGHGNWRALPKEAGLMRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTK  442
            L+P IKRG+FS +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH+HLKK L+ K
Sbjct  61   LRPDIKRGNFSKEEEETIIKLHQLLGNRWSAIAARLPGRTDNEIKNFWHSHLKKRLKHK  119



>gb|AEW23186.1| MYB73 [Triticum aestivum]
Length=254

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 11/178 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ +ED  L A++ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKLGLKRGPWTAKEDMTLVAHIEKHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+++E+E II+LH  LGN+WS IA +LPGR+DNEIKN WH HLKK L++  
Sbjct  61   LRPDIKRGNFTSEEEEAIIQLHAMLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLESSS  120

Query  446  DP-----------KIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGT  586
             P           K   +   I   T+E  SS   Q + +  ++S    + + YS  +
Sbjct  121  KPSGQAAPKRKAKKPAVAGSAIEGPTSEPASSSPGQSLSMSPEQSLSTSSAADYSMAS  178



>ref|XP_004296369.1| PREDICTED: myb-related protein Myb4-like [Fragaria vesca subsp. 
vesca]
Length=256

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+  YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTTEEDQILISYIQTYGHGNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG+FS +E++ II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L
Sbjct  61   LRPDIKRGNFSREEEDAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRL  116



>ref|XP_004151985.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
Length=245

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+  YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQTLINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+   
Sbjct  61   LRPDIKRGNFTAEEEETIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLRQNY  120

Query  446  DPKIIRSELKINE  484
                +R+   +NE
Sbjct  121  ATPQLRNYPVMNE  133



>ref|NP_001241018.1| uncharacterized protein LOC100807569 [Glycine max]
 dbj|BAA81736.1| GmMYB29B2 [Glycine max]
 gb|ACU21296.1| unknown [Glycine max]
 gb|KHN05063.1| Myb-related protein Myb4 [Glycine soja]
Length=272

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 103/138 (75%), Gaps = 10/138 (7%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWATEEDQILTSYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL----  433
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA KLPGR+DNEIKN WH +LKK L    
Sbjct  61   LRPDIKRGNFTIEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHTNLKKRLLKSD  120

Query  434  QTKQD------PKIIRSE  469
            Q+K        PKI RS+
Sbjct  121  QSKPSSKRATKPKIKRSD  138



>gb|KDO74266.1| hypothetical protein CISIN_1g045387mg, partial [Citrus sinensis]
Length=242

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R PS DKNGLKKG W+ EED KL  Y+ ++GH  WR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRPPSSDKNGLKKGPWTAEEDQKLVDYIQKHGHGRWRTLPKNAGLKRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG FS +E+E II+LHK LGNKWSAIA +LPGR+DNEIKN+W+ H+KK L
Sbjct  61   LRPDIKRGKFSLEEEEAIIQLHKVLGNKWSAIASRLPGRTDNEIKNYWNTHIKKKL  116



>ref|XP_004162391.1| PREDICTED: myb-related protein Myb4-like [Cucumis sativus]
Length=245

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+  YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQTLINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+   
Sbjct  61   LRPDIKRGNFTAEEEETIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLRQNY  120

Query  446  DPKIIRSELKINE  484
                +R+   +NE
Sbjct  121  ATPQLRNYPVMNE  133



>emb|CAA74603.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
Length=273

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLK+G W+ EED  L +++L +GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKP IKRG+F+ +E++ II LH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDYQ  120

Query  446  DPK  454
              K
Sbjct  121  PAK  123



>ref|NP_001170585.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR34121.1| unknown [Zea mays]
 tpg|DAA49620.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04389.1| MYB transcription factor, partial [Zea mays]
Length=272

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GL++GAWS EED +L AYV + GH NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKEGLRRGAWSAEEDQRLVAYVRQNGHPNWRALPRQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+F+ DE+ +I++LH+ELGN+WSAIA +LPGR+DNEIKN WH H+KK L+
Sbjct  61   LRPDIKRGNFTPDEEALIVRLHRELGNRWSAIAAQLPGRTDNEIKNVWHTHIKKRLE  117



>ref|XP_008224356.1| PREDICTED: myb-related protein Myb4-like [Prunus mume]
Length=254

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +++ +YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILVSFIQKYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+F+ +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+
Sbjct  61   LRPDIKRGNFTREEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLK  117



>ref|XP_009785075.1| PREDICTED: transcription factor MYB114-like [Nicotiana sylvestris]
Length=175

 Score =   172 bits (436),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  101  SVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYLKPGI  280
            S +   LKKGAWS EED KLRAY+++YG WNW Q+PKFAGLSR GKSCRLRW+NYL P +
Sbjct  12   STNMEELKKGAWSPEEDKKLRAYIMKYGIWNWSQMPKFAGLSRTGKSCRLRWVNYLSPDV  71

Query  281  KRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQD  448
            KRG FS +E ++++K+++ELGN+WS IA +LPGR+DNE+KN +H HLKKHL  K +
Sbjct  72   KRGPFSMEEVDIVVKMYQELGNRWSTIAARLPGRTDNEVKNFFHTHLKKHLGVKNN  127



>ref|XP_006354484.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=268

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+   GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILISYIQSNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E++ II+LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKNYQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQK  523
             P+  +   K N  +    +S+   K
Sbjct  121  PPQNSKRHSKNNNDSKAPCTSQIALK  146



>ref|XP_009779489.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=236

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  ++ GLKKG W+ EED  L +++ RYGH NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCERMGLKKGPWTAEEDQILISFIQRYGHENWRALPRQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKK  427
            L+P IKRG+FS +E+E I KLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK
Sbjct  61   LRPDIKRGNFSEEEEETITKLHQVLGNRWSAIASRLPGRTDNEIKNFWHTHLKK  114



>ref|XP_004976230.1| PREDICTED: myb-related protein Myb4-like [Setaria italica]
Length=274

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLKKG W+ EED  L A++ R+GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRFGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ-TK  442
            L+P IKRG+FS +E++ II+LH++LGN+WSAIA +LPGR+DNEIKN WH HLKK L+ TK
Sbjct  61   LRPDIKRGNFSKEEEDAIIRLHEQLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLEPTK  120

Query  443  QD  448
            Q+
Sbjct  121  QE  122



>ref|XP_011029827.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=283

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L +YV +YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTPEEDQILISYVQKYGHSNWRALPKQAGLQRCGKSCRLRWVNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+FS +E+E IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HL K L+
Sbjct  61   LRPDIKRGNFSKEEEETIIKLHEVLGNRWSAIASRLPGRTDNEIKNVWHTHLLKRLK  117



>gb|AGN52040.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=210

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MV+   VDKNG +KGAW+EEED K RAYV R+GH NWR LP  AGL+RCGKSCRLRWMN+
Sbjct  1    MVKRTYVDKNGTRKGAWTEEEDHKSRAYVERFGHSNWRLLPNSAGLNRCGKSCRLRWMNH  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKPG+KRG F+ +E ++I KLH + GNKWSAIA +LPGR+D+EIKN+WHAH K +    +
Sbjct  61   LKPGLKRGGFTQEEKDLIEKLHHQHGNKWSAIAAELPGRTDHEIKNYWHAHHKNYRDQSK  120

Query  446  DPKIIRSEL  472
              K    EL
Sbjct  121  PSKSSDQEL  129



>gb|ACB30359.1| myb-related transcription factor [Capsicum annuum]
Length=278

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+   GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILVSYIQANGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E++ II+LH+ LGN+WSAIA +LPGR+D+EIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDDEIKNVWHTHLKKRLKNYQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQK  523
             P+  +   K N  +    +S+ T K
Sbjct  121  APENSKRHCKKNIDSKAPSTSQITLK  146



>gb|KFK40183.1| hypothetical protein AALP_AA3G341200 [Arabis alpina]
Length=284

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLK+G W+ EED  L ++++++GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDQILISFIIKHGHSNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKP IKRG+FS +E++ II LH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LKPDIKRGNFSKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDYQ  120

Query  446  DPK  454
              K
Sbjct  121  PAK  123



>ref|XP_009401945.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=268

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DK GLKKGAWS EED  L  Y+ ++GH NWR +PK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKVGLKKGAWSAEEDKILVDYIQQHGHGNWRVMPKRAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E++ II LH ELGNKWSAIAG LPGR+DNEIKN WH HLKK +  K+
Sbjct  61   LRPDIKRGNFTKEEEDTIISLHGELGNKWSAIAGSLPGRTDNEIKNVWHTHLKKRMDPKE  120



>dbj|BAC07543.1| myb-related transcription factor VlMYBB1-1 [Vitis labrusca x 
Vitis vinifera]
Length=253

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ +ED  L AYVL++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQNLTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAH  418
            L+P IKRG+FS +E++ II+LH++LGNKWSAIA  LPGR+DNEIKN WH H
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHTH  111



>ref|XP_003571882.1| PREDICTED: myb-related protein Myb4-like [Brachypodium distachyon]
Length=252

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DK GL++GAWS +ED  L  Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCDKEGLRRGAWSPDEDQLLADYIAQHGHPNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG+F+ DE++ II+LH  LGN+WSAIA +LPGR+DNEIKN WH HLKK L
Sbjct  61   LRPDIKRGNFTADEEDQIIRLHHSLGNRWSAIAAQLPGRTDNEIKNVWHTHLKKRL  116



>ref|XP_010262320.1| PREDICTED: myb-related protein Myb4 [Nelumbo nucifera]
Length=271

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+ +YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDRILINYIQQYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E+E II+LH++LGN+WS IA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFSKEEEETIIELHEKLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLKQYQ  120



>gb|ADN96004.1| MYB1 [Leymus multicaulis]
Length=245

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L A++ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDMTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+++E++ II+LH  LGN+WS IA +LPGR+DNEIKN WH HLKK L++  
Sbjct  61   LRPDIKRGNFTSEEEDAIIQLHAMLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLESSS  120

Query  446  DP  451
             P
Sbjct  121  KP  122



>ref|XP_009770485.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=274

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 157/275 (57%), Gaps = 16/275 (6%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLK+G WS+EEDD L  Y+ ++GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCEKLGLKRGPWSKEEDDLLINYINKHGHPNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+  IIKLH+ LGN+WS IA +LPGR+DNEIKN WH  LKK +  K 
Sbjct  61   LRPDIKRGNFTPEEENTIIKLHQVLGNRWSGIAARLPGRTDNEIKNIWHTRLKKRVDDKS  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSFYDAISRYSQGTssseessclssis  625
             P+  + ++K ++ T E   SE   + +  E E+S  ++    S  T+S  +    +  S
Sbjct  121  QPQETQ-DIK-DQQTMETSKSEENFETRSSEPENSKDNSEEISSPKTNSQIQEHPNTPSS  178

Query  626  isksldlscNTTGW---TVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGGFM  796
               S D   NTT     ++ +E        +  E  D FW ++L+A     P+E+    +
Sbjct  179  TLSSGDSCSNTTATSASSLADESRDQILLDNLLEVDDNFWSEVLWA-----PAETNDYNV  233

Query  797  S--PTSQVEEEFTLPYSL----FGEDDVNFLNNFM  883
            S    S +EE + L  SL    F +D  +  N  M
Sbjct  234  SDLSLSSLEENYELNSSLNDNWFWDDLFSTANELM  268



>ref|XP_006841861.1| hypothetical protein AMTR_s00003p00271440 [Amborella trichopoda]
 gb|ERN03536.1| hypothetical protein AMTR_s00003p00271440 [Amborella trichopoda]
Length=362

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DKNGLKKG W+ EED KL  Y+ ++GH +WR LPK AGLSRCGKSCRLRW NY
Sbjct  1    MGRAPCCDKNGLKKGPWTPEEDQKLIDYIKKHGHGSWRTLPKSAGLSRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG FS +E+E II+LH  LGNKWSAIA +LPGR+DNEIKN+W+ H++K L
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNTHIRKRL  116



>ref|XP_004247733.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=268

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L +Y+   GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILISYIQSNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E++ II+LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLKNYQ  120

Query  446  DPK  454
             P+
Sbjct  121  PPQ  123



>dbj|BAE54312.1| transcription factor DcMYB1 [Daucus carota]
Length=233

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLKKG WS EED  L +++ + GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWSSEEDQILISFIQQNGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQT  439
            L+P IKRG+FS +E+E II+LH++LGNKW+AIA KLPGR+DNEIKN WH HLKK L+ 
Sbjct  61   LRPDIKRGNFSKEEEETIIELHQKLGNKWAAIAAKLPGRTDNEIKNVWHTHLKKKLKN  118



>ref|XP_008447428.1| PREDICTED: myb-related protein Myb4-like [Cucumis melo]
Length=246

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+  YGH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E II LH+ LGN+WS IA +LPGR+DNEIKN WH HLKK L+ K 
Sbjct  61   LRPDIKRGNFTPEEEETIINLHEMLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLRQKY  120

Query  446  DPKIIRSELKINE  484
                +R+   +NE
Sbjct  121  ATPQLRNYPAMNE  133



>ref|NP_188966.1| myb domain protein 15 [Arabidopsis thaliana]
 dbj|BAA95738.1| myb-related transcription factor [Arabidopsis thaliana]
 gb|AAS58507.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAD44380.1| putative myb-related transcription factor [Arabidopsis thaliana]
 dbj|BAD44456.1| putative myb-related transcription factor [Arabidopsis thaliana]
 gb|ABG48402.1| At3g23250 [Arabidopsis thaliana]
 gb|AEE76740.1| myb domain protein 15 [Arabidopsis thaliana]
Length=285

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLK+G W+ EED  L +++L +GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKP IKRG+F+ +E++ II LH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDYQ  120

Query  446  DPK  454
              K
Sbjct  121  PAK  123



>gb|AGN52093.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52203.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=234

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 111/163 (68%), Gaps = 8/163 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  DK GLKKG W+ EED  L  ++ + GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MVRAPCCDKTGLKKGLWTAEEDQILINFITQNGHPNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P I+RG+F+  E++ II+LH +LGNKWS IA +L GR+DNEIKN WH +LKK +  K 
Sbjct  61   LRPDIRRGNFTKQEEDSIIQLHAQLGNKWSVIASRLSGRTDNEIKNVWHTYLKKRVARKY  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKI---GEDESSFYDAI  565
             P+    ++K  E   EY S++  Q+V++   GE  S    AI
Sbjct  121  QPQ---PQIKTGEV--EYSSNQYCQQVELSMPGESLSEVSSAI  158



>ref|XP_008438526.1| PREDICTED: myb-related protein Myb4-like [Cucumis melo]
Length=267

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED+ L +Y+ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKLGLKKGPWTAEEDEILISYINKHGHSNWRALPKLAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E E+++ LH++LGN+WSAIA +LPGR+DNEIKN WH HLKK +  KQ
Sbjct  61   LRPDIKRGNFTLEEQEIVLHLHEKLGNRWSAIAAQLPGRTDNEIKNFWHTHLKKRVSNKQ  120



>gb|ABH02919.1| MYB transcription factor MYB117 [Glycine max]
Length=237

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +2

Query  119  LKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNYLKPGIKRGSFS  298
            ++KG W+ EED KL AYV RYG WNWRQLP+FAGL+RCGKSCRLRW+ YL+P +KRG+F+
Sbjct  1    MRKGTWTLEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWIEYLRPDVKRGNFT  60

Query  299  NDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ----TKQDPKIIRS  466
              E+E II++HK+LGN+WS IA +LPGR+DNEIKNHWH  LKK  Q    TK++ +  +S
Sbjct  61   QQEEEFIIRMHKKLGNRWSTIAAELPGRTDNEIKNHWHTTLKKRSQQNTLTKEEARASKS  120

Query  467  ELKI  478
            + K+
Sbjct  121  KDKV  124



>ref|XP_010512224.1| PREDICTED: myb-related protein Myb4-like [Camelina sativa]
Length=288

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLK+G W+ EED  L ++++++GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDQILISFIIKHGHSNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKP IKRG+F+ +E++ II LH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDYQ  120

Query  446  --DPKIIRSELKINETTAE  496
               PK   ++ K+ +  +E
Sbjct  121  PAKPKTTSNKKKVTKPKSE  139



>ref|XP_007030431.1| Myb domain protein 15, putative [Theobroma cacao]
 gb|EOY10933.1| Myb domain protein 15, putative [Theobroma cacao]
Length=232

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K G+KKG W+ EED  L +Y+ R+GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MARAPCCEKMGMKKGPWTPEEDRILISYIQRHGHGNWRALPKQAGLPRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+F+++E E I KLH+ LGN+WSAIA +LPGR+DNEIKN+WH HLKK L+
Sbjct  61   LRPDIKRGNFTSEEQETIFKLHQVLGNRWSAIAARLPGRTDNEIKNYWHGHLKKKLK  117



>ref|XP_002883414.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59673.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata]
Length=285

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLK+G W+ EED  L +++L++GH NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDQILVSFILKHGHSNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            LKP IKRG+F+ +E++ II LH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLKDYQ  120

Query  446  DPK  454
              K
Sbjct  121  PAK  123



>ref|XP_008441942.1| PREDICTED: transcription factor MYB86-like [Cucumis melo]
Length=390

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  35   LIYIHKIIP--KKKRGEIKMVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLP  208
            LI I +++   +K+     M R P  DKNGLKKG W+ EED KL  Y+ + GH NWR LP
Sbjct  35   LIQIFRLLVNLRKRTVSFSMGRTPCCDKNGLKKGPWTPEEDQKLIDYIQKNGHGNWRTLP  94

Query  209  KFAGLSRCGKSCRLRWMNYLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSD  388
            K AGL RCGKSCRLRW NYL+P IKRG FS +E+E II+LH  LGNKWSAIA +LPGR+D
Sbjct  95   KNAGLQRCGKSCRLRWTNYLRPDIKRGRFSFEEEETIIQLHSVLGNKWSAIATRLPGRTD  154

Query  389  NEIKNHWHAHLKKHL  433
            NEIKN+W+ H++K L
Sbjct  155  NEIKNYWNTHIRKRL  169



>ref|XP_006283783.1| hypothetical protein CARUB_v10004873mg [Capsella rubella]
 gb|EOA16681.1| hypothetical protein CARUB_v10004873mg [Capsella rubella]
Length=426

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  53   IIPKKKRGEIKMVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRC  232
            + P K+   I M R P  +KNGLKKG W+ EED KL  Y+ ++G+ NWR LPK AGL RC
Sbjct  60   LFPYKQSSSISMARSPCCEKNGLKKGPWTSEEDQKLVDYIQKHGYGNWRTLPKNAGLQRC  119

Query  233  GKSCRLRWMNYLKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWH  412
            GKSCRLRW NYL+P IKRG FS +E+E II+LH  LGNKWSAIA +LPGR+DNEIKN W+
Sbjct  120  GKSCRLRWTNYLRPDIKRGRFSFEEEETIIQLHSFLGNKWSAIAARLPGRTDNEIKNFWN  179

Query  413  AHLKKHL  433
             H++K L
Sbjct  180  THIRKKL  186



>ref|XP_010087464.1| Transcription factor [Morus notabilis]
 gb|EXB29145.1| Transcription factor [Morus notabilis]
Length=400

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R PS D+NGLKKG W+ EED KL  Y+ R GH +WR LPK AGL+RCGKSCRLRW NY
Sbjct  1    MGRSPSSDENGLKKGPWTPEEDQKLVDYIRRNGHGSWRALPKLAGLNRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKH-LQTK  442
            L+P IKRG F+ DE+++II LH  LGNKWS IAG LPGR+DNEIKN W+ HLKK  LQ  
Sbjct  61   LRPDIKRGKFTEDEEKLIINLHAVLGNKWSTIAGHLPGRTDNEIKNFWNTHLKKKLLQMG  120

Query  443  QDPKIIRSELKIN  481
             DP   R    +N
Sbjct  121  IDPVTHRPRTDLN  133



>ref|XP_002302045.1| GmMYB29 family protein [Populus trichocarpa]
 gb|EEE81318.1| GmMYB29 family protein [Populus trichocarpa]
Length=272

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 139/259 (54%), Gaps = 33/259 (13%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L  ++  YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDRILINHIQLYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL-QTK  442
            L+P IKRG+FS +E++ IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L Q  
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLEQNH  120

Query  443  QDPKIIRSELKINETTAEYGSS----ETTQKVKIGEDESSFYDAISRYSQGTssseessc  610
              P+I    + ++    E  +      ++  V  G D+S  +  IS     +  S     
Sbjct  121  FAPEINGRSVDVSRFNHELKTGPEIVSSSNVVAAGCDQSKEHRPISPQQCSSDVSSV---  177

Query  611  lssisisksldlscNTTGWTVPEEGVMMTSSQSFGETFDCFWDDLLFADASFSPSESEGG  790
                           TT  T  +    +  S  F E  + FW ++L AD S         
Sbjct  178  ---------------TTVDTSNDMCTKVAESDDFLEMDEIFWSEVLSADNS--------S  214

Query  791  FMSPTSQV--EEEFTLPYS  841
             MS  S +  E +   P+S
Sbjct  215  MMSDYSAISTEPQLQFPFS  233



>gb|KDP40332.1| hypothetical protein JCGZ_02330 [Jatropha curcas]
 gb|AIT52248.1| MYB family protein [Jatropha curcas]
Length=254

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K GLKKG W+ EED  L +++ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTSEEDKILISHIQKHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+ +E+E IIKLH  LGN+WSAIA KLPGR+DNEIKN WH HLKK L+ K 
Sbjct  61   LRPDIKRGNFTLEEEETIIKLHATLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLKQKN  120

Query  446  D  448
            D
Sbjct  121  D  121



>ref|XP_009629473.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=377

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  DKNGLKKG W+ EED KL  Y+ +YG+ NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKNGLKKGPWTPEEDQKLIDYIQKYGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL  433
            L+P IKRG FS +E+E II+LH  LGNKWSAIA +LPGR+DNEIKN+W+ H++K L
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSVLGNKWSAIAARLPGRTDNEIKNYWNTHIRKRL  116



>gb|AGN52057.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52167.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=245

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG WS EED  L +Y+ ++GH NWR LPK +GL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWSPEEDQILVSYIQKHGHGNWRALPKQSGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHL----  433
            L+P IKRG+F+ +E+E II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L    
Sbjct  61   LRPDIKRGNFTKEEEEAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKKLKHYD  120

Query  434  QTKQDPK  454
            ++ QD K
Sbjct  121  ESSQDSK  127



>ref|XP_002306849.2| hypothetical protein POPTR_0005s24550g [Populus trichocarpa]
 gb|EEE93845.2| hypothetical protein POPTR_0005s24550g [Populus trichocarpa]
Length=273

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 141/262 (54%), Gaps = 27/262 (10%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+  +GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQILINYIQLHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+FS +E++ IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+   
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLEKNH  120

Query  446  -DPKIIRSELKINETTAEYGSSE---TTQKVKIGEDESSFYDAISRYSQGTssseesscl  613
              P+I    + I+    E  + +    +  +  G D++  +  IS     + +S      
Sbjct  121  VTPEIKGRSVDISRFDHELNTDQELLDSSNLAAGSDQTEEHRPISPQQCSSDTSSLI---  177

Query  614  ssisisksldlscNTTGWTVPEEGVM-MTSSQSFGETFDCFWDDLLFADAS-----FSPS  775
                          T    +     M + SS  F E  + FW ++L AD S     FS  
Sbjct  178  --------------TGDIDISNNMCMKIESSDDFPEMDESFWSEVLSADNSRIVSDFSAI  223

Query  776  ESEGGFMSPTSQVEEEFTLPYS  841
             +E     P S +  E    Y+
Sbjct  224  GTEPQLQFPFSPLVIEVEQVYA  245



>gb|ADI24681.1| Myb3 [Leymus racemosus]
Length=245

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLK+G W+ EED  L A++ ++GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDMTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+++E++ II+LH  LGN+WS IA +LPGR+DNEIKN WH HLKK L +  
Sbjct  61   LRPDIKRGNFTSEEEDAIIQLHAMLGNRWSTIAARLPGRTDNEIKNVWHTHLKKRLDSSS  120

Query  446  DP  451
             P
Sbjct  121  KP  122



>ref|XP_011025983.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=272

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG W+ EED  L  Y+  +GH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQILINYIQLHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQ  436
            L+P IKRG+FS +E++ IIKLH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLK  117



>ref|XP_010469752.1| PREDICTED: myb-related protein Myb4-like [Camelina sativa]
Length=254

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 105/156 (67%), Gaps = 8/156 (5%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            M R P  +K G+K+G W+ EED  L  Y+  YGH NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGMKRGPWTPEEDQILINYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+  E+E II LH+ LGN+WSAIA KLPGR+DNEIKN WH HLKK +  KQ
Sbjct  61   LRPDIKRGNFTPQEEETIINLHESLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRVNKKQ  120

Query  446  DPKIIRSELKINETTAEYGSSETTQKVKIGEDESSF  553
            +           +T    G +ET+Q  K  ED+ S 
Sbjct  121  NNG--------GDTKDINGINETSQTTKHDEDKESM  148



>ref|XP_011091315.1| PREDICTED: myb-related protein Myb4-like [Sesamum indicum]
Length=251

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  86   MVRGPSVDKNGLKKGAWSEEEDDKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  265
            MVR P  +K GLKKG WS EED  L +Y+ ++GH NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWSPEEDQILVSYIQQHGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  266  LKPGIKRGSFSNDEDEMIIKLHKELGNKWSAIAGKLPGRSDNEIKNHWHAHLKKHLQTKQ  445
            L+P IKRG+F+  E++ II LH+ LGN+WSAIA +LPGR+DNEIKN WH HLKK L+  Q
Sbjct  61   LRPDIKRGNFTKQEEDTIITLHQCLGNRWSAIAARLPGRTDNEIKNVWHTHLKKKLKNDQ  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2181636186120