BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33828_g1_i1 len=1819 path=[1797:0-1818]

Length=1819
                                                                      Score     E

ref|XP_009616320.1|  PREDICTED: beta-galactosidase 15-like              768   0.0      
ref|XP_009801177.1|  PREDICTED: beta-galactosidase 15-like              759   0.0      
gb|EYU39588.1|  hypothetical protein MIMGU_mgv1a001416mg                752   0.0      
ref|XP_009620959.1|  PREDICTED: beta-galactosidase 15-like              751   0.0      
gb|EYU25828.1|  hypothetical protein MIMGU_mgv1a026608mg                746   0.0      
ref|XP_009790181.1|  PREDICTED: beta-galactosidase 15-like              743   0.0      
emb|CDP03052.1|  unnamed protein product                                741   0.0      
ref|XP_011076997.1|  PREDICTED: beta-galactosidase 15-like              723   0.0      
ref|XP_004243920.1|  PREDICTED: beta-galactosidase 15-like              720   0.0      
ref|XP_006367886.1|  PREDICTED: beta-galactosidase 15-like              719   0.0      
ref|XP_008337885.1|  PREDICTED: beta-galactosidase 15-like              716   0.0      
ref|XP_010518958.1|  PREDICTED: beta-galactosidase 15-like              714   0.0      
ref|XP_002276918.2|  PREDICTED: beta-galactosidase 15                   713   0.0      Vitis vinifera
emb|CAJ09953.1|  beta-galactosidase                                     712   0.0      Mangifera indica
ref|XP_009359758.1|  PREDICTED: beta-galactosidase 15                   711   0.0      
ref|XP_010999621.1|  PREDICTED: beta-galactosidase 15-like              709   0.0      
gb|KGN66324.1|  hypothetical protein Csa_1G597710                       707   0.0      
ref|XP_004144130.1|  PREDICTED: beta-galactosidase 15-like              709   0.0      
ref|XP_011000544.1|  PREDICTED: beta-galactosidase 15-like              707   0.0      
ref|XP_002516256.1|  beta-galactosidase, putative                       707   0.0      Ricinus communis
ref|XP_002516237.1|  beta-galactosidase, putative                       706   0.0      Ricinus communis
ref|XP_004171681.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    705   0.0      
ref|XP_010050435.1|  PREDICTED: beta-galactosidase 15-like              705   0.0      
gb|KHN17741.1|  Beta-galactosidase 7                                    702   0.0      
ref|XP_006601406.1|  PREDICTED: beta-galactosidase 7-like               702   0.0      
ref|XP_008450952.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    701   0.0      
ref|XP_011000543.1|  PREDICTED: beta-galactosidase 7-like               696   0.0      
ref|XP_007204034.1|  hypothetical protein PRUPE_ppa020752mg             694   0.0      
ref|XP_006475097.1|  PREDICTED: beta-galactosidase 7-like               694   0.0      
ref|XP_002297749.2|  hypothetical protein POPTR_0001s06310g             692   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY65885.1|  BnaCnng48970D                                          683   0.0      
ref|XP_006452850.1|  hypothetical protein CICLE_v10010454mg             683   0.0      
ref|XP_006368617.1|  hypothetical protein POPTR_0001s06300g             678   0.0      
ref|XP_010540711.1|  PREDICTED: beta-galactosidase 15                   679   0.0      
ref|XP_004288998.1|  PREDICTED: beta-galactosidase-like                 677   0.0      
ref|XP_003541315.2|  PREDICTED: beta-galactosidase-like                 675   0.0      
emb|CDX79397.1|  BnaC06g19060D                                          663   0.0      
emb|CDX79398.1|  BnaC06g19050D                                          667   0.0      
gb|KFK44946.1|  hypothetical protein AALP_AA1G323300                    670   0.0      
ref|XP_007022965.1|  Beta-galactosidase 7                               670   0.0      
ref|XP_009119501.1|  PREDICTED: beta-galactosidase 15-like              664   0.0      
emb|CDY69031.1|  BnaCnng61490D                                          661   0.0      
ref|XP_010245925.1|  PREDICTED: beta-galactosidase 15-like              667   0.0      
gb|KDP33944.1|  hypothetical protein JCGZ_07515                         667   0.0      
gb|EPS73924.1|  hypothetical protein M569_00825                         666   0.0      
ref|XP_010245924.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    664   0.0      
emb|CDX67790.1|  BnaA07g18300D                                          664   0.0      
ref|XP_010535801.1|  PREDICTED: beta-galactosidase 7                    664   0.0      
ref|XP_009120777.1|  PREDICTED: beta-galactosidase                      664   0.0      
ref|XP_006306017.1|  hypothetical protein CARUB_v10011312mg             663   0.0      
sp|P49676.1|BGAL_BRAOL  RecName: Full=Beta-galactosidase; Short=L...    664   0.0      Brassica oleracea
gb|KHN07882.1|  Beta-galactosidase 7                                    658   0.0      
ref|XP_004288329.1|  PREDICTED: beta-galactosidase 15-like              660   0.0      
ref|XP_006290000.1|  hypothetical protein CARUB_v10003630mg             660   0.0      
ref|XP_010541689.1|  PREDICTED: beta-galactosidase 7-like isoform X1    659   0.0      
gb|KFK26294.1|  hypothetical protein AALP_AA8G229300                    659   0.0      
ref|XP_010499714.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    658   0.0      
emb|CDX93659.1|  BnaA06g03890D                                          657   0.0      
emb|CDY36652.1|  BnaA07g04050D                                          650   0.0      
gb|AAK76465.1|  putative beta-galactosidase                             649   0.0      
ref|XP_006400640.1|  hypothetical protein EUTSA_v10012695mg             655   0.0      
ref|XP_003595331.1|  Beta-galactosidase                                 655   0.0      
ref|XP_007012588.1|  Beta-galactosidase 7                               654   0.0      
gb|KCW79363.1|  hypothetical protein EUGRSUZ_C00782                     653   0.0      
emb|CAB64743.1|  putative beta-galactosidase                            650   0.0      
ref|NP_568399.4|  beta-galactosidase 7                                  650   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDO73841.1|  hypothetical protein CISIN_1g036343mg                   649   0.0      
emb|CDY32304.1|  BnaC05g28820D                                          651   0.0      
ref|XP_004288999.1|  PREDICTED: beta-galactosidase 15-like              646   0.0      
ref|XP_002871955.1|  beta-galactosidase 7                               640   0.0      
ref|XP_010478588.1|  PREDICTED: beta-galactosidase 15-like              624   0.0      
emb|CDY34975.1|  BnaA01g27590D                                          617   0.0      
ref|XP_010688541.1|  PREDICTED: beta-galactosidase 15-like              615   0.0      
emb|CDY53917.1|  BnaA07g38250D                                          620   0.0      
emb|CDY28339.1|  BnaC01g35090D                                          611   0.0      
ref|XP_007138632.1|  hypothetical protein PHAVU_009G2251001g            596   0.0      
ref|XP_002284027.2|  PREDICTED: beta-galactosidase 15-like              604   0.0      Vitis vinifera
ref|XP_002893682.1|  Beta-galactosidase 15 precursor                    602   0.0      
gb|EYU41564.1|  hypothetical protein MIMGU_mgv1a001413mg                601   0.0      
gb|KDP33931.1|  hypothetical protein JCGZ_07502                         600   0.0      
sp|Q9C6W4.1|BGA15_ARATH  RecName: Full=Beta-galactosidase 15; Sho...    597   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBI30211.3|  unnamed protein product                                596   0.0      
ref|XP_010050189.1|  PREDICTED: beta-galactosidase 15-like              596   0.0      
gb|KCW89294.1|  hypothetical protein EUGRSUZ_A01583                     595   0.0      
ref|XP_006843913.1|  hypothetical protein AMTR_s00007p00269020          593   0.0      
ref|XP_006583477.1|  PREDICTED: beta-galactosidase-like                 590   0.0      
ref|XP_003530083.1|  PREDICTED: beta-galactosidase-like                 590   0.0      
ref|XP_011094447.1|  PREDICTED: beta-galactosidase 15-like              583   0.0      
ref|XP_003519946.2|  PREDICTED: beta-galactosidase-like                 580   0.0      
ref|XP_003519945.2|  PREDICTED: beta-galactosidase-like                 580   0.0      
gb|KHN00663.1|  Beta-galactosidase                                      579   0.0      
gb|KHN00665.1|  Beta-galactosidase                                      580   0.0      
ref|XP_008811996.1|  PREDICTED: beta-galactosidase 1-like               572   0.0      
ref|NP_683341.1|  beta-galactosidase 15                                 568   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273985.1|  PREDICTED: beta-galactosidase 15-like              569   0.0      
ref|XP_006415308.1|  hypothetical protein EUTSA_v10006871mg             566   0.0      
ref|XP_009390322.1|  PREDICTED: beta-galactosidase-like                 563   0.0      
gb|KHG01468.1|  Beta-galactosidase                                      561   0.0      
ref|XP_011039947.1|  PREDICTED: beta-galactosidase-like                 562   0.0      
ref|XP_003533125.1|  PREDICTED: beta-galactosidase-like                 563   0.0      
emb|CAN82062.1|  hypothetical protein VITISV_016430                     560   0.0      Vitis vinifera
ref|XP_007040803.1|  Beta-galactosidase 7                               572   0.0      
gb|KHN27597.1|  Beta-galactosidase                                      561   0.0      
gb|KHN25095.1|  Beta-galactosidase                                      557   0.0      
ref|XP_006381590.1|  hypothetical protein POPTR_0006s14130g             555   0.0      
ref|XP_009398904.1|  PREDICTED: beta-galactosidase 1-like               547   0.0      
ref|XP_008242326.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    548   0.0      
emb|CDX92439.1|  BnaA10g14780D                                          549   0.0      
ref|XP_009400603.1|  PREDICTED: beta-galactosidase 13-like              547   0.0      
ref|XP_008811417.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    547   0.0      
ref|XP_010558976.1|  PREDICTED: beta-galactosidase 15-like              546   0.0      
ref|XP_008437707.1|  PREDICTED: beta-galactosidase 7-like               543   0.0      
ref|XP_008437703.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    543   4e-180   
ref|XP_002324727.2|  hypothetical protein POPTR_0018s07470g             542   2e-179   Populus trichocarpa [western balsam poplar]
gb|KGN66624.1|  hypothetical protein Csa_1G650110                       541   2e-179   
ref|XP_009400604.1|  PREDICTED: beta-galactosidase 1-like               540   3e-179   
gb|KHN04556.1|  Beta-galactosidase                                      537   1e-178   
ref|XP_003547766.1|  PREDICTED: beta-galactosidase 7-like               538   3e-178   
ref|XP_011006177.1|  PREDICTED: beta-galactosidase 7-like               538   6e-178   
ref|XP_002516236.1|  beta-galactosidase, putative                       535   1e-177   Ricinus communis
ref|XP_008444022.1|  PREDICTED: beta-galactosidase-like                 535   8e-177   
gb|KGN66613.1|  hypothetical protein Csa_1G643050                       531   5e-176   
ref|XP_004154711.1|  PREDICTED: beta-galactosidase 7-like               530   2e-175   
ref|XP_006452854.1|  hypothetical protein CICLE_v10010771mg             530   3e-175   
ref|XP_008452141.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    529   7e-175   
ref|XP_008464891.1|  PREDICTED: beta-galactosidase-like                 527   7e-174   
ref|XP_008451143.1|  PREDICTED: beta-galactosidase 15-like              530   1e-173   
gb|KGN56996.1|  hypothetical protein Csa_3G147790                       522   5e-173   
ref|XP_006475096.1|  PREDICTED: beta-galactosidase 7-like               524   1e-172   
ref|XP_006452851.1|  hypothetical protein CICLE_v10010541mg             524   1e-172   
ref|XP_004170120.1|  PREDICTED: beta-galactosidase 7-like               520   1e-172   
ref|XP_004134448.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    522   2e-172   
ref|XP_008459141.1|  PREDICTED: beta-galactosidase 15-like              522   4e-172   
gb|KDO73840.1|  hypothetical protein CISIN_1g046585mg                   520   2e-171   
ref|XP_008439370.1|  PREDICTED: beta-galactosidase 7-like               519   8e-171   
ref|XP_004157296.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    518   2e-170   
ref|XP_004139151.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    517   2e-170   
ref|XP_004135782.1|  PREDICTED: beta-galactosidase 7-like               517   5e-170   
ref|XP_004171705.1|  PREDICTED: beta-galactosidase 7-like               516   2e-169   
ref|XP_008447673.1|  PREDICTED: beta-galactosidase 15-like              513   1e-168   
ref|XP_002528629.1|  beta-galactosidase, putative                       511   1e-167   Ricinus communis
ref|XP_003612351.1|  Beta-galactosidase                                 508   6e-167   
ref|XP_006475095.1|  PREDICTED: beta-galactosidase-like                 506   2e-165   
ref|XP_003572734.1|  PREDICTED: beta-galactosidase 1-like               505   2e-165   
ref|XP_009775909.1|  PREDICTED: beta-galactosidase 7-like               499   5e-164   
gb|KGN58141.1|  hypothetical protein Csa_3G550690                       498   6e-163   
ref|XP_008462666.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    495   1e-161   
emb|CDP15330.1|  unnamed protein product                                495   2e-161   
ref|XP_003612510.1|  Beta-galactosidase                                 493   2e-160   
gb|AES95468.2|  beta-galactosidase-like protein                         493   2e-160   
gb|EAZ01758.1|  hypothetical protein OsI_23787                          492   2e-160   Oryza sativa Indica Group [Indian rice]
gb|KDP29228.1|  hypothetical protein JCGZ_16617                         491   1e-159   
ref|XP_003566745.1|  PREDICTED: beta-galactosidase 13-like              488   1e-158   
ref|NP_001043252.1|  Os01g0533400                                       485   1e-157   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66762.1|  hypothetical protein OsI_33138                          483   7e-157   Oryza sativa Indica Group [Indian rice]
gb|EEE50782.1|  hypothetical protein OsJ_31141                          483   7e-157   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064366.1|  Os10g0330600                                       481   5e-156   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66744.1|  hypothetical protein OsI_33101                          481   6e-156   Oryza sativa Indica Group [Indian rice]
gb|ABU49386.1|  beta-galactosidase 15                                   481   6e-156   Oryza sativa Indica Group [Indian rice]
ref|XP_006432580.1|  hypothetical protein CICLE_v10001020mg             469   7e-156   
gb|EAZ15685.1|  hypothetical protein OsJ_31098                          480   9e-156   Oryza sativa Japonica Group [Japonica rice]
gb|AAL31090.1|AC091749_19  putative beta-galactosidase                  480   1e-155   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168270.1|  beta-galactosidase precursor                       478   4e-155   Zea mays [maize]
ref|XP_002457961.1|  hypothetical protein SORBIDRAFT_03g023500          478   9e-155   Sorghum bicolor [broomcorn]
gb|KDP29226.1|  hypothetical protein JCGZ_16615                         476   7e-154   
gb|KDO40457.1|  hypothetical protein CISIN_1g0453542mg                  468   8e-154   
dbj|BAK07511.1|  predicted protein                                      471   3e-152   
gb|ABK24373.1|  unknown                                                 468   2e-150   Picea sitchensis
gb|EEC70819.1|  hypothetical protein OsI_02284                          464   2e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_008791518.1|  PREDICTED: beta-galactosidase 6 isoform X2         462   4e-149   
ref|XP_006645968.1|  PREDICTED: beta-galactosidase 1-like               460   8e-149   
ref|XP_008791517.1|  PREDICTED: beta-galactosidase 6 isoform X1         462   1e-148   
ref|XP_002285084.2|  PREDICTED: beta-galactosidase 8                    461   6e-148   Vitis vinifera
gb|ABF95029.1|  Beta-galactosidase precursor, putative, expressed       456   6e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    459   2e-147   
sp|Q7XFK2.1|BGA14_ORYSJ  RecName: Full=Beta-galactosidase 14; Sho...    458   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003598040.1|  Beta-galactosidase                                 457   4e-147   
gb|AES68291.2|  beta-galactosidase                                      457   8e-147   
ref|XP_010910537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    456   4e-146   
gb|ABF95028.1|  Beta-galactosidase precursor, putative, expressed       454   6e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649762.1|  PREDICTED: beta-galactosidase 6-like               453   1e-145   
gb|EAZ24672.1|  hypothetical protein OsJ_08441                          454   2e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006340153.1|  PREDICTED: beta-galactosidase 8-like               454   3e-145   
sp|Q10NX8.2|BGAL6_ORYSJ  RecName: Full=Beta-galactosidase 6; Shor...    454   3e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               454   3e-145   
gb|KDP44070.1|  hypothetical protein JCGZ_05537                         452   6e-145   
ref|XP_011089316.1|  PREDICTED: beta-galactosidase 8-like               452   8e-145   
ref|NP_001049591.1|  Os03g0255100                                       456   9e-145   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89299.1|  hypothetical protein OsI_10800                          452   2e-144   Oryza sativa Indica Group [Indian rice]
ref|XP_009766589.1|  PREDICTED: beta-galactosidase 8                    452   2e-144   
ref|XP_009595284.1|  PREDICTED: beta-galactosidase 8                    451   3e-144   
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     451   4e-144   
dbj|BAJ89450.1|  predicted protein                                      446   2e-143   
ref|XP_009398434.1|  PREDICTED: beta-galactosidase 8-like               448   3e-143   
ref|XP_010313192.1|  PREDICTED: TBG5 protein isoform X1                 448   6e-143   
ref|XP_010228859.1|  PREDICTED: beta-galactosidase 6                    447   1e-142   
ref|NP_001234312.1|  TBG5 protein precursor                             447   1e-142   
ref|XP_008463829.1|  PREDICTED: beta-galactosidase 8                    446   2e-142   
ref|XP_004169598.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    446   3e-142   
ref|XP_004148770.1|  PREDICTED: beta-galactosidase 8-like               446   3e-142   
ref|XP_006853356.1|  hypothetical protein AMTR_s00032p00109160          445   4e-142   
sp|Q67VU7.1|BGA10_ORYSJ  RecName: Full=Putative beta-galactosidas...    444   5e-142   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009338266.1|  PREDICTED: beta-galactosidase 8-like isoform X2    439   1e-141   
ref|XP_002530296.1|  beta-galactosidase, putative                       443   3e-141   Ricinus communis
dbj|BAJ95568.1|  predicted protein                                      442   7e-141   
ref|XP_011044378.1|  PREDICTED: beta-galactosidase 8                    441   2e-140   
gb|KDO73224.1|  hypothetical protein CISIN_1g003095mg                   438   2e-140   
ref|XP_010232635.1|  PREDICTED: beta-galactosidase 3                    441   3e-140   
gb|ACR35639.1|  unknown                                                 434   9e-140   Zea mays [maize]
ref|XP_010521771.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    439   2e-139   
ref|XP_009338265.1|  PREDICTED: beta-galactosidase 8-like isoform X1    438   3e-139   
ref|XP_007132236.1|  hypothetical protein PHAVU_011G077600g             437   4e-139   
ref|XP_011089891.1|  PREDICTED: beta-galactosidase 8-like isoform X1    438   4e-139   
ref|XP_008358406.1|  PREDICTED: beta-galactosidase 8-like               437   6e-139   
gb|EAZ37702.1|  hypothetical protein OsJ_22044                          436   7e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006854486.1|  hypothetical protein AMTR_s00175p00032740          437   1e-138   
gb|KDO73220.1|  hypothetical protein CISIN_1g003095mg                   436   2e-138   
ref|XP_010470077.1|  PREDICTED: beta-galactosidase 8-like               436   2e-138   
gb|EYU18852.1|  hypothetical protein MIMGU_mgv1a001263mg                436   2e-138   
dbj|BAD20774.2|  beta-galactosidase                                     435   4e-138   Raphanus sativus
emb|CAC44501.1|  beta-galactosidase                                     435   4e-138   Fragaria x ananassa
ref|XP_007137754.1|  hypothetical protein PHAVU_009G153100g             434   6e-138   
ref|XP_006424599.1|  hypothetical protein CICLE_v10027805mg             434   9e-138   
gb|AHC32021.1|  beta-galactosidase 3                                    435   1e-137   
ref|XP_009335064.1|  PREDICTED: beta-galactosidase 8-like isoform X2    429   1e-137   
ref|XP_006581786.1|  PREDICTED: beta-galactosidase 10-like              433   2e-137   
ref|XP_002465536.1|  hypothetical protein SORBIDRAFT_01g040750          434   2e-137   Sorghum bicolor [broomcorn]
ref|XP_006296187.1|  hypothetical protein CARUB_v10025350mg             433   2e-137   
tpg|DAA44443.1|  TPA: hypothetical protein ZEAMMB73_968467              432   2e-137   
ref|NP_001146370.1|  beta-galactosidase precursor                       433   3e-137   Zea mays [maize]
gb|EYU18851.1|  hypothetical protein MIMGU_mgv1a001293mg                432   4e-137   
ref|XP_010414520.1|  PREDICTED: beta-galactosidase 8                    431   4e-137   
gb|AAQ21371.2|  beta-galactosidase                                      431   5e-137   Sandersonia aurantiaca [Chinese-lantern lily]
gb|EMT04926.1|  Beta-galactosidase 1                                    431   6e-137   
ref|XP_003523206.1|  PREDICTED: beta-galactosidase 10                   432   6e-137   
ref|XP_004487127.1|  PREDICTED: beta-galactosidase 8-like               431   7e-137   
ref|NP_001189624.1|  beta-galactosidase 8                               432   7e-137   
emb|CDP07127.1|  unnamed protein product                                432   8e-137   
gb|KHN31190.1|  Beta-galactosidase 10                                   432   8e-137   
ref|XP_002879094.1|  beta-glactosidase 8                                431   9e-137   
gb|AAD21482.1|  putative beta-galactosidase                             431   9e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CAB64744.1|  putative beta-galactosidase                            431   1e-136   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850121.1|  beta-galactosidase 8                                  431   1e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010032010.1|  PREDICTED: beta-galactosidase 8                    431   1e-136   
ref|XP_010674348.1|  PREDICTED: beta-galactosidase 10                   431   1e-136   
emb|CDY04567.1|  BnaA07g13930D                                          430   3e-136   
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like               430   3e-136   
ref|XP_003632537.1|  PREDICTED: beta-galactosidase 10                   430   3e-136   
emb|CDX98326.1|  BnaC06g16870D                                          418   4e-136   
ref|NP_001289207.1|  beta-galactosidase 8-like precursor                430   4e-136   
gb|KFK32294.1|  hypothetical protein AALP_AA6G223900                    429   4e-136   
ref|XP_009621302.1|  PREDICTED: beta-galactosidase 7-like               425   6e-136   
emb|CDY15749.1|  BnaC04g15750D                                          429   8e-136   
gb|KHN21526.1|  Beta-galactosidase 8                                    429   8e-136   
gb|KHN38778.1|  Beta-galactosidase 8                                    429   8e-136   
gb|ABR16628.1|  unknown                                                 428   2e-135   Picea sitchensis
ref|XP_004970751.1|  PREDICTED: beta-galactosidase 3-like               428   2e-135   
ref|XP_003540180.1|  PREDICTED: beta-galactosidase 8-like isoform 1     428   2e-135   
gb|EPS63867.1|  beta-galactosidase                                      422   2e-135   
dbj|BAD91083.1|  beta-D-galactosidase                                   427   2e-135   Pyrus pyrifolia [sha li]
ref|XP_003538213.1|  PREDICTED: beta-galactosidase 8-like               427   3e-135   
ref|XP_002314274.2|  beta-galactosidase family protein                  428   3e-135   Populus trichocarpa [western balsam poplar]
ref|XP_004147332.1|  PREDICTED: beta-galactosidase 3-like               427   3e-135   
ref|XP_003543462.1|  PREDICTED: beta-galactosidase 8-like isoform 1     427   3e-135   
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 427   3e-135   
ref|XP_009103690.1|  PREDICTED: beta-galactosidase 8                    427   3e-135   
ref|XP_008385297.1|  PREDICTED: beta-galactosidase 8-like               427   5e-135   
ref|XP_006409871.1|  hypothetical protein EUTSA_v10016234mg             427   6e-135   
ref|XP_003538054.1|  PREDICTED: beta-galactosidase 8-like               426   6e-135   
ref|XP_008460809.1|  PREDICTED: beta-galactosidase 10                   426   1e-134   
ref|XP_007207302.1|  hypothetical protein PRUPE_ppa001480mg             425   1e-134   
ref|XP_010106660.1|  Beta-galactosidase 1                               426   1e-134   
ref|XP_004984968.1|  PREDICTED: beta-galactosidase 6-like               426   2e-134   
ref|XP_008366360.1|  PREDICTED: beta-galactosidase 8-like               425   2e-134   
ref|XP_003597217.1|  Beta-galactosidase                                 425   2e-134   
dbj|BAK02766.1|  predicted protein                                      425   3e-134   
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 426   3e-134   
ref|XP_002973160.1|  hypothetical protein SELMODRAFT_413650             423   5e-134   
ref|XP_002976692.1|  hypothetical protein SELMODRAFT_268001             423   6e-134   
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    424   6e-134   
ref|XP_001775275.1|  predicted protein                                  426   6e-134   
ref|XP_002456725.1|  hypothetical protein SORBIDRAFT_03g041450          424   1e-133   
gb|AES67466.2|  beta-galactosidase-like protein                         423   1e-133   
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   422   2e-133   
gb|ACC60981.1|  beta-galactosidase 1 precursor                          422   2e-133   
ref|XP_007207303.1|  hypothetical protein PRUPE_ppa001480mg             421   3e-133   
emb|CDY31204.1|  BnaC03g46870D                                          422   3e-133   
ref|XP_003606403.1|  Beta-galactosidase                                 422   5e-133   
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    422   5e-133   
ref|XP_007132205.1|  hypothetical protein PHAVU_011G074900g             421   7e-133   
gb|KCW88854.1|  hypothetical protein EUGRSUZ_A01181                     416   1e-132   
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    421   1e-132   
ref|XP_008225494.1|  PREDICTED: beta-galactosidase 8                    421   1e-132   
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             420   2e-132   
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                   413   2e-132   
emb|CDX83288.1|  BnaA03g22180D                                          420   3e-132   
ref|XP_004505982.1|  PREDICTED: beta-galactosidase 8-like               419   3e-132   
ref|XP_011072090.1|  PREDICTED: beta-galactosidase 10                   420   4e-132   
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               419   4e-132   
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    419   4e-132   
gb|EMT22873.1|  Beta-galactosidase 3                                    420   6e-132   
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    419   6e-132   
emb|CBI35944.3|  unnamed protein product                                419   7e-132   
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             419   8e-132   
emb|CDY59693.1|  BnaC07g51120D                                          419   9e-132   
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             419   9e-132   
gb|KHN09646.1|  Beta-galactosidase 3                                    432   1e-131   
dbj|BAJ34544.1|  unnamed protein product                                418   1e-131   
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    418   1e-131   
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             418   1e-131   
ref|XP_007132198.1|  hypothetical protein PHAVU_011G074300g             417   1e-131   
gb|KEH18344.1|  beta-galactosidase                                      417   1e-131   
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 418   1e-131   
gb|ABK96254.1|  unknown                                                 418   2e-131   
ref|XP_006385360.1|  beta-galactosidase 1 family protein                417   2e-131   
ref|XP_009133878.1|  PREDICTED: beta-galactosidase 8-like               417   2e-131   
ref|XP_004143719.1|  PREDICTED: beta-galactosidase 7-like               410   3e-131   
ref|XP_006435077.1|  hypothetical protein CICLE_v10000260mg             411   3e-131   
ref|XP_003597608.1|  Beta-galactosidase                                 417   4e-131   
ref|NP_568001.1|  beta-galactosidase 3                                  417   4e-131   
emb|CAB16852.1|  beta-galactosidase like protein                        417   4e-131   
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               417   5e-131   
ref|XP_007048525.1|  Beta-galactosidase 3                               416   5e-131   
gb|ABV32545.1|  beta-galactosidase protein 2                            416   5e-131   
ref|XP_010243525.1|  PREDICTED: beta-galactosidase 3 isoform X2         415   6e-131   
gb|KHN32687.1|  Beta-galactosidase 1                                    416   7e-131   
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             416   7e-131   
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    416   8e-131   
ref|XP_007152042.1|  hypothetical protein PHAVU_004G096800g             416   9e-131   
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 416   9e-131   
gb|KHN30042.1|  Beta-galactosidase 1                                    415   9e-131   
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             416   9e-131   
emb|CDM85192.1|  unnamed protein product                                416   9e-131   
ref|XP_010098210.1|  Beta-galactosidase 8                               417   9e-131   
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               415   1e-130   
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                416   1e-130   
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               415   1e-130   
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    415   1e-130   
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                   409   2e-130   
ref|XP_010243524.1|  PREDICTED: beta-galactosidase 10 isoform X1        415   3e-130   
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         414   3e-130   
ref|XP_002514108.1|  beta-galactosidase, putative                       414   3e-130   
emb|CAC44500.1|  beta-galactosidase                                     414   4e-130   
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               414   4e-130   
ref|XP_010069008.1|  PREDICTED: beta-galactosidase 9 isoform X2         411   4e-130   
ref|XP_007012844.1|  Beta-galactosidase                                 414   6e-130   
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               414   6e-130   
gb|KDO84693.1|  hypothetical protein CISIN_1g003076mg                   409   6e-130   
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             414   6e-130   
emb|CDO97918.1|  unnamed protein product                                413   7e-130   
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   413   7e-130   
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               413   8e-130   
ref|XP_006645100.1|  PREDICTED: beta-galactosidase 3-like               413   1e-129   
dbj|BAF02242.1|  putative galactosidase                                 405   1e-129   
ref|XP_006369293.1|  beta-galactosidase 1 family protein                412   1e-129   
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               412   2e-129   
ref|XP_006645099.1|  PREDICTED: beta-galactosidase 3-like               412   2e-129   
gb|KDP44674.1|  hypothetical protein JCGZ_19489                         412   2e-129   
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               412   2e-129   
ref|NP_849506.1|  beta-galactosidase 3                                  412   2e-129   
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    412   2e-129   
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             412   3e-129   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    412   3e-129   
gb|AHL69742.1|  beta-galactosidase                                      411   3e-129   
ref|XP_004298203.1|  PREDICTED: beta-galactosidase 9-like               407   3e-129   
emb|CBI27912.3|  unnamed protein product                                411   3e-129   
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      411   3e-129   
gb|ADD62393.1|  beta-galactosidase 3                                    407   4e-129   
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               411   4e-129   
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      411   4e-129   
ref|XP_007015424.1|  Beta-galactosidase 8 isoform 4                     410   4e-129   
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             411   5e-129   
dbj|BAH20412.1|  AT3G13750                                              404   6e-129   
ref|XP_010907797.1|  PREDICTED: beta-galactosidase 3 isoform X1         411   6e-129   
ref|XP_002306893.1|  beta-galactosidase family protein                  411   7e-129   
gb|KFK31109.1|  hypothetical protein AALP_AA6G069300                    410   9e-129   
gb|KGN62231.1|  hypothetical protein Csa_2G337760                       410   9e-129   
dbj|BAD91084.1|  beta-D-galactosidase                                   410   9e-129   
ref|XP_003597215.1|  Beta-galactosidase                                 411   1e-128   
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               410   1e-128   
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               410   1e-128   
ref|XP_004502988.1|  PREDICTED: beta-galactosidase 10-like              408   1e-128   
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             410   1e-128   
ref|XP_002521428.1|  beta-galactosidase, putative                       410   1e-128   
ref|XP_006351534.1|  PREDICTED: beta-galactosidase 3-like               411   1e-128   
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    410   1e-128   
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      411   1e-128   
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg                405   1e-128   
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             410   2e-128   
dbj|BAF00686.1|  beta-galactosidase                                     400   2e-128   
emb|CBI19767.3|  unnamed protein product                                410   2e-128   
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              410   2e-128   
gb|EYU22313.1|  hypothetical protein MIMGU_mgv1a001532mg                409   2e-128   
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             410   2e-128   
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      410   2e-128   
emb|CAN78072.1|  hypothetical protein VITISV_013292                     410   2e-128   
emb|CDY71202.1|  BnaC09g54050D                                          397   2e-128   
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               410   2e-128   
emb|CDO99618.1|  unnamed protein product                                410   2e-128   
ref|NP_001234307.1|  beta-galactosidase, chloroplastic precursor        410   2e-128   
ref|XP_010069007.1|  PREDICTED: beta-galactosidase 9 isoform X1         410   3e-128   
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like               407   3e-128   
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   409   3e-128   
ref|XP_011022866.1|  PREDICTED: beta-galactosidase 10                   409   3e-128   
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    409   4e-128   
ref|XP_006493072.1|  PREDICTED: beta-galactosidase 9-like isoform X2    406   4e-128   
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               409   4e-128   
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 3-like               409   4e-128   
ref|XP_008224970.1|  PREDICTED: beta-galactosidase 8-like               409   4e-128   
gb|AGR44466.1|  beta-D-galactosidase 7                                  409   4e-128   
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 408   5e-128   
gb|KDP38567.1|  hypothetical protein JCGZ_04492                         409   5e-128   
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      408   6e-128   
gb|EEC71891.1|  hypothetical protein OsI_04635                          409   7e-128   
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               408   7e-128   
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    408   7e-128   
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          408   7e-128   
ref|XP_010689565.1|  PREDICTED: beta-galactosidase 8                    408   8e-128   
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             408   8e-128   
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               408   8e-128   
gb|KHN39301.1|  Beta-galactosidase 1                                    408   9e-128   
emb|CDY23785.1|  BnaC04g43370D                                          409   1e-127   
ref|NP_001044964.1|  Os01g0875500                                       408   1e-127   
ref|NP_001234465.1|  beta-galactosidase precursor                       407   1e-127   
ref|XP_010929757.1|  PREDICTED: beta-galactosidase 15 isoform X2        407   1e-127   
gb|ADO34792.1|  beta-galactosidase STBG7                                408   1e-127   
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               407   1e-127   
emb|CDY23637.1|  BnaC05g39570D                                          407   1e-127   
ref|XP_007214621.1|  hypothetical protein PRUPE_ppa001340mg             407   1e-127   
gb|KDP20900.1|  hypothetical protein JCGZ_21371                         407   2e-127   
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               407   2e-127   
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               407   2e-127   
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                407   2e-127   
gb|AHG94611.1|  beta-galactosidase                                      407   2e-127   
ref|NP_001151478.1|  LOC100285111 precursor                             407   2e-127   
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      407   2e-127   
ref|NP_001234303.1|  beta-galactosidase precursor                       407   2e-127   
ref|XP_010052369.1|  PREDICTED: beta-galactosidase 6-like isoform X3    403   2e-127   
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               406   2e-127   
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    407   2e-127   
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    407   2e-127   
ref|XP_010107841.1|  Beta-galactosidase 3                               407   2e-127   
gb|KHN47945.1|  Beta-galactosidase 9                                    408   3e-127   
gb|ADO34788.1|  beta-galactosidase STBG3                                406   3e-127   
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   407   3e-127   
dbj|BAG95687.1|  unnamed protein product                                409   3e-127   
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    406   3e-127   
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             407   3e-127   
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               406   4e-127   
gb|AAQ62586.1|  putative beta-galactosidase                             408   4e-127   
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               406   4e-127   
emb|CDX97513.1|  BnaA05g25660D                                          406   4e-127   
ref|XP_010650317.1|  PREDICTED: beta-galactosidase 9 isoform X2         403   4e-127   
ref|XP_008222836.1|  PREDICTED: beta-galactosidase 9                    407   4e-127   
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               406   5e-127   
ref|XP_006420948.1|  hypothetical protein CICLE_v10004268mg             403   5e-127   
ref|XP_006394240.1|  hypothetical protein EUTSA_v10003705mg             403   5e-127   
ref|XP_002527409.1|  beta-galactosidase, putative                       406   5e-127   
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      406   5e-127   
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 405   6e-127   
gb|KEH39322.1|  beta-galactosidase-like protein                         404   6e-127   
ref|XP_010461037.1|  PREDICTED: beta-galactosidase 10 isoform X2        403   7e-127   
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 405   7e-127   
ref|XP_010929755.1|  PREDICTED: beta-galactosidase 15 isoform X1        407   7e-127   
ref|XP_010461031.1|  PREDICTED: beta-galactosidase 10 isoform X1        402   8e-127   
ref|XP_007024475.1|  Beta galactosidase 1                               405   8e-127   
ref|XP_010509962.1|  PREDICTED: beta-galactosidase 9-like isoform X2    402   9e-127   
ref|XP_006493071.1|  PREDICTED: beta-galactosidase 9-like isoform X1    407   9e-127   
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             405   1e-126   
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      405   1e-126   
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                      404   1e-126   
ref|XP_004292017.1|  PREDICTED: beta-galactosidase 3-like               405   1e-126   
ref|XP_004289502.1|  PREDICTED: beta-galactosidase 10-like              405   1e-126   
tpg|DAA56579.1|  TPA: beta-galactosidase isoform 1                      405   1e-126   
gb|ABY71826.1|  beta-galactosidase                                      404   2e-126   
ref|NP_187988.1|  beta galactosidase 1                                  404   2e-126   
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 404   2e-126   
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           404   2e-126   
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             404   2e-126   
ref|XP_002310540.2|  beta-galactosidase family protein                  404   2e-126   
emb|CDY37486.1|  BnaC01g37460D                                          404   2e-126   
ref|XP_006826783.1|  hypothetical protein AMTR_s00136p00108810          402   2e-126   
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990          402   2e-126   
ref|XP_006280065.1|  hypothetical protein CARUB_v10025947mg             401   2e-126   
ref|XP_002881245.1|  hypothetical protein ARALYDRAFT_902346             405   2e-126   
dbj|BAE72075.1|  pear beta-galactosidase3                               405   3e-126   
ref|XP_001753645.1|  predicted protein                                  406   3e-126   
gb|AGR44464.1|  beta-D-galactosidase 5                                  400   3e-126   
ref|XP_007153611.1|  hypothetical protein PHAVU_003G050100g             405   3e-126   
gb|AGR44461.1|  beta-D-galactosidase 2                                  405   3e-126   
ref|XP_007227352.1|  hypothetical protein PRUPE_ppa001149mg             405   3e-126   
ref|XP_008383809.1|  PREDICTED: beta-galactosidase 8-like               404   3e-126   
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    404   4e-126   
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    403   4e-126   
dbj|BAD91085.1|  beta-D-galactosidase                                   404   4e-126   
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    404   4e-126   
gb|AAM13196.1|  galactosidase, putative                                 404   5e-126   
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1-like               403   5e-126   
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 403   5e-126   
gb|KHN17668.1|  Beta-galactosidase                                      401   5e-126   



>ref|XP_009616320.1| PREDICTED: beta-galactosidase 15-like [Nicotiana tomentosiformis]
Length=824

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/582 (65%), Positives = 452/582 (78%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP+RTAEDLA++VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  248   TENWTGWFKNWGGRDPHRTAEDLAFAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  307

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNLNQPKYGHLKELH+VLHS+EK +  GNI+   L NS+ VT+YA +G 
Sbjct  308   TYDYDAPLDEFGNLNQPKYGHLKELHDVLHSMEKTLTSGNISNNDLGNSVSVTIYALDGK  367

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
              +CFFSN+N T DATI Y+G  Y VPAWSVSILPDCK EVYNTA+VNTQT++MVK   EG
Sbjct  368   SSCFFSNANTTTDATITYEGVKYNVPAWSVSILPDCKTEVYNTAKVNTQTSIMVKKSNEG  427

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                 A+L+WSWRPE  D+T+L GKG  +ANQ+LDQKVA+DVSDY+WYMTS NL KDDPIW
Sbjct  428   ESETASLQWSWRPEKLDETVLLGKGHISANQLLDQKVADDVSDYMWYMTSFNLGKDDPIW  487

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S +M L VNGTG +LHVY NG+Y+ S+W      N +FE  IKL  GKN + LLSA+IG 
Sbjct  488   SDNMTLRVNGTGHILHVYVNGQYLGSKWATYGIFNYVFENKIKLKPGKNQIALLSATIGL  547

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYG  FDL   G+ G VEIVG+NGDE V K+L +HKWSYKV L G ENKL+  +  SR 
Sbjct  548   QNYGARFDLIQTGVPGPVEIVGRNGDERVVKDLSAHKWSYKVDLHGLENKLY--AGNSRF  605

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
              SQW S  +P  R MTWYK +FKAP G DPVVVDL G+GKG AWVNG ++GRYW   LA+
Sbjct  606   ESQWQSHDVPINRMMTWYKATFKAPLGNDPVVVDLQGLGKGLAWVNGESIGRYWPSYLAE  665

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
             GD C T+ CDYRG Y++ KC SNCG PTQR+YHVPRSF++  GDNE+VL EE GGN S +
Sbjct  666   GDGCSTDPCDYRGPYSDKKCNSNCGQPTQRWYHVPRSFMSNDGDNEIVLLEEFGGNPSLI  725

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTVR G  C +AYE+K+  ISCQ GR I+AIK+ANFGDT+G+CG   +      + D 
Sbjct  726   NFQTVRVGSACGNAYEDKLMNISCQ-GRPISAIKFANFGDTQGTCGSFEKGSCESNS-DV  783

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++I++  C+GK +CSV AS+SV G+TNC  +  K+LVVEA+C
Sbjct  784   LSIIQKECVGKENCSVVASQSVLGSTNC-DNIAKRLVVEAIC  824



>ref|XP_009801177.1| PREDICTED: beta-galactosidase 15-like [Nicotiana sylvestris]
Length=874

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/582 (64%), Positives = 448/582 (77%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF+ WGG+DP+RTAEDLA++VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  298   TENWTGWFQNWGGRDPHRTAEDLAFAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  357

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNLNQPKYGHLKELH+VLHS+EK +  GNI+   L NS+ VT+YA +  
Sbjct  358   TYDYDAPLDEFGNLNQPKYGHLKELHDVLHSMEKTLTSGNISNNDLGNSVSVTIYALDDK  417

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
              +CF SN+N T DATI Y+G  Y VPAWSVSILPDCK EVYNTA+VNTQT++MVK   EG
Sbjct  418   SSCFLSNANTTTDATITYEGVKYNVPAWSVSILPDCKTEVYNTAKVNTQTSIMVKKSNEG  477

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                 A+L+WSWRPE  D+T+L GKG  +AN++LDQKVA+DVSDY+WYMTS NL KDDPIW
Sbjct  478   ESETASLQWSWRPEKLDETVLLGKGHVSANKLLDQKVADDVSDYMWYMTSFNLGKDDPIW  537

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S DM L VNGTG +LHVY NG+Y+ S+W      N +FE  IKLN GKN +TLLSA++G 
Sbjct  538   SDDMTLRVNGTGHILHVYVNGQYLGSKWATYGIFNYVFENKIKLNPGKNQITLLSATVGL  597

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYGP FDL   G+ G VEIVG+NGDE V K+L +HKWSYKV L G ENKL+  +   R 
Sbjct  598   QNYGPRFDLIQTGVPGPVEIVGRNGDERVVKDLSAHKWSYKVDLHGLENKLY--AGNPRF  655

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
              SQW S  +P  R MTWYK +F AP G DPVVVDL G+GKG AWVNG ++GRYW   LA+
Sbjct  656   VSQWQSHDVPINRMMTWYKATFTAPLGNDPVVVDLQGLGKGLAWVNGQSIGRYWPSYLAE  715

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C T+ CDYRG Y++ KC SNCG PTQR+YHVPRSFL+  GDNE+VL EE GGN S V
Sbjct  716   EDGCSTDPCDYRGPYSDKKCNSNCGQPTQRWYHVPRSFLSNDGDNEIVLLEEFGGNPSLV  775

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTVR G  C +AYE+K+  ISC   R I+AIK+ANFGDT+G+CG   +      + D 
Sbjct  776   NFQTVRVGSACGNAYEDKLMNISCH-DRPISAIKFANFGDTQGTCGSFEKGSCESNS-DV  833

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++I++  C+GK +CSV AS+S+ G+TNC  +  K+LVVEA+C
Sbjct  834   LSIIQRECVGKENCSVAASQSILGSTNC-DNIAKRLVVEAIC  874



>gb|EYU39588.1| hypothetical protein MIMGU_mgv1a001416mg [Erythranthe guttata]
Length=824

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/582 (63%), Positives = 451/582 (77%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAEDLAYSVARF+QLGGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  248   TENWTGWFKNWGGKDPSRTAEDLAYSVARFYQLGGTFQNYYMYHGGTNFGRTAGGPYITT  307

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYG+LNQPKYGHLK+LH+VLHS+E  + YGNI++    NS+  T+Y+ N  
Sbjct  308   SYDYDAPLNEYGSLNQPKYGHLKQLHDVLHSIENVLTYGNISSMDFGNSVSATIYSTNDQ  367

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             K+CFF N+N + DATINYQG  Y +PAWSVSILPDCK  +YNTA+VNTQT+ M+K   +A
Sbjct  368   KSCFFGNANSSLDATINYQGVSYDIPAWSVSILPDCKNVLYNTAKVNTQTSKMIKVANEA  427

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                   L+WSW  E  D+  L GKGQ +A+ +LDQKVANDVSDY+WYMT ++LD++DPIW
Sbjct  428   ENEPIVLKWSWMQENLDENALLGKGQVSASHLLDQKVANDVSDYLWYMTRLDLDENDPIW  487

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             SK+M + VN TGQ++H Y NG+Y+ S+W      N +FE  IKL  GKN + LLSA++G+
Sbjct  488   SKNMSIRVNATGQIVHAYINGEYLGSEWATYGIYNYVFEKEIKLKPGKNQIALLSATLGY  547

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYG  F++   GL G ++I+GKNGDET+ K+L SHKW+YKVGL G +NKLF  +  +  
Sbjct  548   QNYGARFEMTETGLPGPIQIIGKNGDETIIKDLSSHKWTYKVGLEGLDNKLFDVN--TNY  605

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
             +S+WLSD+LP  + MTWYKT+FKAP G DPVVVDL+G+GKGFAWVNGNNLGRYW   LA 
Sbjct  606   SSKWLSDNLPVNKMMTWYKTTFKAPLGEDPVVVDLIGLGKGFAWVNGNNLGRYWPSFLAD  665

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  E CDYRG Y+NNKC+SNCG P+QR+YHVPRSF+N+   NE VLFEE GGN S V
Sbjct  666   VDGCSAEPCDYRGSYDNNKCVSNCGQPSQRWYHVPRSFMNKDV-NEFVLFEEFGGNPSLV  724

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTVR G VC +AYENK  EISCQ G+ I+ +K+A+FGD +    G FEKG C    DA
Sbjct  725   SFQTVRPGSVCGNAYENKDMEISCQ-GKTISDVKFASFGDVQ-GICGSFEKGTCEAKNDA  782

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++I+K AC+GK SCS+ AS SVFG TNC  S +K+L VE VC
Sbjct  783   ISIVKNACVGKESCSIQASASVFGATNCEASVSKRLAVEVVC  824



>ref|XP_009620959.1| PREDICTED: beta-galactosidase 15-like [Nicotiana tomentosiformis]
Length=825

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/582 (64%), Positives = 450/582 (77%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAED+A+SVARFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  249   TENWTGWFKNWGGKDPLRTAEDVAFSVARFFQTGGTFQNYYMYHGGTNFGRTSGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDE+GNL QPKYGHLKELH+VLHS+EK +  GNIT + L NS+ VT+YA +G 
Sbjct  309   TYDYNAPLDEFGNLAQPKYGHLKELHDVLHSMEKTLTSGNITNSDLGNSVAVTIYALDGQ  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFFSN+NET DATI YQG  Y VPAWSVSILPDCK EVYNTA+VNTQT+VMVK+   A
Sbjct  369   SSCFFSNANETTDATITYQGVQYNVPAWSVSILPDCKTEVYNTAKVNTQTSVMVKKSNDA  428

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                 A+L+WSWRPE  D+ ++ G+GQ +A++++DQKVANDVSDY+WYMT+V + K+DPIW
Sbjct  429   ENEPASLQWSWRPEKVDEAVVLGRGQSSAHELVDQKVANDVSDYMWYMTNVYIGKNDPIW  488

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S +M L VNG+G +LH Y NG+Y+ SQW      N +FE  +KLN G+N ++LLSA+IG 
Sbjct  489   SDNMTLRVNGSGHILHAYVNGQYLGSQWATYGIFNYVFEKQVKLNPGRNHISLLSATIGL  548

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYG +FD   +G+ G VEI+GKNGDE+V K+L SHKWSYKV L G  NKLF S N    
Sbjct  549   QNYGAHFDTVQSGIPGPVEIIGKNGDESVIKDLSSHKWSYKVDLNGINNKLF-SGNPKFE  607

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
               QW S  +P  R MTWYKT+FKAP G DPVVVDL G+GKG AW+NG ++GRYW   LA+
Sbjct  608   NGQWFSQDVPINRMMTWYKTTFKAPLGNDPVVVDLQGLGKGHAWINGESIGRYWPSYLAE  667

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              + C T+ CDYRG+Y  +KC S CG PTQR+YHVPRSFL +  +N LVLFEE GGN S V
Sbjct  668   EEGCSTDLCDYRGKYGPDKCASGCGEPTQRWYHVPRSFL-KSDENTLVLFEEFGGNPSLV  726

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTV+ G  C SAYENK  E+SC  GR ITAI++ANFG+T     G F+KG C    D 
Sbjct  727   NFQTVQVGTACGSAYENKTMELSCN-GRPITAIRFANFGETE-GICGSFDKGSCSSENDV  784

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+I++ AC+GK  CSV ASESVFG+TNC G+  K+L+VEAVC
Sbjct  785   VSIIEKACVGKEKCSVPASESVFGSTNC-GNNAKRLIVEAVC  825



>gb|EYU25828.1| hypothetical protein MIMGU_mgv1a026608mg, partial [Erythranthe 
guttata]
Length=814

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/582 (63%), Positives = 445/582 (76%), Gaps = 13/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK+P RTAED+AY+VARF+Q GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  237   TENWTGWFKFWGGKNPLRTAEDVAYAVARFYQTGGTFQNYYMYHGGTNFGRTAGGPYITT  296

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYG LNQPKYGHLKELH+VLHS+EK + YGNI++    NS+  T+YA NG+
Sbjct  297   SYDYDAPLNEYGGLNQPKYGHLKELHDVLHSIEKTLTYGNISSIDFGNSVYATIYALNGS  356

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N+N T+DATI YQG DY +PAWSVSILPDCK+E YNTA+VNTQT+VM  +   A
Sbjct  357   SSCFFGNTNSTSDATIKYQGVDYTIPAWSVSILPDCKKEAYNTAKVNTQTSVMEMKTNGA  416

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                 +AL+W WR E    T++HGKGQ +A+ ++DQKV NDVSDY+WYMTSV L+K DPIW
Sbjct  417   ENEPSALKWVWRDEQVKQTVVHGKGQISASHLVDQKVTNDVSDYLWYMTSVKLEKKDPIW  476

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S++M L VNGTGQV+H Y NG Y+ SQW      N +FE  IK  HG N ++LLSA++G 
Sbjct  477   SRNMTLRVNGTGQVMHAYINGDYLGSQWATSGVFNYVFEKKIKPKHGTNQISLLSATVGL  536

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYG  F+    GL G +EI+G+ GDET+ K+L SHKWSY+VGL+G +NK F ++N +  
Sbjct  537   QNYGAEFEKIRTGLPGPIEIIGRKGDETIIKDLSSHKWSYQVGLKGLDNKFFNTNNSAD-  595

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
                W S  LPT R MTWYKT+FKAP G +PVVVD+ G+GKG AWVNGN+LGRYW   +A 
Sbjct  596   -HHWKSQDLPTNRMMTWYKTTFKAPIGEEPVVVDMQGLGKGLAWVNGNSLGRYWPSYVAD  654

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  E CDYRG Y++ KC+ NCG PTQR+YHVPRSF+N    NELVLFEE GGN S V
Sbjct  655   VDGCSAEPCDYRGSYDSTKCVWNCGQPTQRWYHVPRSFMNED-VNELVLFEEFGGNPSLV  713

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTVR G VC SAYEN+  E+SC+ GR I+ IK+A FGD RGSCG  F+KG C    DA
Sbjct  714   SFQTVRPGTVCGSAYENREMELSCE-GRQISDIKFAGFGDVRGSCGAAFQKGTCESKNDA  772

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++IL  AC+GK  C VTASE +FG+TNC    +K+LVVEAVC
Sbjct  773   MSILVQACVGKERCVVTASEGIFGSTNCEDGISKRLVVEAVC  814



>ref|XP_009790181.1| PREDICTED: beta-galactosidase 15-like [Nicotiana sylvestris]
Length=821

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/579 (64%), Positives = 449/579 (78%), Gaps = 12/579 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAED+AY+VARFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  249   TENWTGWFKNWGGKDPLRTAEDVAYAVARFFQTGGTFQNYYMYHGGTNFGRTSGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNL QPKYGHLKELH+VLHS+EK +  GNIT + L NS+ VT+YA +G 
Sbjct  309   TYDYDAPLDEFGNLAQPKYGHLKELHDVLHSMEKTLTSGNITNSDLGNSVAVTIYALDGQ  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFFSN+NET DATINY+G  Y VPAWSVSILPDCK EVYNTA+VNTQT+VMVK+  + 
Sbjct  369   SSCFFSNANETTDATINYKGVQYNVPAWSVSILPDCKTEVYNTAKVNTQTSVMVKKSNE-  427

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIWSKD  721
              A+L+WSWRPE  D+ ++ G+G+ +A++++DQKVANDVSDY+WYMT+V + K+DPIWS +
Sbjct  428   PASLQWSWRPEKVDEAVVLGRGRSSAHELVDQKVANDVSDYMWYMTNVYIGKNDPIWSDN  487

Query  722   MRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGFQNY  889
             M L VNG+G +LH Y NG+Y+ SQW      N +FE  +KLN G+N ++LLSA+IG QNY
Sbjct  488   MTLRVNGSGHILHAYVNGQYLGSQWATYGIFNYVFEKQVKLNPGRNHISLLSATIGLQNY  547

Query  890   GPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSASQ  1066
             G +FD   +G+ G VEI+GKNGDE+V K+L SHKWSYKV L G  NKLF S N      Q
Sbjct  548   GAHFDTVQSGIPGPVEIIGKNGDESVIKDLSSHKWSYKVDLNGINNKLF-SGNPKFENGQ  606

Query  1067  WLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAKGDD  1243
             W S  +P  R MTWYKT+FKAP G DPVVVD  G+GKG AW+NG ++GRYW   LA+ + 
Sbjct  607   WFSQDVPINRMMTWYKTTFKAPLGNDPVVVDFQGLGKGHAWINGESIGRYWPSYLAEEEG  666

Query  1244  CPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQ  1423
             C T+ CDYRG+Y  +KC S CG PTQR+YHVPRSFL +  +N LVLFEE GGN S V FQ
Sbjct  667   CSTDLCDYRGKYGPDKCASGCGEPTQRWYHVPRSFL-KSDENTLVLFEEFGGNPSLVNFQ  725

Query  1424  TVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNI  1603
             TV+ G  C SAYENK  E+SC  G+ ITAI+YANFG+T     G F+KG C    +AV+I
Sbjct  726   TVQVGTACGSAYENKTMELSCN-GKAITAIRYANFGETE-GICGSFDKGSCSSENNAVSI  783

Query  1604  LKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++  C+GK  CSV ASE VFG+TNC G+  K+L+VEAVC
Sbjct  784   IEKECVGKEKCSVLASEGVFGSTNC-GNNAKRLIVEAVC  821



>emb|CDP03052.1| unnamed protein product [Coffea canephora]
Length=828

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/581 (63%), Positives = 435/581 (75%), Gaps = 15/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DPYRTAED+AY+VARFFQ GG+ QNYYMYHGGTN+GR AGGPYI+T
Sbjct  255   TENWTGWFKAWGGGDPYRTAEDVAYAVARFFQTGGSLQNYYMYHGGTNYGREAGGPYIST  314

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGNLNQPKYGHLK+LH+ LHSLEK + YGN+T T   NS++ TV+  NGT
Sbjct  315   TYDYNAPLDEYGNLNQPKYGHLKQLHDTLHSLEKILTYGNVTNTDFGNSVKSTVFTLNGT  374

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CFF NSN T DATI YQG+ Y VPAWSVSILPDCK+EVYNTA+VNTQT V VK   +A
Sbjct  375   SACFFENSNTTTDATITYQGSQYNVPAWSVSILPDCKKEVYNTAKVNTQTWVKVKRSNEA  434

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                  +L W+WRPE  DD ++HGKG  +AN++LDQKV ND SDY+WYMT VNL+K+DPIW
Sbjct  435   ENEPVSLSWTWRPEAIDDAVVHGKGHVSANRLLDQKVINDASDYLWYMTRVNLEKNDPIW  494

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S ++ L VN TG +LH Y NG+YV S+W      N +F+ +I+LN G N + LLSA++G 
Sbjct  495   SGNLSLRVNATGHILHAYVNGQYVGSEWAPYGVFNYVFKKDIQLNRGSNQIALLSATVGL  554

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
              NYG  FD    G+ G VEIVG+NGDET+ K+L  HKWSYKVGL G   K+F+SS+ S  
Sbjct  555   TNYGARFDEIPAGISGPVEIVGRNGDETIIKDLSHHKWSYKVGLHGLSKKIFKSSDPSL-  613

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
                W S  LP  RRMTWYKT+FKAP G DPV V+L G+GKG+AWVNGNNLGRYW  L   
Sbjct  614   ---WQSQDLPVNRRMTWYKTTFKAPLGEDPVAVNLQGLGKGWAWVNGNNLGRYWASLLAD  670

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             D C T+ CDYRG Y N+KC++ CG PTQ +YHVPRSFLN  GDN+LVLFEE GGN S+V 
Sbjct  671   DQCSTDPCDYRGPYTNSKCVTGCGEPTQTWYHVPRSFLN-DGDNDLVLFEEFGGNPSQVT  729

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
             FQTV  G  C +AYEN V EISCQ GR I+ IK+A+FG+  G+CG   +        D +
Sbjct  730   FQTVTVGTTCGNAYENTVLEISCQ-GRPISDIKFASFGNPEGTCGSFQKGTCDAN-NDPL  787

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +++ AC+GK SCS  ASE++ G TNC  S TK+LVVEAVC
Sbjct  788   LVVREACVGKESCSFAASETLLGPTNCDASVTKRLVVEAVC  828



>ref|XP_011076997.1| PREDICTED: beta-galactosidase 15-like [Sesamum indicum]
Length=822

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/582 (61%), Positives = 441/582 (76%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDLA+SVARFFQLGGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  248   TENWTGWFKNWGGKDPHRTAEDLAFSVARFFQLGGTFQNYYMYHGGTNFGRTSGGPYITT  307

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APL+EYG+LNQPKYGHLK+LH+VLHS+EK + YGN+++T   NS+  TVY+ N  
Sbjct  308   TYDYDAPLNEYGSLNQPKYGHLKQLHDVLHSIEKTLTYGNVSSTDYGNSVTATVYSTNDQ  367

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             +TCFF N+N TADAT+ YQG  Y VPAWSVSILPDCK+EV+NTA+VNTQT++MVK   KA
Sbjct  368   QTCFFGNANTTADATVTYQGAKYNVPAWSVSILPDCKKEVFNTAKVNTQTSMMVKVSNKA  427

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                  AL+W+W  E    T++HGKG+ +A+ +LDQKVANDVSDY+WYMTS++L KDDP+W
Sbjct  428   EDEPMALKWTWMSESLHKTLVHGKGEVSASHLLDQKVANDVSDYMWYMTSLHLGKDDPVW  487

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S +MR+ +NGTG V+H + NG+++ SQW      N  FE  I L  G+N +TLLSA+IG 
Sbjct  488   SDEMRIRINGTGHVMHSFINGEHLGSQWATYGVFNYKFEKRIHLKPGRNQITLLSATIGL  547

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYGP FD+   GL G +EI+G+ GDE + K+L    W+YKVGL G   KLF ++     
Sbjct  548   QNYGPNFDVVQTGLPGPIEIIGQKGDECIIKDLSKRTWTYKVGLDGFNTKLFNNN----V  603

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
                W +  +P  + MTWYKT+FKAP G +PV VDL G+GKG AWVNGN+LGRYW   +A+
Sbjct  604   DKVWSTGEMPINKMMTWYKTTFKAPLGEEPVAVDLQGLGKGMAWVNGNSLGRYWPSYMAE  663

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  E CDYRG Y+N+KC+SNCG PTQR+YHVPRSF+NR   NELVLFEE GGN S V
Sbjct  664   EDGCSAEPCDYRGSYDNSKCVSNCGQPTQRWYHVPRSFMNRD-VNELVLFEEIGGNPSLV  722

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTVR G VC +AYE K  E+SC  GR I+ IK+A+FG+ +G CG   +      + D 
Sbjct  723   NFQTVRPGSVCGNAYEGKDMELSCY-GRPISGIKFASFGNVQGVCGSFRKGTCEAKS-DV  780

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++ ++ AC+GK SC V ASES+ G+T+C  S TK+LVVEA+C
Sbjct  781   LSFVQNACVGKESCVVRASESLLGSTSCDSSTTKRLVVEAMC  822



>ref|XP_004243920.1| PREDICTED: beta-galactosidase 15-like [Solanum lycopersicum]
Length=818

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/581 (61%), Positives = 434/581 (75%), Gaps = 16/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RT EDLAYSVARF+Q GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  246   TENWTGWFKNWGGKDPLRTTEDLAYSVARFYQTGGTFQNYYMYHGGTNFGRTSGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDE+GNL QPKYGHLKELH+VLHS+EK +  G +  T L NS+ VT+Y  +G 
Sbjct  306   TYDYNAPLDEFGNLAQPKYGHLKELHDVLHSMEKILASGTVNNTNLGNSVAVTMYTLDGE  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFFSN+NET DATI+Y+   Y VPAWSV+ILPDC  EVYNTA+VNTQT+VMVK+   A
Sbjct  366   SSCFFSNANETTDATISYKNVYYNVPAWSVTILPDCITEVYNTAKVNTQTSVMVKKLNNA  425

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                   L+WSWRPE+ DD I+ G+GQ + ++++DQKV ND SDY+WYMT+V ++  DPIW
Sbjct  426   ENEPIPLQWSWRPEMIDDAIILGRGQSSFHELIDQKVVNDTSDYLWYMTNVYINNTDPIW  485

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S DM+L VN +G VLH Y NGKY+ S W      N +FE  +KLN GKN ++LLSA++GF
Sbjct  486   SDDMKLRVNASGHVLHAYVNGKYLGSDWATYGIFNYVFEKKVKLNPGKNSISLLSATVGF  545

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             +NYGP+FD   +G+ G VEI+GKNGDE++ K+L SHKWSY VGL+G  NKLF   N  + 
Sbjct  546   KNYGPHFDTIESGILGPVEIIGKNGDESIIKDLSSHKWSYTVGLKGINNKLFDEYNTGK-  604

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
                W S  +P  R MTWYKT+FKAP G  PVVVD+ G+GKG AWVNG ++GRYW      
Sbjct  605   ---WDSHDVPINRMMTWYKTTFKAPLGNAPVVVDMQGLGKGTAWVNGQSIGRYWPSYLAE  661

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
              +C  + CDYRG Y+ +KC S CG PTQR+YHVPRSFL+   +N LVLFEE GGN S V+
Sbjct  662   GNCSLDPCDYRGPYSADKCTSKCGEPTQRWYHVPRSFLSSD-ENTLVLFEEFGGNPSHVK  720

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
             FQT+  G  C SAYENK  E+SC G R I+AI++ANFG+T     G F KG C   +D V
Sbjct  721   FQTIEVGMACGSAYENKTMELSCNGSR-ISAIRFANFGETE-GSCGSFGKGSCSSEQDVV  778

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++++  C+GK  C V ASESVFG TNC G++ KKL+VEAVC
Sbjct  779   SLVEKQCVGKEKCLVQASESVFGMTNC-GNKEKKLIVEAVC  818



>ref|XP_006367886.1| PREDICTED: beta-galactosidase 15-like [Solanum tuberosum]
Length=815

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/581 (61%), Positives = 436/581 (75%), Gaps = 13/581 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RT EDLAYSVARF+Q GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  240   TENWTGWFKNWGGKDPLRTTEDLAYSVARFYQTGGTFQNYYMYHGGTNFGRTSGGPYITT  299

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDE+GNL QPKYGHLKELH+VLHS+EK +  G++  T L NS+ VT+Y+ +G 
Sbjct  300   TYDYNAPLDEFGNLAQPKYGHLKELHDVLHSMEKILTSGSVNNTNLGNSVAVTMYSLDGE  359

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFFSN+NET DATI+Y+  +Y VPAWSV+ILPDC  EVYNTA+VNTQT++MVK+   A
Sbjct  360   SSCFFSNANETTDATISYKNVNYNVPAWSVTILPDCITEVYNTAKVNTQTSIMVKKLNDA  419

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                  +L+WSWRPE+ DD I+ G+GQ + +++LDQKV ND SDY+WYMT+V ++K DPIW
Sbjct  420   ENEPISLQWSWRPEMIDDAIILGRGQSSVHELLDQKVVNDTSDYLWYMTTVYINKTDPIW  479

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S DM+L VN +G VLH Y NG+Y+ S W      N +FE  +KLN GKN ++LLSA++G 
Sbjct  480   SDDMKLRVNASGHVLHAYVNGQYLGSDWATYGIFNYVFEEKVKLNPGKNYISLLSATVGL  539

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             +NYGP+FD   +G+ G VEI+GK GDE++ K+L SHKWSY VGL+G  NKLF   N   +
Sbjct  540   KNYGPHFDTIQSGILGPVEIIGKIGDESIIKDLSSHKWSYTVGLKGINNKLF-DENPKYN  598

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               +W S  +P  R MTWYKT+FKAP G  PVVVD+ G+GKG AWVNG ++GRYW      
Sbjct  599   TRKWDSHDVPINRMMTWYKTTFKAPLGNAPVVVDMQGLGKGTAWVNGQSIGRYWPSYLAE  658

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
               C  + CDYRG Y+ +KC S CG PTQR+YHVPRSFL+   +N LVLFEE GGN S V 
Sbjct  659   GSCSLDPCDYRGPYSADKCTSKCGEPTQRWYHVPRSFLSSD-ENTLVLFEEFGGNPSLVN  717

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
             FQT+  G  C SAYENK  E+SC  GR I+AI++ANFG+T     G F KG C   +D V
Sbjct  718   FQTIEVGMACGSAYENKTMELSCN-GRPISAIRFANFGETE-GSCGSFGKGSCSSEQDVV  775

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++++  C+GK  C V ASESVFGTTNC G+  K+L+VEAVC
Sbjct  776   SVVEKECIGKEKCLVQASESVFGTTNC-GNNDKRLIVEAVC  815



>ref|XP_008337885.1| PREDICTED: beta-galactosidase 15-like [Malus domestica]
Length=827

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/583 (62%), Positives = 438/583 (75%), Gaps = 18/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAEDLA+SVARFFQLGGTFQNYYMYHGGTNFGRTA   Y+TT
Sbjct  253   TENWTGWFKSWGGKDPLRTAEDLAFSVARFFQLGGTFQNYYMYHGGTNFGRTAAA-YVTT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYGNLNQPK+GHLKELH +L S+E  + +GN+TTT  DNS+  TVYA N +
Sbjct  312   TYDYDAPLDEYGNLNQPKWGHLKELHQILKSMEYTLTHGNVTTTNFDNSVSATVYATNES  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N+N T DATI +QG  Y +PAWSVSILPDCK E YNTA+VNTQTTV VK G KA
Sbjct  372   SSCFLGNANSTTDATITFQGNTYTIPAWSVSILPDCKTEGYNTAKVNTQTTVKVKVGNKA  431

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                  +L WSWRPE  DDT +  KG+ TANQ+LDQKVA +D SDY+WYMTSV+L KDDPI
Sbjct  432   EDEPESLAWSWRPETIDDTRVLAKGEITANQLLDQKVAGDDASDYLWYMTSVHLKKDDPI  491

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             WSK+M L VNGTG +LH Y NG+YV SQW      N +FE ++KL+ GKN+++LLSA++G
Sbjct  492   WSKNMTLRVNGTGFILHAYVNGEYVGSQWAQYNVYNYVFEKSVKLHPGKNIISLLSATVG  551

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  F+    G+ G V +VG+NGDE V K+L +HKWSYKVGL G +NKLF  S  SR
Sbjct  552   FPNYGGGFEEIKTGISGPVVLVGQNGDEIVIKDLSAHKWSYKVGLHGLKNKLF--STDSR  609

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
              A++W +++LP  R +TWYK +FKAP G DPVVVDL G+GKG AW+NG+++GRYW   L+
Sbjct  610   YATKWSTENLPINRMLTWYKATFKAPLGTDPVVVDLQGLGKGHAWINGHSIGRYWPSYLS  669

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                DC  +ACDYRG Y+NNKC  NCGNPTQR+YHVPRSF+   G+N +VLFEE GGN S 
Sbjct  670   YDTDCSLDACDYRGTYDNNKCSFNCGNPTQRWYHVPRSFM-EDGENAIVLFEEFGGNPSL  728

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT++ G VCA AYE    E++C+ GR I+AIK+A+FG+++     G  +     +  
Sbjct  729   VNFQTIQVGTVCAHAYEKHTVELACE-GRPISAIKFASFGNSQ--GTCGSFEKGSCDSGR  785

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A++ILK  C+GK  C +  SES FG TNC G   K+L VEAVC
Sbjct  786   ALSILKKECVGKEKCLINVSESKFGLTNC-GDAVKRLAVEAVC  827



>ref|XP_010518958.1| PREDICTED: beta-galactosidase 15-like [Tarenaya hassleriana]
Length=821

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/582 (60%), Positives = 429/582 (74%), Gaps = 15/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG KDPYRTAEDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  246   TENWTGWFKNWGSKDPYRTAEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDE+G LNQPKYGHLK+LH+VLHS+EK + +GNITT   DNS+  T+YA    
Sbjct  306   TYDYNAPLDEFGQLNQPKYGHLKQLHDVLHSMEKTLTHGNITTVDFDNSVTATIYATEEG  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N+N ++DATIN+QGT+Y VPAWSV++LPDCK E YNTA+VNTQT+VMVK    A
Sbjct  366   SSCFLGNANSSSDATINFQGTEYTVPAWSVTVLPDCKTEAYNTAKVNTQTSVMVKRPNGA  425

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 ++L WSWRPE+ D  +L GKG    NQ+ DQK VAND SDY+WYMT V+L + DP+
Sbjct  426   EEEPSSLEWSWRPEIMDGAVLRGKGDSAMNQLFDQKNVANDESDYLWYMTKVHLKESDPV  485

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
             WSK+M + +N T  VLHV+ NG+++ SQW  +     +FE N+K   G N ++LLS ++G
Sbjct  486   WSKNMTIRINSTAHVLHVFVNGEHIGSQWAKDGKYTYMFEQNVKYKPGVNQISLLSTTVG  545

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG +F+ G  G+ G VEIVG NGDETV KNL  HKWSYK GL G +++LF     S 
Sbjct  546   FANYGAFFETGAAGITGPVEIVGWNGDETVVKNLSGHKWSYKTGLDGFQDQLF----SSE  601

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             ++S+W  + +P  R MTWYKT+FKAP G +PVVVDL+G+GKG AW+NGNN+GRYW     
Sbjct  602   TSSKWSEESVPFNRMMTWYKTTFKAPLGTEPVVVDLLGLGKGTAWINGNNIGRYWPSFLA  661

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
             G+D  +  CDYRG Y + KC +NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  662   GEDGCSAVCDYRGSYGSEKCQTNCGQPTQRWYHVPRSFLNSEGDNTLVLFEEIGGNPSLV  721

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTV  G +CA+AYE    E+SC  G+ I+AIK+A+FG+  G   G FEKG C G+ DA
Sbjct  722   NFQTVTVGSICANAYEKNTLELSCN-GKPISAIKFASFGNP-GGVCGSFEKGTCEGSNDA  779

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               IL   C+GK  CS+  S  +FG  +C G   +KL VEAVC
Sbjct  780   EAILAKECVGKEKCSIDVSADIFGAADCDGGFARKLAVEAVC  821



>ref|XP_002276918.2| PREDICTED: beta-galactosidase 15 [Vitis vinifera]
 emb|CBI27773.3| unnamed protein product [Vitis vinifera]
Length=835

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/581 (62%), Positives = 432/581 (74%), Gaps = 17/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDL+YSVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  264   TENWTGWFKNWGGKDPHRTAEDLSYSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  323

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLK+LH VL S+E+ +  GNITT  + NS++VTVYA    
Sbjct  324   SYDYDAPLDEFGNLNQPKWGHLKDLHTVLKSMEETLTEGNITTIDMGNSVEVTVYATQKV  383

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
              +CFFSNSN T DAT  Y GT+Y VPAWSVSILPDCK+EVYNTA+VN QT+VMVK   E 
Sbjct  384   SSCFFSNSNTTNDATFTYGGTEYTVPAWSVSILPDCKKEVYNTAKVNAQTSVMVKNKNEA  443

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                 A+L+WSWRPE+ DDT + GKGQ +AN+++DQK  ND SDY+WYM SV+L +DD +W
Sbjct  444   EDQPASLKWSWRPEMIDDTAVLGKGQVSANRLIDQKTTNDRSDYLWYMNSVDLSEDDLVW  503

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLLTLLSASIGF  880
             + +M L VN TG +LH Y NG+Y+ SQW  N +    FE  +KL  GKNL+ LLSA+IGF
Sbjct  504   TDNMTLRVNATGHILHAYVNGEYLGSQWATNGIFNYVFEEKVKLKPGKNLIALLSATIGF  563

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYG ++DL  +G+ G VEIVG+ GDET+ K+L SHKWSYKVG+ G   KL+       S
Sbjct  564   QNYGAFYDLVQSGISGPVEIVGRKGDETIIKDLSSHKWSYKVGMHGMAMKLY----DPES  619

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               +W   ++P  R +TWYKT+FKAP G D VVVDL G+GKG AWVNG +LGRYW      
Sbjct  620   PYKWEEGNVPLNRNLTWYKTTFKAPLGTDAVVVDLQGLGKGEAWVNGQSLGRYWPSSIAE  679

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             D C    CDYRG Y N KC+ NCGNPTQR+YHVPRSFL    +N LVLFEE GGN S V 
Sbjct  680   DGC-NATCDYRGPYTNTKCVRNCGNPTQRWYHVPRSFLTAD-ENTLVLFEEFGGNPSLVN  737

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
             FQTV  G  C +AYEN V E++CQ  R I+ IK+A+FGD +GSCG   +    G  KDA+
Sbjct  738   FQTVTIGTACGNAYENNVLELACQ-NRPISDIKFASFGDPQGSCGSFSKGSCEGN-KDAL  795

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +I+K AC+GK SCS+  SE  FG+T+C GS  K+L VEAVC
Sbjct  796   DIIKKACVGKESCSLDVSEKAFGSTSC-GSIPKRLAVEAVC  835



>emb|CAJ09953.1| beta-galactosidase [Mangifera indica]
Length=827

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/582 (59%), Positives = 438/582 (75%), Gaps = 13/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGRT+GGPY+TT
Sbjct  250   TENWTGWFKSWGGKDPHRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRTSGGPYLTT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLKELH VL ++EK + +GN++TT   NS+  TVYA    
Sbjct  310   SYDYDAPLDEFGNLNQPKWGHLKELHTVLKAMEKTLTHGNVSTTDFGNSVTATVYATEEG  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N+N T DATI +QG+DY VPAWSVSILPDCK E YNTA+VNTQT+V+VK+  +A
Sbjct  370   SSCFFGNANTTGDATITFQGSDYVVPAWSVSILPDCKTEAYNTAKVNTQTSVIVKKPNQA  429

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
                 ++L+W WRPE  D+ ++ GKG F+A+ ++DQKV ND SDY+WYMTSV+L  DD IW
Sbjct  430   ENEPSSLKWVWRPEAIDEPVVQGKGSFSASFLIDQKVINDASDYLWYMTSVDLKPDDIIW  489

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGF  880
             S +M L VN TG VLH + NG++V SQW        +F+  +KLN GKN ++LLS ++G 
Sbjct  490   SDNMTLRVNTTGIVLHAFVNGEHVGSQWTKYGVFKDVFQQQVKLNPGKNQISLLSVTVGL  549

Query  881   QNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             QNYGP FD+   G+ G VE++G+ GDETV K+L  HKW+Y+VGL G E+  F S   +  
Sbjct  550   QNYGPMFDMVQAGITGPVELIGQKGDETVIKDLSCHKWTYEVGLTGLEDNKFYSKASTNE  609

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
                W ++++P+  +MTWYKT+FKAP G DPVV+DL GMGKGFAWVNG NLGRYW   LA+
Sbjct  610   TCGWSAENVPSNSKMTWYKTTFKAPLGNDPVVLDLQGMGKGFAWVNGYNLGRYWPSYLAE  669

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C ++ CDYRG+Y+NNKC++NCG P+QR+YHVPRSFL + G+N LVLFEE GGN  +V
Sbjct  670   ADGCSSDPCDYRGQYDNNKCVTNCGQPSQRWYHVPRSFL-QDGENTLVLFEEFGGNPWQV  728

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT+  G VC +A+E K  E+SC  GR I+AIK+A+FGD +    G F+ G C   +D 
Sbjct  729   NFQTLVVGSVCGNAHEKKTLELSCN-GRPISAIKFASFGDPQ-GTCGSFQAGTCQTEQDI  786

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + +L+  C+GK +CS+  SE   G TNC GS  KKL VEAVC
Sbjct  787   LPVLQQECVGKETCSIDISEDKLGKTNC-GSVVKKLAVEAVC  827



>ref|XP_009359758.1| PREDICTED: beta-galactosidase 15 [Pyrus x bretschneideri]
Length=854

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/583 (62%), Positives = 438/583 (75%), Gaps = 18/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAEDLA+SVARFFQLGGTFQNYYMYHGGTNFGRTA   YITT
Sbjct  280   TENWTGWFKSWGGKDPLRTAEDLAFSVARFFQLGGTFQNYYMYHGGTNFGRTAAA-YITT  338

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYG LNQPK+GHLKELH +L S+E  + +GN+TTT  DNS+  TVYA N +
Sbjct  339   TYDYDAPLDEYGKLNQPKWGHLKELHQILKSMEYTLTHGNVTTTNFDNSVSATVYATNES  398

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N+N T DATI ++G  Y +PAWSVSILPDCK E YNTA+VNTQTTV VK   KA
Sbjct  399   SSCFLGNANSTTDATITFEGNTYTIPAWSVSILPDCKTEGYNTAKVNTQTTVKVKVVNKA  458

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                  +L WSWRPE  DDT +  KG+ TANQ+LDQKVA +D SDY+WYMTSV+L KDDPI
Sbjct  459   EDEPESLAWSWRPETIDDTRVLAKGEITANQLLDQKVAGDDASDYLWYMTSVHLKKDDPI  518

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             WSK+M L VNGTG +LH Y NGKYV SQW      N +FE ++KL  GKN+++LLSA++G
Sbjct  519   WSKNMTLRVNGTGFILHAYVNGKYVGSQWAQYNVYNYVFEKSVKLLPGKNIISLLSATVG  578

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  F+    G+ G V +VG+NGDE V K+L +HKWSYKVGL G +NKLF  S  SR
Sbjct  579   FPNYGGGFEEIKTGISGPVVLVGQNGDEIVIKDLSAHKWSYKVGLHGLKNKLF--STDSR  636

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
              A++W +++LP  R +TWYK +FKAP G DPVVVDL G+GKG AW+NG+++GRYW   L+
Sbjct  637   YATKWSTENLPVNRMLTWYKATFKAPLGTDPVVVDLQGLGKGHAWINGHSIGRYWPSYLS  696

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                DC  +ACDYRG Y+NNKC  NCGNPTQR+YHVPRSF+   G+N +VLFEE GGN S 
Sbjct  697   YDTDCSLDACDYRGSYDNNKCSFNCGNPTQRWYHVPRSFM-EDGENTIVLFEEFGGNPSL  755

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT++ G VCA AYE    E++C+ GR I+AIK+A+FG+ RG+CG   +     G+  
Sbjct  756   VNFQTIQVGTVCAHAYEKHTVELACE-GRPISAIKFASFGNPRGTCGSFEKGSCDSGS--  812

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A++ILK  C+GK  C +  S+S FG TNC G   K+L VEAVC
Sbjct  813   ALSILKKECVGKEKCLINVSQSKFGLTNC-GDAVKRLAVEAVC  854



>ref|XP_010999621.1| PREDICTED: beta-galactosidase 15-like [Populus euphratica]
Length=823

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/582 (60%), Positives = 429/582 (74%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDLA+SVARF+QLGGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  249   TENWTGWFKSWGGKDPHRTAEDLAFSVARFYQLGGTFQNYYMYHGGTNFGRTAGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLKELH+VLHS+E  +  GNI++    NS+  T+Y+    
Sbjct  309   SYDYDAPLDEYGNLNQPKWGHLKELHDVLHSMEDTLTRGNISSVDFGNSVSGTIYSTEKG  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF +N++   D TIN+QG DY+VPAWSVSILPDC+  VYNTA+V+ QT+VMVK+   A
Sbjct  369   SSCFLTNTDSRNDTTINFQGIDYEVPAWSVSILPDCQDVVYNTAKVSAQTSVMVKKKNVA  428

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 AAL WSWRPE  D +IL GKG+ + NQILDQK A ND SDY++YMTSV+L +DDPI
Sbjct  429   EDEPAALSWSWRPETNDKSILFGKGEVSVNQILDQKDAGNDQSDYLFYMTSVSLKEDDPI  488

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             W  +M L + G+GQVLHV+ NG+++ SQW      + +FE  IKLN GKN +TLLSA++G
Sbjct  489   WGDNMTLRITGSGQVLHVFVNGEFIGSQWAKYGVFDYVFEQKIKLNKGKNTITLLSATVG  548

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  FDL   G+ G VE+VG + DE + K+L SHKWSYKVGL G    L+     S 
Sbjct  549   FANYGANFDLTQAGVRGPVELVGYHDDEIIIKDLSSHKWSYKVGLEGLHQNLY-----SS  603

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              +S+W  D+ PT +  TWYK +FKAP G DPVVVDL+G+GKG AWVNGN++GRYW     
Sbjct  604   DSSKWQQDNYPTNKMFTWYKATFKAPLGTDPVVVDLLGLGKGLAWVNGNSIGRYWPSFIA  663

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  + CDYRG Y+NNKC++NCG PTQR+YHVPRSFLN  GDN LVLFEE GG+ S V
Sbjct  664   EDGCSLDPCDYRGSYDNNKCVTNCGKPTQRWYHVPRSFLNNEGDNTLVLFEEFGGDPSSV  723

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT+  G  C  A ENK  E+SCQ GR I+AIK+A+FG+      G F KG C  + DA
Sbjct  724   NFQTIAIGSACVGAEENKKIELSCQ-GRQISAIKFASFGNP-LGTCGSFSKGTCEASNDA  781

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +I++ AC+G+ SC++  SE  FG+T C     K L VEA+C
Sbjct  782   FSIIQKACVGQESCTIDVSEDTFGSTTCGDDVIKTLAVEAIC  823



>gb|KGN66324.1| hypothetical protein Csa_1G597710 [Cucumis sativus]
Length=772

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/582 (60%), Positives = 431/582 (74%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RT EDLA+SVARFFQLGGTFQNYYMYHGGTNF R AGGPYITT
Sbjct  196   TENWTGWFKSWGGRDPVRTPEDLAFSVARFFQLGGTFQNYYMYHGGTNFDRMAGGPYITT  255

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGNLNQPK+GHLK+LH  L S+EK +V GN+TTT L +S+ +T YA +  
Sbjct  256   TYDYNAPLDEYGNLNQPKFGHLKQLHAALKSIEKALVSGNVTTTDLTDSVSITEYATDKG  315

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             K+CFFSN NET DA +NY G D+ VPAWSVSILPDC+ EVYNTA+VNTQT+VMVK+  KA
Sbjct  316   KSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYNTAKVNTQTSVMVKKENKA  375

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                   L W WRPE  D+T   GKGQ TAN+++DQK  AND SDY+WYMTSVNL K DPI
Sbjct  376   ENEPEVLEWMWRPENIDNTARLGKGQVTANKLIDQKDAANDASDYLWYMTSVNLKKKDPI  435

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             WS +M L +N +G ++H + NG+++ SQW +    N +FE  +KL  GKN+++LLSA+IG
Sbjct  436   WSNEMTLRINVSGHIVHAFVNGEHIGSQWASYDVYNYIFEQEVKLKPGKNIISLLSATIG  495

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              +NYG  +DL  +G+ G V+++G++GDET+ K+L +HKWSY+VGL G EN+LF  S +SR
Sbjct  496   LKNYGAQYDLIQSGIVGPVQLIGRHGDETIIKDLSNHKWSYEVGLHGFENRLF--SPESR  553

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              A++W S +LP  R MTWYKT+FK P G DPV +DL G+GKG AWVNG+++GRYW     
Sbjct  554   FATKWQSGNLPVNRMMTWYKTTFKPPLGTDPVTLDLQGLGKGMAWVNGHSIGRYWPSFIA  613

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  E CDYRG Y N KC+ +CG PTQ++YHVPRS+LN  GDN LVLFEE GGN S V
Sbjct  614   EDGCSDEPCDYRGSYTNTKCVRDCGKPTQQWYHVPRSWLN-EGDNTLVLFEEFGGNPSLV  672

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              F+T+     C  AYE K  E+SCQ G+ IT IK+A+FGD      G F KG C G  DA
Sbjct  673   NFKTIAMEKACGHAYEKKSLELSCQ-GKEITGIKFASFGDP-TGSCGNFSKGSCEGKNDA  730

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + I++  C+GK SC +  SE  FG TNCA    K+L VEAVC
Sbjct  731   MKIVEDLCIGKESCVIDISEDTFGATNCALGVVKRLAVEAVC  772



>ref|XP_004144130.1| PREDICTED: beta-galactosidase 15-like [Cucumis sativus]
Length=827

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/582 (60%), Positives = 431/582 (74%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RT EDLA+SVARFFQLGGTFQNYYMYHGGTNF R AGGPYITT
Sbjct  251   TENWTGWFKSWGGRDPVRTPEDLAFSVARFFQLGGTFQNYYMYHGGTNFDRMAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGNLNQPK+GHLK+LH  L S+EK +V GN+TTT L +S+ +T YA +  
Sbjct  311   TYDYNAPLDEYGNLNQPKFGHLKQLHAALKSIEKALVSGNVTTTDLTDSVSITEYATDKG  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             K+CFFSN NET DA +NY G D+ VPAWSVSILPDC+ EVYNTA+VNTQT+VMVK+  KA
Sbjct  371   KSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYNTAKVNTQTSVMVKKENKA  430

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                   L W WRPE  D+T   GKGQ TAN+++DQK  AND SDY+WYMTSVNL K DPI
Sbjct  431   ENEPEVLEWMWRPENIDNTARLGKGQVTANKLIDQKDAANDASDYLWYMTSVNLKKKDPI  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             WS +M L +N +G ++H + NG+++ SQW +    N +FE  +KL  GKN+++LLSA+IG
Sbjct  491   WSNEMTLRINVSGHIVHAFVNGEHIGSQWASYDVYNYIFEQEVKLKPGKNIISLLSATIG  550

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              +NYG  +DL  +G+ G V+++G++GDET+ K+L +HKWSY+VGL G EN+LF  S +SR
Sbjct  551   LKNYGAQYDLIQSGIVGPVQLIGRHGDETIIKDLSNHKWSYEVGLHGFENRLF--SPESR  608

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              A++W S +LP  R MTWYKT+FK P G DPV +DL G+GKG AWVNG+++GRYW     
Sbjct  609   FATKWQSGNLPVNRMMTWYKTTFKPPLGTDPVTLDLQGLGKGMAWVNGHSIGRYWPSFIA  668

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  E CDYRG Y N KC+ +CG PTQ++YHVPRS+LN  GDN LVLFEE GGN S V
Sbjct  669   EDGCSDEPCDYRGSYTNTKCVRDCGKPTQQWYHVPRSWLN-EGDNTLVLFEEFGGNPSLV  727

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              F+T+     C  AYE K  E+SCQ G+ IT IK+A+FGD      G F KG C G  DA
Sbjct  728   NFKTIAMEKACGHAYEKKSLELSCQ-GKEITGIKFASFGDP-TGSCGNFSKGSCEGKNDA  785

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + I++  C+GK SC +  SE  FG TNCA    K+L VEAVC
Sbjct  786   MKIVEDLCIGKESCVIDISEDTFGATNCALGVVKRLAVEAVC  827



>ref|XP_011000544.1| PREDICTED: beta-galactosidase 15-like [Populus euphratica]
Length=823

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/582 (60%), Positives = 429/582 (74%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDLA++VARF+QLGGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  249   TENWTGWFKSWGGKDPHRTAEDLAFAVARFYQLGGTFQNYYMYHGGTNFGRTAGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLKELH+VLHS+E  +  GNI++    NS+  T+Y+    
Sbjct  309   SYDYDAPLDEYGNLNQPKWGHLKELHDVLHSMEDTLTRGNISSVDFGNSVSGTIYSTEKG  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF +N++   D TIN+QG DY+VPAWSVSILPDC+  VYNTA+V+ QT+VMVK+   A
Sbjct  369   SSCFLTNTDSRNDTTINFQGIDYEVPAWSVSILPDCQDVVYNTAKVSAQTSVMVKKKNVA  428

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 AAL WSWRPE  D +IL GKG+ + NQILDQK A ND SDY++YMTSV+L +DDPI
Sbjct  429   EDEPAALSWSWRPETNDKSILFGKGEVSVNQILDQKDAGNDQSDYLFYMTSVSLKEDDPI  488

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             W  +M L + G+GQVLHV+ NG+++ SQW      + +FE  IKLN GKN +TLLSA++G
Sbjct  489   WGDNMTLRITGSGQVLHVFVNGEFIGSQWAKYGVFDYVFEQKIKLNKGKNTITLLSATVG  548

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  FDL   G+ G VE+VG + DE + K+L SHKWSYKVGL G    L+     S 
Sbjct  549   FANYGANFDLTQAGVRGPVELVGYHDDEIIIKDLSSHKWSYKVGLEGLHQNLY-----SS  603

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              +S+W  D+ PT +  TWYK +FKAP G DPVVVDL+G+GKG AWVNGN++GRYW     
Sbjct  604   DSSKWQQDNYPTNKMFTWYKATFKAPLGTDPVVVDLLGLGKGLAWVNGNSIGRYWPSFIA  663

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  + CDYRG Y+NNKC++NCG PTQR+YHVPRSFLN  GDN LVLFEE GG+ S V
Sbjct  664   EDGCGLDPCDYRGSYDNNKCVTNCGKPTQRWYHVPRSFLNNEGDNTLVLFEEFGGDPSSV  723

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT+  G  C  A ENK  E+SCQ GR I+AIK+A+FG+      G F KG C  + DA
Sbjct  724   NFQTIAIGSACVGAEENKKIELSCQ-GRPISAIKFASFGNP-LGTCGSFSKGTCEASNDA  781

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +I++ AC+G+ SC++  SE  FG+T C     K L VEA+C
Sbjct  782   FSIIQKACVGQESCTIDVSEDTFGSTTCGDDVIKTLAVEAIC  823



>ref|XP_002516256.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF46258.1| beta-galactosidase, putative [Ricinus communis]
Length=848

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/583 (60%), Positives = 439/583 (75%), Gaps = 15/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAED+A++VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  271   TENWTGWFKSWGGKDPHRTAEDVAFAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  330

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH++LHS+E  + +GNI+T   DNS+  T+YA +  
Sbjct  331   SYDYDAPLDEYGNLNQPKWGHLKQLHDILHSMEYTLTHGNISTIDYDNSVTATIYATDKE  390

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CFF N+NET+DATI ++GT+Y VPAWSVSILPDC+   YNTA+V TQT +MVK+  +A
Sbjct  391   SACFFGNANETSDATIVFKGTEYNVPAWSVSILPDCENVGYNTAKVKTQTAIMVKQKNEA  450

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 ++L+WSW PE    T L GKG   A Q++DQK  AND SDY+WYMTS+++ KDDP+
Sbjct  451   EDQPSSLKWSWIPENTHTTSLLGKGHAHARQLIDQKAAANDASDYLWYMTSLHIKKDDPV  510

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             WS DM L VNG+G VLH Y NGK++ SQ+      + +FE ++KL  GKN+++LLSA++G
Sbjct  511   WSSDMSLRVNGSGHVLHAYVNGKHLGSQFAKYGVFSYVFEKSLKLRPGKNVISLLSATVG  570

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYGP FDL   G+ G VEI+G  GDE V K+L SHKWSY VGL G  N+L+  S+ SR
Sbjct  571   LQNYGPMFDLVQTGIPGPVEIIGHRGDEKVVKDLSSHKWSYSVGLNGFHNELY--SSNSR  628

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
              AS+W+   LPT + M WYKT+FKAP G+DPVV+DL GMGKGFAWVNGNN+GRYW   LA
Sbjct  629   HASRWVEQDLPTNKMMIWYKTTFKAPLGKDPVVLDLQGMGKGFAWVNGNNIGRYWPSFLA  688

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             + D C TE CDYRG Y+NNKC++NCG PTQR+YHVPRSF N   +N LVLFEE GGN + 
Sbjct  689   EEDGCSTEVCDYRGAYDNNKCVTNCGKPTQRWYHVPRSFFNDY-ENTLVLFEEFGGNPAG  747

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV  G V  SA E +  E+SC  G++I+AI++A+FGD +    G + KG C G+ D
Sbjct  748   VNFQTVTVGKVSGSAGEGETIELSCN-GKSISAIEFASFGDPQ-GTSGAYVKGTCEGSND  805

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A +I++ AC+GK +C + AS+ VFG T+C       L V+A C
Sbjct  806   AFSIVQKACVGKETCKLEASKDVFGPTSCGSDVVNTLAVQATC  848



>ref|XP_002516237.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF46239.1| beta-galactosidase, putative [Ricinus communis]
Length=825

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/583 (59%), Positives = 443/583 (76%), Gaps = 16/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAED+A++VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  249   TENWTGWFKSWGGKDPHRTAEDVAFAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLK+LH+VLHS+E+ +  G +++   DNS+  T+YA +  
Sbjct  309   SYDYDAPLDEFGNLNQPKWGHLKQLHDVLHSMEEILTSGTVSSVDYDNSVTATIYATDKE  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+NET+DATI ++GT Y +PAWSVSILPDC    YNTA+V TQT+VMVK   KA
Sbjct  369   SSCFLSNANETSDATIEFKGTTYTIPAWSVSILPDCANVGYNTAKVKTQTSVMVKRDNKA  428

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L WSWRPE  D T+L G+G   A QI+DQK VAND SDY+WYMTSV+L KDD I
Sbjct  429   EDEPTSLNWSWRPENVDKTVLLGQGHIHAKQIVDQKAVANDASDYLWYMTSVDLKKDDLI  488

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASIG  877
             WSKDM + +NG+G +LH Y NG+Y+ SQW+    +N +FE ++KL HG+NL+TLLSA++G
Sbjct  489   WSKDMSIRINGSGHILHAYVNGEYLGSQWSEYSVSNYVFEKSVKLKHGRNLITLLSATVG  548

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG  +DL   G+ G VE+VG+ GDET+ K+L +++WSYKVGL G E+KL+ S   S+
Sbjct  549   LANYGANYDLIQAGILGPVELVGRKGDETIIKDLSNNRWSYKVGLLGLEDKLYLSD--SK  606

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
              AS+W    LPT + +TWYKT+FKAP G DPVV+DL G+GKG AW+NGN++GRYW   LA
Sbjct  607   HASKWQEQELPTNKMLTWYKTTFKAPLGTDPVVLDLQGLGKGMAWINGNSIGRYWPSFLA  666

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             + D C T+ CDYRG Y+NNKC+SNCG PTQR+YHVPRSFL +  +N LVLFEE GGN S+
Sbjct  667   EDDGCSTDLCDYRGPYDNNKCVSNCGKPTQRWYHVPRSFL-QDNENTLVLFEEFGGNPSQ  725

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV TG  C S  E +V EISC  G++I+A+++A+FGD +    G   KG C G +D
Sbjct  726   VNFQTVVTGVACVSGDEGEVVEISCN-GQSISAVQFASFGDPQ-GTCGSSVKGSCEGTED  783

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A+ I++ AC+G  SCS+  S  +FG+T+C      +L VE +C
Sbjct  784   ALLIVQKACVGNESCSLEVSHKLFGSTSCDNG-VNRLAVEVLC  825



>ref|XP_004171681.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15-like [Cucumis 
sativus]
Length=827

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/582 (60%), Positives = 430/582 (74%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RT EDLA+SVARFFQLGGTFQNYYMYHGGTNF R AGGPYITT
Sbjct  251   TENWTGWFKSWGGRDPVRTPEDLAFSVARFFQLGGTFQNYYMYHGGTNFDRMAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGNLNQPK+GHLK+LH  L S+EK +V GN+TTT L +S+ +T YA +  
Sbjct  311   TYDYNAPLDEYGNLNQPKFGHLKQLHAALKSIEKALVSGNVTTTDLTDSVSITEYATDKG  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             K+CFFSN NET DA +NY G D+ VPAWSVSILPDC+ EVYNTA+VNTQT+VMVK+  KA
Sbjct  371   KSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYNTAKVNTQTSVMVKKENKA  430

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                   L W WRPE  D+T   GKGQ TAN+++DQK  AND SDY+WYMTSVNL K DPI
Sbjct  431   ENEPEVLEWMWRPENIDNTARLGKGQVTANKLIDQKDAANDASDYLWYMTSVNLKKKDPI  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             WS +M L +N +G ++H + NG+++ SQW +    N + E  +KL  GKN+++LLSA+IG
Sbjct  491   WSNEMTLRINVSGHIVHAFVNGEHIGSQWASYDVYNYIXEQEVKLKPGKNIISLLSATIG  550

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              +NYG  +DL  +G+ G V+++G++GDET+ K+L +HKWSY+VGL G EN+LF  S +SR
Sbjct  551   LKNYGAQYDLIQSGIVGPVQLIGRHGDETIIKDLSNHKWSYEVGLHGFENRLF--SPESR  608

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              A++W S +LP  R MTWYKT+FK P G DPV +DL G+GKG AWVNG+++GRYW     
Sbjct  609   FATKWQSGNLPVNRMMTWYKTTFKPPLGTDPVTLDLQGLGKGMAWVNGHSIGRYWPSFIA  668

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D C  E CDYRG Y N KC+ +CG PTQ++YHVPRS+LN  GDN LVLFEE GGN S V
Sbjct  669   EDGCSDEPCDYRGSYTNTKCVRDCGKPTQQWYHVPRSWLN-EGDNTLVLFEEFGGNPSLV  727

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              F+T+     C  AYE K  E+SCQ G+ IT IK+A+FGD      G F KG C G  DA
Sbjct  728   NFKTIAMEKACGHAYEKKSLELSCQ-GKEITGIKFASFGDP-TGSCGNFSKGSCEGKNDA  785

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + I++  C+GK SC +  SE  FG TNCA    K+L VEAVC
Sbjct  786   MKIVEDLCIGKESCVIDISEDTFGATNCALGVVKRLAVEAVC  827



>ref|XP_010050435.1| PREDICTED: beta-galactosidase 15-like [Eucalyptus grandis]
Length=829

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/585 (61%), Positives = 431/585 (74%), Gaps = 17/585 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DP+RTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  250   TENWTGWFKSWGGVDPHRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLKELH++LHS+E  +  GNIT   L NS+  TVYA  G 
Sbjct  310   SYDYDAPLDEYGNLNQPKWGHLKELHDMLHSVEGTLTTGNITNVDLGNSVYATVYATPGQ  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              TCF  N+N T+DAT  +QG  + VPAWSVSILPDC+ E YNTA+VN Q++VMV E  KA
Sbjct  370   STCFLGNTNSTSDATFVFQGKQFTVPAWSVSILPDCQNEGYNTAKVNVQSSVMVMEPNKA  429

Query  542   AA---ALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
              +   +L W+WRPE+ADD +  GKG+  A++++DQK  AN  SDY+WYMTSVNL  DDP+
Sbjct  430   ESEPESLSWTWRPEIADDQVTLGKGRVAAHRLVDQKDAANGASDYLWYMTSVNLKDDDPV  489

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTLLSASIG  877
             WS +M L VN TGQ+LH Y NG Y+ SQW    N + +FE N+KLN GKNL++LLS +IG
Sbjct  490   WSDNMTLRVNCTGQILHAYVNGNYLGSQWALYGNFHYVFEKNVKLNPGKNLISLLSVTIG  549

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFR--SSNK  1048
              QNYGP FDL  NG+ G VEI G+ GDE V K+L  H WSYKVGL G  +K F    +  
Sbjct  550   LQNYGPMFDLVQNGVPGPVEIEGRKGDERVIKDLSGHLWSYKVGLHGINHKFFSIDPALD  609

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL  1228
             S SAS+W S  LPT R ++WYKT+FKAP G DPVVVDL G+GKG AWVNG ++GRYW   
Sbjct  610   SASASKWQSKDLPTNRSLSWYKTTFKAPLGTDPVVVDLQGLGKGEAWVNGKSIGRYWPSY  669

Query  1229  -AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
              A  D C T+ CDYRG Y+N KC++NCG PTQR+YHVPRSF+     N LVLFEE GGN 
Sbjct  670   DASLDGCSTDPCDYRGAYDNTKCVTNCGGPTQRWYHVPRSFM-EEDVNTLVLFEEFGGNP  728

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             S V FQTV  G  CA+A+E K  +++CQ GR I+A+K+A+FGD +    G F KG C G+
Sbjct  729   SLVNFQTVTVGSACANAHEKKTLKLACQ-GRPISAVKFASFGDPQ-GSCGSFAKGSCEGS  786

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              DAV IL+ AC+GK SCS+  SE  FG+T C    TK+L VE  C
Sbjct  787   NDAVAILQNACVGKESCSIDVSEKTFGSTTCG--STKRLAVEVSC  829



>gb|KHN17741.1| Beta-galactosidase 7 [Glycine soja]
Length=830

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/583 (59%), Positives = 435/583 (75%), Gaps = 15/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK WGG+DP+RTAED+A++VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  253   TENWIGWFKNWGGRDPHRTAEDVAFAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPK+GHLKELH+ L ++E+ +  GN++ T L NS++VT+YA NG+
Sbjct  313   SYDYDAPLDEYGNIAQPKWGHLKELHSALKAMEEALTSGNVSETDLGNSVKVTIYATNGS  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+N TADAT+ ++G +Y VPAWSVSILPDC+ E YNTA+VN QT+VM KE  KA
Sbjct  373   SSCFLSNTNTTADATLTFRGNNYTVPAWSVSILPDCQHEEYNTAKVNVQTSVMTKENSKA  432

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                AA L+W WR E  D   LHGK   +A+++LDQK  AND SDY+WYMT +++  DDP+
Sbjct  433   EKEAAILKWVWRSENIDKA-LHGKSNVSAHRLLDQKDAANDASDYLWYMTKLHVKHDDPV  491

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASIG  877
             WS++M L +NG+G V+H + NG+Y+DS W     +N  FE  IKL HG N ++LLS ++G
Sbjct  492   WSENMTLRINGSGHVIHAFVNGEYIDSHWATYGIHNDKFEPKIKLKHGTNTISLLSVTVG  551

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYG +F     GL G +E+V   G+ET+ KNL SHKWSYK+GL G ++KLF   +   
Sbjct  552   LQNYGAFFATWHAGLVGPIELVSVKGEETIIKNLSSHKWSYKIGLHGWDHKLFSDDSPFA  611

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL-A  1231
             + S+W S+ LPT R +TWYKT+FKAP G DPVVVDL GMGKG+AWVNG N+GR W    A
Sbjct  612   AQSKWESEKLPTNRMLTWYKTTFKAPLGTDPVVVDLQGMGKGYAWVNGKNIGRIWPSYNA  671

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             + D C  E CDYRGEY+++KC++NCG PTQR+YHVPRS+L + G N LVLF E GGN S 
Sbjct  672   EEDGCSDEPCDYRGEYSDSKCVTNCGKPTQRWYHVPRSYL-KDGANTLVLFAELGGNPSL  730

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV  G VCA+AYENK  E+SCQ GR I+AIK+A+FGD +G CG          + +
Sbjct  731   VNFQTVVVGNVCANAYENKTLELSCQ-GRKISAIKFASFGDPKGVCGAFTNGSCESKS-N  788

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A+ I++ AC+GK +CS+  SE  FG T C G+  K+L VEAVC
Sbjct  789   ALPIVQKACVGKEACSIDVSEKTFGATAC-GNLAKRLAVEAVC  830



>ref|XP_006601406.1| PREDICTED: beta-galactosidase 7-like [Glycine max]
Length=830

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/583 (59%), Positives = 435/583 (75%), Gaps = 15/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK WGG+DP+RTAED+A++VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  253   TENWIGWFKNWGGRDPHRTAEDVAFAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPK+GHLKELH+ L ++E+ +  GN++ T L NS++VT+YA NG+
Sbjct  313   SYDYDAPLDEYGNIAQPKWGHLKELHSALKAMEEALTSGNVSETDLGNSVKVTIYATNGS  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+N TADAT+ ++G +Y VPAWSVSILPDC+ E YNTA+V  QT+VM KE  KA
Sbjct  373   SSCFLSNTNTTADATLTFRGNNYTVPAWSVSILPDCQHEEYNTAKVKEQTSVMTKENSKA  432

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                AA L+W WR E  D   LHGK   +A+++LDQK  AND SDY+WYMT +++  DDP+
Sbjct  433   EKEAAILKWVWRSENIDKA-LHGKSNVSAHRLLDQKDAANDASDYLWYMTKLHVKHDDPV  491

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASIG  877
             WS++M L +NG+G V+H + NG+Y+DS W     +N  FE  IKL HG N ++LLS ++G
Sbjct  492   WSENMTLRINGSGHVIHAFVNGEYIDSHWATYGIHNDKFEPKIKLKHGTNTISLLSVTVG  551

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYG +FD    GL G +E+V   G+ET+ KNL SHKWSYK+GL G ++KLF   +   
Sbjct  552   LQNYGAFFDTWHAGLVGPIELVSVKGEETIIKNLSSHKWSYKIGLHGWDHKLFSDDSPFA  611

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL-A  1231
             + S+W S+ LPT R +TWYKT+FKAP G DPVVVDL GMGKG+AWVNG N+GR W    A
Sbjct  612   AQSKWESEKLPTNRMLTWYKTTFKAPLGTDPVVVDLQGMGKGYAWVNGKNIGRIWPSYNA  671

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             + D C  E CDYRGEY+++KC++NCG PTQR+YHVPRS+L + G N LVLF E GGN S 
Sbjct  672   EEDGCSDEPCDYRGEYSDSKCVTNCGKPTQRWYHVPRSYL-KDGANTLVLFAELGGNPSL  730

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV  G VCA+AYENK  E+SCQ GR I+AIK+A+FGD +G CG          + +
Sbjct  731   VNFQTVVVGNVCANAYENKTLELSCQ-GRKISAIKFASFGDPKGVCGAFTNGSCESKS-N  788

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A+ I++ AC+GK +CS+  SE  FG T C G+  K+L VEAVC
Sbjct  789   ALPIVQKACVGKEACSIDLSEKTFGATAC-GNLAKRLAVEAVC  830



>ref|XP_008450952.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15 [Cucumis 
melo]
Length=826

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/582 (60%), Positives = 428/582 (74%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DP RT EDLA+SVARFFQLGGTFQNYYMYHGGTNF R AGGPYITT
Sbjct  250   TENWTGWFKSWGGSDPVRTPEDLAFSVARFFQLGGTFQNYYMYHGGTNFDRMAGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGNLNQPKYGHLK+LH  L S+EK ++ GN+TTT L +S+ +T YA +  
Sbjct  310   TYDYNAPLDEYGNLNQPKYGHLKQLHAALKSIEKALISGNVTTTDLVDSVSITEYATDEG  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             K+CFFSN NET DA +NY G D+ VPAWSVSILPDC+ EVYNTA+VNTQT+VMVK+  KA
Sbjct  370   KSCFFSNINETTDALVNYLGKDFNVPAWSVSILPDCQEEVYNTAKVNTQTSVMVKKENKA  429

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                   L W WRPE  D T   GKG  +AN+++DQK  AND SDY+WYMTSVNL K DPI
Sbjct  430   EDEPEVLEWMWRPENIDSTARLGKGHASANKLIDQKDAANDASDYLWYMTSVNLKKRDPI  489

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
             WS  M L +N +G ++H + NG+++ SQW +    N +FE  +KL  GKNL++LLSA+IG
Sbjct  490   WSNQMTLRINVSGHIVHAFVNGEHIGSQWASYDVYNYIFEQEVKLKPGKNLISLLSATIG  549

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              +NYGP +DL  +G+ G V++VG++GDETV K+L +HKW+Y+VGL G +N LF  S +SR
Sbjct  550   LKNYGPQYDLIQSGIVGPVQLVGRHGDETVIKDLSNHKWTYEVGLHGFDNHLF--SLESR  607

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              A++W S +LP  R MTWYKT+FK P G +PV +DL G+GKG AWVNG+++GRYW     
Sbjct  608   FATKWQSGNLPVNRMMTWYKTTFKPPLGTEPVTLDLQGLGKGMAWVNGHSIGRYWPSFIA  667

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              D+C  E CDYRG Y+N KC+ +CG PTQ++YHVPRS+LN  GDN LVLFEE GGN S V
Sbjct  668   KDECSDEPCDYRGSYSNTKCVRDCGKPTQQWYHVPRSWLN-EGDNTLVLFEEFGGNPSLV  726

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              F+T+     C  AYE K  E+SCQ G+ I+ IK+A+FGD      G F KG C G  DA
Sbjct  727   NFKTITMEKACGHAYEKKSLELSCQ-GKEISGIKFASFGDP-TGSCGNFSKGSCEGKNDA  784

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + I++  C+G+ SC V  SE  FG TNCA    K+L VE VC
Sbjct  785   MKIVEDLCVGQESCVVDISEDTFGATNCALGVVKRLAVEVVC  826



>ref|XP_011000543.1| PREDICTED: beta-galactosidase 7-like [Populus euphratica]
Length=771

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/584 (59%), Positives = 436/584 (75%), Gaps = 18/584 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+K WGGKDP+RTAEDLA++VARF+Q+GGTFQNYYMYHGGTNFGR+AGGPYITT
Sbjct  195   TENWTGWYKNWGGKDPHRTAEDLAFAVARFYQMGGTFQNYYMYHGGTNFGRSAGGPYITT  254

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKL-DNSIQVTVYAFNG  358
             +YDY+APLDEYGNLNQPK+GHLK+LH++LHS+E  +  GN+++  L D+S+  T+Y+  G
Sbjct  255   SYDYDAPLDEYGNLNQPKWGHLKQLHDLLHSMEDILTTGNVSSVDLGDDSVWGTIYSKEG  314

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
               +CF +N ++ +D  IN+QG +Y VPAWSVSILPDC    YNTA+V+TQT+VMVK+   
Sbjct  315   GSSCFLANVDQGSDKRINFQGVNYTVPAWSVSILPDCLNVSYNTAKVSTQTSVMVKKANV  374

Query  539   A---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
             A     +L+WSWRPE+ D TIL  KG  T NQILDQK  AND+SDY++YMTSVNL KDDP
Sbjct  375   AEDEPISLKWSWRPEMDDRTILLAKGDVTVNQILDQKEAANDLSDYLFYMTSVNLKKDDP  434

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASI  874
             +WS +M L V  +GQ+LH + NG+ + SQW+ N     +FE N+KLNH KN ++LLSA++
Sbjct  435   VWSYNMTLRVKSSGQILHAFVNGELIGSQWSKNGGENFVFEQNVKLNHKKNTISLLSATV  494

Query  875   GFQNYGPYFDLGGNGLYG-VEIVGKNGD-ETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             GF NYG  FDL  +G+ G VE++G +GD E V K+L S KWSYK+GL G   +L+ S   
Sbjct  495   GFTNYGANFDLAPSGITGPVELIGYHGDDEIVVKDLSSQKWSYKIGLEGLNQELYSSQ--  552

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL  1228
                + +W  D  P  R +TWYKT FKAP G DPVVVDL+GMGKG AWVNGN++GRYW   
Sbjct  553   ---SLKWQEDSFPVNRTLTWYKTVFKAPLGTDPVVVDLLGMGKGLAWVNGNSIGRYWPSF  609

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
                 DC  E CDYRG Y++NKCLSNCG+PTQR+YHVPRSFLN  GDN LVLFEE GGN S
Sbjct  610   IAEGDCNLEPCDYRGSYDSNKCLSNCGHPTQRWYHVPRSFLNDNGDNSLVLFEEFGGNPS  669

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
              V FQ +  G  C SA EN+  E+SCQ GR I+A+K+A+FG+ +    G F KG C G+K
Sbjct  670   SVNFQAIAIGSACISAEENRKIELSCQ-GRPISAVKFASFGNPQ-GACGSFVKGYCEGSK  727

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             DA+++++ AC+G+ SC++  SE+ FG+T C     K L VEA+C
Sbjct  728   DALSVVEKACVGQESCTIDVSEATFGSTTCGDDVIKTLSVEAIC  771



>ref|XP_007204034.1| hypothetical protein PRUPE_ppa020752mg [Prunus persica]
 gb|EMJ05233.1| hypothetical protein PRUPE_ppa020752mg [Prunus persica]
Length=817

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/583 (61%), Positives = 433/583 (74%), Gaps = 25/583 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGRTA   YITT
Sbjct  250   TENWTGWFKSWGGKDPLRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRTAAA-YITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYGNLNQPK+GHLK+LH +L S+E  + +GNITT    NS+  T+YA N +
Sbjct  309   TYDYDAPLDEYGNLNQPKWGHLKQLHEILKSMEYTLTHGNITTIDFGNSVSATMYATNDS  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N+N + D TI +QG  Y +PAWSVSILPDCK E YNTA+VNTQT+  VK   KA
Sbjct  369   ASCFFGNANSSTDHTITFQGNKYTIPAWSVSILPDCKTEGYNTAKVNTQTSFKVKMMNKA  428

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L W WRPE  DDT L GKG+ TAN+++DQK VA D SDY+WYMTSV L+KDDPI
Sbjct  429   EDEPESLGWLWRPENIDDTRLQGKGEVTANKLMDQKEVAADASDYLWYMTSVYLNKDDPI  488

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTLLSASIG  877
             WS +M L +N TG +LH Y NG+Y+ S+W    + N +FE N+KLN GKN+++LLSA++G
Sbjct  489   WSGNMTLKINATGFILHAYVNGEYLGSEWAKYNDYNYVFEKNVKLNPGKNVISLLSATVG  548

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  F++   G+ G V +VG+NGDE V K+L +HKWSY+VGL G +N+LF  S  SR
Sbjct  549   FPNYGGGFEVINTGVPGPVVLVGQNGDEMVIKDLSAHKWSYEVGLHGLKNQLF--STDSR  606

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
              A++W +++LP  R MTWYKT+FKAP G DPVVVDL G+GKG AWVNGN+LGRYW   LA
Sbjct  607   YAAKWSAENLPINRMMTWYKTTFKAPLGTDPVVVDLQGLGKGHAWVNGNSLGRYWPSYLA  666

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             K D C  EACDYRG Y+NNKC+ NCG PTQR+YHVPRSF+ + G+N LVLFEE GGN S 
Sbjct  667   KEDGCSLEACDYRGSYDNNKCVFNCGKPTQRWYHVPRSFM-QDGENTLVLFEEFGGNPSL  725

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV TG VCA+AYE    E++CQ GR I++IK+A+FG+ +     G       G+ D
Sbjct  726   VNFQTVTTGTVCANAYEKHTLELACQ-GRPISSIKFASFGNPQ-----GRCGSFEKGSCD  779

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A N     C+GK  CS+  SES  G+ NC G+  K+L VEAVC
Sbjct  780   ANN----ECVGKEKCSIDVSESKLGSANC-GASVKRLAVEAVC  817



>ref|XP_006475097.1| PREDICTED: beta-galactosidase 7-like [Citrus sinensis]
Length=834

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/584 (58%), Positives = 430/584 (74%), Gaps = 14/584 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAEDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGPY+TT
Sbjct  254   TENWTGWFKSWGGKDPKRTAEDLAFAVARFFQFGGTFQNYYMYHGGTNFGRTSGGPYLTT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG+LNQPK+GHL+ELH +L S+EK + YGN+T T   NS+  TVYA    
Sbjct  314   SYDYDAPIDEYGHLNQPKWGHLRELHKLLKSMEKTLTYGNVTNTDYGNSVSATVYATEEG  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
              +CF +N N++ D+TI +QG+ Y +PAWSVSILPDCK E +NTA+VNTQT V VK   + 
Sbjct  374   SSCFLANENQSEDSTITFQGSSYNLPAWSVSILPDCKTEEFNTAKVNTQTNVKVKRPNQA  433

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
             G   A+L+W WRPE+ +D ++ GKG F  N ++DQK  NDVSDY+WYMT+ +L  DDPI 
Sbjct  434   GNDQASLQWKWRPEMINDFVVRGKGHFALNTLIDQKSTNDVSDYLWYMTNTDLKDDDPIL  493

Query  713   --SKDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASI  874
               S +M L +N +GQVLH Y NG YVDSQW     +N LFE  +KL  GKN ++LLSA++
Sbjct  494   SGSSNMTLRINSSGQVLHAYVNGNYVDSQWTKYGASNDLFERPVKLTRGKNQISLLSATV  553

Query  875   GFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
             G QNYG  FD+  NG+ G V +VG+ GDET+ K+L SHKW+YKVGL G ++K F ++  +
Sbjct  554   GLQNYGSKFDMVPNGIPGPVLLVGRAGDETIIKDLSSHKWTYKVGLYGLDDKKFYNAKAA  613

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LIL  1228
              S   W S ++P  RRMTWYKT+F+AP   DPVV++L GMGKGFAWVNG NLGRYW   L
Sbjct  614   NSERGWSSKNVPLNRRMTWYKTTFEAPLENDPVVLNLQGMGKGFAWVNGYNLGRYWPTYL  673

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
             A+ D C TEACDYRG Y +NKC  NCGNP+Q +YHVPRS++ + G N LVLFEE GGN S
Sbjct  674   AEEDGCSTEACDYRGPYGSNKCAYNCGNPSQIWYHVPRSWI-KDGVNTLVLFEEFGGNPS  732

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
             ++ FQTV  G  C  A+ENK  E++C  GR I+ IKYA+FGD +G+CG   +        
Sbjct  733   QINFQTVVVGTACGQAHENKTMELTCH-GRRISEIKYASFGDPQGACGAFKKGSCEAEI-  790

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             D + +++  C+GK SCS+ ASE+  G T+CA    K+LVVEA+C
Sbjct  791   DVLPLIEKQCVGKKSCSIEASETNLGATSCAAGTVKRLVVEALC  834



>ref|XP_002297749.2| hypothetical protein POPTR_0001s06310g, partial [Populus trichocarpa]
 gb|EEE82554.2| hypothetical protein POPTR_0001s06310g, partial [Populus trichocarpa]
Length=819

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/585 (59%), Positives = 429/585 (73%), Gaps = 21/585 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDLA+SVARF+QLGGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  244   TENWTGWFKSWGGKDPHRTAEDLAFSVARFYQLGGTFQNYYMYHGGTNFGRTAGGPYITT  303

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQV---TVYAF  352
             +YDY+APLDEYGNLNQPK+GHLKELH+VLHS+E  +  G  T+ +L  +I     T+Y+ 
Sbjct  304   SYDYDAPLDEYGNLNQPKWGHLKELHDVLHSMEDTLHEG--TSPQLTLAILSRFGTIYST  361

Query  353   NGTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
                 +CF +N++   D TIN+QG DY+VPAWSVSILPDC+  VYNTA+V+ QT+VMVK+ 
Sbjct  362   EKGSSCFLTNTDSRNDTTINFQGLDYEVPAWSVSILPDCQDVVYNTAKVSAQTSVMVKKK  421

Query  533   GKA---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKD  700
               A    AAL WSWRPE  D +IL GKG+ + NQILDQK  AND+SDY++YMTSV+L +D
Sbjct  422   NVAEDEPAALTWSWRPETNDKSILFGKGEVSVNQILDQKDAANDLSDYLFYMTSVSLKED  481

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSA  868
             DPIW  +M L + G+GQVLHV+ NG+++ SQW      + +FE  IKLN GKN +TLLSA
Sbjct  482   DPIWGDNMTLRITGSGQVLHVFVNGEFIGSQWAKYGVFDYVFEQQIKLNKGKNTITLLSA  541

Query  869   SIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
             ++GF NYG  FDL   G+ G VE+VG + DE + K+L SHKWSYKVGL G    L+ S  
Sbjct  542   TVGFANYGANFDLTQAGVRGPVELVGYHDDEIIIKDLSSHKWSYKVGLEGLRQNLYSSD-  600

Query  1046  KSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
                 +S+W  D+ PT +  TWYK +FKAP G DPVVVDL+G+GKG AWVNGN++GRYW  
Sbjct  601   ----SSKWQQDNYPTNKMFTWYKATFKAPLGTDPVVVDLLGLGKGLAWVNGNSIGRYWPS  656

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
                 D C  + CDYRG Y+NNKC++NCG PTQR+YHVPRSFLN  GDN LVLFEE GG+ 
Sbjct  657   FIAEDGCSLDPCDYRGSYDNNKCVTNCGKPTQRWYHVPRSFLNNEGDNTLVLFEEFGGDP  716

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             S V FQT   G  C +A E K  E+SCQ GR I+AIK+A+FG+      G F KG C  +
Sbjct  717   SSVNFQTTAIGSACVNAEEKKKIELSCQ-GRPISAIKFASFGNP-LGTCGSFSKGTCEAS  774

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              DA++I++ AC+G+ SC++  SE  FG+T C     K L VEA+C
Sbjct  775   NDALSIVQKACVGQESCTIDVSEDTFGSTTCGDDVIKTLAVEAIC  819



>emb|CDY65885.1| BnaCnng48970D [Brassica napus]
Length=821

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/583 (58%), Positives = 423/583 (73%), Gaps = 18/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW++ WGGK+P+RT ED+A+SVARFFQ G TFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  247   TENWTGWYQNWGGKNPHRTTEDVAFSVARFFQRGETFQNYYMYHGGTNFGRTAGGPYITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPKYGHLK+LH++LHS+EK + YGN++T    N +  T+Y   G 
Sbjct  307   SYDYDAPLDEFGNLNQPKYGHLKQLHDILHSMEKTLTYGNVSTIDFGNFVSATIYKTEGG  366

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE++DATIN+QG  Y VP WSVSILPDCK EVYNTA++NTQT+VMVK+  +A
Sbjct  367   SSCFFGNVNESSDATINFQGETYVVPTWSVSILPDCKTEVYNTAKINTQTSVMVKKPNEA  426

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                   L+WSWRPE  D+ +L G+G+ T  Q+ DQK V+ND SDY+WYMT++NL ++DP+
Sbjct  427   EDKPINLKWSWRPENIDNFLLKGRGESTMRQLFDQKIVSNDQSDYLWYMTTLNLKEEDPV  486

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
             W K+M L +N T  VLH + NG++V +    N     +FE   K N G N+++LLS ++G
Sbjct  487   WGKNMYLHINSTAHVLHAFVNGQHVGNYHAENGKFHYVFEQEAKFNPGDNVISLLSITVG  546

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G V I+GKN DET+ K+L +HKWSYK GL G EN+LF     S 
Sbjct  547   LPNYGAFFENVPAGITGPVFIIGKNDDETIVKDLSAHKWSYKTGLSGFENQLF----SSE  602

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
             S S+W  D +P  R MTWYKT+FKAP G +PVVVDL+G+GKG AW+NGNN+GRYW   L+
Sbjct  603   SQSKWSGDSVPFNRTMTWYKTTFKAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPEFLS  662

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               D C TE C+YRG Y   KC +NCG PTQR+YHVPRSFLN +GDN LVLFEE GGN S 
Sbjct  663   TEDGCSTE-CNYRGAYYAEKCQTNCGEPTQRWYHVPRSFLNPKGDNTLVLFEEIGGNPSF  721

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT+  GGVCA+ YE  V E+SC  GR I+AIK+A+FG+ RG CG   +       KD
Sbjct  722   VNFQTIGVGGVCANVYEKNVLELSCH-GRPISAIKFASFGNPRGKCGSFEKGTCEAN-KD  779

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              VNIL   C+GK  CSV  S   FG   C G+ T+ L VEA+C
Sbjct  780   VVNILSAECVGKEKCSVNVSAEKFGVPECDGA-TRSLAVEALC  821



>ref|XP_006452850.1| hypothetical protein CICLE_v10010454mg [Citrus clementina]
 gb|ESR66090.1| hypothetical protein CICLE_v10010454mg [Citrus clementina]
Length=834

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/584 (57%), Positives = 426/584 (73%), Gaps = 14/584 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAEDLA++VARFFQ GGT QNYYMYHGGTNFGRT+GGPY+TT
Sbjct  254   TENWTGWFKSWGGKDPKRTAEDLAFAVARFFQFGGTVQNYYMYHGGTNFGRTSGGPYLTT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG+LNQPK+GHL+ELH +L S+EK + +GN+T T   NS+  TVYA    
Sbjct  314   SYDYDAPIDEYGHLNQPKWGHLRELHKLLKSMEKTLTHGNVTNTDYGNSVSATVYATEEG  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
              +CF +N N++ D+TI +QG+ Y +PAWSVSILPDCK E +NTA+VNTQT V VK   + 
Sbjct  374   SSCFLANENQSEDSTITFQGSSYNLPAWSVSILPDCKTEEFNTAKVNTQTNVKVKRPNQA  433

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
             G   A L+W WRPE+ +D ++ GKG F  N ++DQK  NDVSDY+WYMT+ +L  DDPI 
Sbjct  434   GNDQAPLQWKWRPEMINDFVVRGKGHFALNTLIDQKSTNDVSDYLWYMTNADLKDDDPIL  493

Query  713   --SKDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASI  874
               S +M L +N +GQVLH Y NG YVDSQW     +N LFE  +KL  GKN ++LLSA++
Sbjct  494   SGSSNMTLRINSSGQVLHAYVNGNYVDSQWTKYGASNDLFERPVKLTRGKNQISLLSATV  553

Query  875   GFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
             G QNYG  FD+  NG+ G V +VG+ GDET+ K+L SHKW+YKVGL G ++K F ++  +
Sbjct  554   GLQNYGSKFDMVPNGIPGPVLLVGRVGDETIIKDLSSHKWTYKVGLYGLDDKKFYNAKAA  613

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LIL  1228
              S   W S ++P  RRMTWYKT+F+ P   DPVV++L GMGKGFAWVNG NLGRYW   L
Sbjct  614   NSERGWSSKNVPLNRRMTWYKTTFEVPLENDPVVLNLQGMGKGFAWVNGYNLGRYWPTYL  673

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
             A+ D C TE+CDYRG Y ++KC  NCGNP+Q +YHVPRS+L + G N LVLFEE GGN S
Sbjct  674   AEEDGCSTESCDYRGPYGSDKCAYNCGNPSQIWYHVPRSWL-KDGVNTLVLFEEFGGNPS  732

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
             ++ FQTV  G  C  A+ENK  E++C  GR I+ IKYA+FGD +G+CG   +        
Sbjct  733   QINFQTVVVGTACGQAHENKTMELTCH-GRRISEIKYASFGDPQGACGAFKKGSCEAEI-  790

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             D + +++  C+GK SCSV ASE+  G T+C     K+LVVEA+C
Sbjct  791   DVLPLIEKQCVGKKSCSVEASEANLGATSCVTGTVKRLVVEALC  834



>ref|XP_006368617.1| hypothetical protein POPTR_0001s06300g, partial [Populus trichocarpa]
 gb|ERP65186.1| hypothetical protein POPTR_0001s06300g, partial [Populus trichocarpa]
Length=783

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/581 (58%), Positives = 427/581 (73%), Gaps = 30/581 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+K WGGKDP+RTAEDLA++VARF+QLGGTFQNYYMYHGGTNFGR+AGGPYITT
Sbjct  225   TENWTGWYKNWGGKDPHRTAEDLAFAVARFYQLGGTFQNYYMYHGGTNFGRSAGGPYITT  284

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKL-DNSIQVTVYAFNG  358
             +YDY+APLDEYGNLNQPK+GHLK+LH++LHS+E  +  GN+++  L D+S+  T+Y+  G
Sbjct  285   SYDYDAPLDEYGNLNQPKWGHLKQLHDLLHSMEDILTTGNVSSVDLGDDSVWGTIYSNEG  344

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
               +CF +N ++  D TIN+QG +Y VPAWSVSILPDC+   YNTA+              
Sbjct  345   GSSCFLANVDQGTDKTINFQGINYTVPAWSVSILPDCQNVSYNTAK--------------  390

Query  539   AAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWS  715
                +L+WSWRPE+ D TIL GKG  T NQILDQK  AND+SDY++YMTS+NL KDDP+WS
Sbjct  391   -PISLKWSWRPEMDDKTILLGKGDVTINQILDQKEAANDLSDYLFYMTSINLKKDDPVWS  449

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQ  883
              +M L V  +GQ+LH + NG+ + SQW+ N     +FE N+KLNH KN ++LLSA++GF 
Sbjct  450   YNMTLRVKSSGQILHAFVNGELIGSQWSKNGGESFVFEQNVKLNHKKNTISLLSATVGFT  509

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGD-ETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG  FDL  +G+ G VE++G +GD ETV K+L S KWSYK+GL G   +L+ S      
Sbjct  510   NYGANFDLVPSGITGPVELIGYHGDDETVAKDLSSQKWSYKIGLEGLNQELYSSQ-----  564

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
             + +W  D  P  R +TWYKT FKAP G DPVVVDL+GMGKG AWVNGN++GRYW      
Sbjct  565   SLKWQEDSFPVNRTLTWYKTVFKAPLGTDPVVVDLLGMGKGLAWVNGNSIGRYWPSFIAE  624

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
              DC  E CDYRG Y+++KCLSNCG+PTQR+YHVPRSFLN  GDN LVLFEE GGN S V 
Sbjct  625   GDCNLEPCDYRGSYDSSKCLSNCGHPTQRWYHVPRSFLNDTGDNTLVLFEEFGGNPSSVN  684

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
             FQT+  G  C SA EN+  E+SCQ GR+I+A+K+A+FG+ +    G F KG C G+KDA+
Sbjct  685   FQTIAIGSACISAEENRKIELSCQ-GRSISAVKFASFGNPQ-GACGSFVKGFCEGSKDAL  742

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++++ AC+G+ SC++  SE  F +T C     K L VEA+C
Sbjct  743   SVVEKACVGQESCTIDVSEDTFSSTTCGDDVIKTLSVEAIC  783



>ref|XP_010540711.1| PREDICTED: beta-galactosidase 15 [Tarenaya hassleriana]
Length=822

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/581 (58%), Positives = 419/581 (72%), Gaps = 14/581 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDPYRTAEDLA++VARFFQ GG+FQNYYM+HGGTNFGRT GGPYITT
Sbjct  246   TENWTGWFKSWGGKDPYRTAEDLAFAVARFFQKGGSFQNYYMFHGGTNFGRTTGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGNLNQPKYGHLK+LH+VLHS+E  +  G ++     NS+  T YA    
Sbjct  306   TYDYNAPLDEYGNLNQPKYGHLKQLHDVLHSMETTLTQGEVSNVDFGNSVSATTYATKEA  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFFSN+N ++DATIN QG +Y +PAWSV++LPDCK E YNTA+VN QT+VM K+G   
Sbjct  366   SSCFFSNANTSSDATINVQGRNYTIPAWSVTVLPDCKTETYNTAKVNAQTSVMEKKGKDK  425

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
             A  +RWSWR E  ++ ++ G+G  T ++++DQK +A+D SDY+WYMT VNLD++DP+   
Sbjct  426   AKKMRWSWRLEDVEEMVMKGRGDATFSKLVDQKEMADDQSDYLWYMTKVNLDQNDPVLGN  485

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGFQN  886
             +  L +N T  VLHVY NG++V SQW      N +FE  +K   G N+++LLS ++GFQN
Sbjct  486   NSSLRINCTAHVLHVYVNGEHVGSQWAKDGKFNYVFEPTVKFIPGVNIISLLSVTVGFQN  545

Query  887   YGPYFDLGGNGLYG-VEIVGKN--GDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             YG +FDL   G+ G V+IVG+N  G ET  K+L +  W+YK GL G +N+ FRS    RS
Sbjct  546   YGSFFDLAPAGITGSVQIVGRNGAGAETAVKDLSTQAWTYKTGLNGFKNQFFRS---DRS  602

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
             +S W   ++PT R MTWYKTSFKAP G +PVVVDL G+GKG AW+NGNN+GRYW     G
Sbjct  603   SSGWSKSNVPTNRMMTWYKTSFKAPYGTEPVVVDLQGLGKGTAWINGNNIGRYWPSFLAG  662

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
              D  +E CDYRG Y + KC SNCG PTQR+YHVPRSF N +G N LVLFEE GGN S VR
Sbjct  663   QDGCSEVCDYRGSYGSEKCRSNCGQPTQRWYHVPRSFFNPKGKNTLVLFEEMGGNPSLVR  722

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
             FQTV    VCA+ YEN V E+SC G R I+ IK+A+FG+ R    G F K  C  + DAV
Sbjct  723   FQTVAVTTVCANVYENNVLELSCNGKR-ISEIKFASFGNPR-GECGSFNKDTCDASNDAV  780

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +L   C+GK  CSV  SE  FG +NC G+   +L VEAVC
Sbjct  781   AVLTKECVGKERCSVNVSEVKFGASNCGGA-ANRLAVEAVC  820



>ref|XP_004288998.1| PREDICTED: beta-galactosidase-like [Fragaria vesca subsp. vesca]
Length=823

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/583 (59%), Positives = 428/583 (73%), Gaps = 22/583 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DP RTAED+A++VARFFQ GGTFQNYYMYHGGTNFGRTA   YITT
Sbjct  253   TENWTGWFKSWGGLDPLRTAEDVAFAVARFFQYGGTFQNYYMYHGGTNFGRTAAS-YITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG+LNQPK+GHLKELH VL S+E  + YGNITTT+L NS+  TV+A N +
Sbjct  312   SYDYDAPLDEYGHLNQPKWGHLKELHEVLKSMEHTLTYGNITTTELGNSVSTTVFATNES  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +C F N+N +ADATI +QG  + VPAWSVSILPDCK E YNTA+VNTQTT+ VK   KA
Sbjct  372   SSCIFGNANNSADATITFQGKTHIVPAWSVSILPDCKEEAYNTAKVNTQTTLKVKSVNKA  431

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L+WSWRPE  D  +L GKG+  AN +++QK  AND SDY+WYMTSV + KDDP+
Sbjct  432   EDEPQSLQWSWRPERIDTELL-GKGEVVANLLMEQKEAANDASDYLWYMTSVQISKDDPV  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
                +M L +N TG +LH Y NG++V SQW      N +FE  IKL  G N ++LLSA++G
Sbjct  491   LIGNMTLRINETGYILHAYVNGEHVGSQWAKYNVFNYVFEKPIKLVPGVNTISLLSATVG  550

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  F+    G+ G VE+VG+NGDETV KNL   KWSYKVGL G  ++LF S+++  
Sbjct  551   FPNYGGGFEDIKTGIIGPVELVGQNGDETVIKNLSERKWSYKVGLHGMNDQLFSSASR--  608

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
                +W  + +P  R MTWYKT+FKAP G +PVVVDL G+GKG AWVNG+++GRYW   LA
Sbjct  609   ---KWSVEGVPENRTMTWYKTTFKAPLGTEPVVVDLQGLGKGHAWVNGHSIGRYWPSYLA  665

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               D C  EACDYRG Y+NNKC+ NCG PTQR+YHVPRSFL +  +N LVLFEE GGN S 
Sbjct  666   PEDGCSVEACDYRGTYDNNKCVFNCGKPTQRWYHVPRSFL-QDDENTLVLFEEFGGNPSY  724

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT+R G +CA+AYEN   E++CQ GR+I+AIK+A+FG+       G  K     +K 
Sbjct  725   VNFQTIRVGTICANAYENHTLELACQ-GRSISAIKFASFGNPE--GTCGSFKEGTCDSKT  781

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A++IL+  C+GK +CS+  SES+FG+T C G   K+L VEAVC
Sbjct  782   ALSILQKECVGKEACSIDVSESMFGSTTCGGI-VKRLAVEAVC  823



>ref|XP_003541315.2| PREDICTED: beta-galactosidase-like [Glycine max]
Length=827

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/583 (58%), Positives = 429/583 (74%), Gaps = 15/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK WGG+DP+RTAED+A++VARFFQ GGTFQNYYMYHGGTNF RTAGGPYITT
Sbjct  250   TENWVGWFKNWGGRDPHRTAEDVAFAVARFFQTGGTFQNYYMYHGGTNFDRTAGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPK+GHLKELHNVL S+E+ +  GN++ T   NS++ T+YA NG+
Sbjct  310   SYDYDAPLDEYGNIAQPKWGHLKELHNVLKSMEETLTSGNVSETDFGNSVKATIYATNGS  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF S++N T DAT+ ++G +Y VPAWSVSILPDC+ E YNTA+VN QT+VMVKE  KA
Sbjct  370   SSCFLSSTNTTTDATLTFRGKNYTVPAWSVSILPDCEHEEYNTAKVNVQTSVMVKENSKA  429

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                A AL+W WR E  D+  LHGK   +AN++LDQK  AND SDY+WYMT +++  DDP+
Sbjct  430   EEEATALKWVWRSENIDNA-LHGKSNVSANRLLDQKDAANDASDYLWYMTKLHVKHDDPV  488

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASIG  877
             W ++M L +N +G V+H + NG+++ S W     +N  FE  IKL HG N ++LLS ++G
Sbjct  489   WGENMTLRINSSGHVIHAFVNGEHIGSHWATYGIHNDKFEPKIKLKHGTNTISLLSVTVG  548

Query  878   FQNYGPYFDLGGNGLY-GVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYG +FD    GL   +E+V   GDET+ KNL S+KWSYKVGL G ++KLF   +   
Sbjct  549   LQNYGAFFDTWHAGLVEPIELVSVKGDETIIKNLSSNKWSYKVGLHGWDHKLFSDDSPFA  608

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL-A  1231
             + ++W S+ LPT R +TWYKT+F AP G DPVVVDL GMGKG+AWVNG N+GR W    A
Sbjct  609   APNKWESEKLPTDRMLTWYKTTFNAPLGTDPVVVDLQGMGKGYAWVNGQNIGRIWPSYNA  668

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             + D C  E CDYRGEY ++KC++NCG PTQR+YHVPRS+L + G N LVLF E GGN S+
Sbjct  669   EEDGCSDEPCDYRGEYTDSKCVTNCGKPTQRWYHVPRSYL-KDGANNLVLFAELGGNPSQ  727

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV  G VCA+AYENK  E+SCQ GR I+AIK+A+FGD  G CG          + +
Sbjct  728   VNFQTVVVGTVCANAYENKTLELSCQ-GRKISAIKFASFGDPEGVCGAFTNGSCESKS-N  785

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A++I++ AC+GK +CS   SE  FG T C G+  K+L VEAVC
Sbjct  786   ALSIVQKACVGKQACSFDVSEKTFGPTAC-GNVAKRLAVEAVC  827



>emb|CDX79397.1| BnaC06g19060D [Brassica napus]
Length=607

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/582 (56%), Positives = 415/582 (71%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+ +RT ED+A+SVARFFQ GGTF NYYMYHGGTNF R AGGPYITT
Sbjct  33    TENWTGWFKQWGGKNLHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRAAGGPYITT  92

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+EK + YGNI+T +  NS   T+Y     
Sbjct  93    SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKTLTYGNISTIEFGNSASATIYKTEEG  152

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DATI++QG  Y VPAWSV+ILPDCK E YNTA++ TQT++MVK+  +A
Sbjct  153   SSCFFGNGNEKSDATISFQGESYVVPAWSVTILPDCKNEAYNTAKITTQTSMMVKKPNEA  212

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K DP 
Sbjct  213   EDTPSTLKWSWRPENMDNFLLKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDPF  272

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L VN T  VLH + NGK++ +Q   N     +FE ++K   G+N++ LLS ++G
Sbjct  273   SGKNMSLRVNSTAHVLHAFVNGKHIGNQHAENGKFNYVFEKDVKFKSGRNVIALLSITVG  332

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I G+NGDET+ K+L +HKWSYK GL G E++LFR    + 
Sbjct  333   LANYGAFFESKPAGITGPIFITGRNGDETIVKDLSAHKWSYKTGLIGFESQLFR----TE  388

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYKT+FK+P G DPVVVDLMG+GKG AWVNGNN+GRYW     
Sbjct  389   SMSKWSVESVPFNRTMTWYKTTFKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFIS  448

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              ++     C+YRG Y+  KCL+NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  449   SENGCDAKCNYRGAYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLV  508

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G VCA+ YE  + E+SC   + I+AIK+A+FG+      G F KG C  + + 
Sbjct  509   SFQTTRVGSVCANVYEKNIIELSCD-RKQISAIKFASFGNP-DGDCGSFVKGTCESSNNT  566

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+IL   C+GK  CS+  S+  FG  +C+G+  ++L VEA+C
Sbjct  567   VDILTQECVGKEKCSIDVSKEKFGAPDCSGA-ARRLAVEAIC  607



>emb|CDX79398.1| BnaC06g19050D [Brassica napus]
Length=730

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/582 (56%), Positives = 416/582 (71%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  156   TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  215

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+E+ + YGNI+T +  NS   T+Y     
Sbjct  216   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERTLTYGNISTIEFGNSASATIYETEEG  275

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DATI++QG  Y VPAWSV+ILPDCK E YNTA++ TQT++MVK+  +A
Sbjct  276   SSCFFGNGNEKSDATISFQGESYVVPAWSVTILPDCKNEAYNTAKITTQTSMMVKKPNEA  335

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K DP 
Sbjct  336   EDTPSTLKWSWRPENMDNFLLKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDPF  395

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L VN T  VLH + NGK++  Q   N     +FE ++K   G+N++ LLS ++G
Sbjct  396   SGKNMSLRVNSTAHVLHAFVNGKHIGCQHAENGKFNYVFEKDVKFKSGRNVIALLSITVG  455

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I G+NGDET+ K+L +HKWSYK GL G E++LFR    + 
Sbjct  456   LANYGAFFESKPAGITGPIFITGRNGDETIVKDLSAHKWSYKTGLIGFESQLFR----TE  511

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYKT+FK+P G DPVVVDLMG+GKG AWVNGNN+GRYW     
Sbjct  512   SMSKWSVESVPFNRTMTWYKTTFKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFIS  571

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              ++     C+YRG Y+  KCL+NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  572   SENGCDAKCNYRGVYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLV  631

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G VCA+ YE  + E+SC   + I+AIK+A+FG+      G F KG C  + + 
Sbjct  632   SFQTTRVGSVCANVYEKNIIELSCD-RKQISAIKFASFGNP-DGDCGSFVKGTCESSNNT  689

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+IL   C+GK  CS+  S   FG  +C+G+ T++L VEA+C
Sbjct  690   VDILTQECVGKEKCSIDVSTKKFGVPDCSGA-TRRLAVEAIC  730



>gb|KFK44946.1| hypothetical protein AALP_AA1G323300 [Arabis alpina]
Length=820

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/582 (57%), Positives = 417/582 (72%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RT ED+A++VARFFQ GGTFQNYYMYHGGTNF RT+GGPYITT
Sbjct  246   TENWTGWFKNWGGKDPHRTTEDVAFAVARFFQKGGTFQNYYMYHGGTNFDRTSGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNLNQPKYGHLK+LH+VLHS+EK + +GNI+     N    T+Y  N  
Sbjct  306   TYDYDAPLDEFGNLNQPKYGHLKQLHDVLHSMEKTLTHGNISNVDFGNLASATIYTTNEG  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NET+DA IN+ GT Y VPAWSVSILPDC+ E YNTA++NTQT+VMVK+  +A
Sbjct  366   SSCFFGNVNETSDAIINFNGTSYDVPAWSVSILPDCRTETYNTAKINTQTSVMVKKPNEA  425

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  ++ DQKV  ND SDY+WYMT+VNL + DP+
Sbjct  426   ENEPSTLKWSWRPENVDNVLLKGKGESTMKRLFDQKVVGNDESDYLWYMTTVNLKEQDPV  485

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
             W K+M + +N T  VLH + NG+++ +   ++  F    E + K   G N++TLLS ++G
Sbjct  486   WGKNMSIRINSTAHVLHAFVNGEHIGNYRADSGKFHYVYEQDAKFIPGTNVITLLSTTVG  545

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G V I+G+NGDETV K+L +HKWSYK GL G  N+LF     S 
Sbjct  546   LPNYGAFFESIPTGITGPVFIIGRNGDETVIKDLSTHKWSYKTGLSGFTNELF----SSE  601

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYKT+FK P G +PVVVDL+G+GKG AW+NGNN+GRYW     
Sbjct  602   SPSKWSGESVPFNRTMTWYKTTFKPPLGNEPVVVDLLGLGKGTAWINGNNIGRYWPAFLA  661

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
             GD+  ++ CDYRG Y   KC +NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  662   GDNGCSDECDYRGAYYAEKCQTNCGEPTQRWYHVPRSFLNSEGDNTLVLFEEVGGNPSLV  721

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTVR G VCA+AYE  V E+SC  G+ I+ IK+A+FG   G   G FEKG C  + DA
Sbjct  722   NFQTVRVGSVCANAYEKNVLELSCH-GKPISDIKFASFG-YPGGKCGSFEKGTCEASNDA  779

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +IL   C+GK  CS+  S   FG   C G+  ++L VEA+C
Sbjct  780   ASILTDECVGKEKCSIDVSSEKFGAPECGGA-ARRLAVEAIC  820



>ref|XP_007022965.1| Beta-galactosidase 7 [Theobroma cacao]
 gb|EOY25587.1| Beta-galactosidase 7 [Theobroma cacao]
Length=823

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/583 (58%), Positives = 416/583 (71%), Gaps = 18/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DPYRTAEDLAYSVARF+Q GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  249   TENWTGWFKSWGGADPYRTAEDLAYSVARFYQKGGTFQNYYMYHGGTNFGRTSGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGN NQPK+GHLK+LH+VLHS+E  + +G++T T L NS+  TVY+    
Sbjct  309   TYDYNAPLDEYGNPNQPKWGHLKQLHDVLHSMEYTLTHGDVTNTDLGNSVSTTVYSTKEK  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN++   DA + + G DY VPAWSVSILPDCK E YNTA+V  QT+V+VK+  KA
Sbjct  369   SSCFLSNAHNQTDAVVKFGGIDYYVPAWSVSILPDCKDEAYNTAKVYAQTSVLVKKPNKA  428

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L W WRPE  + T + GKG   AN+I+DQK +AND SDY+WYMT V L KDDP+
Sbjct  429   EDEPNSLEWVWRPENIERTAVQGKGDHHANRIIDQKAMANDASDYLWYMTRVELPKDDPL  488

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTLLSASIG  877
              +    L V  +G VLH Y NG+Y+ SQW    +   +FE  +KLN GKNL++LLSA++G
Sbjct  489   VTGKATLRVTDSGHVLHAYVNGEYIGSQWAQYGSQKYVFEKEVKLNPGKNLISLLSATVG  548

Query  878   FQNYGPYFDLGGNG-LYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYGP FDL   G L  VE+V   G+E V K+L SHKWSYKVGL G  NKL+ +   S+
Sbjct  549   LQNYGPMFDLNVTGVLSPVELVAHKGNEKVVKDLSSHKWSYKVGLDGVANKLYETDCPSK  608

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
                +W +D +P  R MTWYKT+FKAP G  PVVVDL+G+GKG AWVNG++LGRYW   +A
Sbjct  609   --LKWSADSIPVDRNMTWYKTTFKAPLGNAPVVVDLLGLGKGHAWVNGHSLGRYWPSYIA  666

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                 C T ACDYRG Y++ KC+S CG PTQR+YHVPRSFL + G+N LVLFEE GGN S 
Sbjct  667   DEHACQTVACDYRGAYSDKKCVSKCGEPTQRWYHVPRSFL-KDGENTLVLFEEFGGNPSG  725

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V+FQTV  G  C +A+E K  E+SC   R I+ I +A+FGD +    G F+K  C   +D
Sbjct  726   VQFQTVEIGTACVNAHEGKKVELSCH-NRPISRINFASFGDPQ-GVCGSFKKTECESTED  783

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             AV+IL+  C+GK SCS   SE  FG   CA    K+L VEAVC
Sbjct  784   AVSILEKECVGKESCSFEISEDKFGKAYCA---IKRLAVEAVC  823



>ref|XP_009119501.1| PREDICTED: beta-galactosidase 15-like [Brassica rapa]
Length=700

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/582 (56%), Positives = 415/582 (71%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  126   TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  185

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL+QPKYGHLK+LH+VLHS+EK + YGNI+T    NS   T+Y     
Sbjct  186   SYDYDAPLDEYGNLSQPKYGHLKQLHDVLHSIEKTLTYGNISTIDFGNSASATIYKTEEG  245

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DATI++QG  Y VPAWSV+ILPDCK+E YNTA++ TQT++MVK+  +A
Sbjct  246   SSCFFGNGNEKSDATISFQGESYVVPAWSVTILPDCKKEAYNTAKITTQTSMMVKKPNEA  305

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K DP 
Sbjct  306   ENTPSTLKWSWRPENMDNFLLKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDPF  365

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L VN T  VLH + NGK++ SQ   N     +FE ++K   G+N++ LLS ++G
Sbjct  366   LGKNMSLRVNSTAHVLHAFVNGKHIGSQHAENGKFNYVFEKDVKFKSGRNVIALLSITVG  425

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I G+NGDET+ K+L +HKWSYK GL G E++LFR    + 
Sbjct  426   LANYGAFFESKPAGITGPIFITGRNGDETIVKDLSAHKWSYKTGLIGFESQLFR----TE  481

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R M WYKT+FK+P G DPVVVDLMG+GKG AWVNGNN+GRYW     
Sbjct  482   SMSKWSVESVPFNRTMIWYKTTFKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFIS  541

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              ++     C+YRG Y+  KCL+NCG PTQR+YHVPR FLN  GDN LVLFEE GGN S V
Sbjct  542   SENGCDAKCNYRGAYHAEKCLTNCGEPTQRWYHVPRFFLNAEGDNTLVLFEEIGGNPSLV  601

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G +CA+ YE  + E+SC   + I+AIK+A+FG+      G FEKG C  +K+ 
Sbjct  602   SFQTTRVGSLCANVYEKSIIELSCD-RKPISAIKFASFGNP-DGNCGSFEKGTCESSKNT  659

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +IL   C+GK  CS+  S   FGT +C+G+  + L VEA+C
Sbjct  660   ADILTQECVGKEKCSIDVSTKRFGTPDCSGA-VRSLAVEAIC  700



>emb|CDY69031.1| BnaCnng61490D [Brassica napus]
Length=621

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/582 (56%), Positives = 411/582 (71%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  47    TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  106

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+EK + YGNI+T    NS   T+Y     
Sbjct  107   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKTLTYGNISTIDFGNSASATIYKTEEG  166

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DATI+++G  Y VPAWS++ILPDCK E YNTA++ TQT++MVK+  +A
Sbjct  167   SSCFFGNGNENSDATISFRGESYVVPAWSITILPDCKNEAYNTAKITTQTSMMVKKPNEA  226

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K DP 
Sbjct  227   EDTPSTLKWSWRPENMDNFLLKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDPF  286

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L VN T  VLH + NGKY+ +Q   N     +FE ++K   G+N++ LLS ++G
Sbjct  287   LGKNMSLRVNCTAHVLHAFVNGKYIGNQHAENGKFNYIFEKDVKFKSGRNVIALLSITVG  346

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I G+N DET+ K+L +HKWSYK GL G EN+LFR    + 
Sbjct  347   LANYGAFFESKPAGITGPISITGRNVDETIVKDLSAHKWSYKTGLNGFENQLFR----TE  402

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYK +F AP G DPVVVDL+G+GKG AWVNGNN+GRYW     
Sbjct  403   SMSKWSVESVPFNRTMTWYKATFNAPLGNDPVVVDLLGLGKGTAWVNGNNIGRYWPAFIS  462

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              ++     C+YRG Y+  KCL+NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  463   SENGCAAKCNYRGPYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLV  522

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G VCA+ YE    E+SC   + I+AIK+A+FG+      G FEKG C  + + 
Sbjct  523   NFQTTRVGSVCANVYEKNTIELSCD-RKPISAIKFASFGNP-DGNCGSFEKGTCESSNNT  580

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+IL   C+GK  C +  S   FG  +C GS  ++LVVEA+C
Sbjct  581   VDILTQECVGKEKCFIDVSTEKFGAPDCTGS-ARRLVVEAIC  621



>ref|XP_010245925.1| PREDICTED: beta-galactosidase 15-like [Nelumbo nucifera]
Length=829

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/583 (56%), Positives = 415/583 (71%), Gaps = 16/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DP+RTAED+AY+VARFFQ GG FQNYYMYHGGTNFGRTAGGPYI T
Sbjct  253   TENWTGWFKNWGGADPHRTAEDVAYAVARFFQTGGVFQNYYMYHGGTNFGRTAGGPYIAT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYGNLNQPK+GHLKELH VL S+EK + +G+++ T   N +  T+YA N T
Sbjct  313   TYDYDAPLDEYGNLNQPKWGHLKELHLVLKSMEKVLTHGDVSHTDFGNFVGATIYATNET  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+N T DATI +QG  Y +PAWSVSILPDCK+EVYNTA+++ QT+VMVK+   A
Sbjct  373   SSCFLSNANTTTDATITFQGKQYTIPAWSVSILPDCKKEVYNTAKISAQTSVMVKKVNVA  432

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L+W WRPE   +T L GKG   A+ +++QK V ND SDY+WYMTSVN+D+ DPI
Sbjct  433   EDQPMSLKWLWRPEQITETALQGKGPMVASHLMEQKFVTNDASDYLWYMTSVNMDEKDPI  492

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
             W  D+ L VN TG VLH Y NG ++ SQW  +      FE  IKL  G+N ++LLSA++G
Sbjct  493   WGTDLTLLVNTTGHVLHAYVNGNHIGSQWAEHGGFVFAFEKAIKLKPGRNQISLLSATVG  552

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              +NYG  +DL   G+ G V ++GK   E + K+L S+KW++KVGL GEE +L+   N+  
Sbjct  553   LKNYGAMYDLTPTGILGPVALIGKKTGEEIVKDLSSNKWTFKVGLNGEEKQLY---NEDL  609

Query  1055  SA-SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
             S  S+W S++ PT R MTWYKT+FK P G DPVVVDL G+GKG AWVNG ++GRYW    
Sbjct  610   SHDSEWKSENXPTNRMMTWYKTTFKPPLGTDPVVVDLQGLGKGHAWVNGKSIGRYWPTFL  669

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                D  +  CDYRG Y+++KC++NCG+P+QR+YHVPRSFL R  +N L LFEE GG+   
Sbjct  670   SQQDGCSNTCDYRGPYSDSKCVTNCGHPSQRWYHVPRSFL-RDDENTLTLFEEMGGSPYL  728

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV  G  CA+  E K  E+SCQ G+ I+ I++A+FGD +     G        AKD
Sbjct  729   VNFQTVTVGSACATVQEGKTLELSCQSGQTISEIRFASFGDPQ--GTCGSFVKGSCDAKD  786

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              ++ ++ AC+GK SC +  S++  G  NC G+ TK+L VEAVC
Sbjct  787   ILSTVQNACVGKESCCIEVSKNALGAPNCGGNITKRLAVEAVC  829



>gb|KDP33944.1| hypothetical protein JCGZ_07515 [Jatropha curcas]
Length=825

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/582 (58%), Positives = 421/582 (72%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDLA++VARFFQ GGT QNYYMYHGGTNFGRTAGGPYITT
Sbjct  249   TENWTGWFKGWGGKDPHRTAEDLAFAVARFFQTGGTLQNYYMYHGGTNFGRTAGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYGNLNQPKYGHLK+LH VLHS+E  + +G+I+T   DN++  T+YA    
Sbjct  309   SYDYDAPLNEYGNLNQPKYGHLKQLHAVLHSMEYTLTHGDISTINYDNAVTATIYASEKG  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+N T DATI +Q  +YK+PAWSVSILPDCK   YNTA+V TQTT MV +  K 
Sbjct  369   SSCFLSNANSTTDATIVFQYLEYKIPAWSVSILPDCKNVAYNTAKVTTQTTTMVNQ--KT  426

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIWSKD  721
              +   WSWRPE  + TI+ G G F+A+Q+LDQK+ ND SDY+W+MTSV+L KDDPIW+ D
Sbjct  427   TSFFDWSWRPEDVNSTIVLGSGDFSADQLLDQKIFNDSSDYLWHMTSVDLKKDDPIWTDD  486

Query  722   MRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQNYGPYF  901
             M L +NGTG VLH + NG+ V SQW  N LFE +IKL  G+NL+T+LS+++G QNYG  F
Sbjct  487   MSLRINGTGHVLHAFVNGEIVGSQWRKNDLFEKSIKLKQGRNLITILSSTVGLQNYGARF  546

Query  902   DLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG-----EENKLFRSSNKSRSAS  1063
             DLG  G+ G VE+VG+  DET+ K+L S  W+Y+VGL+G      +N +  + N   +  
Sbjct  547   DLGPTGIPGPVELVGRKNDETIIKDLSSGNWTYRVGLQGLNQTVVDNNIMYNLNLPETF-  605

Query  1064  QWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAKGD  1240
             +W    LP    MTWYK +FK P+G DPVV+D++GM KG AWVNG ++GRYW  ILA  D
Sbjct  606   KWQDKDLPFFTMMTWYKGTFKTPSGNDPVVLDMLGMEKGLAWVNGYSIGRYWPSILADDD  665

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFL--NRRGDNELVLFEETGGNTSRV  1414
             DC TE CDYRG YNNNKCL+NCG P+QR YH+PRSFL  +    N LVLFEE GG+   +
Sbjct  666   DC-TEKCDYRGAYNNNKCLTNCGKPSQRVYHIPRSFLKNDPNATNTLVLFEEFGGSPFFI  724

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
               QTV  G V     E    E+SC  G+ I+AI++A+FGD + +  G FEKG C G+KDA
Sbjct  725   TLQTVTVGKVSGRGNEGDTIELSCY-GKPISAIQFASFGDPQRTSNGSFEKGSCEGSKDA  783

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++I + AC+GK +C++  S  VFG TNC       L VEA+C
Sbjct  784   LSIAQKACVGKETCAIKVSADVFGCTNCEEGVENSLAVEALC  825



>gb|EPS73924.1| hypothetical protein M569_00825, partial [Genlisea aurea]
Length=821

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/585 (58%), Positives = 431/585 (74%), Gaps = 22/585 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP+RTAED+AY+VARFFQ GG FQNYYMYHGGTNFGR+AGGPYITT
Sbjct  247   TENWTGWFKSWGGRDPHRTAEDVAYAVARFFQRGGIFQNYYMYHGGTNFGRSAGGPYITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+APLDEYG LNQPKYGHLK+LH VLHS+EK +  GN+T     NS+  TVYA  NG
Sbjct  307   SYDYDAPLDEYGGLNQPKYGHLKQLHRVLHSIEKQLTDGNVTDIDYGNSVTATVYALPNG  366

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
              K+CF  N+N T  AT+ Y G +Y VPAWSVSILPDCKREVYNTA+V TQTTVM +EGG 
Sbjct  367   RKSCFLGNANSTTAATVVYGGVNYTVPAWSVSILPDCKREVYNTAKVKTQTTVMAREGG-  425

Query  539   AAAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW-S  715
                 L+W WR E  DD +L GKGQ ++  + DQK  +D SDY+WYMTSV+L+++DP++ +
Sbjct  426   -TQTLKWEWRREALDDAVLFGKGQSSSKHLWDQKAIDDASDYLWYMTSVDLEEEDPLFAA  484

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGFQ  883
             K+M + VN TGQ++H Y NG++V S W+      +LF    K   GKN ++LLSA++G Q
Sbjct  485   KNMSIQVNTTGQIVHAYVNGRHVGSNWSTYGDFKTLFSKEAKFRKGKNQISLLSATVGLQ  544

Query  884   NYGPYFDLGGNGLYG-VEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG ++D+  +G+ G V+IVG  NGDE++ K+L  HKW+Y+VGLRG ++   RS N  R 
Sbjct  545   NYGSFYDMMEDGIVGPVQIVGIINGDESITKDLSKHKWNYQVGLRGLKDA--RSVNVDRW  602

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
              +   S+ LP  R MTWY+ +F++P G DPV VDL GMGKG+AWVNGN+LGRYW   LA 
Sbjct  603   TT---SEPLPVNRMMTWYRAAFESPPGEDPVAVDLKGMGKGYAWVNGNSLGRYWPSFLAD  659

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN-TSR  1411
              + C  + CDYRG Y+NNKC+ NCG PTQR+YHVPRSFLN  G NELVLFEE GGN TS 
Sbjct  660   ENGCSDDPCDYRGAYDNNKCVYNCGKPTQRYYHVPRSFLNAGGHNELVLFEEFGGNPTSH  719

Query  1412  VRFQTVRTGGVCASA-YENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
             V F+T+R G VCA+A  +N+   +SC  GR I+AIK+A++GD      G F+KG C  +K
Sbjct  720   VGFKTLRPGSVCATAKQQNQRVTLSCH-GRRISAIKFASYGDPN-GTCGSFQKGTCESSK  777

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK-KLVVEAVC  1720
             DAV +L+  C+GK +C+   S+ +FG T+CA +    KLVVEAVC
Sbjct  778   DAVAVLQF-CVGKETCTFIHSDQMFGATDCAAAAIDVKLVVEAVC  821



>ref|XP_010245924.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15-like [Nelumbo 
nucifera]
Length=820

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/582 (55%), Positives = 413/582 (71%), Gaps = 14/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DP+RTAED+AY+VARFFQ GG FQNYYMYHGGTNFGRTAGGPYI T
Sbjct  244   TENWTGWFKNWGGADPHRTAEDVAYAVARFFQTGGVFQNYYMYHGGTNFGRTAGGPYIAT  303

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYGNLNQPK+GHLKELH VL S+EK + +G+++ T   N +  T+YA N T
Sbjct  304   TYDYDAPLDEYGNLNQPKWGHLKELHLVLKSMEKVLTHGDVSHTDFGNFVGATIYATNET  363

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+N T DATI +QG  Y +PAWSVSILPDCK+EVYNTA+++ QT+VMVK+   A
Sbjct  364   SSCFLSNANTTTDATITFQGKQYTIPAWSVSILPDCKKEVYNTAKISAQTSVMVKKVNAA  423

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L+W WRPE   +T L GKG   A+ +++QK V ND SDY+WYMTSVN+D+ DPI
Sbjct  424   EDQPMSLKWLWRPEQITETALQGKGPMVASHLMEQKFVTNDASDYLWYMTSVNMDEKDPI  483

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
             W  D+ L VN TG VLH Y NG ++ SQ   +      FE  IKL  G+N ++LLSA++G
Sbjct  484   WGTDLTLLVNTTGHVLHAYVNGNHIGSQRAEHGGFVFAFEKAIKLKPGRNQISLLSATVG  543

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              +NYG  +DL   G+ G V ++GK   E + K+L S+KW++KVGL GEE +L+  +    
Sbjct  544   LKNYGAMYDLTPTGILGPVALIGKKTGEEIVKDLSSNKWTFKVGLNGEEKQLY--NEDLS  601

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
               S+W S++ PT R MTWYKT+FK P G DPVVVDL G+GKG AWVNG ++GRYW     
Sbjct  602   HDSEWKSENPPTNRMMTWYKTTFKPPLGTDPVVVDLQGLGKGHAWVNGKSIGRYWPTFLS  661

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
               D  +  CDYRG Y+++KC++NCG+P+QR+YHVPRSFL R  +N L LFEE GG+   V
Sbjct  662   QQDGCSNTCDYRGPYSDSKCVTNCGHPSQRWYHVPRSFL-RDDENTLTLFEEMGGSPYLV  720

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQTV  G VCA+  E K  E+SCQ G+ I+ I++A+FGD +     G        AKD 
Sbjct  721   NFQTVTVGSVCATVQEGKTLELSCQSGQTISEIRFASFGDPQ--GTCGSFVKGSCDAKDI  778

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++ ++ AC+GK SC +  S++  G  NC G+ TK+L VEAVC
Sbjct  779   LSTVQNACVGKESCCIEVSKNALGAPNCGGNITKRLAVEAVC  820



>emb|CDX67790.1| BnaA07g18300D [Brassica napus]
Length=815

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/582 (56%), Positives = 413/582 (71%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  241   TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  300

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+EK + YGNI+T    NS   T+Y     
Sbjct  301   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKILTYGNISTIDFGNSASATIYRTKEG  360

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DATI++QG  Y VPAWSV+ILPDCK E YNTA++ TQT++MVK+  +A
Sbjct  361   SSCFFGNGNENSDATISFQGESYVVPAWSVTILPDCKNEAYNTAKITTQTSMMVKKPNEA  420

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K DP 
Sbjct  421   EDTPSTLKWSWRPENMDNFLLKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDPF  480

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L VN T  VL  + NGK++ +Q+  N     +FE ++K   G+N++ LLS ++G
Sbjct  481   LGKNMSLRVNSTAHVLRAFVNGKHIGNQYAENGKFNYVFEKDVKFKSGRNVIALLSITVG  540

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I G+N DET+ K+L +HKWSYK GL G EN+LFR    + 
Sbjct  541   LANYGAFFESKPAGITGPISITGRNVDETIVKDLSAHKWSYKTGLNGFENQLFR----TE  596

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYK +FKAP G DPVVVDL+G+GKG AWVNGNN+GRYW     
Sbjct  597   SMSKWSVESVPFNRTMTWYKATFKAPLGNDPVVVDLLGLGKGTAWVNGNNIGRYWPAFIS  656

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              ++     C+YRG Y+  KCL+NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  657   SENGCAAKCNYRGPYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLV  716

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT+R G VCA+ YE    E+SC   + I+AIK+A+FG+      G FEKG C  + + 
Sbjct  717   SFQTIRVGSVCANVYEKNSIELSCD-RKPISAIKFASFGNP-DGNCGSFEKGTCESSNNT  774

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +NIL   C+GK  CS+  S   FG  +C GS  ++L VEA+C
Sbjct  775   INILTQECVGKEKCSIDVSTEKFGAPDCTGS-ARRLAVEAIC  815



>ref|XP_010535801.1| PREDICTED: beta-galactosidase 7 [Tarenaya hassleriana]
Length=822

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/579 (56%), Positives = 408/579 (70%), Gaps = 12/579 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK P+RTAEDL+Y+VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  250   TENWTGWFKNWGGKHPFRTAEDLSYAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLK+LHNVL S+EK++ YGNI+     N +  T+YA    
Sbjct  310   SYDYHAPLDEFGNLNQPKWGHLKQLHNVLKSMEKSLTYGNISDIDFGNDVTATIYAMKEG  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SNSN TADA +++QG  Y VPAWSVS+LPDCK   YNTA+VNTQ +VM  +    
Sbjct  370   SSCFISNSNTTADALVSFQGNQYSVPAWSVSVLPDCKNVAYNTAKVNTQESVMATQDAD-  428

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                +RWSWRPE+A+ TI+ GKG   A+ + DQK  AND SDY+WYMT V L+KDDPIWS+
Sbjct  429   VGGIRWSWRPEIAEQTIVKGKGDVVADYLFDQKDFANDASDYLWYMTRVRLEKDDPIWSR  488

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLLTLLSASIGFQN  886
             +M L V+    VLH Y NGK+V + +  +      FE +I+L  G N + LLS ++GFQN
Sbjct  489   NMSLRVHSNAHVLHAYVNGKHVGTHFVEDGKYDYDFEKSIELAPGTNRIALLSVTVGFQN  548

Query  887   YGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSAS  1063
             YGP+F+    G+ G V IVG  GDE + K+L +H W YKVGL G E+K+F  S  S S  
Sbjct  549   YGPFFEKSPAGINGPVMIVGYKGDERIEKDLSAHPWEYKVGLNGVESKVF--SPDSGSNF  606

Query  1064  QWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGDD  1243
             +W ++ LPT+R +TWYKTSFK P+G DPVVVDL G+GKG AW+NG ++GRYW      DD
Sbjct  607   KWSTEKLPTSRMLTWYKTSFKTPSGSDPVVVDLHGLGKGEAWINGKSIGRYWPSFKASDD  666

Query  1244  CPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQ  1423
               ++ CDYRG Y++NKC   CG PTQ  YHVPR+FLN  G+N L L EE GG+ +   F+
Sbjct  667   GCSDECDYRGPYDSNKCTFKCGEPTQTLYHVPRAFLNENGENVLALLEEMGGDPTMASFK  726

Query  1424  TVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNI  1603
             T+  G VCA A EN V E+SC  G+ I+ IK+ NFG+  G CG   +    G  KDA+ +
Sbjct  727   TMSVGSVCAKADENNVIELSCN-GKKISDIKFVNFGNPTGKCGSFAKGTCEGD-KDALKL  784

Query  1604  LKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +   C+GK +C + AS  +FG  +C G   K LVVEAVC
Sbjct  785   VTEECIGKMTCQLEASSKMFGAADC-GDSVKSLVVEAVC  822



>ref|XP_009120777.1| PREDICTED: beta-galactosidase [Brassica rapa]
Length=829

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/581 (56%), Positives = 409/581 (70%), Gaps = 10/581 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  251   TENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH +L S+EK + YGNI+T  L NS+  TVY+ N  
Sbjct  311   SYDYDAPLDEYGNLNQPKWGHLKQLHTLLKSMEKPLTYGNISTIDLGNSVTATVYSTNEK  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N++G DY VPAWSVS+LPDC +E YNTARVNTQT+++ ++    
Sbjct  371   SSCFIGNVNATADALVNFKGKDYNVPAWSVSVLPDCDKEAYNTARVNTQTSIITEDSCDE  430

Query  542   AAALRWSWRPE-VADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWS  715
                L+W+WRPE     TIL G G   A  ++DQK V ND SDY+WYMT V+LDK DPIWS
Sbjct  431   PEKLKWTWRPEFTTQKTILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRVHLDKKDPIWS  490

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQ  883
             ++M L V+    VLH Y NGKYV +Q   ++     FE  + L HG N L LLS S+G Q
Sbjct  491   RNMSLRVHSNAHVLHAYVNGKYVGNQIVRDNKFDYRFEKKVNLVHGTNHLALLSVSVGLQ  550

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYGP+F+ G  G+ G V++VG  GDETV K+L  H+W YK+GL G  NKLF   + +   
Sbjct  551   NYGPFFESGPTGINGPVKLVGYKGDETVEKDLSKHQWDYKIGLNGFNNKLFSLKSANHHQ  610

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGD  1240
              +W ++ LP  R ++WYK +FKAP G+DPV+VDL G+GKG  W+NG ++GRYW      +
Sbjct  611   LKWSTEKLPADRMLSWYKANFKAPLGKDPVIVDLNGLGKGEVWINGQSIGRYWPSFNSSE  670

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRF  1420
             D  TE CDYRGEY ++KC   CG PTQR+YHVPRSFLN +G N + LFEE GG+ S V+F
Sbjct  671   DGCTEECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNDKGHNTITLFEEMGGDPSMVKF  730

Query  1421  QTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVN  1600
             +TV TG VCA A+E+   E+SC   R I+A+K+A+FG+      G F  G C GAKDA  
Sbjct  731   KTVVTGRVCAKAHEHNKVELSCN-NRPISAVKFASFGNP-SGLCGSFAAGTCEGAKDAAK  788

Query  1601  ILKTACLGKASCSVTASESVFGTTNC-AGSRTKKLVVEAVC  1720
             I+   C+GK +C++  S   FG+TN   G   K+L VE  C
Sbjct  789   IVAKECVGKLNCTMNVSSHKFGSTNLDCGDSPKRLFVELEC  829



>ref|XP_006306017.1| hypothetical protein CARUB_v10011312mg, partial [Capsella rubella]
 gb|EOA38915.1| hypothetical protein CARUB_v10011312mg, partial [Capsella rubella]
Length=805

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/585 (56%), Positives = 418/585 (71%), Gaps = 22/585 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG KDP+RT+ED+A++VARFFQ GGTFQNYYMYHGGTNF RT+GGPYITT
Sbjct  231   TENWTGWFKNWGSKDPHRTSEDVAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPYITT  290

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+VLHS+EK + +GNIT     N +  T+Y     
Sbjct  291   SYDYDAPLDEYGNLAQPKYGHLKQLHDVLHSMEKTLTHGNITNIDFGNQVSATIYKTEEG  350

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N NET+DA IN+QGT Y VP WSVSILPDCK   YNTA++NTQT+VMVK+  +A
Sbjct  351   SSCFIGNVNETSDARINFQGTSYDVPPWSVSILPDCKTVTYNTAKINTQTSVMVKKPNEA  410

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQK V+ND SDY+WYMT+VNL + DP+
Sbjct  411   EDEPSTLKWSWRPENVDNVLLKGKGESTMRQLFDQKVVSNDQSDYLWYMTTVNLKEQDPV  470

Query  710   WSKDMRLGVNGTGQVLHVYANGKYV------DSQWNNNSLFETNIKLNHGKNLLTLLSAS  871
             WSK+M + VN T  VLH + NG+++      D ++  + +FE + K N G N++T LS +
Sbjct  471   WSKNMSIRVNSTAHVLHAFVNGQHIGNYRVEDGKF--HYVFEQDAKFNPGANVITFLSIT  528

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             +G  NYG +F+    G+ G V I+G+NGDET+ K+L +HKWSYK GL G EN+LF     
Sbjct  529   VGLPNYGAFFENIPAGITGPVFIIGRNGDETIVKDLSAHKWSYKTGLSGFENQLF----S  584

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL  1228
             + S S W  + +P  R MTWYKT+FKAP G +PVVVDL+G+GKG AW+NGNN+GRYW   
Sbjct  585   AESPSTWSGESVPINRTMTWYKTTFKAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPSF  644

Query  1229  AKG-DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
               G D CP E C+Y+G Y   KC +NCG PTQR+YH+PRSFLN  GDN LVLFEE GGN 
Sbjct  645   LSGIDGCPAE-CNYKGAYYAEKCQTNCGEPTQRWYHIPRSFLNSDGDNTLVLFEEIGGNP  703

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             S V FQT+  G VCA+ YE  V E+SC  G+ I+AIK+A+FG+  G   G FEKG C  +
Sbjct  704   SLVNFQTIGVGSVCANVYEKNVLELSCN-GKPISAIKFASFGNP-GGNCGSFEKGTCEAS  761

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +A  IL   C+GK  CS+  S+  FG   C G   ++L VEA+C
Sbjct  762   NNAAAILTQECVGKEKCSIDVSQEKFGAPECGGD-ARRLAVEAIC  805



>sp|P49676.1|BGAL_BRAOL RecName: Full=Beta-galactosidase; Short=Lactase; Flags: Precursor 
[Brassica oleracea]
 emb|CAA59162.1| beta-galactosidase [Brassica oleracea]
Length=828

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/580 (56%), Positives = 407/580 (70%), Gaps = 9/580 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  251   TENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH +L S+EK + YGNI+T  L NS+  TVY+ N  
Sbjct  311   SYDYDAPLDEYGNLNQPKWGHLKQLHTLLKSMEKPLTYGNISTIDLGNSVTATVYSTNEK  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N++G DY VPAWSVS+LPDC +E YNTARVNTQT+++ ++    
Sbjct  371   SSCFIGNVNATADALVNFKGKDYNVPAWSVSVLPDCDKEAYNTARVNTQTSIITEDSCDE  430

Query  542   AAALRWSWRPE-VADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWS  715
                L+W+WRPE     TIL G G   A  ++DQK V ND SDY+WYMT V+LDK DPIWS
Sbjct  431   PEKLKWTWRPEFTTQKTILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRVHLDKKDPIWS  490

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQ  883
             ++M L V+    VLH Y NGKYV +Q   ++     FE  + L HG N L LLS S+G Q
Sbjct  491   RNMSLRVHSNAHVLHAYVNGKYVGNQIVRDNKFDYRFEKKVNLVHGTNHLALLSVSVGLQ  550

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYGP+F+ G  G+ G V++VG  GDET+ K+L  H+W YK+GL G  +KLF   +     
Sbjct  551   NYGPFFESGPTGINGPVKLVGYKGDETIEKDLSKHQWDYKIGLNGFNHKLFSMKSAGHHH  610

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGD  1240
              +W ++ LP  R ++WYK +FKAP G+DPV+VDL G+GKG  W+NG ++GRYW      D
Sbjct  611   RKWSTEKLPADRMLSWYKANFKAPLGKDPVIVDLNGLGKGEVWINGQSIGRYWPSFNSSD  670

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRF  1420
             +  TE CDYRGEY ++KC   CG PTQR+YHVPRSFLN +G N + LFEE GG+ S V+F
Sbjct  671   EGCTEECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNDKGHNTITLFEEMGGDPSMVKF  730

Query  1421  QTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVN  1600
             +TV TG VCA A+E+   E+SC   R I+A+K+A+FG+      G F  G C GAKDAV 
Sbjct  731   KTVVTGRVCAKAHEHNKVELSCN-NRPISAVKFASFGNP-SGQCGSFAAGSCEGAKDAVK  788

Query  1601  ILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++   C+GK +C++  S   FG+    G   K+L VE  C
Sbjct  789   VVAKECVGKLNCTMNVSSHKFGSNLDCGDSPKRLFVEVEC  828



>gb|KHN07882.1| Beta-galactosidase 7 [Glycine soja]
Length=747

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/575 (57%), Positives = 423/575 (74%), Gaps = 15/575 (3%)
 Frame = +2

Query  26    KKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITTTYDYNAPL  205
             + WGG+DP+RTAED+A++VARFFQ GGTFQNYYMYHGGTNF RTAGGPYITT+YDY+APL
Sbjct  178   QNWGGRDPHRTAEDVAFAVARFFQTGGTFQNYYMYHGGTNFDRTAGGPYITTSYDYDAPL  237

Query  206   DEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGTKTCFFSNS  385
             DEYGN+ QPK+GHLKELHNVL S+E+ +  GN++ T   NS++ T+YA NG+ +CF S++
Sbjct  238   DEYGNIAQPKWGHLKELHNVLKSMEETLTSGNVSETDFGNSVKATIYATNGSSSCFLSST  297

Query  386   NETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA---AAALR  556
             N T DAT+ ++G +Y VPAWSVSILPDC+ E YNTA+VN QT+VMVKE  KA   A AL+
Sbjct  298   NTTTDATLTFRGKNYTVPAWSVSILPDCEHEEYNTAKVNVQTSVMVKENSKAEEEATALK  357

Query  557   WSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSKDMRLG  733
             W WR E  D+  LHGK   +AN++LDQK  AND SDY+WYMT +++  DDP+W ++M L 
Sbjct  358   WVWRSENIDNA-LHGKSNVSANRLLDQKDAANDASDYLWYMTKLHVKHDDPVWGENMTLR  416

Query  734   VNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASIGFQNYGPYF  901
             +NG+G V+H + NG+++ S W     +N  FE  IKL HG N ++LLS ++G QNYG +F
Sbjct  417   INGSGHVIHAFVNGEHIGSHWATYGIHNDKFEPKIKLKHGTNTISLLSVTVGLQNYGAFF  476

Query  902   DLGGNGLY-GVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSASQWLSD  1078
             D    GL   +E+V   GDET+ KNL S+KWSYKVGL G ++KLF   +   + ++W S+
Sbjct  477   DTWHAGLVEPIELVSVKGDETIIKNLSSNKWSYKVGLHGWDHKLFSDDSPFAAPNKWESE  536

Query  1079  HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL-AKGDDCPTE  1255
              LPT R +TWYKT+F AP G DPVVVDL GMGKG+AWVNG N+GR W    A+ D C  E
Sbjct  537   KLPTDRMLTWYKTTFNAPLGTDPVVVDLQGMGKGYAWVNGQNIGRIWPSYNAEEDGCSDE  596

Query  1256  ACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQTVRT  1435
              CDYRGEY ++KC++NCG PTQR+YHVPRS+L + G N LVLF E GGN S+V FQTV  
Sbjct  597   PCDYRGEYTDSKCVTNCGKPTQRWYHVPRSYL-KDGANNLVLFAELGGNPSQVNFQTVVV  655

Query  1436  GGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTA  1615
             G VCA+AYENK  E+SCQ GR I+AIK+A+FGD  G CG          + +A++I++ A
Sbjct  656   GTVCANAYENKTLELSCQ-GRKISAIKFASFGDPEGVCGAFTNGSCESKS-NALSIVQKA  713

Query  1616  CLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             C+GK +CS   SE  FG T C G+  K+L VEAVC
Sbjct  714   CVGKQACSFDVSEKTFGPTAC-GNVAKRLAVEAVC  747



>ref|XP_004288329.1| PREDICTED: beta-galactosidase 15-like [Fragaria vesca subsp. 
vesca]
Length=823

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/583 (58%), Positives = 423/583 (73%), Gaps = 22/583 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DP RTAED+A++VARFFQ GGTFQNYYMYHGGTNF RTA   YITT
Sbjct  253   TENWTGWFKSWGGLDPLRTAEDVAFAVARFFQYGGTFQNYYMYHGGTNFDRTAAS-YITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG+LNQPK+GHLKELH VL S+E  + YGNITTT+L NS+  TV+A N +
Sbjct  312   SYDYDAPLDEYGHLNQPKWGHLKELHEVLKSMEHVLTYGNITTTELGNSLSTTVFATNES  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               C F N+N + DATI +QG  + +PAWSVSILPDCK E YNTA+VNTQTT+ VK   KA
Sbjct  372   SGCIFGNANNSVDATITFQGKTHTIPAWSVSILPDCKEEAYNTAKVNTQTTIKVKSVNKA  431

Query  542   A---AALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L+WSWRPE     +L GKG+  AN++++QK  AND SDY+WYMTSV + KDDP+
Sbjct  432   EDELQSLQWSWRPEKIHTELL-GKGEVVANRLMEQKEAANDASDYLWYMTSVQISKDDPV  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
                +M L +N TG +LH Y NG++V SQW      N +FE  I L  G N ++LLSA++G
Sbjct  491   LIGNMTLRINETGYILHAYVNGEHVGSQWAKYNVFNYVFEKPITLVPGVNTISLLSATVG  550

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  F+    G+ G VE+VG++GDETV KNL   KWSYKVGL G +++LF S+++  
Sbjct  551   FPNYGGGFEDIKTGIVGPVELVGQSGDETVIKNLSERKWSYKVGLHGMKDQLFSSASR--  608

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
                +W  + LP  R MTWYKT+FKAP G +PVVVDL G+GKG AWVNG+++GRYW   LA
Sbjct  609   ---KWSVEGLPVNRTMTWYKTTFKAPLGTEPVVVDLQGLGKGNAWVNGHSIGRYWPSYLA  665

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             + D C  +ACDYRG Y+NNKC+ NCG PTQR+YH+PRSFL +  +N LVLFEE GGN S 
Sbjct  666   QTDGCSLQACDYRGTYDNNKCVFNCGKPTQRWYHIPRSFL-QDDENTLVLFEEFGGNPSY  724

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT+R G +CA+AYEN   +++CQ GR I+AIK+A+FG+       G  +     +  
Sbjct  725   VNFQTIRVGTICANAYENHTLKLACQ-GRPISAIKFASFGNPE--GTCGSFRKGTCDSTT  781

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A++IL+  C+GK SCS+  SES+FG T C G   K+L VEAVC
Sbjct  782   ALSILQKECVGKESCSIDVSESMFGYTTC-GDIMKRLAVEAVC  823



>ref|XP_006290000.1| hypothetical protein CARUB_v10003630mg [Capsella rubella]
 gb|EOA22898.1| hypothetical protein CARUB_v10003630mg [Capsella rubella]
Length=827

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/579 (56%), Positives = 403/579 (70%), Gaps = 9/579 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLAYSVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  252   TENWTGWFKNWGGKHPYRTAEDLAYSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH VL S+EK + YGNI+   L NSI+ T+Y     
Sbjct  312   SYDYHAPLDEYGNLNQPKWGHLKQLHAVLKSIEKPLTYGNISRIDLGNSIKATIYTTKEG  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N+ G DY VPAWSVSILPDC +E YNTA+VNTQT++M  +  K 
Sbjct  372   SSCFIGNVNATADALVNFHGKDYHVPAWSVSILPDCDKEAYNTAKVNTQTSIMTDDSSK-  430

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                L+W+WRPE A  TIL G+G   A  ++DQK V ND SDY+WYMT V+LDK DP+WS+
Sbjct  431   PHMLQWTWRPESAQKTILKGRGNLIAKGLVDQKDVTNDASDYLWYMTRVHLDKKDPLWSR  490

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQN  886
             +M L V+    VLH Y NGKY+  Q+  +      FE  + L HG N ++LLS S+G QN
Sbjct  491   NMSLRVHSNAHVLHAYVNGKYIGHQFVKDGKFDYRFERKVNLVHGTNHISLLSVSVGLQN  550

Query  887   YGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSAS  1063
             YGP+F  G  G+ G V +VG  G+ET+ K+L  H+W YK+G+ G  +KLF +++  R   
Sbjct  551   YGPFFANGPTGINGPVSLVGYKGEETIEKDLSKHQWDYKIGMNGYNHKLFSTNSIGRHHV  610

Query  1064  QWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGDD  1243
             +W ++ L T R +TWYK  FKAP G+DPV+VD  G+GKG AW+NG ++GRYW      DD
Sbjct  611   KWANEKLATGRMLTWYKAHFKAPLGKDPVIVDFNGLGKGEAWINGQSIGRYWPSFNSSDD  670

Query  1244  CPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQ  1423
                + CDYRGEY ++KC   CG PTQR+YHVPRSFLN  G N + LFEE GGN S+V F+
Sbjct  671   GCKDECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSKVNFK  730

Query  1424  TVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNI  1603
             TV  G VCA A+E+   E+SC   R I+A+K+A+FG+      G F  G C G KDAV  
Sbjct  731   TVVVGTVCARAHEHNKVELSCH-DRAISAVKFASFGNP-VGHCGSFAVGTCQGDKDAVKT  788

Query  1604  LKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             L   C+GK +C++  S   FG+++  G   KKL VE  C
Sbjct  789   LVEKCVGKLNCTIDVSSDTFGSSSDCGDSPKKLAVELEC  827



>ref|XP_010541689.1| PREDICTED: beta-galactosidase 7-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010541690.1| PREDICTED: beta-galactosidase 7-like isoform X2 [Tarenaya hassleriana]
Length=823

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/579 (56%), Positives = 409/579 (71%), Gaps = 12/579 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK P+RTAEDL+++VARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  251   TENWTGWFKNWGGKHPFRTAEDLSFAVARFFQTGGTFQNYYMYHGGTNFGRTAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLKELHNVL S+E+++ YGNI+   + NS+ VT YA +  
Sbjct  311   SYDYHAPLDEFGNLNQPKWGHLKELHNVLKSMERSLTYGNISDIDMGNSVTVTTYATSEG  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+N T DA +++QG  Y VPAWSVS+LPDCK+EVYNTA+V+TQ +VMV E    
Sbjct  371   SSCFISNANTTVDAVVSFQGNQYNVPAWSVSVLPDCKKEVYNTAKVSTQESVMVAEDAH-  429

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
              + ++WSWRPE+A+DTIL GKG   A+ + DQK VAND SDY+WYMT V+LDK DPIWS 
Sbjct  430   VSGIQWSWRPEMAEDTILKGKGDVVASGLFDQKAVANDASDYLWYMTRVHLDKSDPIWSH  489

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLLTLLSASIGFQN  886
             +M L V+    VLH Y NG++V + +  +      FE ++KL HG N + LLS ++GF N
Sbjct  490   NMSLRVHSNAHVLHAYVNGEHVGTHFVKDGKYDYDFEKSVKLVHGTNRIALLSVTVGFHN  549

Query  887   YGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSAS  1063
             YG +F+    G+ G V IVG  GDE + K+L  H+W YK+GL G ENK+F  S  S S  
Sbjct  550   YGAFFEKNAAGINGPVSIVGYKGDERIEKDLSGHQWEYKIGLNGIENKVF--SPDSASNL  607

Query  1064  QWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGDD  1243
             +W +   PT R +TWYKT F  P+G  PVVVDL G+GKG AW+NG ++GRYW      +D
Sbjct  608   KWSTQQFPTFRMLTWYKTPFDTPSGNSPVVVDLNGLGKGEAWINGRSIGRYWPSFDADND  667

Query  1244  CPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQ  1423
               +E CDYRG Y++NKC   CG PTQR YHVPR FLN    N L L EE GG+ S   F+
Sbjct  668   GCSEECDYRGPYDSNKCAFKCGEPTQRLYHVPRDFLNGNSSNTLTLLEEMGGDPSMASFK  727

Query  1424  TVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNI  1603
             T+  G  CA A ENKV E+SC  G+ I+A+K+ +FG+      G F KG+C GA+DA  +
Sbjct  728   TIGVGSACARAEENKVVELSCN-GKPISAVKFVSFGNP-TGKCGSFAKGMCDGAEDAEAV  785

Query  1604  LKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               T C+GK +C + AS +VFG  +C G   K L VE VC
Sbjct  786   ASTECVGKMTCKLEASSTVFGAADC-GDLAKSLAVEVVC  823



>gb|KFK26294.1| hypothetical protein AALP_AA8G229300 [Arabis alpina]
Length=824

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/579 (56%), Positives = 408/579 (70%), Gaps = 10/579 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLAYSVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  250   TENWTGWFKNWGGKHPYRTAEDLAYSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH +L S+EK + YGNI+T  L NS   TVY+ N  
Sbjct  310   SYDYHAPLDEYGNLNQPKWGHLKQLHTILKSMEKRLTYGNISTVDLGNSATATVYSTNEG  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TA+A +N+QG DY +PAWSVS+LPDCK+E YNTA+VNTQT++M +E  K 
Sbjct  370   SSCFIGNVNATANALVNFQGKDYHIPAWSVSVLPDCKKEAYNTAKVNTQTSIMTEESSK-  428

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                L W+WRPEVA  TIL G G   A  ++DQK V ND SDY+WYMT V+LDK DPIWS+
Sbjct  429   PKTLEWTWRPEVARKTILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRVHLDKKDPIWSR  488

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQN  886
             +M L ++    VLH YANGKYV  +  N++     FE  + L HG N ++LLS S+G  N
Sbjct  489   NMSLRIHSNAHVLHAYANGKYVGHKIVNDTKFDYRFEKKVNLVHGTNHISLLSVSVGLHN  548

Query  887   YGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSAS  1063
             YG +F+    G+ G V++VG  GDET+ K+L  H+W+YK+GL G ++KLF +++  R   
Sbjct  549   YGAFFENSPTGINGPVKLVGYRGDETIEKDLSEHQWNYKIGLNGFDHKLFSTNSVGRHL-  607

Query  1064  QWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGDD  1243
             +W ++ LP+ R +TWYK +FKAP G+DPV+VD  G+GKG AW+NG ++GRYW      DD
Sbjct  608   KWSAEKLPSNRMLTWYKANFKAPFGKDPVIVDFNGLGKGEAWINGQSIGRYWPSFNSSDD  667

Query  1244  CPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQ  1423
               ++ CDYRGEY ++KC   CG PTQR+YHVPR FLN  G N + LFEE GGN S V F+
Sbjct  668   GCSDECDYRGEYGSDKCAFMCGKPTQRWYHVPRGFLNESGHNTITLFEELGGNPSMVNFK  727

Query  1424  TVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNI  1603
             TV T  VCA AYE    E+SC   R ITA+K+A+FG+      G F  G C GA DAV +
Sbjct  728   TVVTRTVCARAYEQNKLELSCN-SRPITAVKFASFGNP-SGHCGSFAVGTCEGANDAVKV  785

Query  1604  LKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +   C+GK +C++  S   FG+T   G    +L VE  C
Sbjct  786   VAKECVGKFNCTMNVSSHKFGSTLDCGDSPTRLFVEIEC  824



>ref|XP_010499714.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15-like [Camelina 
sativa]
Length=820

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/585 (57%), Positives = 421/585 (72%), Gaps = 22/585 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+K WG K+P+RT+ED+A++VARFFQ GGTFQNYYMYHGGTNF RT+GGPYITT
Sbjct  246   TENWTGWYKNWGSKNPHRTSEDVAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYG+L+QPKYGHLK+LH+VLH++EK + +GN+TT    N +  T+Y     
Sbjct  306   TYDYDAPLDEYGHLSQPKYGHLKQLHDVLHAMEKTLTHGNVTTIDFGNLVTATIYKTEEG  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N NET+DA IN+QGT Y VP WSVSILPDCK   YNTA++NTQT+VMVK+  +A
Sbjct  366   SSCFIGNVNETSDARINFQGTSYDVPPWSVSILPDCKTVTYNTAKINTQTSVMVKKPNEA  425

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T +++ DQK V+ND SDY+WYMT+VNL + DP+
Sbjct  426   EDEPSTLKWSWRPENIDNVLLKGKGESTMSKLFDQKVVSNDESDYLWYMTTVNLKEQDPV  485

Query  710   WSKDMRLGVNGTGQVLHVYANGKYV------DSQWNNNSLFETNIKLNHGKNLLTLLSAS  871
             W K+M L +N T  VLH + NG+++      D ++  + +FE + K N G N++TLLS +
Sbjct  486   WCKNMSLRINSTAHVLHAFVNGQHIGNYRVEDGKF--HYVFEQDAKFNPGANVITLLSIT  543

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             +G  NYG +F+    G+ G V I+G+NGDET+ K+L +HKWSYK GL G EN+LF     
Sbjct  544   VGLPNYGAFFENVPAGITGPVFIIGRNGDETIVKDLSAHKWSYKTGLSGFENQLF----S  599

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-I  1225
             + S S W  + +P  R MTWYKT+FKAP G +PVVVDL+G+GKG AW+NGNN+GRYW   
Sbjct  600   TESPSTWSGESVPFNRTMTWYKTAFKAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPSF  659

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
             LA  D C  E C+Y G Y   KC +NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN 
Sbjct  660   LADIDGCSAE-CNYIGTYYAEKCQTNCGEPTQRWYHVPRSFLNSEGDNMLVLFEEIGGNP  718

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             S V FQT+  G VCA+ YE  V E+SC  G+ I+AIK+A+FG+  G   G FEKG C  +
Sbjct  719   SLVNFQTIGVGXVCANVYEKNVLELSCD-GKPISAIKFASFGNP-GGNCGYFEKGTCEAS  776

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              DA  IL   C+GK  CS+  SE  FG   C G+  K+L VEAVC
Sbjct  777   NDAAAILTKECVGKEKCSIDVSEEKFGAPKCGGA-VKRLAVEAVC  820



>emb|CDX93659.1| BnaA06g03890D [Brassica napus]
Length=818

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/583 (56%), Positives = 418/583 (72%), Gaps = 19/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+AYSVA+FFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  245   TENWTGWFKQWGGKNPHRTTEDVAYSVAKFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  304

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+EK + YGNI+T     S   T+Y     
Sbjct  305   SYDYDAPLDEYGNLNQPKYGHLKKLHDVLHSMEKTLTYGNISTIDFGKSASATIYTTGEG  364

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DA I++QG  Y VPAWSV+ILPDCK E YNTA++ TQ ++MVK+  +A
Sbjct  365   SSCFFGNGNENSDAKISFQGKSYVVPAWSVTILPDCKTEAYNTAKITTQISMMVKKPNEA  424

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  DD +L GKG+ T  Q++DQK V+ND SDY+WYMT+V   K D +
Sbjct  425   EDDPSTLKWSWRPENMDDFLLKGKGESTKTQLVDQKVVSNDQSDYLWYMTTVKFRKRDLV  484

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L +N T  VLH + NGK++ +Q   N     +FE + K   G+N+++LLS ++G
Sbjct  485   LGKNMTLRINSTAHVLHAFVNGKHIGNQHAENGKFHYVFEKDAKFKSGRNVISLLSITVG  544

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYG +F+    G+ G + I+G+N DET+ K+L +HKWSYK GL G EN+LFR    + 
Sbjct  545   LQNYGSFFESVPTGITGPISIIGRNSDETIVKDLSAHKWSYKTGLNGFENQLFR----TE  600

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LILA  1231
             S S+W ++ +P  R MTWYK +FKAP G DPVVVDL+G+GKG AWVNGNN+GRYW   ++
Sbjct  601   SPSKWSAESVPLNRSMTWYKATFKAPFGNDPVVVDLLGLGKGTAWVNGNNIGRYWPAFIS  660

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
              GD C  + C+YRG Y+  KCL+ CG PTQR+YHVPRSFLN  GDN LVLFEE GGN S 
Sbjct  661   SGDGCSVK-CNYRGAYHAEKCLTGCGEPTQRWYHVPRSFLN-AGDNTLVLFEEMGGNPSL  718

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT R G VCA+ YE  V E+SC   + I+AIK+A+FG+      G FEKG C    +
Sbjct  719   VNFQTTRVGSVCANVYEKNVIELSCD-RKPISAIKFASFGNPN-GNCGSFEKGTCEEINN  776

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             AV+IL   C+GK  CS+  S   FG  +C G+  ++L +EA+C
Sbjct  777   AVDILTQECVGKEKCSIDVSTEKFGAPDCGGA-ARRLAIEAIC  818



>emb|CDY36652.1| BnaA07g04050D [Brassica napus]
Length=621

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/575 (55%), Positives = 408/575 (71%), Gaps = 16/575 (3%)
 Frame = +2

Query  23    FKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITTTYDYNAP  202
             FK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT+YDY+AP
Sbjct  54    FKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITTSYDYDAP  113

Query  203   LDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGTKTCFFSN  382
             LDEYGNL+QPKYGHLK+LH+VLH++EK + YGNI+T    NS   T+Y      +CFF N
Sbjct  114   LDEYGNLSQPKYGHLKQLHDVLHTIEKTLTYGNISTIDFGNSASATIYKTEEGSSCFFGN  173

Query  383   SNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA---AAAL  553
              NE +DATI++QG  Y VPAWSV+ILPDCK E YNTA++ TQT++MVK+  +A    + L
Sbjct  174   GNENSDATISFQGESYVVPAWSVTILPDCKNEAYNTAKITTQTSMMVKKPNEAEDTPSTL  233

Query  554   RWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPIWSKDMRL  730
             +WSWRPE  D+ +L GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K DP   K+M L
Sbjct  234   KWSWRPENMDNFLLKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDPFLGKNMSL  293

Query  731   GVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQNYGPY  898
              VN T  VLH + NGK++ +Q   N     +FE ++K   G+N++ LLS ++G  NYG +
Sbjct  294   RVNSTAHVLHAFVNGKHIGNQHAENDKFNYVFEKDVKFKSGRNVIALLSITVGLANYGAF  353

Query  899   FDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSASQWLS  1075
             F+    G+ G + I G+NGDET+ K+L +HKWSYK GL G E++LFR    + S S+W  
Sbjct  354   FESKPAGITGPIFITGRNGDETIVKDLSAHKWSYKTGLIGFESQLFR----TESMSKWSV  409

Query  1076  DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGDDCPTE  1255
             + +P  R MTWYKT+FK+P G DPVVVDLMG+GKG AWVNGNN+GRYW       +    
Sbjct  410   ESVPFNRTMTWYKTTFKSPLGNDPVVVDLMGLGKGTAWVNGNNIGRYWPAFISSKNGCDA  469

Query  1256  ACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQTVRT  1435
              C+YRG Y+  KCL+NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V FQT R 
Sbjct  470   NCNYRGAYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEIGGNPSLVSFQTTRV  529

Query  1436  GGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTA  1615
             G +CA+ YE  + E+SC   + I+AIK+A+FG+      G F KG C  + + V+IL   
Sbjct  530   GSLCANVYEKSIIELSCD-RKPISAIKFASFGNP-DGNCGSFVKGTCESSNNTVDILTQE  587

Query  1616  CLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             C+GK  CS+  S   FGT +C+G+  ++L VEA+C
Sbjct  588   CVGKEKCSIDVSTKRFGTPDCSGA-VRRLAVEAIC  621



>gb|AAK76465.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=621

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/580 (55%), Positives = 401/580 (69%), Gaps = 12/580 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  47    TENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  106

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLK+LH VL S+EK++ YGNI+   L NSI+ T+Y     
Sbjct  107   SYDYHAPLDEFGNLNQPKWGHLKQLHTVLKSMEKSLTYGNISRIDLGNSIKATIYTTKEG  166

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N++G DY VPAWSVS+LPDC +E YNTA+VNTQT++M ++  K 
Sbjct  167   SSCFIGNVNATADALVNFKGKDYHVPAWSVSVLPDCDKEAYNTAKVNTQTSIMTEDSSK-  225

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                L W+WRPE A   IL G G   A  ++DQK V ND SDY+WYMT ++LDK DP+WS+
Sbjct  226   PERLEWTWRPESAQKMILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRLHLDKKDPLWSR  285

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLSASIGFQ  883
             +M L V+    VLH Y NGKYV +Q+  +  F+   +     L HG N ++LLS S+G Q
Sbjct  286   NMTLRVHSNAHVLHAYVNGKYVGNQFVKDGKFDYRFERKVNHLVHGTNHISLLSVSVGLQ  345

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYGP+F+ G  G+ G V +VG  G+ET+ K+L  H+W YK+GL G  +KLF  S KS   
Sbjct  346   NYGPFFESGPTGINGPVSLVGYKGEETIEKDLSQHQWDYKIGLNGYNDKLF--SIKSVGH  403

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGD  1240
              +W ++ LPT R +TWYK  FKAP G++PV+VDL G+GKG AW+NG ++GRYW      D
Sbjct  404   QKWANEKLPTGRMLTWYKAKFKAPLGKEPVIVDLNGLGKGEAWINGQSIGRYWPSFNSSD  463

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRF  1420
             D   + CDYRG Y ++KC   CG PTQR+YHVPRSFLN  G N + LFEE GGN S V F
Sbjct  464   DGCKDKCDYRGAYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSMVNF  523

Query  1421  QTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVN  1600
             +TV  G VCA A+E+   E+SC   R I+A+K+A+FG+  G CG        G  KDA  
Sbjct  524   KTVVVGTVCARAHEHNKVELSCH-NRPISAVKFASFGNPLGHCGSFAVGTCQGD-KDAAK  581

Query  1601  ILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +   C+GK +C+V  S   FG+T   G   KKL VE  C
Sbjct  582   TVAKECVGKLNCTVNVSSDTFGSTLDCGDSPKKLAVELEC  621



>ref|XP_006400640.1| hypothetical protein EUTSA_v10012695mg [Eutrema salsugineum]
 gb|ESQ42093.1| hypothetical protein EUTSA_v10012695mg [Eutrema salsugineum]
Length=830

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/582 (56%), Positives = 405/582 (70%), Gaps = 12/582 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLAYSVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  252   TENWTGWFKNWGGKHPYRTAEDLAYSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLK+LH +L S+EK + YGNI+T  L NS+  TVYA N  
Sbjct  312   SYDYHAPLDEFGNLNQPKWGHLKQLHTLLKSMEKPLTYGNISTIDLGNSVTATVYATNEG  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N++G DY VPAWSVS+LPDC +E YNTARVNTQT++M ++  + 
Sbjct  372   SSCFIGNVNATADALVNFKGKDYNVPAWSVSVLPDCDKEAYNTARVNTQTSIMTQD-SRE  430

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                L WSWRPE    TIL G G   A  ++DQK V ND SDY+WYMT V+LDK DP+WS+
Sbjct  431   PEKLEWSWRPEFERKTILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRVHLDKKDPLWSR  490

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLSASIGFQ  883
             +M L V+    VLH Y NGKYV +Q   ++ F+   +     L HG N ++LLS S+G Q
Sbjct  491   NMTLRVHSNAHVLHAYVNGKYVGNQIVKDNKFDYGFEKKVNHLVHGTNHISLLSVSVGLQ  550

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF--RSSNKSR  1054
             NYG +F+ G  G+ G V++VG  GDET+ K+L +HKW YK+GL G  +KLF  +S     
Sbjct  551   NYGAFFETGPTGINGPVKLVGYKGDETIEKDLSAHKWDYKIGLNGFNHKLFSTKSVGHQT  610

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
                +W ++ LP  R +TWYK +FKAP G+DPV+VD  G+GKG AW+NG ++GRYW     
Sbjct  611   HHLKWSTEKLPADRMLTWYKANFKAPLGKDPVIVDFNGLGKGEAWINGQSIGRYWPSFNS  670

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
              DD  TE CDYRGEY ++KC   CG PTQR+YHVPRSFLN  G N + LFEE GG+ + V
Sbjct  671   SDDGCTEECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNETGHNTITLFEEMGGDPTMV  730

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              F+TV  G VCA A+E+   E+SC   R I+A+K+A+FG+      G F  G C GA DA
Sbjct  731   NFKTVVIGTVCARAHEHNKVELSCN-NRPISAVKFASFGNP-SGHCGSFTVGTCEGANDA  788

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               I+   C+GK +CS+  S  VFG+    G   K+L VE  C
Sbjct  789   AKIIAKECVGKPNCSMNVSSHVFGSKLDCGDSPKRLFVEIEC  830



>ref|XP_003595331.1| Beta-galactosidase [Medicago truncatula]
 gb|AES65582.1| beta-galactosidase-like protein [Medicago truncatula]
Length=830

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/583 (56%), Positives = 428/583 (73%), Gaps = 15/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK WGGKDP+RTAED+AYSVARFF+ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  251   TENWVGWFKNWGGKDPHRTAEDIAYSVARFFETGGTFQNYYMYHGGTNFGRTAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPK+GHLKELH VL S+E ++  GN++   L + ++ TVYA N +
Sbjct  311   SYDYDAPLDEYGNIAQPKWGHLKELHLVLKSMENSLTNGNVSKIDLGSYVKATVYATNDS  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF +N+N T DAT+ ++G  Y VPAWSVSILPDC+ E YNTA+VN QT++MVK   KA
Sbjct  371   SSCFLTNTNTTTDATVTFKGNTYNVPAWSVSILPDCQTEEYNTAKVNVQTSIMVKRENKA  430

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
                  AL+W WR E   ++++ GK   + N I+DQK+ AND SDY+WYMT +++++ DP+
Sbjct  431   EDEPEALKWVWRAENVHNSLI-GKSSVSKNTIVDQKIAANDSSDYLWYMTRLDINQKDPV  489

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASIG  877
             W+ +  L +NGTG V+H + NG+++ S W     +N  FETNIKL HG+N ++LLS ++G
Sbjct  490   WTNNTILRINGTGHVIHAFVNGEHIGSHWATYGIHNDQFETNIKLKHGRNDISLLSVTVG  549

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYG  +D   +GL   +E++G  GDET+ K+L SHKW+YKVGL G ENK F       
Sbjct  550   LQNYGKEYDKWQDGLVSPIELIGTKGDETIIKDLSSHKWTYKVGLHGWENKFFSQDTFFA  609

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL-A  1231
             S+S+W S+ LP  + +TWYKT+FKAP   DP+VVDL GMGKG+AWVNG++LGRYW    A
Sbjct  610   SSSKWESNELPINKMLTWYKTTFKAPLESDPIVVDLQGMGKGYAWVNGHSLGRYWPSYNA  669

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               D C  + CDYRGEYN+ KC+SNCG P+QR+YHVPR F+   G N LVLFEE GGN S+
Sbjct  670   DEDGCSDDPCDYRGEYNDTKCVSNCGKPSQRWYHVPRDFI-EDGVNTLVLFEEIGGNPSQ  728

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             + FQTV  G  CA+AYENK  E+SC  GR+I+ IK+A+FG+ +G+CG   +        +
Sbjct  729   INFQTVIVGSACANAYENKTLELSCH-GRSISDIKFASFGNPQGTCGAFTKGSCESN-NE  786

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A+++++ AC+GK SCS+  SE  FG TNC G+  K+L VEAVC
Sbjct  787   ALSLVQKACVGKESCSIDVSEKTFGATNC-GNMVKRLAVEAVC  828



>ref|XP_007012588.1| Beta-galactosidase 7 [Theobroma cacao]
 gb|EOY30207.1| Beta-galactosidase 7 [Theobroma cacao]
Length=825

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/583 (57%), Positives = 406/583 (70%), Gaps = 18/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG DP+RT EDLAY+VARF+Q GGTFQNYYMYHGGTNFGR++GGPYITT
Sbjct  251   TENWTGWFKSWGGADPHRTPEDLAYAVARFYQKGGTFQNYYMYHGGTNFGRSSGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDYNAPLDEYGN NQPK+GHLK+LH+VL S+E  +  G++    L NSI  TVY+    
Sbjct  311   TYDYNAPLDEYGNPNQPKWGHLKQLHDVLRSMEYTLTRGDVKNIDLGNSIWATVYSTKEK  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SNS+   DA + + GTDY VPAWSVSILPDC  E YNTA+V  QT+VMVK+  KA
Sbjct  371   SSCFLSNSDNVTDAEVRFGGTDYSVPAWSVSILPDCGDEAYNTAKVYAQTSVMVKKSNKA  430

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L W WRPE  + T + GKG   ANQI+DQK +AND SDY+WYMT V L  DDP+
Sbjct  431   EDEPNSLEWEWRPENIEKTAVQGKGDHHANQIIDQKAMANDASDYLWYMTRVELANDDPL  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
              ++   L V  +G VLH Y NGKY+ SQW N S    +FE  +KLN GKNL++LLSA++G
Sbjct  491   VTEKATLRVTDSGHVLHAYVNGKYIGSQWANYSSQKYVFEHEVKLNPGKNLISLLSATVG  550

Query  878   FQNYGPYFDLGGNG-LYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYGP FDL   G L  VE+V    D  V K+L S KWSYKVGL G  NKL+ +   S+
Sbjct  551   LHNYGPMFDLNVTGVLSPVELVAHKEDGKVVKDLSSQKWSYKVGLDGVANKLYETDCPSK  610

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
                +W SD +P  R +TWYKT+FKAP G+ PVVVDL+G+GKG AWVN ++LGRYW   +A
Sbjct  611   --LKWASDSIPVDRNLTWYKTTFKAPLGKAPVVVDLLGLGKGHAWVNSHSLGRYWPSYIA  668

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                 C  EACDYRG Y++ KC+S CG PTQR+YHVPRSFL + GDN LVLFEE GGN SR
Sbjct  669   DQHACKAEACDYRGPYSDKKCVSKCGEPTQRWYHVPRSFL-KDGDNTLVLFEEFGGNPSR  727

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V+FQTV  G  C +A+  K  E+SC   R I+ I +A+FGD +G CG   +        D
Sbjct  728   VQFQTVEIGTACINAHVGKKVELSCH-DRPISRINFASFGDPQGVCGAFKKSECESTV-D  785

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             AV+IL+  C+G+ SCS   SE  FG   CA +R   L VEA+C
Sbjct  786   AVSILEKECVGRESCSFQVSEDKFGKAYCAVNR---LAVEAIC  825



>gb|KCW79363.1| hypothetical protein EUGRSUZ_C00782 [Eucalyptus grandis]
Length=807

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/585 (58%), Positives = 411/585 (70%), Gaps = 39/585 (7%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF                      FQ GGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  250   TENWTGWF----------------------FQTGGTFQNYYMYHGGTNFGRTAGGPYITT  287

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLKELH++LHS+E  +  GNIT   L NS+  TVYA  G 
Sbjct  288   SYDYDAPLDEYGNLNQPKWGHLKELHDMLHSVEGTLTTGNITNVDLGNSVYATVYATPGQ  347

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              TCF  N+N T+DAT  +QG  + VPAWSVSILPDC+ E YNTA+VN Q++VMV E  KA
Sbjct  348   STCFLGNTNSTSDATFVFQGKQFTVPAWSVSILPDCQNEGYNTAKVNVQSSVMVMEPNKA  407

Query  542   AA---ALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
              +   +L W+WRPE+ADD +  GKG+  A++++DQK  AN  SDY+WYMTSVNL  DDP+
Sbjct  408   ESEPESLSWTWRPEIADDQVTLGKGRVAAHRLVDQKDAANGASDYLWYMTSVNLKDDDPV  467

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTLLSASIG  877
             WS +M L VN TGQ+LH Y NG Y+ SQW    N + +FE N+KLN GKNL++LLS +IG
Sbjct  468   WSDNMTLRVNCTGQILHAYVNGNYLGSQWALYGNFHYVFEKNVKLNPGKNLISLLSVTIG  527

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFR--SSNK  1048
              QNYGP FDL  NG+ G VEI G+ GDE V K+L  H WSYKVGL G  +K F    +  
Sbjct  528   LQNYGPMFDLVQNGVPGPVEIEGRKGDERVIKDLSGHLWSYKVGLHGINHKFFSIDPALD  587

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL  1228
             S SAS+W S  LPT R ++WYKT+FKAP G DPVVVDL G+GKG AWVNG ++GRYW   
Sbjct  588   SASASKWQSKDLPTNRSLSWYKTTFKAPLGTDPVVVDLQGLGKGEAWVNGKSIGRYWPSY  647

Query  1229  -AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
              A  D C T+ CDYRG Y+N KC++NCG PTQR+YHVPRSF+     N LVLFEE GGN 
Sbjct  648   DASLDGCSTDPCDYRGAYDNTKCVTNCGGPTQRWYHVPRSFM-EEDVNTLVLFEEFGGNP  706

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             S V FQTV  G  CA+A+E K  +++CQ GR I+A+K+A+FGD +    G F KG C G+
Sbjct  707   SLVNFQTVTVGSACANAHEKKTLKLACQ-GRPISAVKFASFGDPQ-GSCGSFAKGSCEGS  764

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              DAV IL+ AC+GK SCS+  SE  FG+T C    TK+L VE  C
Sbjct  765   NDAVAILQNACVGKESCSIDVSEKTFGSTTCG--STKRLAVEVSC  807



>emb|CAB64743.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=788

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/580 (55%), Positives = 401/580 (69%), Gaps = 12/580 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  214   TENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  273

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLK+LH VL S+EK++ YGNI+   L NSI+ T+Y     
Sbjct  274   SYDYHAPLDEFGNLNQPKWGHLKQLHTVLKSMEKSLTYGNISRIDLGNSIKATIYTTKEG  333

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N++G DY VPAWSVS+LPDC +E YNTA+VNTQT++M ++  K 
Sbjct  334   SSCFIGNVNATADALVNFKGKDYHVPAWSVSVLPDCDKEAYNTAKVNTQTSIMTEDSSK-  392

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                L W+WRPE A   IL G G   A  ++DQK V ND SDY+WYMT ++LDK DP+WS+
Sbjct  393   PERLEWTWRPESAQKMILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRLHLDKKDPLWSR  452

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLSASIGFQ  883
             +M L V+    VLH Y NGKYV +Q+  +  F+   +     L HG N ++LLS S+G Q
Sbjct  453   NMTLRVHSNAHVLHAYVNGKYVGNQFVKDGKFDYRFERKVNHLVHGTNHISLLSVSVGLQ  512

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYGP+F+ G  G+ G V +VG  G+ET+ K+L  H+W YK+GL G  +KLF  S KS   
Sbjct  513   NYGPFFESGPTGINGPVSLVGYKGEETIEKDLSQHQWDYKIGLNGYNDKLF--SIKSVGH  570

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGD  1240
              +W ++ LPT R +TWYK  FKAP G++PV+VDL G+GKG AW+NG ++GRYW      D
Sbjct  571   QKWANEKLPTGRMLTWYKAKFKAPLGKEPVIVDLNGLGKGEAWINGQSIGRYWPSFNSSD  630

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRF  1420
             D   + CDYRG Y ++KC   CG PTQR+YHVPRSFLN  G N + LFEE GGN S V F
Sbjct  631   DGCKDECDYRGAYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSMVNF  690

Query  1421  QTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVN  1600
             +TV  G VCA A+E+   E+SC   R I+A+K+A+FG+  G CG        G  KDA  
Sbjct  691   KTVVVGTVCARAHEHNKVELSCH-NRPISAVKFASFGNPLGHCGSFAVGTCQGD-KDAAK  748

Query  1601  ILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +   C+GK +C+V  S   FG+T   G   KKL VE  C
Sbjct  749   TVAKECVGKLNCTVNVSSDTFGSTLDCGDSPKKLAVELEC  788



>ref|NP_568399.4| beta-galactosidase 7 [Arabidopsis thaliana]
 sp|Q9SCV5.2|BGAL7_ARATH RecName: Full=Beta-galactosidase 7; Short=Lactase 7; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED92880.1| beta-galactosidase 7 [Arabidopsis thaliana]
Length=826

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/580 (55%), Positives = 401/580 (69%), Gaps = 12/580 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  252   TENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDE+GNLNQPK+GHLK+LH VL S+EK++ YGNI+   L NSI+ T+Y     
Sbjct  312   SYDYHAPLDEFGNLNQPKWGHLKQLHTVLKSMEKSLTYGNISRIDLGNSIKATIYTTKEG  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N++G DY VPAWSVS+LPDC +E YNTA+VNTQT++M ++  K 
Sbjct  372   SSCFIGNVNATADALVNFKGKDYHVPAWSVSVLPDCDKEAYNTAKVNTQTSIMTEDSSK-  430

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                L W+WRPE A   IL G G   A  ++DQK V ND SDY+WYMT ++LDK DP+WS+
Sbjct  431   PERLEWTWRPESAQKMILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRLHLDKKDPLWSR  490

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLSASIGFQ  883
             +M L V+    VLH Y NGKYV +Q+  +  F+   +     L HG N ++LLS S+G Q
Sbjct  491   NMTLRVHSNAHVLHAYVNGKYVGNQFVKDGKFDYRFERKVNHLVHGTNHISLLSVSVGLQ  550

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYGP+F+ G  G+ G V +VG  G+ET+ K+L  H+W YK+GL G  +KLF  S KS   
Sbjct  551   NYGPFFESGPTGINGPVSLVGYKGEETIEKDLSQHQWDYKIGLNGYNDKLF--SIKSVGH  608

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGD  1240
              +W ++ LPT R +TWYK  FKAP G++PV+VDL G+GKG AW+NG ++GRYW      D
Sbjct  609   QKWANEKLPTGRMLTWYKAKFKAPLGKEPVIVDLNGLGKGEAWINGQSIGRYWPSFNSSD  668

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRF  1420
             D   + CDYRG Y ++KC   CG PTQR+YHVPRSFLN  G N + LFEE GGN S V F
Sbjct  669   DGCKDECDYRGAYGSDKCAFMCGKPTQRWYHVPRSFLNASGHNTITLFEEMGGNPSMVNF  728

Query  1421  QTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVN  1600
             +TV  G VCA A+E+   E+SC   R I+A+K+A+FG+  G CG        G  KDA  
Sbjct  729   KTVVVGTVCARAHEHNKVELSCH-NRPISAVKFASFGNPLGHCGSFAVGTCQGD-KDAAK  786

Query  1601  ILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +   C+GK +C+V  S   FG+T   G   KKL VE  C
Sbjct  787   TVAKECVGKLNCTVNVSSDTFGSTLDCGDSPKKLAVELEC  826



>gb|KDO73841.1| hypothetical protein CISIN_1g036343mg [Citrus sinensis]
Length=795

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/584 (56%), Positives = 411/584 (70%), Gaps = 42/584 (7%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP RTAEDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGPY+TT
Sbjct  243   TENWTGWFKSWGGKDPKRTAEDLAFAVARFFQFGGTFQNYYMYHGGTNFGRTSGGPYLTT  302

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG+LNQPK+GHL+ELH +L S+EK + YGN+T T   NS+          
Sbjct  303   SYDYDAPIDEYGHLNQPKWGHLRELHKLLKSMEKTLTYGNVTNTDYGNSVS---------  353

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
                                G+ Y +PAWSVSILPDCK E +NTA+VNTQT V VK   + 
Sbjct  354   -------------------GSSYNLPAWSVSILPDCKTEEFNTAKVNTQTNVKVKRPNQA  394

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPIW  712
             G   A L+W WRPE+ +D ++ GKG F  N ++DQK  NDVSDY+WYMT+ +L  DDPI 
Sbjct  395   GNDQAPLQWKWRPEMINDFVVRGKGHFALNTLIDQKSTNDVSDYLWYMTNADLKDDDPIL  454

Query  713   S--KDMRLGVNGTGQVLHVYANGKYVDSQWN----NNSLFETNIKLNHGKNLLTLLSASI  874
             S   +M L +N +GQVLH Y NG YVDSQW     +N LFE  +KL  GKN ++LLSA++
Sbjct  455   SGSSNMTLRINSSGQVLHAYVNGNYVDSQWTKYGASNDLFERPVKLTRGKNQISLLSATV  514

Query  875   GFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
             G QNYG  FD+  NG+ G V +VG+ GDET+ K+L SHKW+YKVGL G ++K F ++  +
Sbjct  515   GLQNYGSKFDMVPNGIPGPVLLVGRAGDETIIKDLSSHKWTYKVGLYGLDDKKFYNAKAA  574

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LIL  1228
              S   W S ++P  RRMTWYKT+F+AP   DPVV++L GMGKGFAWVNG NLGRYW   L
Sbjct  575   NSERGWSSKNVPLNRRMTWYKTTFEAPLENDPVVLNLQGMGKGFAWVNGYNLGRYWPTYL  634

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
             A+ D C TE+CDYRG Y ++KC  NCGNP+Q +YHVPRS++ + G N LVLFEE GGN S
Sbjct  635   AEEDGCSTESCDYRGPYGSDKCAYNCGNPSQIWYHVPRSWI-KDGVNTLVLFEEFGGNPS  693

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
             ++ FQTV  G  C  A+ENK  E++C  GR I+ IKYA+FGD +G+CG   +        
Sbjct  694   QINFQTVVVGTACGQAHENKTMELTCH-GRRISEIKYASFGDPQGACGAFKKGSCEAEI-  751

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             D + +++  C+GK SCS+ ASE+  G T+CA    K+LVVEA+C
Sbjct  752   DVLPLIEKQCVGKKSCSIEASEANLGATSCAAGTVKRLVVEALC  795



>emb|CDY32304.1| BnaC05g28820D [Brassica napus]
Length=882

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/582 (56%), Positives = 413/582 (71%), Gaps = 16/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYH GTNF R+AGGPYITT
Sbjct  308   TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHRGTNFDRSAGGPYITT  367

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+EK + YGNI+T    NS   T+Y     
Sbjct  368   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEKTLTYGNISTIDFGNSASATIYTTQEG  427

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DATI+++G  Y VPAWSV+ILPDCK E YNTA++ TQT++MVK+  +A
Sbjct  428   YSCFFGNGNENSDATISFRGESYVVPAWSVTILPDCKTEAYNTAKITTQTSMMVKKPNEA  487

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQK V+ND SDY+WYMT+V   K DP 
Sbjct  488   EDDPSTLKWSWRPENMDNFVLRGKGESTNTQLFDQKVVSNDQSDYLWYMTTVKFRKRDPF  547

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L VN T  VL V+ NGK++ +Q   N     +FE + K   G+N++ LLS ++G
Sbjct  548   MGKNMSLRVNSTAHVLRVFVNGKHIGNQHAENEKFHYVFEKDAKFKSGRNVIFLLSITVG  607

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
              QNYG +F+    G+ G + I+G+NGDE + K+L SHKWSYK GL G ENKLF    K+ 
Sbjct  608   LQNYGAFFESVPVGITGPIFIIGRNGDEIIVKDLSSHKWSYKTGLNGFENKLF----KTE  663

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYKT+FKAP G DPVVVDL+G+GKG AWVNGNN+G YWL    
Sbjct  664   SPSKWSFESVPLNRTMTWYKTTFKAPLGNDPVVVDLLGLGKGTAWVNGNNIGCYWLAFNS  723

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
               D  +  C+YRG Y   K  +NCG PTQR+YHVPRSFL   G N LVLFEE GGN S V
Sbjct  724   SSDGCSAKCNYRGAYYAEKYQTNCGEPTQRWYHVPRSFLITEGVNTLVLFEEMGGNPSLV  783

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G VCA+ YE  V E+SC   + I+AIK+A+FG++     G F KG C G+K+A
Sbjct  784   NFQTTRVGSVCANVYEKNVIELSCD-RKTISAIKFASFGNS-DGNCGSFVKGTCEGSKNA  841

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+IL   C+GK  CS+  +   FG  +C+G   ++L +EA+C
Sbjct  842   VDILTKECIGKEKCSIDVTAEKFGVPDCSGV-ARRLPIEAIC  882



>ref|XP_004288999.1| PREDICTED: beta-galactosidase 15-like [Fragaria vesca subsp. 
vesca]
Length=827

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/585 (57%), Positives = 416/585 (71%), Gaps = 21/585 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG  DPYRTAEDLA++VA+FFQ GGTFQNYYMYHGGTNFGR A G YITT
Sbjct  252   TENWTGWFKSWGASDPYRTAEDLAFAVAKFFQFGGTFQNYYMYHGGTNFGRVAAG-YITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYG LNQPK+GHLK+LH  L S+E  + +GNIT T L N++  TVYA   +
Sbjct  311   SYDYNAPLDEYGALNQPKWGHLKQLHETLKSMEYTLTHGNITATDLGNNVTTTVYATEES  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  NS+   DA I+++GT+Y VPAWSVSILPDCK E YNTA+VNTQTTV VK   KA
Sbjct  371   SSCFLCNSDYKLDANISFRGTNYFVPAWSVSILPDCKTEAYNTAKVNTQTTVKVKRNNKA  430

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L W+WRPE  D+T + GKG+   N +++QK  AND SDY+WYMTSV+L KDDPI
Sbjct  431   EDEPQSLHWTWRPENIDETKILGKGEVVVNHLMEQKEAANDESDYLWYMTSVDLKKDDPI  490

Query  710   WSKD-MRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQN  886
             W K+ + L +NGTG +LH Y NG+++ S     + FE N+ L  G+N+++LLSA+ GF N
Sbjct  491   WGKNNITLRINGTGCILHAYVNGEHIGSDQAARN-FERNVTLKDGRNIISLLSATTGFSN  549

Query  887   YGPYFDLGGNGLYG-VEIVGKNGD-ETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             YG  +DL   G+ G V +VG+NGD E+V K+L  HKWSYKVGL G  NKLF     S  A
Sbjct  550   YGGGYDLQPAGILGPVVLVGQNGDDESVIKDLSGHKWSYKVGLHGLTNKLF----SSEKA  605

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAKG  1237
             ++W S++LP    MTWYKT+FKAP G DPVVVDL G+GKG AWVNG+++GRYW   LAK 
Sbjct  606   TKWSSENLPVNTTMTWYKTTFKAPLGTDPVVVDLQGLGKGNAWVNGHSIGRYWPSFLAKT  665

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             D C  E CDYRG+Y + KC S CG PTQR+YH+PRSF+    +N LVLFEE GG+ S V+
Sbjct  666   DGCSDE-CDYRGKYESKKCNSKCGEPTQRWYHIPRSFMRDDDENTLVLFEEFGGDPSLVK  724

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTR----gscgggfekgvcggA  1585
             FQT+  G VCA+AYEN   E++C  GR+I+AIK+A+FG+ +        G          
Sbjct  725   FQTIAVGSVCANAYENNTLELACD-GRSISAIKFASFGNPQGTCGSFKNGTSFTKGTCDG  783

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +A++I++  C+GK  CS+  S   F +TNC G   K+L VEAVC
Sbjct  784   SNALSIIQKECVGKEKCSIDVSGDKFDSTNC-GDIVKRLAVEAVC  827



>ref|XP_002871955.1| beta-galactosidase 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48214.1| beta-galactosidase 7 [Arabidopsis lyrata subsp. lyrata]
Length=826

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/580 (54%), Positives = 399/580 (69%), Gaps = 12/580 (2%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGR AGGPYITT
Sbjct  252   TENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRVAGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DE+GNLNQPK+GHLK+LH VL S+EK++ YGNI+   L NSI+ T+Y     
Sbjct  312   SYDYHAPIDEFGNLNQPKWGHLKQLHRVLKSMEKSLTYGNISRIDLGNSIKATIYTTKEG  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TA+A +N++G DY VPAWSVS+LP+C +E YNTA+VNTQT++M ++  K 
Sbjct  372   SSCFIGNVNATANALVNFKGKDYHVPAWSVSVLPECDKEAYNTAKVNTQTSIMTEDSSK-  430

Query  542   AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSK  718
                L W+WRPE A   IL   G   A  ++DQK V ND SDY+WYMT V+LDK DP+WS+
Sbjct  431   PEKLEWTWRPESAQKMILKSSGDLIAKGLVDQKDVTNDASDYLWYMTRVHLDKKDPLWSR  490

Query  719   DMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLSASIGFQ  883
             +M L V+    VLH Y NGKYV +Q+  +  F+   +     L HG N ++LLS S+G Q
Sbjct  491   NMTLRVHSNAHVLHAYVNGKYVGNQFVKDGKFDYRFEKKVNHLVHGTNHISLLSVSVGLQ  550

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYG +F+ G  G+ G V +VG  G+ET+ K+L  H+W YK+GL G  NKLF  S KS   
Sbjct  551   NYGAFFESGPTGINGPVSLVGYKGEETIEKDLSQHQWDYKIGLNGYNNKLF--STKSVGH  608

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGD  1240
              +W ++  PT+R +TWYK  FKAP G++PV+VD  G+GKG AW+NG ++GRYW      D
Sbjct  609   IKWANEMFPTSRMLTWYKAKFKAPLGKEPVIVDFNGLGKGEAWINGQSIGRYWPSFNSSD  668

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRF  1420
             D   + CDYRGEY ++KC   CG PTQR+YHVPRSFL   G N + LFEE GGN S V F
Sbjct  669   DGCKDECDYRGEYGSDKCAFMCGEPTQRWYHVPRSFLKASGHNTITLFEEMGGNPSMVNF  728

Query  1421  QTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVN  1600
             +TV  G VCA A+E+   E+SC     I+A+K+A+FG+      G F  G C G KDAV 
Sbjct  729   KTVVVGTVCARAHEHNKVELSCH-NHPISAVKFASFGNP-VGHCGTFAVGTCQGDKDAVK  786

Query  1601  ILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +   C+GK +C++  S   FG+T   G   KKL VE  C
Sbjct  787   TVAKECVGKLNCTINVSSDTFGSTLDCGDSPKKLAVELEC  826



>ref|XP_010478588.1| PREDICTED: beta-galactosidase 15-like [Camelina sativa]
Length=825

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/591 (54%), Positives = 412/591 (70%), Gaps = 28/591 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+K WG K+P+RT+ED+A++VARFFQ GGTFQNYYMYHGGTNF RT+GGPYITT
Sbjct  245   TENWTGWYKNWGSKNPHRTSEDVAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPYITT  304

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLH-SLEKNIV-----YGNITTTKLDNSIQVTV  343
             TYDY+APLDEYG+L+QPKYG +  L   +  S+ +  +     +GNITT    N +  T+
Sbjct  305   TYDYDAPLDEYGHLSQPKYGXVFFLEVCVQMSMRRTFLSFRXTHGNITTIDFGNLVTATI  364

Query  344   YAFNGTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMV  523
             Y      +CF  N NET+DA IN+QGT Y VP WSVSILPDCK   YNTA++NTQT+VMV
Sbjct  365   YKTEEGSSCFIGNVNETSDARINFQGTSYDVPPWSVSILPDCKTVAYNTAKINTQTSVMV  424

Query  524   KEGGKA---AAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNL  691
             K+  +A    + L+WSWRPE  D+ +L GKG+ T +++ DQKV +ND  DY+WYMT+VNL
Sbjct  425   KKPNEAEDEPSTLKWSWRPENIDNVLLKGKGESTMSKLFDQKVVSNDERDYLWYMTTVNL  484

Query  692   DKDDPIWSKDMRLGVNGTGQVLHVYANGKYV------DSQWNNNSLFETNIKLNHGKNLL  853
              + DP+W K+M L +N T  VLH + NG+++      D +++   +FE + K N G N++
Sbjct  485   KEQDPVWCKNMSLRINSTAHVLHAFVNGQHIGNYRVEDGKFH--YVFEQDAKFNPGANVI  542

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
             TLLS ++G  NYG +F+    G+ G V I+G+NGDET+ K+L +HKWSYK GL G EN+L
Sbjct  543   TLLSITVGLPNYGAFFENVPAGITGPVFIIGRNGDETIVKDLSAHKWSYKTGLSGFENQL  602

Query  1031  FRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
             F     + S S W  + +P  R MTWYKT+FKAP G +PVVVDL+G+GKG AW+NGNN+G
Sbjct  603   F----STESPSTWSGESVPFNRTMTWYKTTFKAPLGSEPVVVDLLGLGKGTAWINGNNIG  658

Query  1211  RYWL-ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             RYW   LA  D C  E C+Y G Y   KC +NCG PTQR+YHVPRSFLN  GDN LVLFE
Sbjct  659   RYWPSFLADIDGCSAE-CNYIGTYYAEKCQTNCGEPTQRWYHVPRSFLNSEGDNTLVLFE  717

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfek  1567
             E GGN S V FQT+  G VCA+ YE  V E+SC  G+ I+AIK+A+FG+  G   G FEK
Sbjct  718   EIGGNPSLVNFQTIGVGSVCANVYEKNVLELSCN-GKPISAIKFASFGNP-GGNCGSFEK  775

Query  1568  gvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             G C  + DA  IL   C+GK  CS+  SE  FG   C G+  K+L VEA+C
Sbjct  776   GTCEASNDAAAILTKECVGKEKCSIDVSEEKFGAPKCGGA-AKRLAVEAIC  825



>emb|CDY34975.1| BnaA01g27590D [Brassica napus]
Length=788

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/582 (54%), Positives = 394/582 (68%), Gaps = 47/582 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  245   TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  304

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+E+ + YGNI+T    NS   T+Y     
Sbjct  305   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERTLTYGNISTIDFGNSASATIYKTEEG  364

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DA I++QG  Y +PAWSV+ILPDCK E YNTA++ TQT++MVK+  +A
Sbjct  365   SSCFFGNGNENSDAKISFQGESYVIPAWSVTILPDCKNEAYNTAKITTQTSMMVKKPNEA  424

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ IL GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K D  
Sbjct  425   EDTPSTLKWSWRPENVDNFILKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDLF  484

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
               K M L VN T  VLH + NGK++ +Q       N +FE ++K   G+N++ LLS ++G
Sbjct  485   LGKSMSLRVNSTAHVLHAFVNGKHIGNQHAEDGKFNYVFEKDVKFKSGRNVIALLSITVG  544

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I G+NGDET+ K+L +HKWSYK GL G EN+LFR    + 
Sbjct  545   LANYGIFFESKPAGITGPIFITGRNGDETIVKDLSAHKWSYKTGLNGFENQLFR----TE  600

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYK +FKAP G DPVVVDLMG+GK                   
Sbjct  601   SMSKWSVESVPFNRTMTWYKATFKAPLGNDPVVVDLMGLGK-------------------  641

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
                         G Y+  KCL+NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  642   ------------GAYHAEKCLTNCGEPTQRWYHVPRSFLNAEGDNTLVLFEEMGGNPSLV  689

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G VCA+ YENK+ E+SC   + I+AIK+A+FG+      G FEKG C  + + 
Sbjct  690   SFQTTRVGSVCANVYENKIIELSCD-RKPISAIKFASFGNPH-GNCGSFEKGTCESSNNT  747

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+IL   C+GK  CS+  S   FG  +C+G+  +KL VE +C
Sbjct  748   VDILTQECVGKEKCSIDVSTKKFGAPDCSGA-ARKLAVEVIC  788



>ref|XP_010688541.1| PREDICTED: beta-galactosidase 15-like [Beta vulgaris subsp. vulgaris]
Length=802

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/614 (52%), Positives = 409/614 (67%), Gaps = 47/614 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK P+RTAED+AY+VARFFQ GGT QNYYM+HGGTNFGRT+GGPYITT
Sbjct  195   TENWTGWFKNWGGKVPHRTAEDVAYAVARFFQTGGTVQNYYMFHGGTNFGRTSGGPYITT  254

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+EK + YG++ TT + NS+ VT +  N T
Sbjct  255   SYDYDAPLDEYGNLNQPKYGHLKQLHSVLHSMEKLLTYGDVNTTAMGNSVTVTTFTNNKT  314

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
              +CF SN+N T DATI      + +PAWSVSILPDCK E YNTA+VNTQT ++ K   E 
Sbjct  315   SSCFLSNANSTNDATIVLNHHTFTIPAWSVSILPDCKNEAYNTAKVNTQTNMIEKKHNEA  374

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
              +  ++L W+WR E     +  GKGQF  + +L+QK A ND SDY+WYMTS++LDK+D I
Sbjct  375   EQEPSSLTWNWRRESISKYVKEGKGQFAGDVLLEQKAATNDTSDYLWYMTSLHLDKNDII  434

Query  710   WSKDMRLGVNGTGQVLHVYANGKYV----------------------------------D  787
             WS DMRL +N +  VLHVY NG+ +                                   
Sbjct  435   WSDDMRLRINSSAHVLHVYVNGEELGKISFIILLLSFYLVFILAYAVTNISFYSIGYEYA  494

Query  788   SQWNNNSLFETNIKLNHGKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETV  964
              + +   +FE  + L  GKN+++LLSA++G QNYGPY+D+   G+ G VE+VGK GDE V
Sbjct  495   KEDSFTYIFEGKVNLKKGKNIISLLSATVGLQNYGPYYDMTPVGIVGPVELVGKRGDEIV  554

Query  965   RKNLGSHKWSYKVGLRGEENKLFRSSNKSRSASQWLSD-HLPTARRMTWYKTSFKAPAGR  1141
              K+L SH W+YK GL+G ++ +  S   S S  +W ++  +P   +MTWYKT+FK P G 
Sbjct  555   IKDLSSHVWAYKTGLQGVDHDMLYSET-SPSVRRWKTETDMPVDTQMTWYKTTFKPPLGT  613

Query  1142  DPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPT  1318
             +PV++DL  MGKG AWVNG ++GRYW   LA  D C  + CDYRGEY+N KC++NCG   
Sbjct  614   NPVILDLSSMGKGEAWVNGISIGRYWPSYLADEDGCSLDPCDYRGEYDNTKCVTNCGKSI  673

Query  1319  QRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGR  1498
             Q  YHVPRSFL R   N LVLFEE GGN ++V+F+T+   G CA+ YE    E+SC+G  
Sbjct  674   QTEYHVPRSFL-RDDVNTLVLFEEFGGNPTQVKFKTIGVKGACANGYEGSTLELSCKGS-  731

Query  1499  NITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNC  1678
             +I+AIK+A+FG+  G CG   +        DA +IL  AC+G+  CSV  SE  FG    
Sbjct  732   SISAIKFASFGNPLGDCGSFKKGSCDI---DAQHILTKACVGQEICSVDISEKTFGAALN  788

Query  1679  AGSRTKKLVVEAVC  1720
                +TK+L VE  C
Sbjct  789   CEEKTKRLAVEITC  802



>emb|CDY53917.1| BnaA07g38250D [Brassica napus]
Length=1029

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/582 (54%), Positives = 399/582 (69%), Gaps = 47/582 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  486   TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  545

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+E+ + YGNI+T    NS   T+Y     
Sbjct  546   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERILTYGNISTIDFGNSASATIYKTEEG  605

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK---EG  532
              +CFF N NET+DATI++QG  Y VPAWSV+ILPDCK E +NTA++ TQT++MVK   E 
Sbjct  606   SSCFFGNGNETSDATISFQGESYVVPAWSVTILPDCKNEAFNTAKIITQTSMMVKKPNEA  665

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
               A + L+WSWRPE  D+ +L GKG+ T  Q+ DQKV  ND SDY+WYMT+V   K DPI
Sbjct  666   EDAPSTLKWSWRPENMDNFLLKGKGESTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDPI  725

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K M L VN T  VLH + NGK++ +Q   N     +FE ++K   G+N++ LLS ++G
Sbjct  726   SGKIMSLRVNSTAHVLHAFVNGKHIGNQHAENGKFNYIFEKDVKFKSGRNVIALLSITVG  785

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I GKNGDET+ K+L +HKWSYK GL G EN+LFR    + 
Sbjct  786   LANYGAFFESKPAGITGPIFITGKNGDETIVKDLSAHKWSYKTGLNGFENQLFR----TE  841

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYK +FKAP G +PVVVDLMG+GK                   
Sbjct  842   SMSKWSVEGVPFNRTMTWYKATFKAPLGNEPVVVDLMGLGK-------------------  882

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
                         G Y+  KCL+NCG PTQR+YHVPRSFLN +GDN LVLFEE GGN S V
Sbjct  883   ------------GAYHAEKCLTNCGEPTQRWYHVPRSFLNAQGDNTLVLFEEMGGNPSLV  930

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G VCA+  E K+ E+SC   + I+AIK+A+FG+      G FEKG C  +K+ 
Sbjct  931   NFQTTRVGSVCANVNEKKIIELSCD-RKPISAIKFASFGNPN-GNCGSFEKGTCESSKNT  988

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+IL   C+GK  CS+  S   FG  +C+G+ T++L VEA+C
Sbjct  989   VDILTQECVGKEKCSIDVSTEKFGAPDCSGA-TRRLAVEAIC  1029



>emb|CDY28339.1| BnaC01g35090D [Brassica napus]
Length=788

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/582 (54%), Positives = 390/582 (67%), Gaps = 47/582 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGK+P+RT ED+A+SVARFFQ GGTF NYYMYHGGTNF RTAGGPYITT
Sbjct  245   TENWTGWFKQWGGKNPHRTTEDVAFSVARFFQRGGTFNNYYMYHGGTNFDRTAGGPYITT  304

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+E+ + YGNI+T    NS   T+Y     
Sbjct  305   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMERTLTYGNISTIDFGNSASATIYKTEEG  364

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NE +DA I++QG  Y VPAWSV+ILPDCK E YNTA++ TQT++MVK+  +A
Sbjct  365   SSCFFGNGNENSDAKISFQGESYVVPAWSVTILPDCKNEAYNTAKITTQTSMMVKKPNEA  424

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ IL GKG  T  Q+ DQKV  ND SDY+WYMT+V   K D  
Sbjct  425   EDTPSTLKWSWRPENVDNFILKGKGDSTQTQLFDQKVVTNDQSDYLWYMTTVKFKKRDLF  484

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K M L VN T   LH + NGK++ +Q   N     +FE ++K   G+N++ LLS ++G
Sbjct  485   LGKSMSLRVNSTAHALHAFVNGKHIGNQHAENGKFNYVFEKDVKFKSGRNVIALLSITVG  544

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G + I G NGDET+ K+L +HKWSYK GL G EN+ FR    + 
Sbjct  545   LANYGAFFESKPAGITGPIFITGINGDETIVKDLSAHKWSYKTGLNGFENQFFR----TE  600

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
             S S+W  + +P  R MTWYK +FKAP G DPVVVDLMG+GK                   
Sbjct  601   SMSKWSVESVPFNRSMTWYKATFKAPLGNDPVVVDLMGLGK-------------------  641

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
                         G Y+  KCL+NCG PTQR+YHVPRSFLN  GDN LVLFEE GGN S V
Sbjct  642   ------------GAYHAEKCLTNCGEPTQRWYHVPRSFLNGEGDNTLVLFEEMGGNPSLV  689

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT R G VCA+ YENK+ E+SC   + I+AIK+A+FG+      G FEKG C  + + 
Sbjct  690   SFQTTRVGSVCANVYENKIIELSCD-RKPISAIKFASFGNP-YGNCGSFEKGTCESSNNT  747

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             V+IL   C+GK  CS+  S   FG  +C+G+  +KL VE +C
Sbjct  748   VDILTQECVGKEKCSIDVSTKKFGAPDCSGA-ARKLAVEVIC  788



>ref|XP_007138632.1| hypothetical protein PHAVU_009G2251001g, partial [Phaseolus vulgaris]
 gb|ESW10626.1| hypothetical protein PHAVU_009G2251001g, partial [Phaseolus vulgaris]
Length=558

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/574 (54%), Positives = 403/574 (70%), Gaps = 28/574 (5%)
 Frame = +2

Query  32    WGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITTTYDYNAPLDE  211
             WG KDP+RTAED+AYSVARFFQ GGTFQNYYMYHGGTNFGRTAGGPYITTTYDY+APLDE
Sbjct  2     WGSKDPHRTAEDVAYSVARFFQSGGTFQNYYMYHGGTNFGRTAGGPYITTTYDYDAPLDE  61

Query  212   YGNLNQPKYGHLKELHNVLHSLEKNIV-YGNITTTKLDNSIQVTVYAFNGTKTCFFSNSN  388
             +GN+ QPK+GHLKELH VL S+E ++  YGN++   L +S++ TVYA N + +CF +N+N
Sbjct  62    FGNIAQPKWGHLKELHRVLKSMENSLTNYGNVSEVDLGHSVKATVYATNDSSSCFLTNTN  121

Query  389   ETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA---AAALRW  559
              T DAT+ ++G  Y +PAWSVS+LPDC+ E YNTA+VN QT++MVK   KA     AL W
Sbjct  122   TTTDATVTFRGNKYNIPAWSVSLLPDCQTEEYNTAKVNVQTSLMVKGRNKAEDEPTALNW  181

Query  560   SWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWSKDMRLGV  736
              WR E  DD +L GKG F+  +++DQK VA+D SDY+WYMT +++D++DPI S +M L +
Sbjct  182   VWRAENIDDALL-GKGNFSEKRLIDQKTVASDTSDYLWYMTRLDIDQNDPILSDNMSLSI  240

Query  737   NGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIGFQNYGPYFD  904
             NG+GQV+H + NG+++ S W      N +FE  IKL  GKN+++LLS ++G QNYGP +D
Sbjct  241   NGSGQVIHAFVNGEHIGSHWATYGIRNDIFEPEIKLKPGKNIVSLLSVTVGLQNYGPNYD  300

Query  905   LGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSASQWLSDH  1081
                 GL G + ++ +  DETV K+L S+KWSYKVGL G +NK F   +   S S+W S++
Sbjct  301   KWPTGLVGPISVISRKDDETVVKDLSSNKWSYKVGLHGWDNKFFSEDSSYASDSKWESEY  360

Query  1082  LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL-AKGDDCPTEA  1258
             L T R +TWYKT+FKAP G + VVVDL GMGKG+AWVNG+NLGR W    A  D C  + 
Sbjct  361   LTTNRMLTWYKTTFKAPLGSEGVVVDLQGMGKGYAWVNGHNLGRTWPSYEASEDGCSDDP  420

Query  1259  CDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQTVRTG  1438
             CDYRGEY++ K            YHVPRSF+ + G N +VLFEE GGN S V FQTV  G
Sbjct  421   CDYRGEYDDKK------------YHVPRSFI-QDGLNTMVLFEEIGGNPSLVNFQTVSVG  467

Query  1439  GVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTAC  1618
               C + +ENK  E+SC  G  I+ IK+A+FG+ +G CG   +      + DA+ I++ AC
Sbjct  468   SACGNTHENKTLELSCH-GHPISDIKFASFGNPQGECGAFSKGSCESKS-DALTIVQNAC  525

Query  1619  LGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +GK SC +  SE  FG  NC G   K+L VEAVC
Sbjct  526   VGKESCIIDVSEKTFGPANC-GDMVKRLAVEAVC  558



>ref|XP_002284027.2| PREDICTED: beta-galactosidase 15-like [Vitis vinifera]
Length=829

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/590 (53%), Positives = 409/590 (69%), Gaps = 27/590 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GW+K WGG DP+RTAEDLA+SVARF+QLGGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  250   TENWSGWYKNWGGSDPHRTAEDLAFSVARFYQLGGTFQNYYMYHGGTNFGRTAGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYGN NQPK+GHL++LH +L S+EK + YG++     +     T+Y++ G 
Sbjct  310   SYDYDAPLNEYGNKNQPKWGHLRDLHLLLLSMEKALTYGDVKNVDYETLTSATIYSYQGK  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF NSN   D TINY G +Y +PAWSVSILPDC  EVYNTA+VN+Q +  VK+G +A
Sbjct  370   SSCFFGNSNADRDVTINYGGVNYTIPAWSVSILPDCSNEVYNTAKVNSQYSTFVKKGSEA  429

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L+W+WR E          G+FTA+++LDQK VA D SDY++YMT+V++  DDPI
Sbjct  430   ENEPNSLQWTWRGETIQYIT---PGRFTASELLDQKTVAEDTSDYLYYMTTVDISNDDPI  486

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFE----TNIKLNHGKNLLTLLSASIG  877
             W KD+ L VN +G +LH + NG+++  Q+     FE     ++ L  GKN +TLLSA++G
Sbjct  487   WGKDLTLSVNTSGHILHAFVNGEHIGYQYALLGQFEFQFRRSVTLQLGKNEITLLSATVG  546

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLG-SHKWSYKVGLRGEENKLFRSSNKS  1051
               NYGP FD+   G++G V+I+  NG   + K+L  +++W+YK GL GE+ K+F    + 
Sbjct  547   LTNYGPDFDMVNQGIHGPVQIIASNGSADIIKDLSNNNQWAYKAGLNGEDKKIFLGRAR-  605

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-IL  1228
                +QW SD+LP  R   WYK +F AP G DPVVVDLMG+GKG AWVNG++LGRYW   +
Sbjct  606   --YNQWKSDNLPVNRSFVWYKATFDAPPGEDPVVVDLMGLGKGEAWVNGHSLGRYWPSYI  663

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
             A+G+ C  E CDYRG Y   KC +NCGNP+QR+YHVPRSFL    DN LVLFEE GGN S
Sbjct  664   ARGEGCSPE-CDYRGPYKAEKCNTNCGNPSQRWYHVPRSFLAST-DNRLVLFEEFGGNPS  721

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTR------gscgggfekg  1570
              V FQTV  G  CA+A E    E+SCQ GR I+ IK+A+FGD +       + G    + 
Sbjct  722   SVTFQTVTVGNACANAREGYTLELSCQ-GRAISGIKFASFGDPQGTCGKPFATGSQVFEK  780

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 A D+++I++  C+GK SCS+  SE + G   C  + TK+L VEA+C
Sbjct  781   GTCEAADSLSIIQKLCVGKYSCSIDVSEQILGPAGCT-ADTKRLAVEAIC  829



>ref|XP_002893682.1| Beta-galactosidase 15 precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69941.1| Beta-galactosidase 15 precursor [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/583 (54%), Positives = 392/583 (67%), Gaps = 59/583 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+K WGGKDP+RT ED+A++VARFFQ GGTFQNYYMYHGGTNF RTAGGPYITT
Sbjct  247   TENWTGWYKNWGGKDPHRTTEDVAFAVARFFQRGGTFQNYYMYHGGTNFDRTAGGPYITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNLNQPKYGHLK+LH+VLH++EK + YGNI+T    N +  TVY     
Sbjct  307   TYDYDAPLDEFGNLNQPKYGHLKQLHDVLHAMEKTLTYGNISTVDFGNLVTATVYKTEEG  366

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N NET+DA IN+QGT Y VPAWSVSILPDCK E YNTA++NTQT+VMVK+  +A
Sbjct  367   SSCFIGNVNETSDAKINFQGTFYDVPAWSVSILPDCKTETYNTAKINTQTSVMVKKANEA  426

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D+ +L GKG+ T  Q+ DQK V+ND SDY+WYMT+VN+ + DP+
Sbjct  427   ENEPSTLKWSWRPENIDNVLLKGKGESTMRQLFDQKVVSNDESDYLWYMTTVNIKEQDPV  486

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
             W K+M L +N T  VLH + NG+++ +    N     +FE + K N G N++TLLS ++G
Sbjct  487   WGKNMSLRINSTAHVLHAFVNGQHIGNYRAENGKFHYVFEQDAKFNPGANVITLLSITVG  546

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G V I+G+NGDET+ K+L +HKWSYK GL G EN+LF S + S 
Sbjct  547   LPNYGAFFENVPAGITGPVFIIGRNGDETIVKDLSTHKWSYKTGLSGFENQLFSSESPS-  605

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LILA  1231
                             TW      AP G +PVVVDL+G+GKG AW+NGNN+GRYW   LA
Sbjct  606   ----------------TW-----SAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPAFLA  644

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               D C  E                        YHVPRSFLN  GDN LVLFEE GGN S 
Sbjct  645   DIDGCSAE------------------------YHVPRSFLNSDGDNTLVLFEEIGGNPSL  680

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT+  G VCA+ YE  V E+SC  G+ I++IK+A+FG+  G   G FEKG C  + D
Sbjct  681   VNFQTIGVGNVCANVYEKNVLELSCN-GKPISSIKFASFGNP-GGNCGSFEKGTCEASND  738

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A  IL   C+GK  CS+  SE  FG  +C G   K+L VEA+C
Sbjct  739   AAAILTQECVGKEKCSIDVSEKKFGAADCGG-LAKRLAVEAIC  780



>gb|EYU41564.1| hypothetical protein MIMGU_mgv1a001413mg [Erythranthe guttata]
Length=824

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/590 (52%), Positives = 397/590 (67%), Gaps = 31/590 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWFK WGGKDP+RTAEDL+++VARF+Q GGT QNYYMYHGGTNFGRTAGGPYI T
Sbjct  249   TENWSGWFKNWGGKDPHRTAEDLSFAVARFYQYGGTLQNYYMYHGGTNFGRTAGGPYIAT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYGNLNQPK+GHLK+LH++L S+EK + YG  T T     +  TVY+ NGT
Sbjct  309   SYDYDAPIDEYGNLNQPKWGHLKKLHSLLMSMEKILTYGQYTNTDYGRMMSSTVYSLNGT  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             + CF  N+N   D TIN++G  Y VPAWSVSILPDC  EVYNTARVNTQT+VMVKE    
Sbjct  369   RVCFLGNANNKDDITINFEGRKYTVPAWSVSILPDCVTEVYNTARVNTQTSVMVKELPAE  428

Query  542   AAALR-----WSWRPEVAD--DTILHG----KGQFTANQILDQK-VANDVSDYIWYMTSV  685
             A   R     W WR E  +   T L+     KG   ANQ+LDQK V ND SDY+WYMTSV
Sbjct  429   AEEKRHYDFEWQWRAEHFEHLKTSLNKSSPLKGVTYANQLLDQKIVTNDTSDYLWYMTSV  488

Query  686   NLDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLL  853
             ++++DDPIW +++ L VN    VLH + NGK++ ++W  N     +FE + KL  G N +
Sbjct  489   DVNEDDPIWGEEVTLRVNCDCHVLHAFFNGKHIGTKWVKNGQYSFVFEESAKLKRGTNSI  548

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
             +LLS ++G QNYG Y D   NG+ G V++V  N   ++ K+L +++W+YKVGL G E  L
Sbjct  549   SLLSVTVGLQNYGAYIDKVKNGILGPVKLVAPN---SIEKDLSTNEWAYKVGLNGIERGL  605

Query  1031  FRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  K +   +W S+ +P  R   WYKTSF+ P G+D VV+DL G+GKG AWVNG+N+G
Sbjct  606   QNIDTKYK--REWHSN-IPFNRMFVWYKTSFRTPKGKDAVVLDLWGLGKGSAWVNGHNIG  662

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW      ++    +CDYRG+Y  +KCL+NCGN +QR+YHVPRSFLN   DN LVLFEE
Sbjct  663   RYWPSYLADENGCVSSCDYRGDYTGSKCLTNCGNSSQRWYHVPRSFLNEEEDNTLVLFEE  722

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekg  1570
              GGN + +  +TV  G   A AYE    E+SC G R I+ I +A+FG+            
Sbjct  723   FGGNPTHISVRTVTVGKAVAHAYEGNRLELSCDGSRVISKINFASFGNP--------TSK  774

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 + +++++++ AC+GK SCS+  SE  FG + C  S+ K+L VE  C
Sbjct  775   GSCHSPNSLSVVEKACIGKESCSIEVSEKTFGASGCGKSQMKRLAVEVEC  824



>gb|KDP33931.1| hypothetical protein JCGZ_07502 [Jatropha curcas]
Length=797

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/589 (53%), Positives = 388/589 (66%), Gaps = 60/589 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGKDP+RTAEDLA++VARFFQLGGTFQNYYMYHGGTN GRTAGGPYITT
Sbjct  253   TENWTGWFKSWGGKDPHRTAEDLAFAVARFFQLGGTFQNYYMYHGGTNLGRTAGGPYITT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPKYGHLK+LH+VLHS+E  + +GNI+    +NS+  TVYA    
Sbjct  313   SYDYDAPLDEYGNLNQPKYGHLKQLHDVLHSMEYILTHGNISAVDYNNSVTATVYASEKG  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N+N + DATI +QGT Y VPAWSVSILPDCK   YNTA+V TQT  MVK   +A
Sbjct  373   SSCFFGNANTSLDATIEFQGTTYIVPAWSVSILPDCKNVAYNTAKVQTQTVEMVKRKNEA  432

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPI  709
                  +L+WSWRPE  D T+LHGKG F ANQ++DQK A ND SDY+W+MT     KDDPI
Sbjct  433   EDEPYSLKWSWRPENTDATVLHGKGHFHANQLIDQKAATNDASDYLWHMTR---HKDDPI  489

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
              S D+ L +NG+G ++H Y NG Y+ S+W      N +FE NI L  G NL+T+LS ++G
Sbjct  490   LSHDLSLRINGSGHIIHAYVNGNYIGSEWAKYGVFNYVFEKNITLREGHNLITILSGTVG  549

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL-----FRS  1039
              QNYGP FDL   G+   VE++G  GDE V K+L S KWSY+VGL G  +++       +
Sbjct  550   LQNYGPKFDLIQTGILSPVELIGHKGDEIVIKDLSSAKWSYRVGLHGMNHQISSNNQLYT  609

Query  1040  SNKSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
              +   S+  W  D  LPT R MTWYKT+FKAP G+D VV+DL GMGKGFAWVNG+N+GRY
Sbjct  610   LDSPFSSKLWEEDNELPTNRMMTWYKTTFKAPLGKDAVVLDLQGMGKGFAWVNGHNIGRY  669

Query  1217  WL-ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             W   +A  + C T+ CDYR                                       E 
Sbjct  670   WPSFIADENGCETKECDYR---------------------------------------EF  690

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GGN   V FQTV  G V     E    E+SC  G+ I+AI++A+FGD +    G F KG 
Sbjct  691   GGNPGEVNFQTVTVGKVSGKGNEGDTIELSCY-GKPISAIQFASFGDPQ-WTAGSFVKGT  748

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             C G+KDA +I++TAC+GK SC++  S+ VFG T C       L VEA+C
Sbjct  749   CEGSKDAFSIIRTACVGKESCAIKVSKDVFGPTTCGREVVSTLAVEALC  797



>sp|Q9C6W4.1|BGA15_ARATH RecName: Full=Beta-galactosidase 15; Short=Lactase 15; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG60136.1|AC074360_1 hypothetical protein [Arabidopsis thaliana]
Length=779

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/583 (54%), Positives = 389/583 (67%), Gaps = 59/583 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+K WGGKDP+RT ED+A++VARFFQ  GTFQNYYMYHGGTNF RTAGGPYITT
Sbjct  246   TENWTGWYKNWGGKDPHRTTEDVAFAVARFFQKEGTFQNYYMYHGGTNFDRTAGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNLNQPKYGHLK+LH+VLH++EK + YGNI+T    N +  TVY     
Sbjct  306   TYDYDAPLDEFGNLNQPKYGHLKQLHDVLHAMEKTLTYGNISTVDFGNLVTATVYQTEEG  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N NET+DA IN+QGT Y VPAWSVSILPDCK E YNTA++NTQT+VMVK+  +A
Sbjct  366   SSCFIGNVNETSDAKINFQGTSYDVPAWSVSILPDCKTETYNTAKINTQTSVMVKKANEA  425

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D  +L GKG+ T  Q+ DQK V+ND SDY+WYMT+VNL + DP+
Sbjct  426   ENEPSTLKWSWRPENIDSVLLKGKGESTMRQLFDQKVVSNDESDYLWYMTTVNLKEQDPV  485

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L +N T  VLH + NG+++ +    N     +FE + K N G N++TLLS ++G
Sbjct  486   LGKNMSLRINSTAHVLHAFVNGQHIGNYRVENGKFHYVFEQDAKFNPGANVITLLSITVG  545

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G V I+G+NGDET+ K+L +HKWSYK GL G EN+LF S + S 
Sbjct  546   LPNYGAFFENFSAGITGPVFIIGRNGDETIVKDLSTHKWSYKTGLSGFENQLFSSESPS-  604

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LILA  1231
                             TW      AP G +PVVVDL+G+GKG AW+NGNN+GRYW   L+
Sbjct  605   ----------------TW-----SAPLGSEPVVVDLLGLGKGTAWINGNNIGRYWPAFLS  643

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               D C  E                        YHVPRSFLN  GDN LVLFEE GGN S 
Sbjct  644   DIDGCSAE------------------------YHVPRSFLNSEGDNTLVLFEEIGGNPSL  679

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQT+  G VCA+ YE  V E+SC  G+ I+AIK+A+FG+  G   G FEKG C  + +
Sbjct  680   VNFQTIGVGSVCANVYEKNVLELSCN-GKPISAIKFASFGNP-GGDCGSFEKGTCEASNN  737

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A  IL   C+GK  CS+  SE  FG   C G+  K+L VEA+C
Sbjct  738   AAAILTQECVGKEKCSIDVSEDKFGAAEC-GALAKRLAVEAIC  779



>emb|CBI30211.3| unnamed protein product [Vitis vinifera]
Length=829

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/590 (53%), Positives = 406/590 (69%), Gaps = 31/590 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GW+K WGG DP+RTAEDLA+SVARF+QLGGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  254   TENWSGWYKNWGGSDPHRTAEDLAFSVARFYQLGGTFQNYYMYHGGTNFGRTAGGPYITT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYGN NQPK+GHL++LH +L S+EK + YG++     +     T+Y++ G 
Sbjct  314   SYDYDAPLNEYGNKNQPKWGHLRDLHLLLLSMEKALTYGDVKNVDYETLTSATIYSYQGK  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF NSN   D TINY G +Y +PAWSVSILPDC  EVYNTA+VN+Q +  VK+G +A
Sbjct  374   SSCFFGNSNADRDVTINYGGVNYTIPAWSVSILPDCSNEVYNTAKVNSQYSTFVKKGSEA  433

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L+W+WR E          G+FTA+++LDQK VA D SDY++YMT+     DDPI
Sbjct  434   ENEPNSLQWTWRGETIQYIT---PGRFTASELLDQKTVAEDTSDYLYYMTT----NDDPI  486

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFE----TNIKLNHGKNLLTLLSASIG  877
             W KD+ L VN +G +LH + NG+++  Q+     FE     ++ L  GKN +TLLSA++G
Sbjct  487   WGKDLTLSVNTSGHILHAFVNGEHIGYQYALLGQFEFQFRRSVTLQLGKNEITLLSATVG  546

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLG-SHKWSYKVGLRGEENKLFRSSNKS  1051
               NYGP FD+   G++G V+I+  NG   + K+L  +++W+YK GL GE+ K+F    + 
Sbjct  547   LTNYGPDFDMVNQGIHGPVQIIASNGSADIIKDLSNNNQWAYKAGLNGEDKKIFLGRAR-  605

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-IL  1228
                +QW SD+LP  R   WYK +F AP G DPVVVDLMG+GKG AWVNG++LGRYW   +
Sbjct  606   --YNQWKSDNLPVNRSFVWYKATFDAPPGEDPVVVDLMGLGKGEAWVNGHSLGRYWPSYI  663

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
             A+G+ C  E CDYRG Y   KC +NCGNP+QR+YHVPRSFL    DN LVLFEE GGN S
Sbjct  664   ARGEGCSPE-CDYRGPYKAEKCNTNCGNPSQRWYHVPRSFLAST-DNRLVLFEEFGGNPS  721

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTR------gscgggfekg  1570
              V FQTV  G  CA+A E    E+SCQ GR I+ IK+A+FGD +       + G    + 
Sbjct  722   SVTFQTVTVGNACANAREGYTLELSCQ-GRAISGIKFASFGDPQGTCGKPFATGSQVFEK  780

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 A D+++I++  C+GK SCS+  SE + G   C  + TK+L VEA+C
Sbjct  781   GTCEAADSLSIIQKLCVGKYSCSIDVSEQILGPAGCT-ADTKRLAVEAIC  829



>ref|XP_010050189.1| PREDICTED: beta-galactosidase 15-like [Eucalyptus grandis]
Length=832

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/589 (51%), Positives = 401/589 (68%), Gaps = 22/589 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWFK WG KDP+RTAEDLA++VARFFQ GG+ QNYYMYHGGTNF RTAGGPYITT
Sbjct  247   TENWSGWFKDWGMKDPHRTAEDLAFAVARFFQYGGSLQNYYMYHGGTNFDRTAGGPYITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK LH ++ S+E+ + +G        N +  TVY + G 
Sbjct  307   SYDYDAPLDEYGNLNQPKWGHLKRLHELIMSMEEILTHGVKRDVDYGNMMSGTVYMYKGK  366

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             ++CF  N+N+  D T+N  G+ Y VPAWSVSILPDC  EVYNTA++N+Q TVMVK   +A
Sbjct  367   QSCFLGNANQNQDFTVNLMGSSYTVPAWSVSILPDCYTEVYNTAKINSQQTVMVKLPNEA  426

Query  542   -----AAALRWSWRPEVADDTILHG--KGQF-TANQILDQK-VANDVSDYIWYMTSVNLD  694
                     L+W WRPE   +++ HG  KG   TAN++LDQK V ND SDY+WY+TS++L 
Sbjct  427   DDQTEPYELQWDWRPE-HPESLHHGVAKGSVTTANELLDQKTVTNDTSDYLWYLTSLDLS  485

Query  695   KDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGK-NLLTL  859
             KDD +  K + L V+  G ++H + NGK+V SQW  +     + E +IKL HGK N ++L
Sbjct  486   KDDSLAGKAITLHVHTNGHIVHAFVNGKHVGSQWGTSDHLEFIMEKDIKLKHGKTNSISL  545

Query  860   LSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGD-ETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LS ++G QNYG  FD    G++G V+++G  G  + V  +L ++ W+YKVGL G E K  
Sbjct  546   LSVTVGLQNYGANFDTVNVGIHGPVKLIGNKGQSDEVTVDLSTNLWTYKVGLNGMEEKGL  605

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
             +  N +R    W S +LP+ R   WYKT+FKAP G DPVVVDL G+GKG AWVNG+N+GR
Sbjct  606   QLDN-ARHQHGWKSYNLPSNRLFVWYKTTFKAPLGSDPVVVDLQGLGKGTAWVNGHNIGR  664

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             +W      +D  T  CDYRG YN+NKCL+NCG+P+QR+YH+PRSFL   G N+LVLFEE 
Sbjct  665   FWPSFVASEDGCTATCDYRGAYNSNKCLTNCGDPSQRWYHIPRSFLQDDG-NKLVLFEEF  723

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GG    VRFQT+  G +CA+  E K  E+ CQGGR ++ IK+A+FG+   +   G     
Sbjct  724   GGTPLHVRFQTITAGTICATTDEKKQLELLCQGGRIMSEIKFASFGEP--TGVCGSYARG  781

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                A + +++++  CLG+ SC++  SE+ FG T C      +L VEA C
Sbjct  782   SCEAPNTLSVIQKQCLGQESCTLDVSENTFGPTGCH-QNVYRLAVEATC  829



>gb|KCW89294.1| hypothetical protein EUGRSUZ_A01583 [Eucalyptus grandis]
Length=837

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/589 (51%), Positives = 401/589 (68%), Gaps = 22/589 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWFK WG KDP+RTAEDLA++VARFFQ GG+ QNYYMYHGGTNF RTAGGPYITT
Sbjct  252   TENWSGWFKDWGMKDPHRTAEDLAFAVARFFQYGGSLQNYYMYHGGTNFDRTAGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK LH ++ S+E+ + +G        N +  TVY + G 
Sbjct  312   SYDYDAPLDEYGNLNQPKWGHLKRLHELIMSMEEILTHGVKRDVDYGNMMSGTVYMYKGK  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             ++CF  N+N+  D T+N  G+ Y VPAWSVSILPDC  EVYNTA++N+Q TVMVK   +A
Sbjct  372   QSCFLGNANQNQDFTVNLMGSSYTVPAWSVSILPDCYTEVYNTAKINSQQTVMVKLPNEA  431

Query  542   -----AAALRWSWRPEVADDTILHG--KGQF-TANQILDQK-VANDVSDYIWYMTSVNLD  694
                     L+W WRPE   +++ HG  KG   TAN++LDQK V ND SDY+WY+TS++L 
Sbjct  432   DDQTEPYELQWDWRPE-HPESLHHGVAKGSVTTANELLDQKTVTNDTSDYLWYLTSLDLS  490

Query  695   KDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGK-NLLTL  859
             KDD +  K + L V+  G ++H + NGK+V SQW  +     + E +IKL HGK N ++L
Sbjct  491   KDDSLAGKAITLHVHTNGHIVHAFVNGKHVGSQWGTSDHLEFIMEKDIKLKHGKTNSISL  550

Query  860   LSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGD-ETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LS ++G QNYG  FD    G++G V+++G  G  + V  +L ++ W+YKVGL G E K  
Sbjct  551   LSVTVGLQNYGANFDTVNVGIHGPVKLIGNKGQSDEVTVDLSTNLWTYKVGLNGMEEKGL  610

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
             +  N +R    W S +LP+ R   WYKT+FKAP G DPVVVDL G+GKG AWVNG+N+GR
Sbjct  611   QLDN-ARHQHGWKSYNLPSNRLFVWYKTTFKAPLGSDPVVVDLQGLGKGTAWVNGHNIGR  669

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             +W      +D  T  CDYRG YN+NKCL+NCG+P+QR+YH+PRSFL   G N+LVLFEE 
Sbjct  670   FWPSFVASEDGCTATCDYRGAYNSNKCLTNCGDPSQRWYHIPRSFLQDDG-NKLVLFEEF  728

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GG    VRFQT+  G +CA+  E K  E+ CQGGR ++ IK+A+FG+   +   G     
Sbjct  729   GGTPLHVRFQTITAGTICATTDEKKQLELLCQGGRIMSEIKFASFGEP--TGVCGSYARG  786

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                A + +++++  CLG+ SC++  SE+ FG T C      +L VEA C
Sbjct  787   SCEAPNTLSVIQKQCLGQESCTLDVSENTFGPTGCH-QNVYRLAVEATC  834



>ref|XP_006843913.1| hypothetical protein AMTR_s00007p00269020 [Amborella trichopoda]
 gb|ERN05588.1| hypothetical protein AMTR_s00007p00269020 [Amborella trichopoda]
Length=823

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/587 (51%), Positives = 390/587 (66%), Gaps = 25/587 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP+R AED+AY+VARF+Q GGTFQNYYMYHGGTNFGRTAGGPYI T
Sbjct  248   TENWTGWFKGWGGRDPHRPAEDVAYAVARFYQTGGTFQNYYMYHGGTNFGRTAGGPYIAT  307

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPK+GHLK+LH +L S+EK +  G ++ T        T+Y  +G 
Sbjct  308   SYDYDAPLDEYGNLRQPKWGHLKQLHEILISMEKVLTSGTVSNTSFGFGADATIYTLDGA  367

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF SN+N T DAT+ +QG  Y +PAWSVSILPDCK+  YNTA+V TQT +M  +   A
Sbjct  368   SSCFLSNTNTTNDATVTFQGIQYFLPAWSVSILPDCKQVAYNTAKVTTQTALMEMKPNSA  427

Query  542   AA----ALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
              +     L W WRPE+    +      FT+ Q+++QK  A D SDY+WY TSV + K+DP
Sbjct  428   ESIIPEQLDWQWRPEIIKGILKLANSTFTSTQLIEQKQAAADESDYLWYSTSVVIGKNDP  487

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASI  874
               SK+M L VN TG VLH Y NGK   SQ+  N     +F   + L  G+N ++LLS ++
Sbjct  488   SHSKEMVLSVNTTGHVLHAYVNGKLAGSQYAANGKYQFVFNQTVHLKSGRNYISLLSVTV  547

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G QNYG +FD+G +G+ G  V+I+G      V K++ S KW YKVGL  E+ KL+   N 
Sbjct  548   GLQNYGAFFDMGPSGIVGGPVQIIGSG---NVTKDISSSKWLYKVGLISEQKKLYEIDNL  604

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI-  1225
              +   +W ++ LPT R MTWYK SF AP G DPVVVDL GMGKG AW+NG N+GRYW   
Sbjct  605   KK--VKWHNESLPTKRAMTWYKASFPAPLGTDPVVVDLQGMGKGSAWINGQNIGRYWPTN  662

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNE--LVLFEETGG  1399
             LA  D CP+  C+YRG Y    C + CG PTQR+YHVPRSFL   GD+E  +VLFEE GG
Sbjct  663   LASQDGCPS-VCNYRGVYKPENCPTGCGEPTQRYYHVPRSFL---GDDENIIVLFEEIGG  718

Query  1400  NTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcg  1579
             +   + FQTV  G VC+   E    ++ C  G++I+AI++A+FG+  G CG   + G   
Sbjct  719   DPKDINFQTVSVGKVCSKIEEGSTLQLKCPSGKSISAIEFASFGNPEGQCGSFQKGGCNI  778

Query  1580  gAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +  A++ ++ AC+G  SCSV+ +E V G+ +  G+  K L V+A C
Sbjct  779   AS--ALSAVQKACVGNVSCSVSVTEEVLGSDSSCGNLHKSLAVQATC  823



>ref|XP_006583477.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=846

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/589 (51%), Positives = 392/589 (67%), Gaps = 21/589 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTG +K WG ++P+R AED+AY+VARFFQ GGTFQNYYMYHGGTNF RTAGGPY+TT
Sbjct  252   TENWTGGYKNWGTQNPHRPAEDVAYAVARFFQFGGTFQNYYMYHGGTNFKRTAGGPYVTT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHL++LHN+L S E  +  G+   T   N +  TVY ++G 
Sbjct  312   SYDYDAPLDEYGNLNQPKWGHLRQLHNLLKSKENILTQGSSQNTDYGNMVTATVYTYDGK  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              TCF  N++++ DATIN++  +Y +PAWSVSILP+C  E YNTA+VNTQTT+MVK+  + 
Sbjct  372   STCFIGNAHQSKDATINFRNNEYTIPAWSVSILPNCSSEAYNTAKVNTQTTIMVKKDNED  431

Query  542   AA-ALRWSWRPEV---ADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLD-KDD  703
                ALRW WR E      D  + G    TA ++LDQKV  ND SDY+WY+TS+++   DD
Sbjct  432   LEYALRWQWRQEPFVQMKDGQITGIIDLTAPKLLDQKVVTNDFSDYLWYITSIDIKGDDD  491

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSAS  871
             P W+K+ RL V+ +G VLHV+ NGK+V +Q   N  F    E+ IKL  GKN ++LLS +
Sbjct  492   PSWTKEFRLRVHTSGHVLHVFVNGKHVGTQHAKNGQFKFVHESKIKLTTGKNEISLLSTT  551

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVGKNG-----DETVRKNLGSHKWSYKVGLRGEENKLF  1033
             +G  NYGP+FD    G+ G V++V   G     D+ + K+L  ++WSYKVGL GE    +
Sbjct  552   VGLPNYGPFFDNIEVGVLGPVQLVAAVGDYDYDDDEIVKDLSKNQWSYKVGLHGEHEMHY  611

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                N   S   W +D +PT R + WYKT+FK+P G DPVVVDL G+GKG AWVNGN++GR
Sbjct  612   SYEN---SLKTWYTDAVPTDRILVWYKTTFKSPIGDDPVVVDLSGLGKGHAWVNGNSIGR  668

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             YW      ++  +  CDYRG Y +NKCLS C  P+QR+YHVPRSFL     N LVLFEE 
Sbjct  669   YWSSYLADENGCSPKCDYRGPYTSNKCLSMCAQPSQRWYHVPRSFLRDNDQNTLVLFEEL  728

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GG    V F TV  G VCA+AYE    E++C   + I+ IK+A+FG  +     G  +  
Sbjct  729   GGQPYYVNFLTVTVGKVCANAYEGNTLELACNKNQVISEIKFASFGLPK--GECGSFQKG  786

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                + +A++ +K  C+GK  CS+  SE   G T C  +  ++L VEAVC
Sbjct  787   NCESSEALSAIKAQCIGKDKCSIQVSERTLGPTRCRVAEDRRLAVEAVC  835



>ref|XP_003530083.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=846

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/589 (51%), Positives = 392/589 (67%), Gaps = 21/589 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTG +K WG ++P+R AED+AY+VARFFQ GGTFQNYYMYHGGTNF RTAGGPY+TT
Sbjct  252   TENWTGGYKNWGTQNPHRPAEDVAYAVARFFQFGGTFQNYYMYHGGTNFKRTAGGPYVTT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHL++LHN+L S E  +  G+   T   N +  TVY ++G 
Sbjct  312   SYDYDAPLDEYGNLNQPKWGHLRQLHNLLKSKENILTQGSSQHTDYGNMVTATVYTYDGK  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              TCF  N++++ DATIN++  +Y +PAWSVSILP+C  E YNTA+VNTQTT+MVK+  + 
Sbjct  372   STCFIGNAHQSKDATINFRNNEYTIPAWSVSILPNCSSEAYNTAKVNTQTTIMVKKDNED  431

Query  542   AA-ALRWSWRPEV---ADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLD-KDD  703
                ALRW WR E      D  + G    TA ++LDQKV  ND SDY+WY+TS+++   DD
Sbjct  432   LEYALRWQWRQEPFVQMKDGQITGIIDLTAPKLLDQKVVTNDFSDYLWYITSIDIKGDDD  491

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSAS  871
             P W+K+ RL V+ +G VLHV+ NGK+V +Q   N  F    E+ IKL  GKN ++LLS +
Sbjct  492   PSWTKEFRLRVHTSGHVLHVFVNGKHVGTQHAKNGQFKFVHESKIKLTTGKNEISLLSTT  551

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVGKNG-----DETVRKNLGSHKWSYKVGLRGEENKLF  1033
             +G  NYGP+FD    G+ G V++V   G     D+ + K+L  ++WSYKVGL GE    +
Sbjct  552   VGLPNYGPFFDNIEVGVLGPVQLVAAVGDYDYDDDEIVKDLSKNQWSYKVGLHGEHEMHY  611

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                N   S   W +D +PT R + WYKT+FK+P G DPVVVDL G+GKG AWVNGN++GR
Sbjct  612   SYEN---SLKTWYTDAVPTDRILVWYKTTFKSPIGDDPVVVDLSGLGKGHAWVNGNSIGR  668

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             YW      ++  +  CDYRG Y +NKCLS C  P+QR+YHVPRSFL     N LVLFEE 
Sbjct  669   YWSSYLADENGCSPKCDYRGPYTSNKCLSMCAQPSQRWYHVPRSFLRDDDQNTLVLFEEL  728

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GG    V F TV  G VCA+AYE    E++C   + I+ IK+A+FG  +     G  +  
Sbjct  729   GGQPYYVNFLTVTVGKVCANAYEGNTLELACNKNQVISEIKFASFGLPK--GECGSFQKG  786

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                + +A++ +K  C+GK  CS+  SE   G T C  +  ++L VEAVC
Sbjct  787   NCESSEALSAIKAQCIGKDKCSIQVSERALGPTRCRVAEDRRLAVEAVC  835



>ref|XP_011094447.1| PREDICTED: beta-galactosidase 15-like [Sesamum indicum]
Length=831

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/590 (51%), Positives = 392/590 (66%), Gaps = 30/590 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GW+K WGGKDP+RTAEDLA++VARFFQ GGT QNYYMYHGGTNFGRTAGGPYITT
Sbjct  255   TENWSGWYKNWGGKDPHRTAEDLAFAVARFFQYGGTLQNYYMYHGGTNFGRTAGGPYITT  314

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH+++ S+EK + YG  T       +  TV+ +NGT
Sbjct  315   SYDYDAPLDEYGNLNQPKWGHLKKLHSLIMSMEKILTYGKATNKDYGGMMSSTVFEYNGT  374

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
             + CF  N+N     TIN++G  Y  PAWSVSILPDC   VYNTA VNTQ +VMVK+    
Sbjct  375   RVCFLGNANNRDAKTINFEGKSYTTPAWSVSILPDCVNVVYNTAEVNTQKSVMVKKLPLE  434

Query  542   AAA-----LRWSWRPEVAD--DTILHGKGQFT----ANQILDQKV-ANDVSDYIWYMTSV  685
             AA      L W WR E  +   T +   G       ANQ+LDQK+ AND SDY+WYMTSV
Sbjct  435   AAPKRHYDLEWLWRSEHIEHLKTSVENSGPLKGVTYANQLLDQKLAANDTSDYLWYMTSV  494

Query  686   NLDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLL  853
             ++++DDPIW +++ + V    Q+LHV+ NGK++ S+W  N     LFE N KL  G N L
Sbjct  495   DINEDDPIWGEEVTVSVQCDCQILHVFFNGKHIGSKWVTNGQYNFLFERNAKLKLGTNSL  554

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
             +LLS ++G QNYG +FD   NG+ G V++V  N   ++ K+L S+KW+YKVGL G E +L
Sbjct  555   SLLSVTVGLQNYGAHFDKANNGILGPVKLVAPN---SLEKDLTSNKWAYKVGLNGLERRL  611

Query  1031  FRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  K +   +W   ++P  R   WYKT+FK P G DPVV+DL G+GKG AWVNG+++G
Sbjct  612   QEVDIKHK--RKW-HPNVPFDRMFVWYKTTFKTPKGEDPVVLDLWGLGKGTAWVNGHDIG  668

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW      D+     CDYRG Y  +KCL+NCG  +QR+YHVPRSFLN   DN LVLFEE
Sbjct  669   RYWPSFVADDNGCVSFCDYRGAYTGSKCLTNCGKSSQRWYHVPRSFLNDE-DNTLVLFEE  727

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekg  1570
              GGN + +  QTV      A AYE    E+SCQ GR I+ + +A+FG+       G    
Sbjct  728   FGGNPTFISVQTVTMKSASAHAYEGNSLELSCQ-GRVISKVNFASFGN----GTYGSLHK  782

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 + ++++++K AC+GK SCS+ ASE  FG ++C  +  K L VE  C
Sbjct  783   GSCHSPNSLSVVKQACIGKESCSIDASEQTFGPSSC-DAPMKSLAVEVQC  831



>ref|XP_003519946.2| PREDICTED: beta-galactosidase-like [Glycine max]
Length=836

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/581 (49%), Positives = 383/581 (66%), Gaps = 15/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+WTGWF  WGG  P+RTAED+A++V RFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  252   TEDWTGWFMHWGGPTPHRTAEDVAFAVGRFFQYGGTFQNYYMYHGGTNFGRTSGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYG+LNQPK+GHLK LH VL S+E  +  G+       N +  T++++ G 
Sbjct  312   SYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSRNIDYGNQMTATIFSYAGQ  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF  N++ + DA IN+Q T Y +PAWSVSILPDC  EVYNTA+VN QT++M     + 
Sbjct  372   SVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYNTAKVNAQTSIMTIN-NEN  430

Query  542   AAALRWSWRPEVADDTILHGK----GQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPI  709
             + AL W W PE   + +  GK       TA ++LDQKVAND SDY+WY+TSV++ + DPI
Sbjct  431   SYALDWQWMPETHLEQMKDGKVLGSVAITAPRLLDQKVANDTSDYLWYITSVDVKQGDPI  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
              S D+++ VN  G VLHV+ NG ++ SQ+         FE +IKL  GKN ++L+S ++G
Sbjct  491   LSHDLKIRVNTKGHVLHVFVNGAHIGSQYATYGKYTFTFEADIKLKLGKNEISLVSGTVG  550

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
               NYG YFD    G+ GV++V +N    V K++ ++ W YKVG+ GE  KL+   + SRS
Sbjct  551   LPNYGAYFDNIHVGVTGVQLVSQNDGSEVTKDISTNVWHYKVGMHGENVKLY---SPSRS  607

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               +W ++ L   +   WYKT+F+ P G D VV+DL G+GKG AWVNGNN+GRYW+    G
Sbjct  608   TEEWFTNGLQAHKIFMWYKTTFRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAG  667

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +  CDYRG Y +NKC +NCGNPTQR+YHVP SFL    DN LV+FEE GGN  +V+
Sbjct  668   EDGCSSTCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVK  727

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
               TV     CA AYE    E++C+  + I+ IK+A+FG        G  K     + D +
Sbjct  728   IATVTIAKACAKAYEGHELELACKENQVISEIKFASFGVPE--GECGSFKKGHCESSDTL  785

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +I+K  CLGK  CS+  +E + G T C      +L ++A+C
Sbjct  786   SIVKRLCLGKQQCSIQVNEKMLGPTGCRVPE-NRLAIDALC  825



>ref|XP_003519945.2| PREDICTED: beta-galactosidase-like [Glycine max]
Length=836

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/581 (49%), Positives = 384/581 (66%), Gaps = 15/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+WTGWF  WGG  P+RTAED+A++V RFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  252   TEDWTGWFMHWGGPTPHRTAEDVAFAVGRFFQYGGTFQNYYMYHGGTNFGRTSGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYG+LNQPK+GHLK LH VL S+E  +  G+       N +  T++++ G 
Sbjct  312   SYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSRNIDYGNQMTATIFSYAGQ  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF  N++ + DA IN+Q T Y +PAWSVSILPDC  EVYNTA+VN QT++M     + 
Sbjct  372   SVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYNTAKVNAQTSIMTIN-NEN  430

Query  542   AAALRWSWRPEVADDTILHGK----GQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPI  709
             + AL W W PE   + +  GK       TA ++LDQKVAND SDY+WY+TSV++ + DPI
Sbjct  431   SYALDWQWMPETHLEQMKDGKVLGSVAITAPRLLDQKVANDTSDYLWYITSVDVKQGDPI  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
              S D+++ VN  G VLHV+ NG ++ SQ+         FE +IKL  GKN ++L+S ++G
Sbjct  491   LSHDLKIRVNTKGHVLHVFVNGAHIGSQYATYGKYPFTFEADIKLKLGKNEISLVSGTVG  550

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
               NYG YFD    G+ GV++V +N    V K++ ++ W YKVG+ GE  KL+   + SRS
Sbjct  551   LPNYGAYFDNIHVGVTGVQLVSQNDGSEVTKDISTNVWHYKVGMHGENVKLY---SPSRS  607

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
             + +W ++ L   +   WYKT+F+ P G D VV+DL G+GKG AWVNGNN+GRYW+    G
Sbjct  608   SEEWFTNGLQAHKIFMWYKTTFRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAG  667

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +  CDYRG Y +NKC +NCGNPTQR+YHVP SFL    DN LV+FEE GGN  +V+
Sbjct  668   EDGCSSTCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVK  727

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
               TV     CA AYE    E++C+  + I+ I++A+FG        G  K     + D +
Sbjct  728   IATVTIAKACAKAYEGHELELACKENQVISEIRFASFGVPE--GECGSFKKGHCESSDTL  785

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +I+K  CLGK  CS+  +E + G T C      +L ++A+C
Sbjct  786   SIVKRLCLGKQQCSIHVNEKMLGPTGCRVPE-NRLAIDALC  825



>gb|KHN00663.1| Beta-galactosidase [Glycine soja]
Length=836

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/581 (49%), Positives = 383/581 (66%), Gaps = 15/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+WTGWF  WGG  P+RTAED+A++V RFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  252   TEDWTGWFMHWGGPTPHRTAEDVAFAVGRFFQYGGTFQNYYMYHGGTNFGRTSGGPYITT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYG+LNQPK+GHLK LH VL S+E  +  G+       N +  T++++ G 
Sbjct  312   SYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSRNIDYGNQMTATIFSYAGQ  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF  N++ + DA IN+Q T Y +PAWSVSILPDC  EVYNTA+VN QT++M     + 
Sbjct  372   SVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYNTAKVNAQTSIMTIN-NEN  430

Query  542   AAALRWSWRPEVADDTILHGK----GQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPI  709
             + AL W W PE   + +  GK       TA ++LDQKVAND SDY+WY+TSV++ + DPI
Sbjct  431   SYALDWQWMPETHLEQMKDGKVLGSVAITAPRLLDQKVANDTSDYLWYITSVDVKQGDPI  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
              S D+++ VN  G VLHV+ NG ++ SQ+         FE +IKL  GKN ++L+S ++G
Sbjct  491   LSHDLKIRVNTKGHVLHVFVNGAHIGSQYATYGKYTFTFEADIKLKLGKNEISLVSGTVG  550

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
               NYG YFD    G+ GV++V +N    V K++ ++ W YKVG+ GE  KL+   + SRS
Sbjct  551   LPNYGAYFDNIHVGVTGVQLVSQNDGSEVTKDISTNVWHYKVGMHGENVKLY---SPSRS  607

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               +W ++ L   +   WYKT+F+ P G D VV+DL G+GKG AWVNGNN+GRYW+    G
Sbjct  608   TEEWFTNGLQAHKIFMWYKTTFRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAG  667

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +  CDYRG Y +NKC +NCGNPTQR+YHVP SFL    DN LV+FEE GGN  +V+
Sbjct  668   EDGCSSTCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVK  727

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
               TV     CA AYE    E++C+  + I+ I++A+FG        G  K     + D +
Sbjct  728   IATVTIAKACAKAYEGHELELACKENQVISEIRFASFGVPE--GECGSFKKGHCESSDTL  785

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +I+K  CLGK  CS+  +E + G T C      +L ++A+C
Sbjct  786   SIVKRLCLGKQQCSIHVNEKMLGPTGCRVPE-NRLAIDALC  825



>gb|KHN00665.1| Beta-galactosidase [Glycine soja]
Length=909

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/581 (49%), Positives = 383/581 (66%), Gaps = 15/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+WTGWF  WGG  P+RTAED+A++V RFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  325   TEDWTGWFMHWGGPTPHRTAEDVAFAVGRFFQYGGTFQNYYMYHGGTNFGRTSGGPYITT  384

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYG+LNQPK+GHLK LH VL S+E  +  G+       N +  T++++ G 
Sbjct  385   SYDYDAPLNEYGDLNQPKWGHLKRLHEVLKSVETTLTMGSSRNIDYGNQMTATIFSYAGQ  444

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF  N++ + DA IN+Q T Y +PAWSVSILPDC  EVYNTA+VN QT++M     + 
Sbjct  445   SVCFLGNAHPSMDANINFQNTQYTIPAWSVSILPDCYTEVYNTAKVNAQTSIMTIN-NEN  503

Query  542   AAALRWSWRPEVADDTILHGK----GQFTANQILDQKVANDVSDYIWYMTSVNLDKDDPI  709
             + AL W W PE   + +  GK       TA ++LDQKVAND SDY+WY+TSV++ + DPI
Sbjct  504   SYALDWQWMPETHLEQMKDGKVLGSVAITAPRLLDQKVANDTSDYLWYITSVDVKQGDPI  563

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASIG  877
              S D+++ VN  G VLHV+ NG ++ SQ+         FE +IKL  GKN ++L+S ++G
Sbjct  564   LSHDLKIRVNTKGHVLHVFVNGAHIGSQYATYGKYTFTFEADIKLKLGKNEISLVSGTVG  623

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
               NYG YFD    G+ GV++V +N    V K++ ++ W YKVG+ GE  KL+   + SRS
Sbjct  624   LPNYGAYFDNIHVGVTGVQLVSQNDGSEVTKDISTNVWHYKVGMHGENVKLY---SPSRS  680

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               +W ++ L   +   WYKT+F+ P G D VV+DL G+GKG AWVNGNN+GRYW+    G
Sbjct  681   TEEWFTNGLQAHKIFMWYKTTFRTPVGTDSVVLDLKGLGKGQAWVNGNNIGRYWVSYLAG  740

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +  CDYRG Y +NKC +NCGNPTQR+YHVP SFL    DN LV+FEE GGN  +V+
Sbjct  741   EDGCSSTCDYRGTYRSNKCTTNCGNPTQRWYHVPDSFLRDGLDNTLVVFEEQGGNPFQVK  800

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
               TV     CA AYE    E++C+  + I+ IK+A+FG        G  K     + D +
Sbjct  801   IATVTIAKACAKAYEGHELELACKENQVISEIKFASFGVPE--GECGSFKKGHCESSDTL  858

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +I+K  CLGK  CS+  +E + G T C      +L ++A+C
Sbjct  859   SIVKRLCLGKQQCSIQVNEKMLGPTGCRVPE-NRLAIDALC  898



>ref|XP_008811996.1| PREDICTED: beta-galactosidase 1-like [Phoenix dactylifera]
Length=817

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/586 (50%), Positives = 388/586 (66%), Gaps = 31/586 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK WG  DP+R AEDLA++VARFFQ  GT QNYYMYHGGTNFGRT GGPYITT
Sbjct  250   TENWLGWFKAWGKPDPHRPAEDLAFAVARFFQANGTLQNYYMYHGGTNFGRTPGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPK+GHLKELH  L  +EK + YG++  T   N +  T +++N T
Sbjct  310   SYDYDAPLDEYGNIRQPKWGHLKELHAALKLMEKALTYGDVNNTDFGNGVAATKFSYNET  369

Query  362   KT-CFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
              + CF SN+N+++DAT+ YQG  Y +PAWSVSILPDCK+EVYNTA+V TQT++MVK+  K
Sbjct  370   LSGCFLSNANQSSDATLEYQGAKYFLPAWSVSILPDCKQEVYNTAKVTTQTSIMVKKPNK  429

Query  539   A---AAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDP  706
             A   A+ L+WSWRPE+   ++    G FT N++ DQ   A D SDY+WYMTSV++     
Sbjct  430   AVDEASDLKWSWRPEILGSSVSGLGGNFTENKLSDQITTAFDESDYLWYMTSVDISH---  486

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASI  874
                + M L VN TG VLH + NG+ V SQ+  N     + E       GKN ++LLS ++
Sbjct  487   --QQQMTLRVNTTGHVLHAFVNGQLVGSQYGPNGNWVFVLEQTANFKAGKNHISLLSVTV  544

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G +NYG  ++L   G+ G  V+++G N    +  +L +++WSYK+GL GE+ K++   N 
Sbjct  545   GLKNYGARYELDPAGIVGGPVQLIGGN----ITIDLSTNEWSYKIGLDGEKTKVYL-DNP  599

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-I  1225
              R   +W S  +PT R  TWYKT+F+ P G DPVVVDL+GMGKG AWVNGNN+GR+W   
Sbjct  600   DR---KWYSGMIPTQRPFTWYKTTFETPLGLDPVVVDLVGMGKGAAWVNGNNIGRFWPNY  656

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
              A  D C    CDYRG Y   KC + CG P+QR+YHVPRSFL     N LVLFEE GG+ 
Sbjct  657   TASADGC--NGCDYRGAYKAEKCQTGCGEPSQRWYHVPRSFLKPGEPNTLVLFEEAGGDP  714

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
              +V FQTV  G  C+SA + K  ++SCQGG  I+ I +A+FGD +   G        G  
Sbjct  715   VQVNFQTVTVGTACSSADQGKTLKLSCQGGLTISNIDFASFGDPK---GTCGGYERGGCE  771

Query  1586  KDAV-NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              D V +++   C+GK SCS+   E++ G  N + + +K LVV+A C
Sbjct  772   SDVVYSLISEECVGKESCSIQIGENLLGKCNGSNTSSKSLVVQATC  817



>ref|NP_683341.1| beta-galactosidase 15 [Arabidopsis thaliana]
 gb|AEE31387.1| beta-galactosidase 15 [Arabidopsis thaliana]
Length=786

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/582 (52%), Positives = 377/582 (65%), Gaps = 73/582 (13%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+K WGGKDP+RT ED+A++VARFFQ  GTFQNYYMYHGGTNF RTAGGPYITT
Sbjct  269   TENWTGWYKNWGGKDPHRTTEDVAFAVARFFQKEGTFQNYYMYHGGTNFDRTAGGPYITT  328

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNLNQPKYGHLK+LH+VLH++EK + YGNI+T    N +  TVY     
Sbjct  329   TYDYDAPLDEFGNLNQPKYGHLKQLHDVLHAMEKTLTYGNISTVDFGNLVTATVYQTEEG  388

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N NET+DA IN+QGT Y VPAWSVSILPDCK E YNTA++NTQT+VMVK+  +A
Sbjct  389   SSCFIGNVNETSDAKINFQGTSYDVPAWSVSILPDCKTETYNTAKINTQTSVMVKKANEA  448

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                 + L+WSWRPE  D  +L GKG+ T  Q+ DQK V+ND SDY+WYMT+VNL + DP+
Sbjct  449   ENEPSTLKWSWRPENIDSVLLKGKGESTMRQLFDQKVVSNDESDYLWYMTTVNLKEQDPV  508

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
               K+M L +N T  VLH + NG+++ +    N     +FE + K N G N++TLLS ++G
Sbjct  509   LGKNMSLRINSTAHVLHAFVNGQHIGNYRVENGKFHYVFEQDAKFNPGANVITLLSITVG  568

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G V I+G+NGDET+ K+L +HKWSYK GL G EN+LF S + S 
Sbjct  569   LPNYGAFFENFSAGITGPVFIIGRNGDETIVKDLSTHKWSYKTGLSGFENQLFSSESPS-  627

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
                             TW      AP G +PVVVDL+G+GKG AW+NGNN+GRYW     
Sbjct  628   ----------------TW-----SAPLGSEPVVVDLLGLGKGTAWINGNNIGRYW-----  661

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
                                               P    +  GDN LVLFEE GGN S V
Sbjct  662   ----------------------------------PAFLSDIDGDNTLVLFEEIGGNPSLV  687

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              FQT+  G VCA+ YE  V E+SC  G+ I+AIK+A+FG+  G   G FEKG C  + +A
Sbjct  688   NFQTIGVGSVCANVYEKNVLELSCN-GKPISAIKFASFGNP-GGDCGSFEKGTCEASNNA  745

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               IL   C+GK  CS+  SE  FG   C G+  K+L VEA+C
Sbjct  746   AAILTQECVGKEKCSIDVSEDKFGAAEC-GALAKRLAVEAIC  786



>ref|XP_010273985.1| PREDICTED: beta-galactosidase 15-like [Nelumbo nucifera]
Length=837

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/590 (50%), Positives = 386/590 (65%), Gaps = 28/590 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+W GWFK WGG DP+R  ED+A+S+ARFFQ GG F NYYMYHGGTNFGRT GG YITT
Sbjct  259   TESWIGWFKTWGGADPHRATEDVAFSIARFFQFGGVFHNYYMYHGGTNFGRTPGG-YITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+A LDEYGNLNQPK+GHL +LH V+ S +  + YG  +T  L   +++T Y  NGT
Sbjct  318   SYDYDALLDEYGNLNQPKWGHLTQLHAVIKSAQSVLTYGTYSTKLLGAGLELTTYVNNGT  377

Query  362   --KTCFFSNSNETADATINYQ--GTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
                 CF SN+N   D  I  Q  G DY VPAWS +IL +C +EVYNTA+VNTQT++M K+
Sbjct  378   GESICFLSNANTVNDTNIVLQSNGNDYFVPAWSATILANCSKEVYNTAKVNTQTSLMTKK  437

Query  530   GGKAAAA-----LRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNL  691
                   +     L+W W+PE   D +L G G     ++L+QK    DVSDY+WYMTSV +
Sbjct  438   PATTDQSEHNHQLKWVWKPEPVRD-VLKGWGPLKVKKLLEQKSTTIDVSDYLWYMTSVLV  496

Query  692   DKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTL  859
              K D   +K   L VN TG VLH + N + V SQW    N   +FE  I L  G+N +TL
Sbjct  497   AKKD---AKKAILRVNTTGHVLHAFVNRRLVGSQWGQGGNYGFVFERPIMLKPGQNQITL  553

Query  860   LSASIGFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LSA++G QNYGP+FDL   G+ G  V++V       V K+L S++W YK+GL GE  + +
Sbjct  554   LSATVGLQNYGPFFDLTPTGIAGGPVQLVLSG---NVTKDLSSNQWYYKIGLNGELMQFY  610

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
             +   K      W S  LP  R MTWYKT+FK P G D VVVD++GMGKG AWVNG ++GR
Sbjct  611   KDI-KIHHHKYWRSKKLPINRPMTWYKTTFKTPLGTDAVVVDMVGMGKGHAWVNGESIGR  669

Query  1214  YW-LILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             +W   LA       + CDYRG Y+  KCL+NCGNP+QR+YH+PRSFL +   N L+LFEE
Sbjct  670   FWPAFLADKKAGCNDTCDYRGTYDPTKCLTNCGNPSQRWYHIPRSFLMKNRSNTLILFEE  729

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekg  1570
              GGN S+V FQTV  G  C +AYE    ++SCQGGR  TAI++A+FGD +     G  + 
Sbjct  730   IGGNPSQVSFQTVTVGTACGNAYEGNTLQLSCQGGRKFTAIQFASFGDPQ--GSCGMFRK  787

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 + + +N+++ ACLG+  C +T+SE+ FG++ C G+ T++L V+A+C
Sbjct  788   GTCESANTLNVVRKACLGQERCKITSSEATFGSSKCNGNITRRLAVQAIC  837



>ref|XP_006415308.1| hypothetical protein EUTSA_v10006871mg [Eutrema salsugineum]
 gb|ESQ33661.1| hypothetical protein EUTSA_v10006871mg [Eutrema salsugineum]
Length=770

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/582 (51%), Positives = 378/582 (65%), Gaps = 69/582 (12%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG KDP+RT ED+A++VARFFQ GGTFQNYYMYHGGTNF RTAGGPYITT
Sbjct  249   TENWTGWFKNWGSKDPHRTTEDVAFAVARFFQRGGTFQNYYMYHGGTNFDRTAGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDE+GNLNQPKYGHLK+LH+VLHS+EK + +GNI+TT   N    TVY     
Sbjct  309   TYDYDAPLDEFGNLNQPKYGHLKQLHDVLHSMEKTLTHGNISTTDFGNFASATVYTTEEG  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N NET+DATIN+ GT Y VPAWSVSILPDCK E YNTA++NTQT+VMVK+  +A
Sbjct  369   SSCFFGNVNETSDATINFNGTSYVVPAWSVSILPDCKTETYNTAKINTQTSVMVKKPNEA  428

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                   L+WSWRPE  D+ +L GKG+ T +Q+ DQK V+ND SDY+WYMT+VNL + DP+
Sbjct  429   EDEPVTLKWSWRPENVDNVLLKGKGESTMSQLFDQKIVSNDQSDYLWYMTTVNLKEQDPV  488

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIG  877
              SK+M L +N T  VLH + NG+++ +   ++     +FE + K N G N+++LLS ++G
Sbjct  489   LSKNMSLRINSTAHVLHAFVNGEHIGNYRADSGKFHYVFEQDAKFNPGANVISLLSITVG  548

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
               NYG +F+    G+ G V I+G+NGDETV K+L +HKW+YK GL G +N+LF S + S 
Sbjct  549   LPNYGAFFETVPAGITGPVFIIGRNGDETVVKDLSAHKWNYKTGLSGFDNQLFSSESPS-  607

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
                             TW   S  AP G +PVVVDL+G+GKG AW+NGNN+GRYW     
Sbjct  608   ----------------TWSGES--APLGNEPVVVDLLGLGKGTAWINGNNIGRYWPAFLS  649

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
               D                                       GDN LVLFEE GGN S V
Sbjct  650   SVD--------------------------------------EGDNTLVLFEEIGGNPSLV  671

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
              F+TV  G VCA+ YE  V E+SC  G+ I+AIK+A+FG+  G+CG   +       KDA
Sbjct  672   NFRTVTVGSVCANVYEKNVLELSCN-GKPISAIKFASFGNPGGNCGSFEKGTCEAN-KDA  729

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++IL   C+GK  C +  S   FG   C G   ++L VEA+C
Sbjct  730   MDILTDECVGKEMCFIDVSTEKFGAPEC-GDAIRRLAVEAIC  770



>ref|XP_009390322.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=817

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/582 (49%), Positives = 390/582 (67%), Gaps = 22/582 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG   P+R  ED+AY+VA FF  GGTFQNYYMYHGGTNFGRT+GGPY+TT
Sbjct  249   TENWTGWFKGWGESQPHRPVEDVAYAVANFFASGGTFQNYYMYHGGTNFGRTSGGPYLTT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPK+GHLK+LH+ +  +EK + YG + TT+L N++ VT ++ N T
Sbjct  309   SYDYDAPLDEYGNIRQPKWGHLKQLHSAIKMMEKILTYGEVNTTQLGNALAVTKFSINET  368

Query  362   KT-CFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
              + CF +N+N++ DA   Y G  Y VP+ S+SILPDC++EVYNTA+V TQT++MV +  K
Sbjct  369   SSGCFLTNANQSNDANATYNGNTYLVPSRSISILPDCEKEVYNTAKVTTQTSLMVNKPVK  428

Query  539   AAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDDPIWS  715
              +  L W W  E+ +DT L+GKG F+   +L+Q +   D SDY+WYMTSV L+K    W 
Sbjct  429   -STKLSWKWHSEIMEDT-LNGKGSFSNESLLEQIMTTGDASDYLWYMTSVTLNKSSTSWR  486

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLLTLLSASIGFQ  883
             K M L V   G +LH Y N + + S +         FE   +L  G N +TLLSA+ G  
Sbjct  487   KKMNLRVKTKGHILHAYVNNRLIGSGYATKGSYKFDFEQEAELRDGHNFITLLSATDGLA  546

Query  884   NYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG +FDL   G+ G  VE++G NG E +  +L  +KWSYK+GL GE +K++  S  +  
Sbjct  547   NYGAFFDLQKAGIDGGPVELIG-NGKEKI--DLTKNKWSYKIGLNGEMSKIYLPS--ASH  601

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILAK  1234
                W SD LP  + MTWYKT+F+ P G D +V+DL GMGKG AWVNG ++GRYW   LA 
Sbjct  602   GLNWNSDRLPINKSMTWYKTTFEVPDGNDSLVLDLQGMGKGHAWVNGQSIGRYWPSFLAA  661

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
                C  E CDYR +Y+++KC + CG P+QR+YHVP+SF   +G N L+LFEE GG+ S+V
Sbjct  662   DSGC--EPCDYRQKYDSDKCRTECGMPSQRWYHVPKSF-TTKGPNTLILFEEVGGDPSQV  718

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
               QTV  G VCA+  E  + E+SCQG R+ + I++A+FG+       G  K     A DA
Sbjct  719   SLQTVTIGTVCANVVEGSILELSCQGSRSFSKIQFASFGNPE--GSCGSFKKGSCEAPDA  776

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + ++K AC+G+++CS+  + + FG + C+   +++L V+A+C
Sbjct  777   LAVVKKACIGRSNCSINVTANAFGPSECS-DLSRRLAVQAIC  817



>gb|KHG01468.1| Beta-galactosidase [Gossypium arboreum]
Length=783

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/579 (51%), Positives = 385/579 (66%), Gaps = 19/579 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFKKWG KDP+R AEDLAYSVARFFQ GG   NYY YHGGTNFGRT+GGP+ITT
Sbjct  218   TENWTGWFKKWGQKDPHRPAEDLAYSVARFFQAGGVLINYYTYHGGTNFGRTSGGPFITT  277

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDY+APLDE+GNLNQPKYGHLK+LH  +   E+ +  G  TT    N +++T Y  +  
Sbjct  278   SYDYDAPLDEFGNLNQPKYGHLKQLHAAIKVGERVLTNGTATTKVYGNGVELTTYTNSIT  337

Query  356   GTKTCFFSNSNETADATINY-QGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMV-KE  529
             G   CF SN+N+  +AT+   +G  + VPAWSVSIL  C +E++NTA+VNTQT++MV K+
Sbjct  338   GESFCFLSNNNQIEEATVVLEEGNIFVVPAWSVSILGGCNKEIFNTAKVNTQTSIMVKKQ  397

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
                  A L W W PE   DT+L G+G FTA Q+L+QK V +DVSDY+WYM S   D +  
Sbjct  398   MDDETAKLSWMWTPETIKDTLL-GQGIFTARQLLEQKRVTSDVSDYLWYMAS--FDVNGT  454

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQN  886
              W KD  L V  +GQVL+ Y NG  + SQ      F+  + L  G N LTLLS ++G QN
Sbjct  455   SW-KDATLSVKSSGQVLYAYVNGHLIGSQSGYAFQFKNPVSLMPGTNNLTLLSVTVGLQN  513

Query  887   YGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSASQ  1066
             YGP+FD G  GL G  +V  + ++ V  +L S+ W YK+GL GE  +L        +  Q
Sbjct  514   YGPFFDKGPEGLNGGPVVLTD-NKNVTIDLSSNTWKYKIGLNGEAERL-HDPKSPHARLQ  571

Query  1067  WLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI-LAKGDD  1243
             + S+ L     M    T FKAP G DPVVVDL GMGKG AW+NGN++GR+W   +   + 
Sbjct  572   FSSEFLELFIGMP--MTEFKAPPGTDPVVVDLQGMGKGHAWINGNSIGRFWPARITDSNG  629

Query  1244  CPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQ  1423
             C TE CDYRG+YN  KCLSNCGNP+QR+YHVPRSFLN   +N L+LFEE GGN S+V FQ
Sbjct  630   CGTE-CDYRGKYNERKCLSNCGNPSQRWYHVPRSFLNDD-NNTLILFEEMGGNPSQVSFQ  687

Query  1424  TVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNI  1603
             TV  G +CA+  E    E+SCQGG+ I+ IK+A+FGD +     G  +     A  +++ 
Sbjct  688   TVTVGSICANVSEGNTLELSCQGGQTISQIKFASFGDPQ--GKCGSFQKGSCDADLSISY  745

Query  1604  LKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             L+  C+G+  CS+  S++ FG+T CA + TK+L VEA+C
Sbjct  746   LEKECVGRKRCSIDVSDATFGSTECA-NFTKRLAVEAIC  783



>ref|XP_011039947.1| PREDICTED: beta-galactosidase-like [Populus euphratica]
 ref|XP_011039948.1| PREDICTED: beta-galactosidase-like [Populus euphratica]
 ref|XP_011039949.1| PREDICTED: beta-galactosidase-like [Populus euphratica]
Length=822

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/582 (52%), Positives = 390/582 (67%), Gaps = 21/582 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+KKWG KDP+RTAEDLA+SVARFFQ  G  QNYYMYHGGTNFGRT+GGP+I T
Sbjct  252   TENWTGWYKKWGQKDPHRTAEDLAFSVARFFQYNGVLQNYYMYHGGTNFGRTSGGPFIAT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKL-DNSIQVTVYAFN-  355
             +YDY+APLDEYGNLNQPK+GHLK LH  L   EK +    + TTK  D  I++T Y  N 
Sbjct  312   SYDYDAPLDEYGNLNQPKWGHLKNLHTALKLGEKILTNSTVKTTKYSDGWIELTTYTSNI  371

Query  356   -GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
              G + CF SN+          Q   Y VPAWSVSIL DC +E YNTA+VN QT+++VK+ 
Sbjct  372   DGERLCFLSNTKMDDLDVDLQQDGKYFVPAWSVSILQDCNKETYNTAKVNVQTSLIVKKL  431

Query  533   GKAAAALR--WSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDD  703
              ++   L+  W W PE      LHG+G F A Q+L+QK A  D SDY+WYMTSV+ +  D
Sbjct  432   HESDTPLKLSWEWAPE-PTKAPLHGQGGFKATQLLEQKAAAYDESDYLWYMTSVDNNGTD  490

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQ  883
                SK++ L V  +GQ LH + NGK + SQ      FE    L  G N+++LLSA++G Q
Sbjct  491   ---SKNVTLRVKYSGQFLHAFVNGKEIGSQHGYTFTFEKPALLKPGTNIISLLSATVGLQ  547

Query  884   NYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG +FD G  G+ G  VE++  +G+ T   +L S++WSYKVGL GE  + +   N +  
Sbjct  548   NYGQFFDEGPEGIAGGPVELI-DSGNTTT--DLSSNEWSYKVGLNGEGGRFY---NPTSG  601

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
              ++W+S +L   R MTWYKT+F+AP+G +PVVVDL GMGKG AWVNGN+LGR W IL   
Sbjct  602   RAKWVSGNLRVGRAMTWYKTTFQAPSGTEPVVVDLQGMGKGHAWVNGNSLGRSWPILTAD  661

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
              +     CDYRG+Y  +KCLSNCGNPTQR+YHVPRSFLN  G N L+LFEE GGN S V 
Sbjct  662   PNGLDGKCDYRGQYKEDKCLSNCGNPTQRWYHVPRSFLN-NGSNTLILFEEIGGNPSDVS  720

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITA-IKYANFGDTRgscgggfekgvcggAKDA  1594
             FQ   T  +C +AYE    E+SC GGR I + I+YA+FGD +GS  G F++G    ++ +
Sbjct  721   FQITATETICGNAYEGTTLELSCNGGRRIISDIQYASFGDPQGSSCGSFQRGSVEASR-S  779

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              + ++ AC+GK SCS+  S++ FG  +  G    +L V+AVC
Sbjct  780   FSAVEKACIGKESCSINVSKTTFGVEDSFGVDNNRLAVQAVC  821



>ref|XP_003533125.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=832

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/590 (50%), Positives = 385/590 (65%), Gaps = 27/590 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG  P+RTA D+AY+VARFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  246   TENWTGWFKNWGGPIPHRTARDVAYAVARFFQYGGTFQNYYMYHGGTNFGRTSGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN NQPK+GHLK+LH +L S+E  +  G    T   N +  TVY ++G 
Sbjct  306   SYDYDAPLDEYGNKNQPKWGHLKQLHELLKSMEDVLTQGTTNHTDYGNLLTATVYNYSGK  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF  N+N + DATI +Q T Y VPAWSVSILP+C  EVYNTA++N QT++MV +  K+
Sbjct  366   SACFLGNANSSNDATIMFQSTQYIVPAWSVSILPNCVNEVYNTAKINAQTSIMVMKDNKS  425

Query  542   ------AAALRWSWRPE----VADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVN  688
                    + L W W  E    + D  +L G     A Q+LDQKV  ND SDY+WY+TSV+
Sbjct  426   DNEEEPHSTLNWQWMHEPHVQMKDGQVL-GSVSRKAAQLLDQKVVTNDTSDYLWYITSVD  484

Query  689   LDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLT  856
             + ++DPIWSK +R+  N  G VLHV+ NG     Q+  N      +E  IKL  G N ++
Sbjct  485   ISENDPIWSK-IRVSTN--GHVLHVFVNGAQAGYQYGQNGKYSFTYEAKIKLKKGTNEIS  541

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LLS ++G  NYG +F     G+ G V++V    +  V K++ ++ W+YKVGL GE  KL+
Sbjct  542   LLSGTVGLPNYGAHFSNVSVGVCGPVQLVALQNNTEVVKDITNNTWNYKVGLHGEIVKLY  601

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                N       W ++ LPT R   WYKT FK+P G DPVVVDL G+ KG AWVNGNN+GR
Sbjct  602   CPENNKG----WNTNGLPTNRVFVWYKTLFKSPKGTDPVVVDLKGLKKGQAWVNGNNIGR  657

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             YW      D+  T  C+YRG Y+++KC++ CG PTQR+YHVPRSFL +   N LVLFEE 
Sbjct  658   YWTRYLADDNGCTATCNYRGPYSSDKCITKCGRPTQRWYHVPRSFLRQDNQNTLVLFEEF  717

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GG+ + V+F TV    +CA++YE  V E+SC+  + I+ IK+A+FG        G  K  
Sbjct  718   GGHPNEVKFATVMVEKICANSYEGNVLELSCREEQVISKIKFASFGVPE--GECGSFKKS  775

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK-KLVVEAVC  1720
                + +A++IL  +CLGK SCSV  S+ + G T C   + + KL +EAVC
Sbjct  776   QCESPNALSILSKSCLGKQSCSVQVSQRMLGPTGCRMPQNQNKLAIEAVC  825



>emb|CAN82062.1| hypothetical protein VITISV_016430 [Vitis vinifera]
Length=773

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/591 (50%), Positives = 388/591 (66%), Gaps = 54/591 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GW+K WGG DP+RTAEDLA+SVARF+QLGGTFQNYYMYHGGTNFGRTAGGPYITT
Sbjct  219   TENWSGWYKNWGGSDPHRTAEDLAFSVARFYQLGGTFQNYYMYHGGTNFGRTAGGPYITT  278

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APL+EYGN NQPK+GHL++LH +L S+EK + YG++     +     T+Y++ G 
Sbjct  279   SYDYDAPLNEYGNKNQPKWGHLRDLHLLLLSMEKALTYGDVKNVDYETLTSATIYSYQGK  338

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF NSN   D TINY G +Y +PAWSVSILPDC  EVYNTA+VN+Q +  VK+G +A
Sbjct  339   SSCFFGNSNADRDVTINYGGVNYTIPAWSVSILPDCSNEVYNTAKVNSQYSTFVKKGSEA  398

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMT--SVNLDKDDP  706
                  +L+W+WR E                              I Y+T  SV++  DDP
Sbjct  399   ENEPNSLQWTWRGET-----------------------------IQYITPGSVDISNDDP  429

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFE----TNIKLNHGKNLLTLLSASI  874
             IW KD+ L VN +G +LH + NG+++  Q+     FE     +I L  GKN +TLLS ++
Sbjct  430   IWGKDLTLSVNTSGHILHAFVNGEHIGYQYALLGQFEFQFRRSITLQLGKNEITLLSVTV  489

Query  875   GFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLG-SHKWSYKVGLRGEENKLFRSSNK  1048
             G  NYGP FD+   G++G V+I+  NG   + K+L  +++W+YK GL GE+ K+F    +
Sbjct  490   GLTNYGPDFDMVNQGIHGPVQIIASNGSADIIKDLSNNNQWAYKAGLNGEDKKIFLGRAR  549

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-I  1225
                 +QW SD+LP  R   WYK +F AP G DPVVVDLMG+GKG AWVNG++LGRYW   
Sbjct  550   ---YNQWKSDNLPVNRSFVWYKATFDAPPGEDPVVVDLMGLGKGEAWVNGHSLGRYWPSY  606

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
             +A+G+ C  E CDYRG Y   KC +NCGNP+QR+YHVPRSFL    DN LVLFEE  GN 
Sbjct  607   IARGEGCSPE-CDYRGPYKAEKCNTNCGNPSQRWYHVPRSFLAST-DNRLVLFEEFXGNP  664

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTR------gscgggfek  1567
             S V FQTV  G  CA+A E    E+SCQ GR I+ IK+A+FGD +       + G    +
Sbjct  665   SSVTFQTVTVGNACANAREGYTLELSCQ-GRAISXIKFASFGDPQGTCGKPFATGSQVFE  723

Query  1568  gvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                  A D+++I++  C+GK SCS+  SE + G   C  + TK+L VEA+C
Sbjct  724   KGTCEAADSLSIIQKLCVGKYSCSIDVSEQILGPAGCT-ADTKRLAVEAIC  773



>ref|XP_007040803.1| Beta-galactosidase 7 [Theobroma cacao]
 gb|EOY25304.1| Beta-galactosidase 7 [Theobroma cacao]
Length=1196

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/581 (51%), Positives = 392/581 (67%), Gaps = 20/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFKKWG KDPYRTAEDLAYSVARFFQLGG   NYYMYHGGTNFGRT+GGPYITT
Sbjct  246   TENWTGWFKKWGQKDPYRTAEDLAYSVARFFQLGGVLINYYMYHGGTNFGRTSGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  L   EK +  G   T    + IQ+T +     
Sbjct  306   SYDYNAPLDEYGNLNQPKWGHLKQLHEALRVGEKFLTNGTSETKDSGDGIQLTTFTDGQT  365

Query  356   GTKTCFFSNSNETADATINYQGTD-YKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE-  529
             G + CF SN+N   D  ++ +    + VPAWSVSIL  CK+E+YN+A+VNTQT+VMVK+ 
Sbjct  366   GERFCFLSNTNNNKDVNVDLKDDGMHFVPAWSVSILGACKKEIYNSAKVNTQTSVMVKKQ  425

Query  530   --GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLDKD  700
                   +A   W+W  E   DT L GKG F+AN +L+QK A +D+SDY+WYMTSV+++  
Sbjct  426   IGDEDKSAQFNWTWTLEPMRDT-LEGKGTFSANTLLEQKRASDDLSDYLWYMTSVDINGT  484

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGF  880
                   +  +  N +GQV+H Y NG+ + ++   +  F   + L  G+N +TLLS ++G 
Sbjct  485   S---FNEGTIFANSSGQVVHAYVNGRLIGTKSGYSFQFRNPVSLVPGRNNITLLSVTVGL  541

Query  881   QNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             QNYG +FDLG  G+ G   +   G++T+  +L S+ W+YKVGL GE  KL+  +  S + 
Sbjct  542   QNYGDHFDLGPEGVTGPVGLIDVGNKTI--DLSSNAWNYKVGLNGEAKKLYDPN--SPNL  597

Query  1061  SQW-LSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               W  S+ LP  R MTWYKT+FKAP+G DPVV+DLMGMGKG AW+NGN++GR+W      
Sbjct  598   QLWRTSEELPIGRPMTWYKTAFKAPSGTDPVVLDLMGMGKGHAWINGNSIGRFWPAQIAD  657

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             ++  T+ CDYRG Y   KCLSNCGNP+QR+YHVPRSF+   G N LVLFEE GG+ S V 
Sbjct  658   NNGCTDECDYRGAYKEQKCLSNCGNPSQRWYHVPRSFIT-SGTNFLVLFEEIGGDPSEVS  716

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
             FQTV TG +CA+A E  + E+SC GG  I+ I++A++G+ +     G        A+ ++
Sbjct  717   FQTVTTGSICANANEGSLLELSCHGGNVISKIEFASYGNPK--GRCGSLTKGSCEAEGSL  774

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + L+  C+GK SC+V  SE  FG+ +C G   K L VEA+C
Sbjct  775   SALEKICVGKESCTVDVSEKTFGSADC-GEDKKSLAVEALC  814



>gb|KHN27597.1| Beta-galactosidase [Glycine soja]
Length=832

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/590 (50%), Positives = 385/590 (65%), Gaps = 27/590 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG  P+RTA D+AY+VARFFQ GGTFQNYYMYHGGTNFGRT+GGPYITT
Sbjct  246   TENWTGWFKNWGGPIPHRTARDVAYAVARFFQYGGTFQNYYMYHGGTNFGRTSGGPYITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN NQPK+GHLK+LH +L S+E  +  G    T   N +  TVY ++G 
Sbjct  306   SYDYDAPLDEYGNKNQPKWGHLKQLHELLKSMEDVLTQGTTNHTDYGNLLTATVYNYSGK  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF  N+N + DATI +Q T Y VPAWSVSILP+C  EVYNTA++N QT++MV +  K+
Sbjct  366   SACFLGNANSSNDATIMFQSTQYIVPAWSVSILPNCVNEVYNTAKINAQTSIMVMKDNKS  425

Query  542   ------AAALRWSWRPE----VADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVN  688
                    + L W W  E    + D  +L G     A Q+LDQKV  ND SDY+WY+TSV+
Sbjct  426   DNEEEPHSTLNWQWMHEPHVQMKDGQVL-GSVSRKAAQLLDQKVVTNDTSDYLWYITSVD  484

Query  689   LDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLT  856
             + ++DPIWSK +R+  N  G VLHV+ NG     Q+  N      +E  IKL  G N ++
Sbjct  485   ISENDPIWSK-IRVSTN--GHVLHVFVNGAQAGYQYGQNGKYSFTYEAKIKLKKGTNEIS  541

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LLS ++G  NYG +F     G+ G V++V    +  V K++ ++ W+YKVGL GE  KL+
Sbjct  542   LLSGTVGLPNYGAHFSNVSVGVCGPVQLVTLQNNTEVVKDITNNTWNYKVGLHGEIVKLY  601

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                N       W ++ LPT R   WYKT FK+P G DPVVVDL G+ KG AWVNGNN+GR
Sbjct  602   CPENNKG----WNTNGLPTNRVFVWYKTLFKSPKGTDPVVVDLRGLKKGQAWVNGNNIGR  657

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             YW      D+  T  C+YRG Y+++KC++ CG PTQR+YHVPRSFL +   N LVLFEE 
Sbjct  658   YWTRYLADDNGCTATCNYRGPYSSDKCITKCGRPTQRWYHVPRSFLRQDNQNTLVLFEEF  717

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GG+ + V+F TV    +CA++YE  V E+SC+  + I+ IK+++FG        G  K  
Sbjct  718   GGHPNEVKFATVMVEKICANSYEGNVLELSCREEQVISEIKFSSFGVPE--GECGSFKKS  775

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK-KLVVEAVC  1720
                + +A++IL  +CLGK SCSV  S+ + G T C   + + KL +EAVC
Sbjct  776   QCESPNALSILSKSCLGKQSCSVQVSQRMLGPTGCRMPQNQNKLAIEAVC  825



>gb|KHN25095.1| Beta-galactosidase [Glycine soja]
Length=810

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/526 (53%), Positives = 361/526 (69%), Gaps = 19/526 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTG +K WG ++P+R AED+AY+VARFFQ GGTFQNYYMYHGGTNF RTAGGPY+TT
Sbjct  252   TENWTGGYKNWGTQNPHRPAEDVAYAVARFFQFGGTFQNYYMYHGGTNFKRTAGGPYVTT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHL++LHN+L S E  +  G+   T   N +  TVY ++G 
Sbjct  312   SYDYDAPLDEYGNLNQPKWGHLRQLHNLLKSKENILTQGSSQNTDYGNMVTATVYTYDGK  371

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              TCF  N++++ DATIN++  +Y +PAWSVSILP+C  E YNTA+VNTQTT+MVK+  + 
Sbjct  372   STCFIGNAHQSKDATINFRNNEYTIPAWSVSILPNCSSEAYNTAKVNTQTTIMVKKDNED  431

Query  542   AA-ALRWSWRPEV---ADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSVNLD-KDD  703
                ALRW WR E      D  + G    TA ++LDQKV  ND SDY+WY+TS+++   DD
Sbjct  432   LEYALRWQWRQEPFVQMKDGQITGIIDLTAPKLLDQKVVTNDFSDYLWYITSIDIKGDDD  491

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSAS  871
             P W+K+ RL V+ +G VLHV+ NGK+V +Q   N  F    E+ IKL  GKN ++LLS +
Sbjct  492   PSWTKEFRLRVHTSGHVLHVFVNGKHVGTQHAKNGQFKFVHESKIKLTTGKNEISLLSTT  551

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVGKNG-----DETVRKNLGSHKWSYKVGLRGEENKLF  1033
             +G  NYGP+FD    G+ G V++V   G     D+ + K+L  ++WSYKVGL GE    +
Sbjct  552   VGLPNYGPFFDNIEVGVLGPVQLVAAVGDYDYDDDEIVKDLSKNQWSYKVGLHGEHEMHY  611

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                N   S   W +D +PT R + WYKT+FK+P G DPVVVDL G+GKG AWVNGN++GR
Sbjct  612   SYEN---SLKTWYTDAVPTDRILVWYKTTFKSPIGDDPVVVDLSGLGKGHAWVNGNSIGR  668

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             YW      ++  +  CDYRG Y +NKCLS C  P+QR+YHVPRSFL     N LVLFEE 
Sbjct  669   YWSSYLADENGCSPKCDYRGPYTSNKCLSMCAQPSQRWYHVPRSFLRDDDQNTLVLFEEL  728

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFG  1531
             GG    V F TV  G VCA+AYE    E++C   + I+ IK+A+FG
Sbjct  729   GGQPYYVNFLTVTVGKVCANAYEGNTLELACNKNQVISEIKFASFG  774



>ref|XP_006381590.1| hypothetical protein POPTR_0006s14130g [Populus trichocarpa]
 gb|ERP59387.1| hypothetical protein POPTR_0006s14130g [Populus trichocarpa]
Length=824

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/582 (51%), Positives = 386/582 (66%), Gaps = 21/582 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW+KKWG KDP+RTAEDLA+SVARFFQ  G  QNYYMY+GGTNFGRT+GGP+I T
Sbjct  254   TENWTGWYKKWGQKDPHRTAEDLAFSVARFFQYNGVLQNYYMYYGGTNFGRTSGGPFIAT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKL-DNSIQVTVYAFN-  355
             +YDY+APLDEYGNLNQPK+GHLK LH  L   EK +    + TTK  D  +++T Y  N 
Sbjct  314   SYDYDAPLDEYGNLNQPKWGHLKNLHAALKLGEKILTNSTVKTTKYSDGWVELTTYTSNI  373

Query  356   -GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
              G + CF SN+          Q   Y VPAWSVSIL DC +E YNTA+VN QT+++VK+ 
Sbjct  374   DGERLCFLSNTKMDGLDVDLQQDGKYFVPAWSVSILQDCNKETYNTAKVNVQTSLIVKKL  433

Query  533   GKAAAALR--WSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDD  703
              +    L+  W W PE      LHG+G F A Q+L+QK A  D SDY+WYMTSV+   ++
Sbjct  434   HENDTPLKLSWEWAPE-PTKAPLHGQGGFKATQLLEQKAATYDESDYLWYMTSVD---NN  489

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQ  883
                SK++ L V  +GQ LH + NGK + SQ      FE    L  G N+++LLSA++G Q
Sbjct  490   GTASKNVTLRVKYSGQFLHAFVNGKEIGSQHGYTFTFEKPALLKPGTNIISLLSATVGLQ  549

Query  884   NYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG +FD G  G+ G  VE++      T   +L S++WSYKVGL GE  + +   + +  
Sbjct  550   NYGEFFDEGPEGIAGGPVELIDSGNTTT---DLSSNEWSYKVGLNGEGGRFY---DPTSG  603

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
              ++W+S +L   R MTWYKT+F+AP+G +PVVVDL GMGKG AWVNGN+LGR+W IL   
Sbjct  604   RAKWVSGNLRVGRAMTWYKTTFQAPSGTEPVVVDLQGMGKGHAWVNGNSLGRFWPILTAD  663

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
              +     CDYRG+Y   KCLSNCGNPTQR+YHVPRSFLN  G N L+LFEE GGN S V 
Sbjct  664   PNGCDGKCDYRGQYKEGKCLSNCGNPTQRWYHVPRSFLN-NGSNTLILFEEIGGNPSDVS  722

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITA-IKYANFGDTRgscgggfekgvcggAKDA  1594
             FQ   T  +C + YE    E+SC GGR I + I+YA+FGD +GS  G F++G    ++ +
Sbjct  723   FQITATETICGNTYEGTTLELSCNGGRRIISDIQYASFGDPQGSSCGSFQRGSVEASR-S  781

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              + ++ AC+GK SCS+  S++ FG  +  G    +LVV+AVC
Sbjct  782   FSAVEKACMGKESCSINVSKATFGVEDSFGVDNNRLVVQAVC  823



>ref|XP_009398904.1| PREDICTED: beta-galactosidase 1-like [Musa acuminata subsp. malaccensis]
Length=664

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/585 (49%), Positives = 376/585 (64%), Gaps = 34/585 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG  DP+R AE+LA+ VARFFQ  GT QNYYMYHGGTNFGRT+GGPYI T
Sbjct  102   TENWTGWFKNWGSPDPHRPAEELAFQVARFFQTKGTLQNYYMYHGGTNFGRTSGGPYIVT  161

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG   QPK+GHLKELH  +  +EK + YG +    LDN + +T Y+ +G 
Sbjct  162   SYDYDAPLDEYGYTRQPKWGHLKELHASIKLMEKALTYGEVEEVNLDNELTITKYSGDGV  221

Query  362   -KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE---  529
                CF SN N   +ATI+Y+G  Y +PAWSVSILPDCK EVYNTA+V TQT++MVK+   
Sbjct  222   NPACFLSNQNSKLNATIDYEGRTYFLPAWSVSILPDCKSEVYNTAKVKTQTSLMVKKRNT  281

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               +A+  L WSWRPE    +     G FT N +L+QK V  D SDY+WY TSV++ + + 
Sbjct  282   AMEASEVLYWSWRPERLGTSAKGFGGTFTVNNLLEQKSVTLDESDYLWYTTSVDVGEKE-  340

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTLLSASI  874
                 +  L VN TG +LH + NG+ V SQ+      N  FE  +  N G+N+++LLSA++
Sbjct  341   ----EFTLSVNTTGHILHAFVNGRLVGSQYGLAGQLNFTFERKVWFNPGRNVISLLSATV  396

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G QNYG Y+DL   G+ G  V+++G+N       +L ++ WSYK+GL GE ++       
Sbjct  397   GLQNYGAYYDLAPTGIVGGPVKLIGEN----TTLDLSNYTWSYKIGLDGELDQ-------  445

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-I  1225
                A +W S   PT R  TWYK +F+AP G + VVVDL+GMGKG AWVNGN++GR+W   
Sbjct  446   --RAVKWHSGMFPTNRPFTWYKATFQAPLGSEAVVVDLLGMGKGTAWVNGNSIGRFWPNY  503

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
              A  D C    CDYRG +++NKC + CG P+QR+YHVPRSFL     N L+LFEE GGN 
Sbjct  504   TASADGC--HECDYRGTFSSNKCQTGCGEPSQRWYHVPRSFLKLGEPNTLMLFEEAGGNP  561

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
              +V FQTV  G  CASA E     +SC  GR I+++ +A+F +      G FE G    +
Sbjct  562   LQVNFQTVTVGAACASASEGDTLSLSCLRGRTISSVDFASFEEPE-GTCGAFEGGKGCSS  620

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +A  ++K +CLGK SCS+  +E  FG +       +KL V+  C
Sbjct  621   DEAFAVIKDSCLGKESCSIEITEE-FGKSCGTLPSPRKLAVQVTC  664



>ref|XP_008242326.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 15 [Prunus 
mume]
Length=739

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/583 (51%), Positives = 379/583 (65%), Gaps = 88/583 (15%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK+WGGKDP RTAEDLA+SVARFFQ GGTFQNYYMYHGGTNFGRT+   YITT
Sbjct  235   TENWTGWFKRWGGKDPLRTAEDLAFSVARFFQTGGTFQNYYMYHGGTNFGRTSAA-YITT  293

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYGNLNQPK+GHLK+LH +L S+E  + +GNITT    NS+  T+YA N +
Sbjct  294   TYDYDAPLDEYGNLNQPKWGHLKQLHEILKSMEYTLTHGNITTIDFGNSVSATMYATNDS  353

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CFF N+N + D TI +QG                         VNTQT+V VK   KA
Sbjct  354   ASCFFGNANSSTDHTITFQG------------------------NVNTQTSVKVKMVNKA  389

Query  542   ---AAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPI  709
                  +L W WRPE  DDT L GKG+FTAN+++DQK VA D SDY+WYMTSV+L+KDDPI
Sbjct  390   EDEPESLGWLWRPENIDDTRLQGKGEFTANKLMDQKDVAADASDYLWYMTSVHLNKDDPI  449

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTLLSASIG  877
             WS +M L +N TG +LH Y NG+Y+ S+W    + N +FE N+KLN GKN+++LLSA++G
Sbjct  450   WSGNMTLKINATGFILHAYVNGEYLGSEWAKYNDYNYVFEKNVKLNPGKNVISLLSATVG  509

Query  878   FQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             F NYG  FD+   G+ G V +VG+NGDE V K+L +HKWSY+VGL G +N+LF + +   
Sbjct  510   FPNYGGGFDVINTGVPGPVVLVGQNGDEMVIKDLSAHKWSYEVGLHGLKNQLFSTDSP--  567

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-ILA  1231
                  +  +L        ++T+FKAP G DPVVVDL G+GKG AWVNGN+LGRYW   LA
Sbjct  568   -----IXXYL---VMFALFQTTFKAPLGTDPVVVDLQGLGKGHAWVNGNSLGRYWPSYLA  619

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
             + DD                                       G+N LVLFEE GGN S 
Sbjct  620   EEDD---------------------------------------GENTLVLFEEFGGNPSL  640

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV TG VCA+A+E    E++CQ GR I+AIK+A+FG+ +     G  +     AKD
Sbjct  641   VNFQTVTTGTVCANAHEKHTLELACQ-GRPISAIKFASFGNPQ--GRCGSFEKGSCDAKD  697

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              ++I++  C+GK  CS+  SES  G+ NC G+  K+L VEAVC
Sbjct  698   VLSIIQNECVGKEKCSIDVSESKLGSANC-GASVKRLAVEAVC  739



>emb|CDX92439.1| BnaA10g14780D [Brassica napus]
Length=789

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/581 (49%), Positives = 368/581 (63%), Gaps = 50/581 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGGK PYRTAEDLA+SVARFFQ GGTFQNYYM                  
Sbjct  251   TENWTGWFKNWGGKHPYRTAEDLAFSVARFFQTGGTFQNYYMV-----------------  293

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
                              ++ ++++       L+  + YGNI+T  L NS+  TVY+ N  
Sbjct  294   -----------------RFSYMQKY------LDLPLTYGNISTIDLGNSVTATVYSTNEK  330

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
              +CF  N N TADA +N++G DY VPAWSVS++PDC +E YNTARVNTQT+++ ++    
Sbjct  331   SSCFIGNVNATADALVNFKGKDYNVPAWSVSVIPDCDKEAYNTARVNTQTSIITEDSCDE  390

Query  542   AAALRWSWRPE-VADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWS  715
                L+W+WRPE     TIL G G   A  ++DQK V ND SDY+WYMT V+LDK DPIWS
Sbjct  391   PEKLKWTWRPEFTTQKTILKGSGDLIAKGLVDQKDVTNDASDYLWYMTRVHLDKKDPIWS  450

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQ  883
             ++M L V+    VLH Y NGKYV +Q   ++     FE  + L HG N L LLS S+G Q
Sbjct  451   RNMSLRVHSNAHVLHAYVNGKYVGNQIVRDNKFDYRFEKKVNLVHGTNHLALLSVSVGLQ  510

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYGP+F+ G  G+ G V++VG  GDETV K+L  H+W YK+GL G  NKLF   + +   
Sbjct  511   NYGPFFESGPTGINGPVKLVGYKGDETVEKDLSKHQWDYKIGLNGFNNKLFSLKSANHHQ  570

Query  1061  SQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGD  1240
              +W ++ LP  R ++WYK +FKAP G+DPV+VDL G+GKG  W+NG ++GRYW      +
Sbjct  571   LKWSTEKLPADRMLSWYKANFKAPLGKDPVIVDLNGLGKGEVWINGQSIGRYWPSFNSSE  630

Query  1241  DCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRF  1420
             D  TE CDYRGEY ++KC   CG PTQR+YHVPRSFLN +G N + LFEE GG+ S V+F
Sbjct  631   DGCTEECDYRGEYGSDKCAFMCGKPTQRWYHVPRSFLNDKGHNTITLFEEMGGDPSMVKF  690

Query  1421  QTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVN  1600
             +TV TG VCA A+E+   E+SC   R I+A+K+A+FG+      G F  G C GAKDA  
Sbjct  691   KTVVTGRVCAKAHEHNKVELSCN-NRPISAVKFASFGNP-SGLCGSFAAGTCEGAKDAAK  748

Query  1601  ILKTACLGKASCSVTASESVFGTTNC-AGSRTKKLVVEAVC  1720
             I+   C+GK +C++  S   FG+TN   G   K+L VE  C
Sbjct  749   IVAKECVGKLNCTMNVSSHKFGSTNLDCGDSPKRLFVELEC  789



>ref|XP_009400603.1| PREDICTED: beta-galactosidase 13-like [Musa acuminata subsp. 
malaccensis]
Length=818

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/585 (49%), Positives = 375/585 (64%), Gaps = 31/585 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG  DP+R  E++A+ VARFFQ  GT QNYYMYHGGTNFGRT+GGPYI T
Sbjct  252   TENWTGWFKNWGSPDPHRPVEEVAFQVARFFQSNGTVQNYYMYHGGTNFGRTSGGPYIVT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNG-  358
             +YDY+APLDEYGN+ QPK+GHLKELH  +  +EK + YG +    L N + +T ++ +G 
Sbjct  312   SYDYDAPLDEYGNIRQPKWGHLKELHASVKLMEKALTYGEVVEDHLGNGLTITKFSGDGI  371

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE---  529
                CF SN N T DATI++QGT Y +PAWSVSILPDC++EVYNTA+V TQT++MVK+   
Sbjct  372   VPGCFLSNQNSTVDATISFQGTKYFLPAWSVSILPDCEKEVYNTAKVKTQTSIMVKKKDN  431

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDDP  706
              G  +  LRWSW+PE   ++       FT N++L+QK    D SDY+WY T+V + K + 
Sbjct  432   AGDQSKDLRWSWKPERLHNSAKGFGSSFTVNKLLEQKTTTVDASDYLWYTTNVEVSKKE-  490

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASI  874
                    L V+ TG +L+ + NG+ V S++      N +FE  +    GKN ++LLSA++
Sbjct  491   ----SFTLSVSTTGHILYAFVNGRLVGSEYATGGSYNFIFERKVTFKPGKNQISLLSATV  546

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G +NYG ++D    G+ G  V+++GKN       +L    WSYK+GL GE  KL      
Sbjct  547   GLRNYGAFYDNTPVGIVGGPVKLIGKN---NTILDLSESNWSYKIGLDGEVRKL------  597

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-I  1225
                  +W S  +PT R  TWYKT+F+AP G +PVVVDL+G+GKG AWVNGN+LGR+W   
Sbjct  598   QLDEKRWHSGVIPTNRPFTWYKTTFQAPLGSEPVVVDLLGLGKGEAWVNGNSLGRFWPNF  657

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
              A    C    CDYRG +  NKC + CG  +QR+YHVPRSFL R   N L LFEE GGN 
Sbjct  658   TANPYGC--NQCDYRGNFQPNKCQTACGEASQRWYHVPRSFLKRGEPNTLTLFEEAGGNP  715

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             ++V FQTV  G  C SA E  V  +SCQGGR I+++ +A FG+       G        +
Sbjct  716   NQVNFQTVTVGTACTSASEGDVLSLSCQGGRTISSVDFATFGEP--DGTCGAYGSGGCVS  773

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +AV ILK ACLG+ SCS+  S+ + GT+    +  +KLVV+  C
Sbjct  774   DEAVAILKDACLGRDSCSIQISDKI-GTSCAKLASPRKLVVQVTC  817



>ref|XP_008811417.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 13-like [Phoenix 
dactylifera]
Length=823

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/585 (47%), Positives = 381/585 (65%), Gaps = 22/585 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWFK W   DP+R AEDLA+SVARFFQL G+  NYYMYHGGTNFGRT GGPYITT
Sbjct  249   TENWSGWFKAWDKPDPHRAAEDLAFSVARFFQLKGSLVNYYMYHGGTNFGRTTGGPYITT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNG-  358
             TYDY+APLDEYGN  QPK+GHLKELH  ++ +E+ +++G++   +L   +  T Y  NG 
Sbjct  309   TYDYDAPLDEYGNKRQPKWGHLKELHAAIYMMEQALIHGDVKDVELSKGVWATKYIANGI  368

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
             T  CF SN+NE +DAT++++G  Y VPAWSVSILPDCK+EV+NTA+VN QT++MVK+   
Sbjct  369   TPGCFISNTNENSDATVDFEGAKYFVPAWSVSILPDCKQEVHNTAKVNVQTSIMVKKPNT  428

Query  539   AAAA---LRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDDP  706
             A      L+WSWRPE    ++    G FT   +L+Q     D SDY+WYMTSV+  +   
Sbjct  429   AENEPNDLKWSWRPETLRHSLKGLGGSFTDYTLLEQITTTLDESDYLWYMTSVDTKQCGI  488

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASI  874
                 ++ L VN TG +L+ + NG  + S++  N     +FE  + +  G+N ++LLSA++
Sbjct  489   TQEHEVTLRVNSTGHILYAFVNGHLIGSEYAPNGNFTFMFERKVMIEPGENKISLLSATV  548

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G + YG +F+    G+ G  V+++G   D T+  +L  ++WSYK+GL GE+ KL+  + +
Sbjct  549   GLKTYGSFFEQMPAGIVGGPVQLIGD--DFTI--DLSKNEWSYKIGLDGEKKKLYLDNPE  604

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-I  1225
              +    W  + LPT R  TWYKT F+AP G DPVV+DL+GMGKG AWVNGN+LGRYW   
Sbjct  605   DK----WYDEKLPTKRPFTWYKTKFQAPLGLDPVVIDLLGMGKGAAWVNGNSLGRYWTSY  660

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
             L+  +    + C+YRG Y + KC + CG P+QR+YHVPRSFL     N L+LFEE GG+ 
Sbjct  661   LSSTNGGCRDYCEYRGNYQSQKCQTGCGEPSQRWYHVPRSFLKAGEPNTLILFEEAGGDP  720

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             S++ FQTV  G +CA+  + K   +SCQ G++I+ I    FG+       G  +     +
Sbjct  721   SKINFQTVSVGTICATIDQGKTVSLSCQNGQSISKIDITRFGEPE--GSCGRFEKSGCDS  778

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +A   +  AC+GK SCS+  SE++ G        +KKLVV+A C
Sbjct  779   NEAYFAISNACVGKESCSIQNSENLLGGCKSNSLTSKKLVVQATC  823



>ref|XP_010558976.1| PREDICTED: beta-galactosidase 15-like [Tarenaya hassleriana]
Length=836

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/592 (48%), Positives = 381/592 (64%), Gaps = 29/592 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWFK +G  DP+R+AEDLA++VARFFQ GG+  NYYMYHGGTNFGRTAGGP+ITT
Sbjct  253   TENWSGWFKDYGMGDPHRSAEDLAFAVARFFQKGGSVHNYYMYHGGTNFGRTAGGPFITT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGN NQPK+GHLK LH VL S+EK ++YG  + T        TVY++ G 
Sbjct  313   SYDYNAPLDEYGNKNQPKWGHLKSLHKVLKSIEKPLLYGEKSETGFGQWANATVYSYKGK  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG---  532
               CF +N  +  D  I  QGT Y+VP WSVSILPDC+ EVYNTA+VN QT+VMVK+    
Sbjct  373   SVCFLANVYQ-EDKDITVQGTTYRVPGWSVSILPDCETEVYNTAKVNAQTSVMVKKTNGE  431

Query  533   ------GKAAAALRWSWRPE--VADDTILHGKGQF-TANQILDQKVANDVSDYIWYMTSV  685
                   G     L W WR +  V      H +G    ++ +LDQK+AND SDY+WY+T V
Sbjct  432   DDDNYEGNPFGGLNWVWRDDKPVGLSKSGHVRGSLMMSHSLLDQKIANDTSDYLWYITRV  491

Query  686   NLDKDDPIW-SKDMRLGVNGTGQVLHVYANGKYVDSQW---NNNSLFETNIKLNHGKNLL  853
             N+ K D +   K + L V+  G V+H + N KY+  ++   +N+ + +  IK+  GKN +
Sbjct  492   NIKKRDSLMGKKKINLHVHTNGHVVHAFFNKKYLGYKYSVSSNDFVMDKRIKIKRGKNEI  551

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLS ++G+ NYG +FD   +G++G V++VG+N  E + KN+ S  W YK GL GEENK 
Sbjct  552   ALLSTTVGYNNYGEFFDETRHGIWGPVKLVGENHGEKIIKNVSSSLWIYKSGLYGEENKF  611

Query  1031  FRSS-NKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             + +  + +R A  W S  LP+ R   WYK +F  P G DPVVVDL G+ KG  WVNG ++
Sbjct  612   YEAGIHNARRA--WHSTSLPSNRPFVWYKATFPTPLGTDPVVVDLRGLSKGEVWVNGKSI  669

Query  1208  GRYWLIL-AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GR+W  L AKG  C  + CDYRG Y+  KC++ CG PTQR+YH+PRSFL    DN +V+F
Sbjct  670   GRFWASLEAKG--C-NDNCDYRGAYSGEKCVTGCGEPTQRWYHIPRSFLKEYEDNVMVVF  726

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfe  1564
             +E GG+   V+ QTV  G VCA+AYE+K  E+SCQGG       +A++G+       G  
Sbjct  727   DEFGGSPQLVKIQTVTIGKVCATAYEDKTLELSCQGGSVFKEFHFADYGEPE--GDCGDF  784

Query  1565  kgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                  GA+  +NI+   CLGK  C +  S+  FG ++C G   K+L VEA C
Sbjct  785   SRGSCGARHTMNIINQKCLGKERCVIRVSDETFGASHCNGE--KRLAVEASC  834



>ref|XP_008437707.1| PREDICTED: beta-galactosidase 7-like, partial [Cucumis melo]
Length=777

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/583 (49%), Positives = 379/583 (65%), Gaps = 21/583 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYRTAED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  203   TENWVGWFKKWGDKDPYRTAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  262

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +  G  +     +S+ +T + FN  
Sbjct  263   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGTRSDQNFGSSVTLTKF-FNPT  321

Query  356   -GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
              G + CF SN++   DATI+ QG   Y VPAWSVSIL  C +EVYNTA+VN+QT++ VKE
Sbjct  322   TGERFCFLSNTDRKNDATIDLQGDGKYFVPAWSVSILDGCNKEVYNTAKVNSQTSMFVKE  381

Query  530   GG-KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDD  703
                K  A L W+W PE   DT L G G+F AN +L+QK V  D SDY WYMT V+  +  
Sbjct  382   QNEKENAQLSWTWAPEPMKDT-LQGNGKFAANLLLEQKRVTVDFSDYFWYMTKVDTSRTS  440

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASI  874
              +  +++ L VN  G VLH + N +Y+ SQW +N    +FE  I L  G N +TLLSA++
Sbjct  441   SL--QNVTLQVNTKGHVLHAFVNKRYIGSQWKSNGQSFVFEKPILLKSGTNTITLLSATV  498

Query  875   GFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             G +NY  ++D+   G+ G  I    GD  V  +L S+ WSYKVGL GE  +++      R
Sbjct  499   GLKNYDAFYDMVPTGIDGGPIY-LIGDGNVTTDLSSNLWSYKVGLNGEMKQIYNPMFSER  557

Query  1055  SASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
               + W++ +     RRMTWYKTSFK P G DPVV+D+ GMGKG AWVNG ++GR+W    
Sbjct  558   --TNWIALNKKSIGRRMTWYKTSFKTPGGIDPVVLDMQGMGKGQAWVNGQSIGRFWPSFI  615

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
              G+D     CDYRG Y+ +KC+ NCGNP+QR+YHVPRSFL+    N L+LFEE GGN  +
Sbjct  616   AGNDSCNATCDYRGAYDPSKCVQNCGNPSQRWYHVPRSFLSSD-KNTLILFEEIGGNPQQ  674

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V  QT+  G +C +A E    E+SCQGG  I+ I++A++G+       G  K       +
Sbjct  675   VSVQTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGNPE--GKCGSFKQGSWDVTN  732

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +   ++ AC+G  SCS+  S   FG  +   + + +L V+A+C
Sbjct  733   SALFVEKACIGMESCSIDVSAKSFGLGDVT-NLSARLAVQALC  774



>ref|XP_008437703.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
melo]
Length=821

 Score =   543 bits (1398),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 290/583 (50%), Positives = 379/583 (65%), Gaps = 21/583 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYRTAED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  247   TENWVGWFKKWGDKDPYRTAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +  G  +   L  S+ +T + FN  
Sbjct  307   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGTRSDQNLGGSVTLTKF-FNPT  365

Query  356   -GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
              G + CF SN++   DATIN Q    Y VPAWSVSIL  C +EVYNTA+VN+QT++ +KE
Sbjct  366   TGERFCFLSNTDGKNDATINLQADGKYFVPAWSVSILDGCNKEVYNTAKVNSQTSIFIKE  425

Query  530   GG-KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDD  703
                K  A L W+W PE   DT L G G+F AN +L+QK V  D SDY WYMT V  D ++
Sbjct  426   QNEKENAQLSWAWAPEPMKDT-LQGNGKFAANLLLEQKRVTVDFSDYFWYMTKV--DTNE  482

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASI  874
                 +++ L VN  G VLH + N +Y+ SQW +N    +FE  I L  G N +TLLSA++
Sbjct  483   TSLLQNVTLQVNTKGHVLHAFVNKRYIGSQWKSNGQSFVFEKPILLKSGTNTITLLSATV  542

Query  875   GFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             G +NY  ++D+   G+ G  I    GD  V  +L S+ W YKVGL GE  +++      R
Sbjct  543   GLKNYDAFYDMVPTGIDGGPIY-LIGDGNVTTDLSSNLWYYKVGLNGEMKQIYNPIFSQR  601

Query  1055  SASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
               + W++ +     RRMTWYKTSFK PAG DPVV+D+ GMGKG AWVNG ++GR+W    
Sbjct  602   --TNWIALNQKSIGRRMTWYKTSFKTPAGIDPVVLDMQGMGKGQAWVNGQSIGRFWPSFI  659

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
              G+D  +  CDYRG YN +KC+ NCGNP+QR+YHVPRSFL+    N L+LFEE GGN  +
Sbjct  660   AGNDSCSATCDYRGAYNPSKCVENCGNPSQRWYHVPRSFLSSD-TNTLILFEEIGGNPQQ  718

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V  QT+  G +C +A E    E+SCQGG  I+ I++A++G+       G  K       +
Sbjct  719   VSVQTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGNPE--GKCGSFKEGSWDVTN  776

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +   ++ AC+G  SC +  S   FG  + A + + +L V+A+C
Sbjct  777   SALFVEKACIGMESCLIDVSAKSFGLGD-ATNLSARLAVQALC  818



>ref|XP_002324727.2| hypothetical protein POPTR_0018s07470g [Populus trichocarpa]
 gb|EEF03292.2| hypothetical protein POPTR_0018s07470g [Populus trichocarpa]
Length=855

 Score =   542 bits (1397),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 284/595 (48%), Positives = 381/595 (64%), Gaps = 32/595 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWFK WGG+DPYRTAEDLA+SVARF Q GG   +YYMYHGGTNFGRTAGGPYITT
Sbjct  251   TENWSGWFKLWGGRDPYRTAEDLAFSVARFIQNGGVLNSYYMYHGGTNFGRTAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   E+ +  G +T+      +  T Y   GT
Sbjct  311   SYDYNAPLDEYGNLNQPKWGHLKQLHEAIKQGERILTNGTVTSKNFWGGVDQTTYTNQGT  370

Query  362   --KTCFFSNSN-ETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
               + CF SN+N E A+  +   G  Y +PAWSV+IL DC +E+YNTA+VNTQT++MVK+ 
Sbjct  371   GERFCFLSNTNMEEANVDLGQDG-KYSLPAWSVTILQDCNKEIYNTAKVNTQTSIMVKKL  429

Query  533   GKA--AAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDD  703
              +      L W+W PE     +L GKG+F A ++L+QK    D +DY+WYMTSVNL++  
Sbjct  430   HEEDKPVQLSWTWAPEPMKG-VLQGKGRFRATELLEQKETTVDTTDYLWYMTSVNLNETT  488

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS-------------LFETNIKLNHGK  844
                  ++ L V   G  LH Y N K + +Q++  +             LFE  + L  G 
Sbjct  489   LKKWTNVTLRVGTRGHTLHAYVNKKEIGTQFSKQANAQQSVKGDDYSFLFEKPVTLTSGT  548

Query  845   NLLTLLSASIGFQNYGPYFDLGGNGLY--GVEIVGKNGDETVRKNLGSHKWSYKVGLRGE  1018
             N ++LLSA++G  NYG Y+D    G+    V++V  NG   +  +L S++WSYK+GL GE
Sbjct  549   NTISLLSATVGLANYGQYYDKKPVGIAEGPVQLVA-NGKPFM--DLTSYQWSYKIGLSGE  605

Query  1019  ENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNG  1198
               K +   N   ++    SD+LPT R MTWYKT+F +P+G +PVVVDL+GMGKG AWVNG
Sbjct  606   A-KRYNDPNSPHASKFTASDNLPTGRAMTWYKTTFASPSGTEPVVVDLLGMGKGHAWVNG  664

Query  1199  NNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNEL  1375
              +LGR+W   +A    CP + CDYRG YN +KC++NCGNP+QR+YH+PRS+LN+ G N L
Sbjct  665   KSLGRFWPTQIADAKGCP-DTCDYRGSYNGDKCVTNCGNPSQRWYHIPRSYLNKDGQNTL  723

Query  1376  VLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgg  1555
             +LFEE GGN + V FQ V    +C +AYE    E+SC+GGR I+ I++A++GD       
Sbjct  724   ILFEEVGGNPTNVSFQIVAVETICGNAYEGSTLELSCEGGRTISDIQFASYGDPE--GTC  781

Query  1556  gfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             G        A  +  +++ AC+GK SC +  S   FG          +L V+AVC
Sbjct  782   GAFMKGSFYATRSAAVVEKACVGKQSCGILVSGETFGLKK-RSDIANRLAVQAVC  835



>gb|KGN66624.1| hypothetical protein Csa_1G650110 [Cucumis sativus]
Length=821

 Score =   541 bits (1393),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 288/582 (49%), Positives = 378/582 (65%), Gaps = 19/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYRTAED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  247   TENWVGWFKKWGDKDPYRTAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +     +     +S+ +T ++    
Sbjct  307   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNSTRSNQNFGSSVTLTKFSNPTT  366

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
             G + CF SN++   DATI+ Q    Y VPAWSVSIL  C +EVYNTA+VN+QT++ VKE 
Sbjct  367   GERFCFLSNTDGKNDATIDLQEDGKYFVPAWSVSILDGCNKEVYNTAKVNSQTSMFVKEQ  426

Query  533   G-KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K  A L W+W PE   DT L G G+F AN +L+QK V  D SDY WYMT V+ +    
Sbjct  427   NEKENAQLSWAWAPEPMKDT-LQGNGKFAANLLLEQKRVTVDFSDYFWYMTKVDTNGTSS  485

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASIG  877
             +  +++ L VN  G VLH + N +Y+ S+W +N    +FE  I L  G N +TLLSA++G
Sbjct  486   L--QNVTLQVNTKGHVLHAFVNKRYIGSKWGSNGQSFVFEKPILLKSGINTITLLSATVG  543

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
              +NY  ++D+   G+ G  I    GD  V  +L S+ WSYKVGL GE  +++      R 
Sbjct  544   LKNYDAFYDMVPTGIDGGPIY-LIGDGNVTTDLSSNLWSYKVGLNGEMKQIYNPMFSQR-  601

Query  1058  ASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              + W+  +     RRMTWYKTSFK PAG DPVV+D+ GMGKG AWVNG ++GR+W     
Sbjct  602   -TNWIPLNQKSIGRRMTWYKTSFKTPAGIDPVVLDMQGMGKGQAWVNGQSIGRFWPSFIA  660

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
             G+D  +  CDYRG YN +KC+ NCGNP+QR+YHVPRSFL+    N L+LFEE GGN  +V
Sbjct  661   GNDSCSATCDYRGAYNPSKCVENCGNPSQRWYHVPRSFLSSD-TNTLILFEEIGGNPQQV  719

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
               QT+  G +C +A E    E+SCQGG  I+ I++A++G+       G  K       + 
Sbjct  720   SVQTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGNP--GGKCGSFKKGSWDVTNI  777

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               IL+ AC+G  SCS+  S   FG  + A + + +L V+A+C
Sbjct  778   ALILEKACIGMESCSIDVSAKSFGLGD-ATNLSARLAVQALC  818



>ref|XP_009400604.1| PREDICTED: beta-galactosidase 1-like [Musa acuminata subsp. malaccensis]
Length=818

 Score =   540 bits (1392),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 282/585 (48%), Positives = 375/585 (64%), Gaps = 31/585 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTG FK WG   P+R  E++A+ VARFFQ  GT QNYYMYHGGTNFGRT+GGPYI T
Sbjct  252   TENWTGSFKIWGSPHPHRPVEEVAFQVARFFQSNGTVQNYYMYHGGTNFGRTSGGPYIAT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNG-  358
             +YDY+APLDEYGN+ QPK+GHLKELH  +  +EK + YG +    L N + +T ++ +G 
Sbjct  312   SYDYDAPLDEYGNIRQPKWGHLKELHASVKLMEKALTYGEVVEDHLGNGLTITKFSGDGI  371

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE---  529
                CF SN N T DATI++QGT+Y +PAWSVSILPDCK+EVYNTA+V TQT++MV +   
Sbjct  372   VPGCFLSNQNSTVDATISFQGTNYFLPAWSVSILPDCKKEVYNTAKVKTQTSIMVTKKDN  431

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDDP  706
              G  +  LRWSW+PE   D+       FT N++L+QK    D SDY+WY T+V + K + 
Sbjct  432   AGDQSKDLRWSWKPERLHDSAKGFGNSFTVNKLLEQKTTTVDASDYLWYTTNVEVSKKE-  490

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSASI  874
                    L V+ TG +L+ + NG+ V S++      N +FE  +    GKN ++LLSA++
Sbjct  491   ----SFTLSVSTTGHILYAFVNGRLVGSEYATGGTYNFIFERKVTFKPGKNQISLLSATV  546

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G  NYG ++D    G+ G  V+++GKN       +L    WSYK+GL GE  KL      
Sbjct  547   GLSNYGAFYDNTPVGIVGGPVKLIGKN---NTILDLSESNWSYKIGLDGEVRKL------  597

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL-I  1225
                  +W S  +PT R  TWYKT+F+AP G +PVVVDL+G+GKG AWVNGN+LGR+W   
Sbjct  598   QLDEERWYSGVIPTKRPFTWYKTTFQAPLGSEPVVVDLLGLGKGEAWVNGNSLGRFWPNF  657

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
              A  D C  + CDYRG +  NKC + CG  +QR+YHVPRSFL R   N L LFEE GG+ 
Sbjct  658   TANPDGC--KQCDYRGNFQTNKCQTACGEASQRWYHVPRSFLKRGEPNTLTLFEEAGGDP  715

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             ++V FQTV  G  C SA E     +SCQGGR I+++ +A FG+       G  +    G+
Sbjct  716   NQVNFQTVTVGTACTSAGEGDALSLSCQGGRTISSVDFATFGEP--DGTCGDYESGGCGS  773

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +AV ILK ACLG+ SCS+  S+++ GT+    +  +KLV +  C
Sbjct  774   DEAVAILKDACLGRESCSIKISDTI-GTSCAKLASPRKLVGQVTC  817



>gb|KHN04556.1| Beta-galactosidase [Glycine soja]
Length=769

 Score =   537 bits (1384),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 285/586 (49%), Positives = 385/586 (66%), Gaps = 24/586 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+KWG + P+R+AED A+SVARFFQ GG   NYYMYHGGTNFGRTAGGPY+TT
Sbjct  195   TENWIGWFQKWGERVPHRSAEDSAFSVARFFQNGGILNNYYMYHGGTNFGRTAGGPYMTT  254

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +Y+Y+APLDEYGNLNQPK+GHLK+LH  +   EK I  G  T     N + +T Y   NG
Sbjct  255   SYEYDAPLDEYGNLNQPKWGHLKQLHAAIKLGEKIITNGTRTDKDFGNEVTLTTYTHTNG  314

Query  359   TKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG  535
              + CF SN+N++ DA ++ Q   +Y +PAWSV+IL  C +EV+NTA+VN+QT++MVK+  
Sbjct  315   ERFCFLSNTNDSKDANVDLQQDGNYFLPAWSVTILDGCNKEVFNTAKVNSQTSIMVKKSD  374

Query  536   KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIW  712
              A+  L W+W PE   DT +HGKG F  NQ+L+QK +  DVSDY+WYMTSV+++ D  IW
Sbjct  375   DASNKLTWAWIPEKKKDT-MHGKGNFKVNQLLEQKELTFDVSDYLWYMTSVDIN-DTSIW  432

Query  713   SKDMRLGVNGTGQVLHVYANGKYVD---SQWNNNSLFETNIKLNHGKNLLTLLSASIGFQ  883
             S +  L VN  G  L  Y NG++V    SQW  N  +E  + L  G N++TLLSA++G  
Sbjct  433   S-NATLRVNTRGHTLRAYVNGRHVGYKFSQWGGNFTYEKYVSLKKGLNVITLLSATVGLP  491

Query  884   NYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG  FD    G+ G  V+++G N +ET+  +L ++ WSYK+GL GE+ +L+    + R 
Sbjct  492   NYGAKFDKIKTGIAGGPVQLIGNN-NETI--DLSTNLWSYKIGLNGEKKRLYDP--QPRI  546

Query  1058  ASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
                W ++   P  R +TWYK  F AP+G DPVVVDL+G+GKG AWVNG ++GRYW     
Sbjct  547   GVSWRTNSPYPIGRSLTWYKADFVAPSGNDPVVVDLLGLGKGEAWVNGQSIGRYWTSWIT  606

Query  1235  GDDCPTEACDYRGEY-NNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               +  ++ CDYRG+Y    KC +NCGNP+QR+YHVPRSFL +   N LVLFEE GGN   
Sbjct  607   ATNGCSDTCDYRGKYVPAQKCNTNCGNPSQRWYHVPRSFL-KNDKNTLVLFEEIGGNPQN  665

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV TG +CA   E  + E+SCQGG+ I+ I++++FG+   +   G  K     A D
Sbjct  666   VSFQTVITGTICAQVQEGALLELSCQGGKTISQIQFSSFGNP--TGNCGSFKKGTWEATD  723

Query  1592  AVNILKTACLGKASCSVTASESVFGTT---NCAGSRTKKLVVEAVC  1720
               ++++ AC+G+ SC    ++  FG          R  +L V+A C
Sbjct  724   GQSVVEAACVGRNSCGFMVTKEAFGVAIGPMNVDERVARLAVQATC  769



>ref|XP_003547766.1| PREDICTED: beta-galactosidase 7-like [Glycine max]
Length=826

 Score =   538 bits (1386),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 285/586 (49%), Positives = 385/586 (66%), Gaps = 24/586 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+KWG + P+R+AED A+SVARFFQ GG   NYYMYHGGTNFGRTAGGPY+TT
Sbjct  252   TENWIGWFQKWGERVPHRSAEDSAFSVARFFQNGGILNNYYMYHGGTNFGRTAGGPYMTT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +Y+Y+APLDEYGNLNQPK+GHLK+LH  +   EK I  G  T     N + +T Y   NG
Sbjct  312   SYEYDAPLDEYGNLNQPKWGHLKQLHAAIKLGEKIITNGTRTDKDFGNEVTLTTYTHTNG  371

Query  359   TKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG  535
              + CF SN+N++ DA ++ Q   +Y +PAWSV+IL  C +EV+NTA+VN+QT++MVK+  
Sbjct  372   ERFCFLSNTNDSKDANVDLQQDGNYFLPAWSVTILDGCNKEVFNTAKVNSQTSIMVKKSD  431

Query  536   KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIW  712
              A+  L W+W PE   DT +HGKG F  NQ+L+QK +  DVSDY+WYMTSV+++ D  IW
Sbjct  432   DASNKLTWAWIPEKKKDT-MHGKGNFKVNQLLEQKELTFDVSDYLWYMTSVDIN-DTSIW  489

Query  713   SKDMRLGVNGTGQVLHVYANGKYVD---SQWNNNSLFETNIKLNHGKNLLTLLSASIGFQ  883
             S +  L VN  G  L  Y NG++V    SQW  N  +E  + L  G N++TLLSA++G  
Sbjct  490   S-NATLRVNTRGHTLRAYVNGRHVGYKFSQWGGNFTYEKYVSLKKGLNVITLLSATVGLP  548

Query  884   NYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG  FD    G+ G  V+++G N +ET+  +L ++ WSYK+GL GE+ +L+    + R 
Sbjct  549   NYGAKFDKIKTGIAGGPVQLIGNN-NETI--DLSTNLWSYKIGLNGEKKRLYDP--QPRI  603

Query  1058  ASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
                W ++   P  R +TWYK  F AP+G DPVVVDL+G+GKG AWVNG ++GRYW     
Sbjct  604   GVSWRTNSPYPIGRSLTWYKADFVAPSGNDPVVVDLLGLGKGEAWVNGQSIGRYWTSWIT  663

Query  1235  GDDCPTEACDYRGEY-NNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               +  ++ CDYRG+Y    KC +NCGNP+QR+YHVPRSFL +   N LVLFEE GGN   
Sbjct  664   ATNGCSDTCDYRGKYVPAQKCNTNCGNPSQRWYHVPRSFL-KNDKNTLVLFEEIGGNPQN  722

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V FQTV TG +CA   E  + E+SCQGG+ I+ I++++FG+   +   G  K     A D
Sbjct  723   VSFQTVITGTICAQVQEGALLELSCQGGKTISQIQFSSFGNP--TGNCGSFKKGTWEATD  780

Query  1592  AVNILKTACLGKASCSVTASESVFGTT---NCAGSRTKKLVVEAVC  1720
               ++++ AC+G+ SC    ++  FG          R  +L V+A C
Sbjct  781   GQSVVEAACVGRNSCGFMVTKEAFGVAIGPMNVDERVARLAVQATC  826



>ref|XP_011006177.1| PREDICTED: beta-galactosidase 7-like [Populus euphratica]
Length=855

 Score =   538 bits (1387),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 282/595 (47%), Positives = 380/595 (64%), Gaps = 32/595 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWFK WGG+DPYRTAEDLA+SVARF Q GG   +YYMYHGGTNFGRTAGGPYITT
Sbjct  251   TENWSGWFKLWGGRDPYRTAEDLAFSVARFIQNGGVLNSYYMYHGGTNFGRTAGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   E+ +  G +T+      +  T Y   GT
Sbjct  311   SYDYNAPLDEYGNLNQPKWGHLKQLHAAIKQGERILTNGTVTSKNFWGGVDQTTYTNQGT  370

Query  362   --KTCFFSNSN-ETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
               + CF SN+N E A+  +   G  Y +P WSV+IL DC +E+YNTA+VNTQT++MVK+ 
Sbjct  371   GERFCFLSNTNMEEANVDLGQDG-KYSLPDWSVTILQDCNKEIYNTAKVNTQTSIMVKKL  429

Query  533   GKA--AAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDD  703
              +      L W+W PE     +L GKG+F A ++L+QK    D +DY+WYMTSVNL++  
Sbjct  430   HEEDKPVHLSWTWAPEPMKG-VLQGKGRFRATELLEQKETTVDTTDYLWYMTSVNLNETT  488

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS-------------LFETNIKLNHGK  844
                  ++ L V   G  LH Y N K + +Q++  +             LFE  + L  G 
Sbjct  489   LKKWTNVTLRVGTRGHTLHAYVNKKEIGTQFSKQANGQQSVKGDDYSFLFEKPVTLTSGT  548

Query  845   NLLTLLSASIGFQNYGPYFDLGGNGLY--GVEIVGKNGDETVRKNLGSHKWSYKVGLRGE  1018
             N ++LLSA++G  NYG Y+D    G+    V++V  NG   +  +L S++WSYK+GL GE
Sbjct  549   NTISLLSATVGLANYGQYYDKKPVGIAEGPVQLVA-NGKPFM--DLTSYQWSYKIGLSGE  605

Query  1019  ENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNG  1198
               K +   N   ++    SD+LPT R MTWYKT+F +P+G +PV VDL+GMGKG AWVNG
Sbjct  606   A-KRYYDPNSPHASKFTASDNLPTGRAMTWYKTTFASPSGTEPVAVDLLGMGKGHAWVNG  664

Query  1199  NNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNEL  1375
              +LGR+W   +A    CP + CDYRG YN +KC++NCGNP+QR+YH+PRS+LN+ G N L
Sbjct  665   KSLGRFWPTQIADAKGCP-DTCDYRGSYNGDKCVTNCGNPSQRWYHIPRSYLNKDGQNTL  723

Query  1376  VLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgg  1555
             ++FEE GGN + V FQ V  G +C +AYE    E+SC+GGR I+ I++A++GD       
Sbjct  724   IVFEEVGGNPTNVSFQIVAVGTICGNAYEGSTLELSCEGGRTISDIQFASYGDPE--GTC  781

Query  1556  gfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             G        A  +  +++ AC+GK SC +  S   FG          +L V+AVC
Sbjct  782   GAFMKGSFYATRSAAVVEKACVGKQSCGILVSGETFGLKK-RSDIANRLAVQAVC  835



>ref|XP_002516236.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF46238.1| beta-galactosidase, putative [Ricinus communis]
Length=775

 Score =   535 bits (1377),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 286/584 (49%), Positives = 376/584 (64%), Gaps = 21/584 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GW+K WGGK  YRTAED+A+SVARF Q GG F NYYMY+GGTNFGRTAGGPYIT 
Sbjct  187   TENWSGWYKLWGGKTSYRTAEDMAFSVARFVQAGGVFNNYYMYYGGTNFGRTAGGPYITA  246

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY++PLDEYGNLNQPK+GHLK+LH  +   EK I  G +T       + +T Y  N T
Sbjct  247   SYDYDSPLDEYGNLNQPKWGHLKQLHASIKLGEKIITNGTVTIKNFQAGVDLTAYTNNAT  306

Query  362   KT--CFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE-  529
             +   CF SN N  ADA I+ Q   +Y +PAWSVSIL +C +E++NTA+VNTQT++MVK+ 
Sbjct  307   RERFCFLSNIN-IADAHIDLQQDGNYTIPAWSVSILQNCSKEIFNTAKVNTQTSLMVKKL  365

Query  530   -GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDD  703
                     L W W PE   DT+L GKG+F  +Q+LDQK    D SDY+WYMTS +++K+ 
Sbjct  366   YENDKPTNLSWVWAPEPMKDTLL-GKGRFRTSQLLDQKETTVDASDYLWYMTSFDMNKNT  424

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKY-VDSQW--NNNSLFETNIKLNHGKNLLTLLSASI  874
               W+ ++ L V   G VLH Y N K  V SQ        FE  + L  G N+++LLSA++
Sbjct  425   LQWT-NVTLRVTSRGHVLHAYVNKKLIVGSQLVIQGEFTFEKPVTLKPGNNVISLLSATV  483

Query  875   GFQNYGPYFDLGGNGLY-GVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
             G  NYG +FD    G+  G   +  NG   +  +L S+ WSYK+GL GE  + +  +++ 
Sbjct  484   GLANYGSFFDKTPVGIVDGPVQLMANGKPVM--DLSSNLWSYKIGLNGEAKRFYDPTSRH  541

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI-L  1228
                S   ++ + TAR MTWYKT+F +P+G DPVVVDL GMGKG AW NG +LGRYW   +
Sbjct  542   NKWSA--ANGVSTARPMTWYKTTFSSPSGTDPVVVDLQGMGKGHAWANGKSLGRYWPSQI  599

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
             A  + C +  CDYRG YN  KC  NCG PTQR+YHVPRSFLN  G N L+LFEE GG+ S
Sbjct  600   ANANGC-SGTCDYRGPYNAGKCTRNCGIPTQRWYHVPRSFLNSNGKNTLILFEEVGGDPS  658

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
              + FQ V T  +C +AYE    E+SCQGGR I+ I++A++G+ +        K     A 
Sbjct  659   GISFQIVTTETICGNAYEGSTLELSCQGGRTISEIQFASYGNPQ--GTCSSFKKGSFDAM  716

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++V +++  C+GK SCS+ AS+  F      G   K+L V+A C
Sbjct  717   NSVQMVQKECVGKDSCSIIASDETFMVNEPQGISNKRLAVQAHC  760



>ref|XP_008444022.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=824

 Score =   535 bits (1377),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 280/581 (48%), Positives = 378/581 (65%), Gaps = 17/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYR+AED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  250   TENWVGWFKKWGEKDPYRSAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +  G+ +  K  + + +T ++    
Sbjct  310   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGSRSDKKFGSFVTLTKFSNPIT  369

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK-E  529
             G + CF SN+N+T DAT++ +    Y VPAWSVSIL  CK+EV+NTA +N+QT++ VK +
Sbjct  370   GERFCFLSNTNDTNDATVDLKADGKYFVPAWSVSILNGCKKEVFNTANINSQTSMFVKVQ  429

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K  A L W W PE   DT L GKG F AN +L+QK    D SDY+WYMT V  +    
Sbjct  430   NEKENAQLSWVWAPEAMTDT-LQGKGTFKANLLLEQKGTTVDFSDYLWYMTDVETNGTSA  488

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASIG  877
             +  +++ L VN  G VLH + N  Y+ SQW +N    +FE  I+L  G N +TLLSA++G
Sbjct  489   L--QNVTLQVNTKGHVLHAFVNNMYIGSQWESNGQSFVFEKPIQLKTGTNTITLLSATVG  546

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
              +NY  ++D    G+ G  I     D  V  NL S+ WSYKVGL GE+ +L+     S+ 
Sbjct  547   LKNYDAFYDTVPTGIDGGPIYLIE-DGNVTTNLSSNLWSYKVGLNGEKEQLYNPM-FSKG  604

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
              +    +     RRMTWYKTSFK P+G DP+ +D+ GMGKG AW+NG ++GR+W     G
Sbjct  605   TNWSKLNKTSVERRMTWYKTSFKTPSGIDPIALDMQGMGKGEAWINGQSIGRFWPSFIAG  664

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +EACDYRG Y+ +KC+ NCGNP+QR+YH+PRSFL+    N LVLFEE GGN  +V 
Sbjct  665   NDNCSEACDYRGAYDPSKCVENCGNPSQRWYHIPRSFLSDD-TNTLVLFEEIGGNPQQVS  723

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
              QT+  G +C +A E  + E+SCQGG  I+ I++A++G+ +     G  K       +  
Sbjct  724   VQTITIGTICGNANEGSILELSCQGGHIISEIQFASYGNPK--GKCGSFKQGSWDVTNTA  781

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               ++  C+G  +CS+  S   FG    A + + +L V+A+C
Sbjct  782   LFVEKTCIGMKNCSLDVSAKSFGLRK-AANLSARLAVQALC  821



>gb|KGN66613.1| hypothetical protein Csa_1G643050 [Cucumis sativus]
Length=803

 Score =   531 bits (1369),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 283/581 (49%), Positives = 378/581 (65%), Gaps = 17/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYR+AED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  229   TENWVGWFKKWGDKDPYRSAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  288

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGNLNQPK+GHLK+LH+ +   EK +  G  +     + + +T ++   T
Sbjct  289   SYDYNAPLDEYGNLNQPKWGHLKQLHSSIKLGEKILTNGTHSNKTFGSFVTLTKFSNPTT  348

Query  362   KT--CFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK-E  529
             K   CF SN++ T DATI+ Q    Y VPAWSVSI+  CK+EV+NTA++N+QT++ VK +
Sbjct  349   KERFCFLSNTDGTNDATIDLQADGKYFVPAWSVSIIDGCKKEVFNTAKINSQTSIFVKVQ  408

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K    L W W PE   DT L GKG F  N +L+QK    D SDY+WYMT+V  +    
Sbjct  409   NEKENVKLSWVWAPEAMSDT-LQGKGTFKENLLLEQKGTTIDSSDYLWYMTNVETNGTSS  467

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASIG  877
             I   ++ L VN  G VLH + N +Y+ SQW NN    +FE  I L  G N++TLLSA++G
Sbjct  468   I--HNVTLQVNTKGHVLHAFVNTRYIGSQWGNNGQSFVFEKPILLKAGTNIITLLSATVG  525

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
              +NY  ++D    G+ G  I    GD  V  NL S+ WSYKVGL GE  +L+       +
Sbjct  526   LKNYDAFYDTLPTGIDGGPIY-LIGDGNVTTNLSSNLWSYKVGLNGEIKQLYNPVFSQET  584

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
             +   L+ +    RRMTWYKTSFK P+G DPV +D+ GMGKG AW+NG ++GR+W     G
Sbjct  585   SWNTLNKN-SIGRRMTWYKTSFKTPSGIDPVTLDMQGMGKGEAWINGQSIGRFWPSFIAG  643

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +E CDYRG Y+ +KC+ NCGNP+QR+YH+PRSFL+    N LVLFEE GG+  +V 
Sbjct  644   NDNCSETCDYRGAYDPSKCVGNCGNPSQRWYHIPRSFLSNN-TNTLVLFEEIGGSPQQVS  702

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
              QT+  G +C +A E    E+SCQG   I+ I++A++G+ +     G  K       ++ 
Sbjct  703   VQTITIGTICGNANEGSTLELSCQGEYIISEIQFASYGNPK--GKCGSFKQGSWDVTNSA  760

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +L+  C G  SCSV  S  +FG  + A + + +LVV+A+C
Sbjct  761   LLLEKTCKGMKSCSVDVSAKLFGLGD-AVNLSARLVVQALC  800



>ref|XP_004154711.1| PREDICTED: beta-galactosidase 7-like [Cucumis sativus]
Length=803

 Score =   530 bits (1365),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 282/581 (49%), Positives = 378/581 (65%), Gaps = 17/581 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYR+AED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  229   TENWVGWFKKWGDKDPYRSAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  288

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGNLNQPK+GHLK+LH+ +   EK +  G  +     + + +T ++   T
Sbjct  289   SYDYNAPLDEYGNLNQPKWGHLKQLHSSIKLGEKILTNGTHSNKTFGSFVTLTKFSNPTT  348

Query  362   KT--CFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK-E  529
             K   CF SN+++T DATI+ Q    Y VPAWSVSI+  CK+EV+NTA++N+QT++ VK +
Sbjct  349   KERFCFLSNTDDTNDATIDLQADGKYFVPAWSVSIIDGCKKEVFNTAKINSQTSMFVKVQ  408

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K    L W W PE   DT L GKG F  N +L+QK    D SDY+WYMT+V  +    
Sbjct  409   NEKENVKLSWVWAPEAMSDT-LQGKGTFKENLLLEQKGTTIDSSDYLWYMTNVETNGTSS  467

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASIG  877
             I   ++ L VN  G VLH + N +Y+ SQW NN    +FE  I L  G N++TLLSA++G
Sbjct  468   I--HNVTLQVNTKGHVLHAFVNTRYIGSQWGNNGQSFVFEKPILLKAGTNIITLLSATVG  525

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
              +NY  ++D    G+ G  I    GD  V  NL S+ WSYKVGL GE  +L+       +
Sbjct  526   LKNYDAFYDTLPTGIDGGPIY-LIGDGNVTTNLSSNLWSYKVGLNGEIKQLYNPVFSQET  584

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
             +   L+ +    RRMTWYKTSFK P+G DPV +D+ GMGKG AW+NG ++GR+W     G
Sbjct  585   SWNTLNKN-SIGRRMTWYKTSFKTPSGIDPVTLDMQGMGKGEAWINGQSIGRFWPSFIAG  643

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +E CDYRG Y+ +KC+ NCGNP+QR+YH+PRSFL+    N LVLFEE GG+  +V 
Sbjct  644   NDNCSETCDYRGAYDPSKCVGNCGNPSQRWYHIPRSFLSNN-TNTLVLFEEIGGSPQQVS  702

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
              QT+  G +C +A E    E+SCQG   I+ I++A++G+ +     G  K       ++ 
Sbjct  703   VQTITIGTICGNANEGSTLELSCQGEYIISEIQFASYGNPK--GKCGSFKQGSWDVTNSA  760

Query  1598  NILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +L+  C    SCSV  S  +FG  + A + + +LVV+A+C
Sbjct  761   LLLEKTCKDMKSCSVDVSAKLFGLGD-AVNLSARLVVQALC  800



>ref|XP_006452854.1| hypothetical protein CICLE_v10010771mg [Citrus clementina]
 gb|ESR66094.1| hypothetical protein CICLE_v10010771mg [Citrus clementina]
Length=832

 Score =   530 bits (1366),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 295/602 (49%), Positives = 383/602 (64%), Gaps = 48/602 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RTAEDLA+SVARFFQ GG   NYYMYHGGTNFGRTAGGPYI T
Sbjct  249   TENWTGWFKLWGGRDPQRTAEDLAFSVARFFQNGGVLNNYYMYHGGTNFGRTAGGPYIAT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +  G + T  + N + +T +  N  
Sbjct  309   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKQAEKFLTNGTVETKSVMNFVDLTKFTLNAT  368

Query  356   GTKTCFFSNSNETADATINYQGTDYK--VPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
             G + C  SNS+ T D T +  G D K  VPAWSV+ L +C +EVYNTA++NTQT+VMV +
Sbjct  369   GERFCMLSNSDNTGDYTADL-GEDGKFFVPAWSVTFLQNCSKEVYNTAKINTQTSVMVTK  427

Query  530   GGKA--------AAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTS  682
               +          A L W W PE   DT L G G+F A Q+LDQK A+ DVSDY+WYMT 
Sbjct  428   HSEEDAYGNEVKPAKLSWMWAPEPIQDT-LKGNGRFEAAQLLDQKEASGDVSDYLWYMTR  486

Query  683   VNLDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL-------------FETN  823
                     I  K+M L V+  G  LH Y NGK + SQ++  +              F+  
Sbjct  487   -------NISLKNMTLRVSTNGHGLHAYVNGKLIGSQFSRQAKGQQMVTGDDYSFGFDKA  539

Query  824   IKLNHGKNLLTLLSASIGFQNYGPYFDLGGNGLY--GVEIVGKNGDETVRKNLGSHKWSY  997
             + L  G N+++LLS ++G  NYG ++DL   GL   GV + GK G+ ++  N  +++WSY
Sbjct  540   VSLKKGLNVISLLSVTVGLANYGAFYDLKPTGLINGGVLLNGK-GNNSI--NATTYQWSY  596

Query  998   KVGLRGEENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGK  1177
             KVGL GE  + F   N SR+A+ W S  +P  R MTWYKTSFK P+G +PVV+ L+GMGK
Sbjct  597   KVGLNGEAQQ-FHDPN-SRNAN-WNSTKVPKNRPMTWYKTSFKTPSGEEPVVLGLLGMGK  653

Query  1178  GFAWVNGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLN  1354
             G AW+NG ++GRYW   +A+   C    C+Y+G YN+ KC +NCGNP+QR+YHVPRSFLN
Sbjct  654   GHAWMNGKSIGRYWPTQIAETTGCDAH-CNYKGSYNDGKCRTNCGNPSQRWYHVPRSFLN  712

Query  1355  RRGDNELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGD  1534
                DN L+LFEE GG    V  Q V  G VCA+AYE    E+ CQG R I+ I++A+FGD
Sbjct  713   NNTDNTLILFEEVGGAPWNVTLQVVTVGTVCANAYEGNNLELYCQGDRRISEIQFASFGD  772

Query  1535  TRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEA  1714
              +     G        A  +V +++  C G+ SC +  S+S FG ++  G+ T +L V+A
Sbjct  773   PQ--GTCGSFSLGNYQATQSVAVVEKLCAGRPSCLIDVSQSTFGISSW-GNVTSRLAVQA  829

Query  1715  VC  1720
             VC
Sbjct  830   VC  831



>ref|XP_008452141.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
melo]
Length=821

 Score =   529 bits (1363),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 285/583 (49%), Positives = 377/583 (65%), Gaps = 21/583 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYRTA+D+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  247   TENWVGWFKKWGDKDPYRTAKDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDYNA LDEYGNLNQPK+GHLK+LH  +   EK +  G  +     NS+ +T + FN  
Sbjct  307   SYDYNALLDEYGNLNQPKWGHLKQLHASIKLGEKILTNGTRSDQNFGNSVTLTKF-FNPT  365

Query  356   -GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
              G + CF SN++   DATI+ Q    Y VPAWSVSIL  C +EVYNTA+VN+QT++ VKE
Sbjct  366   TGERFCFLSNTDGKNDATIDLQADGKYFVPAWSVSILDGCNKEVYNTAKVNSQTSMFVKE  425

Query  530   GG-KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDD  703
                K    L W+W PE   DT L G G+F AN +L+QK V  D SDY WYMT+V+ +   
Sbjct  426   KNEKENVQLSWAWAPEPMKDT-LQGNGKFAANLLLEQKRVTVDFSDYFWYMTNVDTNGTS  484

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASI  874
              +  +++ L VN  G VLHV+ N +Y+ SQW +N    +FE  I L    N +TLLSA++
Sbjct  485   SL--QNVTLQVNTKGHVLHVFVNKRYIGSQWGSNGKSFVFEKPILLKSRTNTITLLSATV  542

Query  875   GFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSR  1054
             G +NY  ++D+   G+ G  I    GD  V  +L S+ WSYKVGL GE  +++      R
Sbjct  543   GLKNYDAFYDMVPTGIDGGPIY-LIGDGNVTTDLSSNLWSYKVGLNGEMKQIYNPMFSQR  601

Query  1055  SASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
               + W++ +     RRMTWYKTSFK PAG DPVV+D+ GMGKG AWVN  ++GR+W    
Sbjct  602   --TNWIALNQKSIGRRMTWYKTSFKTPAGIDPVVLDMQGMGKGQAWVNEKSIGRFWPSFI  659

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
              G+D  +  CDYRG YN +KC+ NCGNP+QR+YHVPRSFL+    N L+LFEE GGN  +
Sbjct  660   AGNDSCSATCDYRGAYNPSKCVGNCGNPSQRWYHVPRSFLSSN-TNTLILFEEIGGNPQQ  718

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V  QT+    +C +A E    E+SCQGG  I+ I++A++G+       G  K       +
Sbjct  719   VSVQTITIRTICGNANEGSTLELSCQGGHVISEIQFASYGNP--GGKCGSFKQGSWDVTN  776

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +   ++ AC+G  SCS+      FG  + A + + +L V+A+C
Sbjct  777   SALFVEKACIGMESCSIDVFAKSFGLGD-ATNLSARLAVQALC  818



>ref|XP_008464891.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=824

 Score =   527 bits (1357),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 283/586 (48%), Positives = 382/586 (65%), Gaps = 27/586 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDP+RTAED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  250   TENWVGWFKKWGDKDPHRTAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDY+APLDEYGNLNQPK+GHLK+LH+ +   EK  +  N T +  D    VT+  F+  
Sbjct  310   SYDYDAPLDEYGNLNQPKWGHLKQLHSSIKLGEK--ILTNGTQSNQDYGASVTLTKFSNP  367

Query  356   --GTKTCFFSNSNETADATINYQGTD--YKVPAWSVSILPDCKREVYNTARVNTQTTVMV  523
               G + CF SN+N + DATI+ Q TD  Y VPAWSV+IL  C +E+YNTA++N+QT+  V
Sbjct  368   STGERFCFLSNTNGSNDATIDLQ-TDGKYFVPAWSVTILDGCNKEIYNTAKINSQTSKFV  426

Query  524   KEGG-KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDK  697
             KE   K  A L W+W PE   DT L GKG+F AN++L+QK    D SDY+WYMT V  + 
Sbjct  427   KEQNEKNNAKLLWTWTPEPMKDT-LQGKGKFKANRLLEQKGTTIDASDYLWYMTHVKTNA  485

Query  698   DDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSA  868
                +  + + L V+  G VLH + N +Y+ SQW +N    +FE  I L   KN++TLLSA
Sbjct  486   TFSL--RYVSLQVHTKGHVLHAFVNKRYIGSQWKSNGQSFVFEKPILLKSRKNIITLLSA  543

Query  869   SIGFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             ++G  NYG ++D    G+ G  + ++   GD  V  +L S+ WSYKVGL GE  KL+ ++
Sbjct  544   TVGLNNYGAFYDTVPTGIDGGPIHLI---GDGNVTIDLSSNLWSYKVGLNGEMKKLYDAT  600

Query  1043  NKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
                ++  + L+      RRMTWYKT+FK P+G D V +D+ GMGKG AWVNG ++GR+W 
Sbjct  601   FSQKTKWRALNKK-SIGRRMTWYKTNFKTPSGTDSVALDMQGMGKGQAWVNGVSIGRFWP  659

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                 G+D  +  CDYRGEYN NKC  NCG+P+QR+YHVPRSFL+    N L+LFEE GGN
Sbjct  660   SFISGNDNCSAKCDYRGEYNPNKCADNCGSPSQRWYHVPRSFLSND-TNTLILFEELGGN  718

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcgg  1582
               +V  QT+    +C +AYE    E+SC  GR I+ I++A++G+       G  +     
Sbjct  719   PQQVSIQTIALRTICGNAYEGSTLELSCTKGRIISEIQFASYGNPE--GKCGSFEKGSWD  776

Query  1583  AKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               ++  ++K  C+G  +C++  S   FG  N   +   +LVV+A+C
Sbjct  777   VTNSTFLVKKTCIGMENCTIDVSARFFGVENTT-NLPARLVVQALC  821



>ref|XP_008451143.1| PREDICTED: beta-galactosidase 15-like [Cucumis melo]
Length=940

 Score =   530 bits (1365),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 279/584 (48%), Positives = 375/584 (64%), Gaps = 23/584 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYR+AED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  366   TENWVGWFKKWGDKDPYRSAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  425

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +     +  K+ + I +T ++    
Sbjct  426   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKMGEKILTNSTRSDQKISSFITLTKFSNPTT  485

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK-E  529
             G + CF SN++   DATI+ Q    Y VPAWSVSIL  C +EV+NTA++N+QT++ VK +
Sbjct  486   GERFCFLSNTDNKNDATIDLQADGKYFVPAWSVSILDSCNKEVFNTAKINSQTSMFVKVQ  545

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K  A   W W PE   DT L GKG F AN +L+QK    D SDY+WYMT  N+D +  
Sbjct  546   NKKENAQFSWVWAPEPMRDT-LQGKGTFKANLLLEQKGTTVDFSDYLWYMT--NIDSNTT  602

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASIG  877
                +++ L VN  G +LH + N +Y+ SQW NN    +FE  I +  G N +TLLSA++G
Sbjct  603   SSLQNITLQVNTKGHMLHAFVNRRYIGSQWRNNGQSFVFEKPILIKPGTNTITLLSATVG  662

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
              +NY  ++D    G+ G  I    GD  V  +L S+ WSYKVGL GE  +L+      R+
Sbjct  663   LKNYDAFYDTVPTGIDGGPIY-LIGDGNVTIDLSSNLWSYKVGLNGEMKQLYNPVFSQRT  721

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               + + +     RRMTWYKTSFK P G DPV +D+ GMGKG AWVNG ++GR+W     G
Sbjct  722   NWREI-NQKSIGRRMTWYKTSFKTPPGTDPVTLDMQGMGKGQAWVNGQSIGRFWPSFIAG  780

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +D  +  CDYRG YN +KC+ NCGNP+QR+YH+PRSFL+    N L+LFEE GGN  +V 
Sbjct  781   NDSCSTTCDYRGAYNPSKCVENCGNPSQRWYHIPRSFLS-DDTNTLILFEEIGGNPQQVS  839

Query  1418  FQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAV  1597
              QT+  G +C +A E    E+SCQGG  I+ I++A++G+       G       G+ D +
Sbjct  840   VQTITIGTICGNANEGSTLELSCQGGHIISEIQFASYGNPE-----GKCGSFKQGSWDVI  894

Query  1598  N---ILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             N   +++  C+G  SCS+  S   FG  +   + + +L ++A+C
Sbjct  895   NSAILVEKICIGMESCSIDVSAKSFGLGDVT-NLSARLAIQALC  937



>gb|KGN56996.1| hypothetical protein Csa_3G147790 [Cucumis sativus]
Length=737

 Score =   522 bits (1344),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 265/586 (45%), Positives = 364/586 (62%), Gaps = 22/586 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+W GWFK WG +DPYRTAEDLA++VARFFQ GG+  NYYMYHGGTNFGR+AGGPYITT
Sbjct  161   TESWAGWFKGWGERDPYRTAEDLAFAVARFFQYGGSLHNYYMYHGGTNFGRSAGGPYITT  220

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGN+NQPK+GHLK+LH ++ S+EK + YG++      +S   T Y + G 
Sbjct  221   SYDYNAPLDEYGNMNQPKWGHLKQLHELIRSMEKVLTYGDVKHIDTGHSTTATSYTYKGK  280

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE-G  532
              +CFF N  E +D  I +Q   Y VP WSV++LPDCK EVYNTA+VNTQTT+  MV    
Sbjct  281   SSCFFGNP-ENSDREITFQERKYTVPGWSVTVLPDCKTEVYNTAKVNTQTTIREMVPSLV  339

Query  533   GKAAAALRWSWRPEVADDTILHGK---GQFTANQILDQK-VANDVSDYIWYMTSVNLDKD  700
             GK    L+W WR E  +     G       TAN ++DQK V ND SDY+WY+T  +L+ +
Sbjct  340   GKHKKPLKWQWRNEKIEHLTHEGDISGSAITANSLIDQKMVTNDSSDYLWYLTGFHLNGN  399

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLS  865
             DP++ K + L V   G +LH + N K++ +Q+     +   ++     L HG N + LLS
Sbjct  400   DPLFGKRVTLRVKTRGHILHAFVNNKHIGTQFGPYGKYSFTLEKKVRNLRHGFNQIALLS  459

Query  866   ASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             A++G  NYG Y++    G+YG VE++    D    ++L +++W YKVGL GE+ + F   
Sbjct  460   ATVGLPNYGAYYENVEVGIYGPVELI---ADGKTIRDLSTNEWIYKVGLDGEKYEFFDPD  516

Query  1043  NKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
             +K R    WLS++LP  +  TWYKTSF  P GR+ VVVDLMGMGKG AWVNG ++GRYW 
Sbjct  517   HKFRKP--WLSNNLPLNQNFTWYKTSFSTPKGREGVVVDLMGMGKGQAWVNGKSIGRYWP  574

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                  ++  + +CDYRG Y  +KC +NCG PTQR+YH+PRS++N   +N L+LFEE GG 
Sbjct  575   SYLATENGCSSSCDYRGAYYGSKCATNCGKPTQRWYHIPRSYMNDGKENTLILFEEFGGM  634

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcgg  1582
                +  +T R   VCA        E++C   R +  I +  FG+ +              
Sbjct  635   PLNIEIKTTRVKKVCAKVDLGSKLELTCH-DRTVKRIIFVGFGNPK--GNCNNFHKGSCH  691

Query  1583  AKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + +A ++++  CL K  CS+  ++   G T C   +   L V+  C
Sbjct  692   SSEAFSVIEKECLWKRKCSIEVTKDKLGLTGCKNPKDNWLAVQVSC  737



>ref|XP_006475096.1| PREDICTED: beta-galactosidase 7-like [Citrus sinensis]
Length=832

 Score =   524 bits (1349),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 283/597 (47%), Positives = 375/597 (63%), Gaps = 38/597 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RTAEDLA+SVARFFQ GG   NYYMYHGGTNFGRTAGGPYI T
Sbjct  249   TENWTGWFKLWGGRDPQRTAEDLAFSVARFFQTGGVLNNYYMYHGGTNFGRTAGGPYIAT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK    G + T  +   + +T +     
Sbjct  309   SYDYNAPLDEYGNLNQPKWGHLKQLHEAIKQAEKFFTDGIVETKNISTYVNLTQFTVKAT  368

Query  356   GTKTCFFSNSNETADATINYQGTDYK--VPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
             G + C  SN + T D T +  G D K  VPAWSV+ L  C  EVYNTA++NTQ +VMV +
Sbjct  369   GERFCMLSNGDNTGDYTADL-GPDGKFFVPAWSVTFLQGCTEEVYNTAKINTQRSVMVNK  427

Query  530   GG---KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDK  697
                  +  A L W+W PE   DT L G G+F A ++LDQK A+ D SDY+WYMT V+  K
Sbjct  428   HSHENEKPAKLAWAWTPEPIQDT-LDGNGKFKAARLLDQKEASGDGSDYLWYMTRVDT-K  485

Query  698   DDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNI--------------KLN  835
             D  + +  +R+   G G  LH Y NG+ + +Q++  +  +  +               L 
Sbjct  486   DMSLENATLRVSTKGHG--LHAYVNGQLIGTQFSRQATGQQMVTGDDYSFGFDKAVSSLK  543

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLY-GVEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
              G N+++LLS ++G  NYG ++DL   GL  G  ++ + G + +  +   ++WSYKVGL 
Sbjct  544   KGVNVISLLSVTVGLTNYGAFYDLHPTGLVEGSVLLREKGKDII--DATGYEWSYKVGLN  601

Query  1013  GEENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             GE    +  ++K+ +   W    +P  R MTWYKTSFK P G++ VVVDL+GMGKG AWV
Sbjct  602   GEAQHFYDPNSKNVN---WSCTDVPKDRPMTWYKTSFKTPPGKEAVVVDLLGMGKGHAWV  658

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   +A+   C    C+YRG Y ++KC +NCGNP+QR+YHVPRSFLN+  DN
Sbjct  659   NGRSIGRYWPTQIAETSGCDPH-CNYRGTYKDDKCRTNCGNPSQRWYHVPRSFLNKNADN  717

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgsc  1549
              L+LFEE GG    V FQ V  G VCA+A E    E+ CQG R I+ I++A+FGD R   
Sbjct  718   TLILFEEVGGAPWNVTFQVVTVGTVCANAQEGNKVELRCQGHRKISEIQFASFGDPR--G  775

Query  1550  gggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               G        A   V++++  CLGK SCS+  S+S FG ++  G+ T +L V+AVC
Sbjct  776   TCGSFSVGNHQADQTVSVVEKLCLGKPSCSIEVSQSTFGHSSL-GNLTSRLAVQAVC  831



>ref|XP_006452851.1| hypothetical protein CICLE_v10010541mg [Citrus clementina]
 gb|ESR66091.1| hypothetical protein CICLE_v10010541mg [Citrus clementina]
Length=832

 Score =   524 bits (1349),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 283/597 (47%), Positives = 376/597 (63%), Gaps = 38/597 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RTAEDLA+SVARFFQ GG   NYYMYHGGTNFGRTAGGPYI T
Sbjct  249   TENWTGWFKLWGGRDPQRTAEDLAFSVARFFQSGGVLNNYYMYHGGTNFGRTAGGPYIAT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK    G + T  +   + +T +  N  
Sbjct  309   SYDYNAPLDEYGNLNQPKWGHLKQLHEAIKEAEKFFTGGIVETKNISTYVNLTQFTVNAT  368

Query  356   GTKTCFFSNSNETADATINYQGTDYK--VPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
             G + C  SN + T D T +  G D K  VPAWSV+ L  C  EVYNTA++NTQ +VMV +
Sbjct  369   GERFCMLSNGDNTGDYTADL-GPDGKFFVPAWSVTFLQGCTEEVYNTAKINTQRSVMVNK  427

Query  530   GG---KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDK  697
                  +  A L W+W PE   DT L G G+F A ++LDQK A+ D SDY+WYMT V+  K
Sbjct  428   HSHENEKPAKLTWAWTPEPIQDT-LDGNGKFKAARLLDQKEASGDGSDYLWYMTRVDT-K  485

Query  698   DDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNI--------------KLN  835
             D  + +  +R+   G G  LH Y NG+ + +Q++  +  +  +               L 
Sbjct  486   DMSLENATLRVSTKGHG--LHAYVNGQLIGTQFSRQATGQQMVTGDDYSFGFDKAVSSLK  543

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLY-GVEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
              G N+++LLS ++G  NYG ++DL   GL  G  ++ + G + +  +   ++WSYKVGL 
Sbjct  544   KGVNVISLLSVTVGLTNYGAFYDLHPTGLVEGSVLLREKGKDMI--DATGYEWSYKVGLN  601

Query  1013  GEENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             GE    +  ++K+ +   W    +P  R MTWYKTSFK P G++ VVVDL+GMGKG AWV
Sbjct  602   GEAQHFYDPNSKNVN---WSCTDVPKDRPMTWYKTSFKTPPGKEAVVVDLLGMGKGHAWV  658

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   +A+   C    C+YRG Y ++KC +NCGNP+QR+YHVPRSFLN+  DN
Sbjct  659   NGRSIGRYWPTQIAETSGCDPH-CNYRGTYKDDKCRTNCGNPSQRWYHVPRSFLNKNADN  717

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgsc  1549
              L+LFEE GG    V FQ V  G VCA+A+E    E+ CQG R I+ I++A+FGD     
Sbjct  718   TLILFEEVGGAPWNVTFQVVTVGTVCANAHEGNKVELRCQGHRKISEIQFASFGDP--LG  775

Query  1550  gggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               G        A   V++++  CLGK SCS+  S+S FG ++  G+ T +L V+AVC
Sbjct  776   TCGSFSVGNHQADQTVSVVEKLCLGKPSCSIEVSQSTFGHSSL-GNLTSRLAVQAVC  831



>ref|XP_004170120.1| PREDICTED: beta-galactosidase 7-like, partial [Cucumis sativus]
Length=706

 Score =   520 bits (1338),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 266/592 (45%), Positives = 365/592 (62%), Gaps = 22/592 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+W GWFK WG +DPYRTAEDLA++VARFFQ GG+  NYYMYHGGTNFGR+AGGPYITT
Sbjct  72    TESWAGWFKGWGERDPYRTAEDLAFAVARFFQYGGSLHNYYMYHGGTNFGRSAGGPYITT  131

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGN+NQPK+GHLK+LH ++ S+EK + YG++      +S   T Y + G 
Sbjct  132   SYDYNAPLDEYGNMNQPKWGHLKQLHELIRSMEKVLTYGDVKHIDTGHSTTATSYTYKGK  191

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE-G  532
              +CFF N  E +D  I +Q   Y VP WSV++LPDCK EVYNTA+VNTQTT+  MV    
Sbjct  192   SSCFFGNP-ENSDREITFQERKYTVPGWSVTVLPDCKTEVYNTAKVNTQTTIREMVPSLV  250

Query  533   GKAAAALRWSWRPEVADDTILHGK---GQFTANQILDQK-VANDVSDYIWYMTSVNLDKD  700
             GK    L+W WR E  +     G       TAN ++DQK V ND SDY+WY+T  +L+ +
Sbjct  251   GKHKKPLKWQWRNEKIEHLTHEGDISGSAITANSLIDQKMVTNDSSDYLWYLTGFHLNGN  310

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLS  865
             DP++ K + L V   G +LH + N K++ +Q+     +   ++     L HG N + LLS
Sbjct  311   DPLFGKRVTLRVKTRGHILHAFVNNKHIGTQFGPYGKYSFTLEKKVRNLRHGFNQIALLS  370

Query  866   ASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             A++G  NYG Y++    G+YG VE++    D    ++L +++W YKVGL GE+ + F   
Sbjct  371   ATVGLPNYGAYYENVEVGIYGPVELI---ADGKTIRDLSTNEWIYKVGLDGEKYEFFDPD  427

Query  1043  NKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
             +K R    WLS++LP  +  TWYKTSF  P GR+ VVVDLMGMGKG AWVNG ++GRYW 
Sbjct  428   HKFRKP--WLSNNLPLNQNFTWYKTSFSTPKGREGVVVDLMGMGKGQAWVNGKSIGRYWP  485

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                  ++  + +CDYRG Y  +KC +NCG PTQR+YH+PRS++N   +N L+LFEE GG 
Sbjct  486   SYLATENGCSSSCDYRGAYYGSKCATNCGKPTQRWYHIPRSYMNDGKENTLILFEEFGGM  545

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcgg  1582
                +  +T R   VCA        E++C   R +  I +  FG+ +              
Sbjct  546   PLNIEIKTTRVKKVCAKVDLGSKLELTCH-DRTVKRIIFVGFGNPK--GNCNNFHKGSCH  602

Query  1583  AKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC*FKLFC  1738
             + +A ++++  CL K  CS+  ++   G T C   +   L V+     K  C
Sbjct  603   SSEAFSVIEKECLWKRKCSIEVTKDKLGLTGCKNPKDNWLAVQPFWHHKSHC  654



>ref|XP_004134448.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
sativus]
Length=803

 Score =   522 bits (1345),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 265/586 (45%), Positives = 364/586 (62%), Gaps = 22/586 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+W GWFK WG +DPYRTAEDLA++VARFFQ GG+  NYYMYHGGTNFGR+AGGPYITT
Sbjct  227   TESWAGWFKGWGERDPYRTAEDLAFAVARFFQYGGSLHNYYMYHGGTNFGRSAGGPYITT  286

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGN+NQPK+GHLK+LH ++ S+EK + YG++      +S   T Y + G 
Sbjct  287   SYDYNAPLDEYGNMNQPKWGHLKQLHELIRSMEKVLTYGDVKHIDTGHSTTATSYTYKGK  346

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE-G  532
              +CFF N  E +D  I +Q   Y VP WSV++LPDCK EVYNTA+VNTQTT+  MV    
Sbjct  347   SSCFFGNP-ENSDREITFQERKYTVPGWSVTVLPDCKTEVYNTAKVNTQTTIREMVPSLV  405

Query  533   GKAAAALRWSWRPEVADDTILHGK---GQFTANQILDQK-VANDVSDYIWYMTSVNLDKD  700
             GK    L+W WR E  +     G       TAN ++DQK V ND SDY+WY+T  +L+ +
Sbjct  406   GKHKKPLKWQWRNEKIEHLTHEGDISGSAITANSLIDQKMVTNDSSDYLWYLTGFHLNGN  465

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLS  865
             DP++ K + L V   G +LH + N K++ +Q+     +   ++     L HG N + LLS
Sbjct  466   DPLFGKRVTLRVKTRGHILHAFVNNKHIGTQFGPYGKYSFTLEKKVRNLRHGFNQIALLS  525

Query  866   ASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             A++G  NYG Y++    G+YG VE++    D    ++L +++W YKVGL GE+ + F   
Sbjct  526   ATVGLPNYGAYYENVEVGIYGPVELI---ADGKTIRDLSTNEWIYKVGLDGEKYEFFDPD  582

Query  1043  NKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
             +K R    WLS++LP  +  TWYKTSF  P GR+ VVVDLMGMGKG AWVNG ++GRYW 
Sbjct  583   HKFRKP--WLSNNLPLNQNFTWYKTSFSTPKGREGVVVDLMGMGKGQAWVNGKSIGRYWP  640

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                  ++  + +CDYRG Y  +KC +NCG PTQR+YH+PRS++N   +N L+LFEE GG 
Sbjct  641   SYLATENGCSSSCDYRGAYYGSKCATNCGKPTQRWYHIPRSYMNDGKENTLILFEEFGGM  700

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcgg  1582
                +  +T R   VCA        E++C   R +  I +  FG+ +              
Sbjct  701   PLNIEIKTTRVKKVCAKVDLGSKLELTCH-DRTVKRIIFVGFGNPK--GNCNNFHKGSCH  757

Query  1583  AKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + +A ++++  CL K  CS+  ++   G T C   +   L V+  C
Sbjct  758   SSEAFSVIEKECLWKRKCSIEVTKDKLGLTGCKNPKDNWLAVQVSC  803



>ref|XP_008459141.1| PREDICTED: beta-galactosidase 15-like [Cucumis melo]
Length=824

 Score =   522 bits (1345),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 281/584 (48%), Positives = 383/584 (66%), Gaps = 23/584 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDP+RTAED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  250   TENWVGWFKKWGDKDPHRTAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDY+APLDEYG+LNQPK+GHLK+LH  +   EK +  G  +      S+ +T ++    
Sbjct  310   SYDYDAPLDEYGSLNQPKWGHLKQLHASIKLGEKILTNGTRSNQDYGGSVTLTKFSNPST  369

Query  356   GTKTCFFSNSNETADATINYQGTD--YKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
             G + CF SN+N + DATI+ Q TD  Y VPAWSV+IL  C +EVYNTA+VN+QT+  VKE
Sbjct  370   GERFCFLSNTNGSNDATIDLQ-TDGKYFVPAWSVTILDGCNKEVYNTAKVNSQTSKFVKE  428

Query  530   GG-KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDD  703
                K  A L W+W PE   DT L GKG+F AN++L+QK    D SDY+WYMT +  +   
Sbjct  429   QNEKNNAKLLWTWTPEPMKDT-LQGKGKFKANRLLEQKGTTVDASDYLWYMTHIETNATF  487

Query  704   PIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASI  874
              +  +++ L V+  G VLH + N +Y+ SQW ++    +FE  I L   KN++TLLSA++
Sbjct  488   SL--RNVSLQVSTKGHVLHAFVNKRYIGSQWKSDGQSFVFEKPILLKPRKNIITLLSATV  545

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G  NYG ++D    G+ G  + ++G  G+ TV  +L S+ WSYKVGL GE  KL+  +  
Sbjct  546   GLNNYGAFYDTVPTGIDGGPIYLIG-GGNVTV--DLSSNLWSYKVGLNGEMKKLYDPTFS  602

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL  1228
              +   + L+      RRMTWYKT+FK P+G +PV +D+ GMGKG AWVNG ++GR+W   
Sbjct  603   QKKKWRALNKK-SIGRRMTWYKTNFKTPSGTNPVALDMQGMGKGQAWVNGVSIGRFWPSF  661

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
               G+D  +  CDYRG YN  KC  NCGNP+QR+YHVPRSFL+    N L+LFEE GGN  
Sbjct  662   ISGNDSCSANCDYRGGYNPKKCADNCGNPSQRWYHVPRSFLSND-TNTLILFEEIGGNPQ  720

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
             +V  QT+  G +C +AYE    E+SCQ GR I+ I++A++G+       G  K       
Sbjct  721   QVSIQTIALGTICGNAYEGSTLELSCQEGRIISEIQFASYGNP--DGKCGSFKKGSWDVT  778

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++  +++  C+G  +C++  S   FG  N A + + +L V+A+C
Sbjct  779   NSTVLVEKTCVGVENCTIDVSARFFGVEN-ATNLSARLAVQALC  821



>gb|KDO73840.1| hypothetical protein CISIN_1g046585mg, partial [Citrus sinensis]
Length=810

 Score =   520 bits (1339),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 282/597 (47%), Positives = 374/597 (63%), Gaps = 38/597 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RTAEDLA+SVARFFQ GG   NYYMYHGGTNFGRTAGGPYI T
Sbjct  227   TENWTGWFKLWGGRDPQRTAEDLAFSVARFFQSGGVLNNYYMYHGGTNFGRTAGGPYIAT  286

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK    G + T  +   + +T +     
Sbjct  287   SYDYNAPLDEYGNLNQPKWGHLKQLHEAIKQAEKFFTDGIVETKNISTYVNLTQFTVKAT  346

Query  356   GTKTCFFSNSNETADATINYQGTDYK--VPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
             G + C  SN + T D T +  G D K  VPAWSV+ L  C  EVYNTA++NTQ +VMV +
Sbjct  347   GERFCMLSNGDNTGDYTADL-GPDGKFFVPAWSVTFLQGCTEEVYNTAKINTQRSVMVNK  405

Query  530   GG---KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDK  697
                  +  A L W+W PE   DT L G G+F A ++LDQK A+ D SDY+WYMT V+  K
Sbjct  406   HSHENEKPAKLAWAWTPEPIQDT-LDGNGKFKAARLLDQKEASGDGSDYLWYMTRVDT-K  463

Query  698   DDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNI--------------KLN  835
             D  + +  +R+   G G  LH Y NG+ + +Q++  +  +  +               L 
Sbjct  464   DMSLENATLRVSTKGHG--LHAYVNGQLIGTQFSRQATGQQMVTGDDYSFGFDKAVSSLK  521

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLY-GVEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
              G N+++LLS ++G  NYG ++DL   GL  G  ++ + G + +  +   ++WSYKVGL 
Sbjct  522   KGVNVISLLSVTVGLTNYGAFYDLHPTGLVEGSVLLREKGKDII--DATGYEWSYKVGLN  579

Query  1013  GEENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             GE    +  ++K+ +   W    +P  R MTWYKTSFK P G++ VVVDL+GMGKG AWV
Sbjct  580   GEAQHFYDPNSKNVN---WSCTDVPKDRPMTWYKTSFKTPPGKEAVVVDLLGMGKGHAWV  636

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   +A+   C    C+YRG Y ++KC +NCGNP+QR+YHVPRSFLN+  DN
Sbjct  637   NGRSIGRYWPTQIAETSGCDPH-CNYRGTYKDDKCRTNCGNPSQRWYHVPRSFLNKNADN  695

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgsc  1549
              L+LFEE GG    V FQ V  G VCA+A E    E+ CQG R I+ I++A+FGD     
Sbjct  696   TLILFEEVGGAPWNVTFQVVTVGTVCANAQEGNKVELRCQGHRKISEIQFASFGDP--LG  753

Query  1550  gggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               G        A   V++++  CLGK SCS+  S+S FG ++  G+ T +L V+AVC
Sbjct  754   TCGSFSVGNHQADQTVSVVEKLCLGKPSCSIEVSQSTFGHSSL-GNLTSRLAVQAVC  809



>ref|XP_008439370.1| PREDICTED: beta-galactosidase 7-like [Cucumis melo]
Length=829

 Score =   519 bits (1337),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 263/586 (45%), Positives = 368/586 (63%), Gaps = 22/586 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE+W GWFK WG +DPYRTAEDLA++VARFFQ GG+  NYYMYHGGTNFGR+AGGPYITT
Sbjct  253   TESWAGWFKGWGQRDPYRTAEDLAFAVARFFQYGGSLHNYYMYHGGTNFGRSAGGPYITT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGN+NQPK+GHLK+LH ++ S+EK + YG++   +  +    T Y + G 
Sbjct  313   SYDYNAPLDEYGNMNQPKWGHLKQLHELVKSMEKVLTYGDVKHIEYGHLTTATSYTYKGK  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE-G  532
              +CFF N+ E ++  I ++  +Y VP WSV++LPDCK EVYNTA+VNTQTT+  MV    
Sbjct  373   SSCFFGNA-ENSNREITFRKRNYTVPGWSVTVLPDCKTEVYNTAKVNTQTTIREMVPSLV  431

Query  533   GKAAAALRWSWRPEVADDTILHGKGQ---FTANQILDQK-VANDVSDYIWYMTSVNLDKD  700
             GK    L+W WR E  +     G       TAN +LDQK V ND SDY+WY+T  +L+ +
Sbjct  432   GKYKKPLKWQWRNEKIEHITHEGDISGVALTANSLLDQKIVTNDTSDYLWYLTGFHLNGN  491

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIK-----LNHGKNLLTLLS  865
             DP++ K ++L V   G +LH + N K++ +Q+     +   ++     L HG N + LLS
Sbjct  492   DPLFGKRVKLRVKTRGHILHAFFNNKHIGTQFGPYGKYSFTLEKKVRNLRHGFNQIALLS  551

Query  866   ASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             A++G  NYG Y++    G++G VE++    D    ++L +++W YKVGL GE+ + F   
Sbjct  552   ATVGLPNYGAYYENVEVGIHGPVELI---ADGKTIRDLSTNEWVYKVGLDGEKYEFFDPD  608

Query  1043  NKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
             +K R    WLS++LP  +  TWYKTSF+ P GR+ VVVDLMGMGKG AWVNG ++GRYW 
Sbjct  609   HKFRKP--WLSNNLPLNQNFTWYKTSFQTPKGREGVVVDLMGMGKGQAWVNGKSIGRYWP  666

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                  ++  + +CDYRG Y  +KC +NCG PTQR+YH+PRS++N   +N L+LFEE GG 
Sbjct  667   SYLATENGCSSSCDYRGAYYGSKCATNCGKPTQRWYHIPRSYMNDGKENTLILFEEFGGM  726

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcgg  1582
                +  +T R   VCA        E++C   R +  I +  FG+ +              
Sbjct  727   PLNIEIKTTRVTKVCAKVELGSKLELTCH-DRTVKRIIFVGFGNPK--GNCDNFHKGSCD  783

Query  1583  AKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +  A ++++  CL K  CS+ A++   G T C   +   L V+  C
Sbjct  784   SSSAFSVIEKECLWKRKCSIEATKDKLGLTGCKNPKDNWLAVQVSC  829



>ref|XP_004157296.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
sativus]
Length=813

 Score =   518 bits (1333),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 274/582 (47%), Positives = 373/582 (64%), Gaps = 19/582 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYR+ ED+A++VARFFQ GG F NYYMYHGGTNFGRTAGGP+ITT
Sbjct  237   TENWVGWFKKWGDKDPYRSPEDVAFAVARFFQSGGVFNNYYMYHGGTNFGRTAGGPFITT  296

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +     +  KL + + +T ++   +
Sbjct  297   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKMGEKILTNSTRSDQKLXSFVTLTKFSNPTS  356

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK-E  529
             G + CF SN++   DATI+ Q    Y VPAWSVSIL  C +EV+NTA++N+QT++ VK +
Sbjct  357   GERFCFLSNTDNKNDATIDLQADGKYFVPAWSVSILDGCNKEVFNTAKINSQTSMFVKVQ  416

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K  A   W W PE   DT L GKG F AN +L+QK    D SDY+WYMT  N+D +  
Sbjct  417   NKKENAQFSWVWAPEPMRDT-LQGKGTFKANLLLEQKGTTVDFSDYLWYMT--NIDSNAT  473

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASIG  877
                +++ L VN  G +LH + N +Y+ SQW +N    +F   I +  G N +TLLSA++G
Sbjct  474   SSLQNVTLQVNTKGHMLHAFVNRRYIGSQWRSNGQSFVFXKPILIKPGTNTITLLSATVG  533

Query  878   FQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
              +NY  ++D    G+ G  I    GD  V+ +L S+ WSYKVGL GE  +L+      R 
Sbjct  534   LKNYDAFYDTVPTGIDGGPIY-LIGDGNVKIDLSSNLWSYKVGLNGEMKQLYNPVFSQR-  591

Query  1058  ASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              + W + +     RRMT YKT+FK P+G DPV +D+ GMGKG AWVNG ++GR+W     
Sbjct  592   -TNWSTINQKSIGRRMTLYKTNFKTPSGIDPVTLDMQGMGKGQAWVNGQSIGRFWPSFIA  650

Query  1235  GDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRV  1414
             G+D  +  CDYRG YN +KC+ NCGNP+QR+YH+PRSFL+    N LVLFEE GGN  +V
Sbjct  651   GNDSCSTTCDYRGAYNPSKCVENCGNPSQRWYHIPRSFLSDD-TNTLVLFEEIGGNPQQV  709

Query  1415  RFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDA  1594
               QT+  G +C +A E    E+SCQGG  I+ I++A++G+       G  K       ++
Sbjct  710   SVQTITIGTICGNANEGSTLELSCQGGHIISEIQFASYGNPE--GKCGSFKQGSWHVINS  767

Query  1595  VNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
               +++  C+G  SCS+  S   FG  +   + + +L ++A+C
Sbjct  768   AILVEKLCIGMESCSIDVSAKSFGLGDVT-NISARLAIQALC  808



>ref|XP_004139151.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
sativus]
Length=803

 Score =   517 bits (1332),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 283/590 (48%), Positives = 376/590 (64%), Gaps = 35/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYR+AED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  229   TENWVGWFKKWGDKDPYRSAEDVAFSVARFFQSGGVFNNYYMYHGGTNFGRTSGGPFITT  288

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEK--------NIVYGNITTTKLDNSIQV  337
             +YDYNAPLDEYGNLNQPK+GHLK+LH+ +   EK        N  +G+  T K   S  V
Sbjct  289   SYDYNAPLDEYGNLNQPKWGHLKQLHSSIKLGEKILTNGTHSNKTFGSFVTFKTFGSF-V  347

Query  338   TVYAFNGTKT----CFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNT  505
             T+  F+   T    CF SN+ + AD         Y VPAWSVSI+  CK+EV+NTA++N+
Sbjct  348   TLTKFSNPTTKERFCFLSNTXK-ADG-------KYFVPAWSVSIIDGCKKEVFNTAKINS  399

Query  506   QTTVMVK-EGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMT  679
             QT++ VK +  K    L W W PE   DT L GKG F  N +L+QK    D SDY+WYMT
Sbjct  400   QTSIFVKVQNEKENVKLSWVWAPEAMSDT-LQGKGTFKENLLLEQKGTTIDSSDYLWYMT  458

Query  680   SVNLDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNL  850
             +V  +    I   ++ L VN  G VLH + N +Y+ SQW NN    +FE  I L  G N+
Sbjct  459   NVETNGTSSI--HNVTLQVNTKGHVLHAFVNTRYIGSQWGNNGQSFVFEKPILLKAGTNI  516

Query  851   LTLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
             +TLLSA++G +NY  ++D    G+ G  I    GD  V+ +L S+ WSYKVGL GE  +L
Sbjct  517   ITLLSATVGLKNYDAFYDTLPTGIDGGPIY-LIGDGNVKIDLSSNLWSYKVGLNGEIKQL  575

Query  1031  FRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
             +       ++   L+ +    RRMTWYKTSFK P+G DPV +D+ GMGKG AW+NG ++G
Sbjct  576   YNPVFSQETSWNTLNKN-SIGRRMTWYKTSFKTPSGIDPVTLDMQGMGKGEAWINGQSIG  634

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             R+W     G+D  +E CDYRG Y+ +KC+ NCGNP+QR+YH+PRSFL+    N LVLFEE
Sbjct  635   RFWPSFIAGNDNCSETCDYRGAYDPSKCVGNCGNPSQRWYHIPRSFLSNN-TNTLVLFEE  693

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekg  1570
              GG+  +V  QT+  G +C +A E    E+SCQG   I+ I++A++G+ +     G  K 
Sbjct  694   IGGSPQQVSVQTITIGTICGNANEGSTLELSCQGEYIISEIQFASYGNPK--GKCGSFKQ  751

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                   ++  +L+  C G  SCSV  S  +FG  + A + + +LVV+A+C
Sbjct  752   GSWDVTNSALLLEKTCKGMKSCSVDVSAKLFGLGD-AVNLSARLVVQALC  800



>ref|XP_004135782.1| PREDICTED: beta-galactosidase 7-like [Cucumis sativus]
Length=838

 Score =   517 bits (1332),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 273/584 (47%), Positives = 373/584 (64%), Gaps = 21/584 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDPYR+ ED+A++VARFFQ GG F NYYMYHGGTNFGRTAGGP+ITT
Sbjct  262   TENWVGWFKKWGDKDPYRSPEDVAFAVARFFQSGGVFNNYYMYHGGTNFGRTAGGPFITT  321

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +     +  K+ + + +T ++   +
Sbjct  322   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKMGEKILTNSTRSDQKISSFVTLTKFSNPTS  381

Query  356   GTKTCFFSNSNETADATINYQGTD---YKVPAWSVSILPDCKREVYNTARVNTQTTVMVK  526
             G + CF SN++   DATI+ Q        VPAWSVSIL  C +EV+NTA++N+QT++ VK
Sbjct  382   GERFCFLSNTDNKNDATIDLQADGKYFVPVPAWSVSILDGCNKEVFNTAKINSQTSMFVK  441

Query  527   -EGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKD  700
              +  K  A   W W PE   DT L GKG F AN +L+QK    D SDY+WYMT  N+D +
Sbjct  442   VQNKKENAQFSWVWAPEPMRDT-LQGKGTFKANLLLEQKGTTVDFSDYLWYMT--NIDSN  498

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSAS  871
                  +++ L VN  G +LH + N +Y+ SQW +N    +FE  I +  G N +TLLSA+
Sbjct  499   ATSSLQNVTLQVNTKGHMLHAFVNRRYIGSQWRSNGQSFVFEKPILIKPGTNTITLLSAT  558

Query  872   IGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
             +G +NY  ++D    G+ G  I    GD  V+ +L S+ WSYKVGL GE  +L+      
Sbjct  559   VGLKNYDAFYDTVPTGIDGGPIY-LIGDGNVKIDLSSNLWSYKVGLNGEMKQLYNPVFSQ  617

Query  1052  RSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL  1228
             R  + W + +     RRMTWYKTSFK P+G D V +D+ GMGKG AWVNG ++GR+W   
Sbjct  618   R--TNWSTINQKSIGRRMTWYKTSFKTPSGIDRVTLDMQGMGKGQAWVNGQSIGRFWPSF  675

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
                +D  +  CDYRG YN +KC+ NCGNP+QR+YH+PRSFL+    N LVLFEE GGN  
Sbjct  676   IASNDSCSTTCDYRGAYNPSKCVENCGNPSQRWYHIPRSFLS-DDTNTLVLFEEIGGNPQ  734

Query  1409  RVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAK  1588
             +V  QT+  G +C +A E    E+SCQGG  I+ I++A++G+       G  K       
Sbjct  735   QVSVQTITIGTICGNANEGSTLELSCQGGHIISEIQFASYGNPE--GKCGSFKQGSWHVI  792

Query  1589  DAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++  +++  C+G+ SCS+  S   FG  +   + + +L ++A+C
Sbjct  793   NSAILVEKLCIGRESCSIDVSAKSFGLGDVT-NLSARLAIQALC  835



>ref|XP_004171705.1| PREDICTED: beta-galactosidase 7-like [Cucumis sativus]
Length=826

 Score =   516 bits (1328),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 279/583 (48%), Positives = 374/583 (64%), Gaps = 20/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDP+RTAED+A+SVARFFQ GG   NYYMYHGGTNFGRT+GGP+ITT
Sbjct  251   TENWVGWFKKWGDKDPHRTAEDVAFSVARFFQSGGILNNYYMYHGGTNFGRTSGGPFITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN--  355
             +YDY+APLDEYGNLNQPK+GHLK+LH  +   EK  +  N T +  D    VT   F+  
Sbjct  311   SYDYDAPLDEYGNLNQPKWGHLKQLHASIKLGEK--ILTNSTRSDQDFGSSVTFTKFSNL  368

Query  356   --GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMV-  523
               G K CF SN++E  DA ++  G   Y +PAWSVSIL  C +E++NTA+V++QT++   
Sbjct  369   ETGEKFCFLSNADENNDAIVDMLGDRKYFLPAWSVSILDGCNKEIFNTAKVSSQTSLFFK  428

Query  524   KEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKD  700
             K+  K  A L W+W  E   DT L G G F AN +L+QK A  D SDY+WYMT+VN +  
Sbjct  429   KQNEKENAKLSWNWASEPMRDT-LQGYGTFKANLLLEQKGATIDSSDYLWYMTNVNSNTT  487

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSAS  871
               +  +++ L VN  G VLH + N +Y+ SQW +N    +FE  I+L  G N +TLLSA+
Sbjct  488   SSL--QNLTLQVNTKGHVLHAFINRRYIGSQWGSNGQSFVFEKPIQLKLGTNTITLLSAT  545

Query  872   IGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
             +G +NY  ++D    G+ G  I    GD  V  +L S+ WSYKVGL GE  +L+     +
Sbjct  546   VGLKNYDAFYDTVPTGIDGGPIY-LIGDGNVTTDLSSNLWSYKVGLNGERKQLYNPMFSN  604

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
             R+    L+      RRMTW+K +FK P+G DPVV+D+ GMGKG AWVNG ++GR+W    
Sbjct  605   RTKWSTLNKK-SIGRRMTWFKATFKTPSGTDPVVLDMQGMGKGQAWVNGRSIGRFWPSFI  663

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               +D  +E CDY+G YN NKC+ NCGN +QR+YH+PRSF+N    N L+LFEE GGN   
Sbjct  664   ASNDSCSETCDYKGSYNPNKCVRNCGNSSQRWYHIPRSFMN-DSINTLILFEEIGGNPQM  722

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V  QT+  G +C +A E    E+SCQGG  I+ I++A++G       G F+ G+    K 
Sbjct  723   VSVQTITIGTICGNANEGSTLELSCQGGHVISEIQFASYGHPE-GKCGSFQSGLWDVTKS  781

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                I++ AC+G  +CS+  S ++F  +  A     KL V+A+C
Sbjct  782   TTIIVEKACIGMKNCSIDISPNLFKLSKVAYPYA-KLAVQALC  823



>ref|XP_008447673.1| PREDICTED: beta-galactosidase 15-like [Cucumis melo]
Length=826

 Score =   513 bits (1322),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 276/583 (47%), Positives = 376/583 (64%), Gaps = 20/583 (3%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDP+RTAED+A+SVARFFQ GG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  251   TENWVGWFKKWGDKDPHRTAEDVAFSVARFFQSGGIFNNYYMYHGGTNFGRTSGGPFITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH  +   EK  +  N T +  + S  +T+  F+  
Sbjct  311   SYDYDAPLDEYGNLNQPKWGHLKQLHASIKLGEK--ILTNSTRSNQNFSSSITLTKFSNL  368

Query  362   KT----CFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK  526
             +T    CF SN +E  DA I+      Y +PAWSVSIL  C +EV+NTA+V +QT++  K
Sbjct  369   ETGEMFCFLSNVDENNDAIIDLLADRKYFLPAWSVSILDGCNKEVFNTAKVTSQTSIFFK  428

Query  527   EGG-KAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKD  700
             E   K  A L W+W  E   DT L G G   AN +L+QK    D SDY+WYMT+VN +  
Sbjct  429   EQNEKENAKLSWTWASEPMRDT-LQGYGTIKANLLLEQKGTTIDSSDYLWYMTNVNTNAT  487

Query  701   DPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSAS  871
               +  +++ L VN  G VLH + N +Y+ SQW +N    +FE  I+L  G N +TLLSA+
Sbjct  488   SSL--QNVTLQVNTKGHVLHAFINRRYIGSQWGSNGQSFVFEKPIQLKLGNNTITLLSAT  545

Query  872   IGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
             +G +NY  ++D    G+ G  I    GD  V  +L S+ WSYKVGL GE  +L+     +
Sbjct  546   VGLKNYDAFYDTVPTGIDGGPIY-LIGDGNVTTDLSSNLWSYKVGLNGERKQLYNPMFSN  604

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
             R+    L+      RRMTW+K +FK P+G DPVV+D+ GMGKG AWVNG ++GR+W    
Sbjct  605   RTKWNQLNKK-SIGRRMTWFKATFKTPSGTDPVVLDMQGMGKGQAWVNGRSIGRFWPSFI  663

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
               +D  +  CDY+G Y+ +KC+ NCGN +QR+YH+PRSF++    N L+LFEE GGN  R
Sbjct  664   ASNDSCSATCDYKGAYDPSKCVENCGNSSQRWYHIPRSFMSDDM-NTLILFEEIGGNPQR  722

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V  QT+  G +C +A E    E+SCQGG  I+ I++A++G       G F+ G+    K+
Sbjct  723   VSVQTITIGTICGNADEGSTLELSCQGGHIISQIQFASYGHPE-GKCGSFQPGLWDVTKN  781

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                +++ AC+G  +CS+  S ++F  +N AG  + KL V+A+C
Sbjct  782   TTIMVEKACIGMENCSIDVSPNLFEMSNVAGP-SAKLTVQALC  823



>ref|XP_002528629.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF33732.1| beta-galactosidase, putative [Ricinus communis]
Length=822

 Score =   511 bits (1315),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 278/597 (47%), Positives = 379/597 (63%), Gaps = 29/597 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF+ WG K+P+R+AED+A++VARFFQLGG+  NYYMYHGGTNFG T GGPYIT 
Sbjct  231   TENWTGWFQDWGQKNPHRSAEDVAFAVARFFQLGGSVMNYYMYHGGTNFGTTGGGPYITA  290

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKL--DNSIQVTVYAFN  355
             +YDY+APLDEYGNL QPK+GHL++LH+VL+S+E+ + YG    +    +N+I +T++A+ 
Sbjct  291   SYDYDAPLDEYGNLRQPKWGHLRDLHSVLNSMEQTLTYGESKNSNYPDNNNIFITIFAYQ  350

Query  356   GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG  535
             G ++CFFS S +  D TI+++GTDY +PAWSVSILPDC  EVYNTA VN QT++M  +  
Sbjct  351   GKRSCFFS-SIDYKDQTISFEGTDYFLPAWSVSILPDCFTEVYNTATVNVQTSIMENKAN  409

Query  536   KAAA-----ALRWSWRPEVADDTILHGK---GQFTANQILDQK-VANDVSDYIWYMTSVN  688
              A +     +L+W WRPE      L G        AN+++DQK V N  SDY+W MT+ +
Sbjct  410   AADSFREPNSLQWKWRPEKIRGLSLQGDFVGNTLVANELMDQKAVTNGTSDYLWIMTNYD  469

Query  689   LDKDDPIW--SKDMRLGVNGTGQVLHVYANGKYVDSQWNN------NSLFETNIKLNHGK  844
              + +D +W   KD+ L V+  G V+H + NGK+V SQ  +      + +FE+ IKL  G 
Sbjct  470   HNMNDSLWGAGKDIILQVHTNGHVVHAFVNGKHVGSQSASIESGRFDFVFESKIKLKRGI  529

Query  845   NLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKN---GDETVRKNLGSHKWSYKVGLR  1012
             N ++L+S S+G QNYG  FD    G+ G + I+G++       V  ++ S++W YK GL 
Sbjct  530   NRISLVSVSVGLQNYGANFDTAPTGINGPITIIGRSKLGNQPDVTVDISSNRWVYKTGLH  589

Query  1013  GEENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             GE+      + + R   Q+ + H+   +   WYKTSF AP G+DPVVVDL+G+GKG AWV
Sbjct  590   GEDQGF--QAVRPRHRRQFYTKHVLINQPFVWYKTSFNAPLGQDPVVVDLLGLGKGTAWV  647

Query  1193  NGNNLGRYWL-ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG N+GR+W   LA  D      C Y G Y   +C++ CG PTQR+YH+PR +L +  DN
Sbjct  648   NGRNIGRFWPKALAPDDGTCNAPCSYIGTYEPKQCVTGCGEPTQRYYHIPRDWL-KPEDN  706

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgsc  1549
             +LVLFEE GG    V  QTV  G VC   YE    E+SCQ GR  + I +A+FG  +G C
Sbjct  707   KLVLFEELGGTPDFVSVQTVTVGKVCVHGYEGHTVELSCQHGRKFSKITFASFGLPQGKC  766

Query  1550  gggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             G            D   I++ AC+GK  CS+  SE      +C  +R  +L VEAVC
Sbjct  767   GSFTPSNNHDCHADVSTIVEKACVGKERCSIDISEKALAPIHC-DARIYRLAVEAVC  822



>ref|XP_003612351.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95309.1| beta-galactosidase-like protein [Medicago truncatula]
Length=806

 Score =   508 bits (1309),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 274/586 (47%), Positives = 377/586 (64%), Gaps = 26/586 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+KWG + P+R+AED A+SVARFFQ GG   NYYMYHGGTNFGRTAGGPYITT
Sbjct  234   TENWIGWFQKWGERVPHRSAEDSAFSVARFFQNGGVLNNYYMYHGGTNFGRTAGGPYITT  293

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIV--YGNITTTKLDNSIQVTVYA-F  352
             +YDY+AP+DEYGNLNQPK+GHLK LH  +  L +N++  Y       L N + +T Y   
Sbjct  294   SYDYDAPIDEYGNLNQPKWGHLKNLHAAI-KLGENVLTNYSARKDEDLGNGLTLTTYTNS  352

Query  353   NGTKTCFFSNSNET---ADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMV  523
             +G + CF SN+N T   A   +   G  Y VPAWSVSI+  C +EV+NTA+VN+QT++MV
Sbjct  353   SGARFCFLSNNNNTDLGARVDLKNDGV-YIVPAWSVSIINGCNQEVFNTAKVNSQTSMMV  411

Query  524   KEGGKAAAA-LRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDK  697
             K+    ++  L W W+ E   DTI HG G   A ++L+QK +  D SDY+WYMTS +++ 
Sbjct  412   KKSDNVSSTNLTWEWKVEPKRDTI-HGNGSLKAQKLLEQKELTLDASDYLWYMTSADIN-  469

Query  698   DDPIWSKDMRLGVNGTGQVLHVYANGKYVD---SQWNNNSLFETNIKLNHGKNLLTLLSA  868
             D  IWS +  L VN +G  LH Y N +YV    SQ+ N   +E  + L +G N++TLLSA
Sbjct  470   DTSIWS-NATLRVNTSGHSLHGYVNQRYVGYQFSQYGNQFTYEKQVSLKNGTNIITLLSA  528

Query  869   SIGFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             ++G  NYG +FD    G+ G  VE++GKN    V  +L ++ WSYK+GL GE   L+ + 
Sbjct  529   TVGLANYGAWFDDKKTGISGGPVELIGKN---NVTMDLSTNLWSYKIGLNGERRHLYDAQ  585

Query  1043  NKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
                  A    S ++P  + + WY+  FK+P G +P+VVDL G+GKG AWVNG+++GRYW 
Sbjct  586   QNVSVAWHTNSSYIPIGKPLIWYRAKFKSPFGTNPIVVDLQGLGKGHAWVNGHSIGRYWS  645

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                   D  ++ CDYRG Y   KC +NCG+P+QR+YHVPRSFLN    N LVLFEE GGN
Sbjct  646   SWISPSDGCSDTCDYRGNYVPVKCNTNCGSPSQRWYHVPRSFLNHDM-NTLVLFEEIGGN  704

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcgg  1582
                V+FQTV TG +CA+ YE    E+SCQ G+ ++ I++A++G+       G  K     
Sbjct  705   PQSVQFQTVTTGTICANVYEGAQFELSCQSGQVMSQIQFASYGNPE--GQCGSFKKGNFD  762

Query  1583  AKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A ++ ++++ +C+GK +C    ++ +FG TN   S   +L V+  C
Sbjct  763   AANSQSVVEASCVGKNNCGFNVTKEMFGVTNV--SSIPRLAVQVTC  806



>ref|XP_006475095.1| PREDICTED: beta-galactosidase-like [Citrus sinensis]
Length=830

 Score =   506 bits (1302),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 278/546 (51%), Positives = 352/546 (64%), Gaps = 45/546 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+DP RTAEDLA+SVARFFQ GG   NYYMYHGGTNFGRTAGGPYI T
Sbjct  234   TENWTGWFKLWGGRDPQRTAEDLAFSVARFFQNGGVLNNYYMYHGGTNFGRTAGGPYIAT  293

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDYNAPLDEYGNLNQPK+GHLK+LH  +   EK +  G + T  + N +        G 
Sbjct  294   SYDYNAPLDEYGNLNQPKWGHLKQLHASIKQAEKFLTNGTVETKSVMNFLTKFTLNATGE  353

Query  362   KTCFFSNSNETADATINYQGTDYK--VPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG  535
             + C  SNS+ T D T +  G D K  VPAWSV+ L +C +EVYNTA++NTQT+VMV +  
Sbjct  354   RFCMLSNSDNTGDYTADL-GEDGKFFVPAWSVTFLQNCSKEVYNTAKINTQTSVMVTKHS  412

Query  536   KA--------AAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVN  688
             +          A   W W PE   DT L G G+F A Q+LDQK A+ DVSDY+WYMTSV+
Sbjct  413   EEDAYGNEVKPAKFSWMWAPEPIQDT-LKGNGRFEAAQLLDQKEASGDVSDYLWYMTSVD  471

Query  689   LDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL-------------FETNIK  829
                   I  K+M L V+  G  LH Y NGK + SQ++  +              F+  + 
Sbjct  472   TRN---ISLKNMTLRVSTNGHGLHAYVNGKLIGSQFSRQAKGQQMVTGDDYSFGFDKAVS  528

Query  830   LNHGKNLLTLLSASIGFQNYGPYFDLGGNGLY--GVEIVGKNGDETVRKNLGSHKWSY--  997
             L  G N+++LLS ++G  NYG ++DL   GL   GV + GK G+ ++  N  +++WSY  
Sbjct  529   LKKGLNVISLLSVTVGLANYGAFYDLKPTGLINGGVLLNGK-GNNSI--NATTYQWSYKL  585

Query  998   ----KVGLRGEENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLM  1165
                 KVGL GE  + F   N SR+A+ W S  +P  R MTWYKTSFK P+G +PVV+DL+
Sbjct  586   SLLVKVGLNGEAQQ-FHDPN-SRNAN-WNSTKVPKNRPMTWYKTSFKTPSGEEPVVLDLL  642

Query  1166  GMGKGFAWVNGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPR  1342
             GMGKG AWVNG ++GRYW   +A+   C    C+Y+G YN+ KC +NCGNP+QR+YHVPR
Sbjct  643   GMGKGHAWVNGKSIGRYWPTQIAETTGCDAH-CNYKGSYNDGKCRTNCGNPSQRWYHVPR  701

Query  1343  SFLNRRGDNELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYA  1522
             SFLN   DN L+LFEE GG    V  Q V  G VCA+AYE    E+ CQG R I+ I++A
Sbjct  702   SFLNNNADNTLILFEEVGGAPWNVTLQVVTVGTVCANAYEGNNLELYCQGDRRISEIQFA  761

Query  1523  NFGDTR  1540
             +FGD +
Sbjct  762   SFGDPQ  767



>ref|XP_003572734.1| PREDICTED: beta-galactosidase 1-like [Brachypodium distachyon]
Length=831

 Score =   505 bits (1301),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 273/587 (47%), Positives = 368/587 (63%), Gaps = 30/587 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R AED+AY+VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  260   TENWTGWFKAWDKPDYHRPAEDVAYAVAMFFQNRGSVQNYYMYHGGTNFGRTSGGPYITT  319

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             TYDY+APLDEYGN+ QPKYGHLK LH VL S+EK++VYG    T LD+ ++ T Y   +G
Sbjct  320   TYDYDAPLDEYGNIRQPKYGHLKALHTVLTSMEKHLVYGQQNETNLDDKVKATKYTLDDG  379

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
             +  CF SNS++  D  + ++G+ Y+VPAWSVS+LPDCK   YNTA+V TQT+VMVK+   
Sbjct  380   SSACFISNSHDNKDVNVTFEGSAYQVPAWSVSVLPDCKTVAYNTAKVKTQTSVMVKKESA  439

Query  539   AAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDDPIWS  715
             A   L+WSW PE    +     G F +N++L+Q V   D SDY+WY TS+     +    
Sbjct  440   AKGGLKWSWLPEFLRPSFTDSYGSFKSNELLEQIVTGADESDYLWYKTSLTRGPKE----  495

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASIGFQ  883
                 L VN TG  L+ + NG+    +   N      FE  + L  GKN ++LLSA++G +
Sbjct  496   -QFTLYVNTTGHELYAFVNGELAGYKHAVNGPYLFQFEAPVTLKPGKNYISLLSATVGLK  554

Query  884   NYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYG  F+L   G+ G  V++V  +G+     +L ++ W+YK GL GE+ ++    +  + 
Sbjct  555   NYGASFELMPAGIVGGPVKLVSAHGNTI---DLSNNTWTYKTGLFGEQKQI----HLDKP  607

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               +W    +PT R  TWYK +F+APAG + VVVDL+G+ KG  +VNG+NLGRYW     G
Sbjct  608   GLRWSPFAVPTNRPFTWYKATFQAPAGTEAVVVDLVGLNKGVVYVNGHNLGRYWPSYVAG  667

Query  1238  DDCPTEACDYRGEY----NNNKCLSNCGNPTQRFYHVPRSFLN--RRGDNELVLFEETGG  1399
             D      CDYRGEY    N  KCL+ CG   QRFYHVPRSFLN      N +VLFEE GG
Sbjct  668   DMDGCHRCDYRGEYVTWNNQEKCLTGCGEVGQRFYHVPRSFLNAAHGAPNTVVLFEEAGG  727

Query  1400  NTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcg  1579
             + ++V F+TV  G VCA A +     ++C  GR I+++  A+FG   G   G +E G   
Sbjct  728   DPAKVNFRTVAVGPVCADAEKGDAVTLACAHGRTISSVDTASFG-VSGGQCGAYEGGSGC  786

Query  1580  gAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
              +K A+  +  AC+GK  C+V+ +++ F + +C GS    L V+A C
Sbjct  787   ESKPALEAITAACVGKKWCTVSYTDA-FDSADCKGSGV--LTVQATC  830



>ref|XP_009775909.1| PREDICTED: beta-galactosidase 7-like [Nicotiana sylvestris]
Length=743

 Score =   499 bits (1284),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 256/495 (52%), Positives = 332/495 (67%), Gaps = 24/495 (5%)
 Frame = +2

Query  2     TENWTGWFKKWG-GKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYIT  178
             TENWTGWFK W  G+DP+RTAED+A++VARFFQ GGT QNYYMYHGGTNFGR AGGPYIT
Sbjct  251   TENWTGWFKDWNNGRDPHRTAEDVAFAVARFFQKGGTLQNYYMYHGGTNFGRVAGGPYIT  310

Query  179   TTYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKL---DNSIQVTVYA  349
             TTYDY+APL+EYG LNQPKYGHLKELH +L S+EK + YGN T       D     T+Y 
Sbjct  311   TTYDYDAPLNEYGQLNQPKYGHLKELHEILKSVEKLLTYGNATQKAYGDDDWQYTSTMYE  370

Query  350   FNGTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE  529
             + G++ CF +N+N+  D   N++G +Y VPAWSVSILPDC    YNTA+VN    VMV++
Sbjct  371   YQGSRVCFLANANDKNDRIFNFEGKNYTVPAWSVSILPDCVNVKYNTAKVNAPKKVMVRK  430

Query  530   --GGKAAAALRWSWRPEVADDTI-----LHGKGQFTANQILDQK-VANDVSDYIWYMTSV  685
                G     L WSWR E           +  KG   ANQ+LDQK VAND SDY+WYMTSV
Sbjct  431   PNNGDNPNGLDWSWRAEKPSHLKPSFINIKKKGVLYANQLLDQKVVANDTSDYLWYMTSV  490

Query  686   NLDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLL  853
             ++ + DP++  +  L V+    VL+ + NGK++ ++W  +      F+  +K+  GKN L
Sbjct  491   DIKESDPLYGGEAVLEVHTDAHVLYAFFNGKHIGTKWAKDGKYSFDFQQLLKIKPGKNTL  550

Query  854   TLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             +LLS ++GF NYG YFD   NG+ G  ++       V K+L +++W YK+GL G E +L+
Sbjct  551   SLLSVTVGFPNYGAYFDKVKNGILGPVVL--KSPSGVVKDLTNNQWEYKIGLEGLERRLW  608

Query  1034  RSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                +      +  +  L T R   WYKT+FK P+G DPVV+D+MG+GKG AWVNGNN+GR
Sbjct  609   EDEDYMHRNWK-PAQTLQTNRMFVWYKTTFKTPSGDDPVVLDMMGLGKGTAWVNGNNIGR  667

Query  1214  YWLI---LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             YWL      K + C + +CDYRG Y+  KC +NCG PTQR+YHVPRSFL R+ DN LV+F
Sbjct  668   YWLTSYDFEKENGC-SNSCDYRGNYHPEKCATNCGQPTQRWYHVPRSFL-RKSDNNLVIF  725

Query  1385  EETGGNTSRVRFQTV  1429
             EE GG+ ++V  QTV
Sbjct  726   EEFGGHPAKVNVQTV  740



>gb|KGN58141.1| hypothetical protein Csa_3G550690 [Cucumis sativus]
Length=809

 Score =   498 bits (1282),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 270/579 (47%), Positives = 367/579 (63%), Gaps = 29/579 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFKKWG KDP+RTAED+A+SVARFFQ GG   NYYMYHGGTNFGRT+GGP+ITT
Sbjct  251   TENWVGWFKKWGDKDPHRTAEDVAFSVARFFQSGGILNNYYMYHGGTNFGRTSGGPFITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNLNQPK+GHLK+LH                + K +   + ++ A   T
Sbjct  311   SYDYDAPLDEYGNLNQPKWGHLKQLH---------------ASIKSNWERRFSLTAPAQT  355

Query  362   KTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMV-KEGG  535
             +T    N++E  DA ++  G   Y +PAWSVSIL  C +E++NTA+V++QT++   K+  
Sbjct  356   RTLVALNADENNDAIVDMLGDRKYFLPAWSVSILDGCNKEIFNTAKVSSQTSLFFKKQNE  415

Query  536   KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVAN-DVSDYIWYMTSVNLDKDDPIW  712
             K  A L W+W  E   DT L G G F AN +L+QK A  D SDY+WYMT+VN +    + 
Sbjct  416   KENAKLSWNWASEPMRDT-LQGYGTFKANLLLEQKGATIDSSDYLWYMTNVNSNTTSSL-  473

Query  713   SKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---LFETNIKLNHGKNLLTLLSASIGFQ  883
              +++ L VN  G VLH + N +Y+ SQW +N    +FE  I+L  G N +TLLSA++G +
Sbjct  474   -QNLTLQVNTKGHVLHAFINRRYIGSQWGSNGQSFVFEKPIQLKLGTNTITLLSATVGLK  532

Query  884   NYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSAS  1063
             NY  ++D    G+ G  I    GD  V  +L S+ WSYKVGL GE  +L+     +R+  
Sbjct  533   NYDAFYDTVPTGIDGGPIY-LIGDGNVTTDLSSNLWSYKVGLNGERKQLYNPMFSNRTKW  591

Query  1064  QWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKGDD  1243
               L+      RRMTW+K +FK P+G DPVV+D+ GMGKG AWVNG ++GR+W      +D
Sbjct  592   STLNKK-SIGRRMTWFKATFKTPSGTDPVVLDMQGMGKGQAWVNGRSIGRFWPSFIASND  650

Query  1244  CPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVRFQ  1423
               +E CDY+G YN NKC+ NCGN +QR+YH+PRSF+N    N L+LFEE GGN   V  Q
Sbjct  651   SCSETCDYKGSYNPNKCVRNCGNSSQRWYHIPRSFMN-DSINTLILFEEIGGNPQMVSVQ  709

Query  1424  TVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNI  1603
             T+  G +C +A E    E+SCQGG  I+ I++A++G       G F+ G+    K    I
Sbjct  710   TITIGTICGNANEGSTLELSCQGGHVISEIQFASYGHPE-GKCGSFQSGLWDVTKSTTII  768

Query  1604  LKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             ++ AC+G  +CS+  S ++F  +  A     KL V+A+C
Sbjct  769   VEKACIGMKNCSIDISPNLFKLSKVAYPYA-KLAVQALC  806



>ref|XP_008462666.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Cucumis 
melo]
Length=826

 Score =   495 bits (1275),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 264/596 (44%), Positives = 367/596 (62%), Gaps = 47/596 (8%)
 Frame = +2

Query  11    WTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITTTYD  190
             WTGWFK WG   P RTAED+A+SVARFFQ GG+ QNYYMYHGGTNFGRT+GGPYI T YD
Sbjct  252   WTGWFKNWG--XPMRTAEDVAFSVARFFQYGGSLQNYYMYHGGTNFGRTSGGPYIKTFYD  309

Query  191   YNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGTKTC  370
             YNAPLDEYGN+NQPK+ HLK+L+ +L S+EK + YG++  T   +S         G  +C
Sbjct  310   YNAPLDEYGNINQPKWEHLKQLNELLMSMEKVLTYGDVKHTDYGHST-------TGKSSC  362

Query  371   FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK-EGGKAAA  547
             F  N+ E  D  + +    Y +P WSV ILPDCK EVYNTA VNTQTT+  K    +   
Sbjct  363   FIGNA-ENGDRNVTFGDRTYNIPGWSVGILPDCKSEVYNTAEVNTQTTIREKVSSQRTNK  421

Query  548   ALRWSWRPEVADDTILHGK---GQFTANQILDQKVA-NDVSDYIWYMTSVNLDKDDPIWS  715
               +W WR E  +      +      TAN++LDQKV  ND SDY+WY+T  +L+  DP++ 
Sbjct  422   GFKWQWRSEKIEHMTYEDRVDGSVITANRLLDQKVVTNDASDYLWYLTGFHLEGSDPLFG  481

Query  716   KDMRLGVNGTGQVLHVYANGKYVD--------------SQW----NNNSLFETNIK-LNH  838
             K ++L VN  G +LH + N +++D              SQ+      N +FE  ++ L H
Sbjct  482   KRVKLRVNTRGHILHAFVNKRHIDLTSYIDKLQIQISRSQYALKSKYNFIFEKEVRNLRH  541

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             G N + LLSA++G  +YG +F+    G++G VE+V     ET+R +L +++W+YK+GL G
Sbjct  542   GFNQIVLLSATVGLPHYGAHFEDVEAGVHGPVELVADG--ETIR-DLSNNEWAYKIGLDG  598

Query  1016  EENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVN  1195
             E+ + F  +++ R    WLSD+LP+ +  TW KT+F+ P  R+ VVVDL+GMGKG AWVN
Sbjct  599   EKYEFFDPNHRFRKP--WLSDNLPSNQNFTWXKTTFQTPKKREGVVVDLLGMGKGHAWVN  656

Query  1196  GNNLGRYWLIL-AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNE  1372
             G ++GRYW    A  +DC +  CD+RG Y +NKC++NCG PTQR+YH+PRS+LN+  +N 
Sbjct  657   GKSIGRYWPSYHANENDCSSH-CDFRGAYYDNKCVTNCGKPTQRWYHIPRSYLNKGKENT  715

Query  1373  LVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscg  1552
             L+LFEE GG    +  Q  R   VCA  Y     E+SC   R I  I + +FG+      
Sbjct  716   LILFEEFGGVPLNIDIQITRVKKVCAKPYAGSTLELSCH-DRTIKNINFVSFGNPH--GN  772

Query  1553  ggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +     +  A+++++ ACLGK  CS+  ++S  G T C   +  +L V+  C
Sbjct  773   CDNFQKGTCDSSTALSVIEKACLGKRKCSIEVTKSNLGNTGC--KKHNRLAVQVTC  826



>emb|CDP15330.1| unnamed protein product [Coffea canephora]
Length=820

 Score =   495 bits (1274),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 265/586 (45%), Positives = 367/586 (63%), Gaps = 31/586 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WG   P RTAED+A++VARF+QL GT  NYYMYHGGTNFGRT+GGPYI T
Sbjct  252   TENWTGWFKDWGDATPRRTAEDVAFAVARFYQLNGTVMNYYMYHGGTNFGRTSGGPYIIT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDN-SIQVTVYAFNG  358
             +YDY+APL+EYG LNQPK+GHL++LH +L+SLEK + YG+    +     +  +VY +  
Sbjct  312   SYDYDAPLNEYGLLNQPKWGHLRQLHLLLYSLEKILTYGDHKYQEHGTYMLSSSVYTYGP  371

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
              + CFF N+N     T+ ++G  Y +P WSVSI  DC+   YNTA+V+ QT V+  +  +
Sbjct  372   ERVCFFGNANSNDAMTLTFEGIQYTIPPWSVSIYRDCRTLAYNTAQVSAQTNVL--DAVE  429

Query  539   AAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDPIWS  715
               A L+W W  E  ++  L  KG   A ++LDQK V ND SDY+WYMT+      DP+W 
Sbjct  430   DIAGLKWRWTIEPIEN--LAQKGLTLATELLDQKTVTNDTSDYLWYMTTY-----DPVWG  482

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFE----TNIKLNHGKNLLTLLSASIGFQ  883
              D+ L V+ TG V+H + NG +V SQ   N  FE    + + L HG N ++LLSA++G Q
Sbjct  483   GDLTLYVHTTGHVIHAFVNGIHVGSQAAQNGHFEFDFSSPVSLKHGMNSISLLSATVGLQ  542

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENK--LFRSSNKSR  1054
             NYG +FD   NG+ G V++V  N +E   K+L  + W+YKVG+ G + K       ++S 
Sbjct  543   NYGAFFDNVKNGILGPVKLVAPNHEE---KDLSKNTWAYKVGMGGIDQKQLYLNLPHQSW  599

Query  1055  SASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAK  1234
              +SQ     LP  R   WYKT+F  P+G DPVV++L  +GKG AWVNG+N+GRYW     
Sbjct  600   HSSQ---KSLPINRMFVWYKTTFGTPSGLDPVVLNLQDLGKGTAWVNGHNIGRYWPSKFA  656

Query  1235  GDDCPTEACDYRGEYN-NNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                   + CDYRG+Y  + +C   CGN TQ+ YHVPRSFL   G+N+LVLFEE GG+   
Sbjct  657   AGQQGCQTCDYRGQYQPSQQCRRGCGNSTQQLYHVPRSFLRDEGNNDLVLFEEFGGDPRN  716

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V+FQT++   +CA+  E  + ++SCQ GR +T I +A+FG+       G        A D
Sbjct  717   VKFQTIKLVKICANVEEGNILDLSCQ-GRVMTRIDFASFGNP--DGVCGAFTKGNCEASD  773

Query  1592  AVNILKTACLGKASCSV--TASESVFGTTNCAGSR-TKKLVVEAVC  1720
             ++++++ AC+GK+ CS+  TA         C  S+  ++L VE  C
Sbjct  774   SLSVVQDACIGKSRCSIDLTAKGPFRCIAGCESSKEPRRLAVEISC  819



>ref|XP_003612510.1| Beta-galactosidase [Medicago truncatula]
Length=828

 Score =   493 bits (1268),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 269/591 (46%), Positives = 372/591 (63%), Gaps = 29/591 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+KWG + P+RTAED AY+VARFFQ GG F NYYMYHGGTNFGRT+GGPYI T
Sbjct  249   TENWIGWFQKWGERAPHRTAEDSAYAVARFFQNGGVFNNYYMYHGGTNFGRTSGGPYIIT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIV-YGNITTTKLDNSIQVTVYAFN-  355
             +YDY+AP++EYGNLNQPKYGHLK LH  +   EK +  Y +     L N I +T Y  + 
Sbjct  309   SYDYDAPINEYGNLNQPKYGHLKFLHEAIKLGEKVLTNYTSRNDKDLGNGITLTTYTNSV  368

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
             G + CF SN  +  D  ++ Q    Y VPAWSV+IL  C +EV+NTA+VN+QT++M K+ 
Sbjct  369   GARFCFLSNDKDNTDGNVDLQNDGKYFVPAWSVTILDGCNKEVFNTAKVNSQTSIMEKKI  428

Query  533   GKAAA-ALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               ++   L W+W  E   DT ++G+G   A+Q+L+QK +  D SDY+WYMTSV+++ D  
Sbjct  429   DNSSTNKLTWAWIMEPKKDT-MNGRGSIKAHQLLEQKELTLDASDYLWYMTSVDIN-DTS  486

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYV---DSQWNNNSLFETNIKLNHGKNLLTLLSASIG  877
              WS +  L V  +G  LH Y N +Y+    SQ+ NN  +E  + L +G N++TLLSA++G
Sbjct  487   NWS-NANLHVETSGHTLHGYVNKRYIGYGHSQFGNNFTYEKQVSLKNGTNIITLLSATVG  545

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
               NYG  FD    G+    V++VG+N   +V  +L +  WS+KVGL GE+ + +    + 
Sbjct  546   LANYGARFDEIKTGISDGPVKLVGQN---SVTIDLSTGNWSFKVGLNGEKRRFYDL--QP  600

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
             RS   W +   PT + +TWYKT FK+P G +P+VVDL G+GKG AWVNG ++GRYW    
Sbjct  601   RSGVAWNTSSYPTGKPLTWYKTQFKSPLGPNPIVVDLQGLGKGHAWVNGKSIGRYWTSWI  660

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                   ++ CDYRG Y   KC + C +P+QR+YHVPRSFLN    N L+LFEE GGN   
Sbjct  661   TSTAGCSDTCDYRGNYKKEKCNTGCASPSQRWYHVPRSFLNDDM-NTLILFEEIGGNPQN  719

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V F T  T  +CA+ YE    E+SCQ G+ IT+I +A+FG+ +     G  K     + +
Sbjct  720   VSFLTETTKTICANVYEGGKLELSCQNGQVITSINFASFGNPQ--GQCGSFKKGSWESLN  777

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTK--------KLVVEAVC  1720
             + ++++T+C+GK  C  T +  +FG      S +K        +L V+A C
Sbjct  778   SQSMMETSCIGKTGCGFTVTRDMFGVNLDPLSASKASVKDGIPRLAVQATC  828



>gb|AES95468.2| beta-galactosidase-like protein [Medicago truncatula]
Length=831

 Score =   493 bits (1268),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 269/591 (46%), Positives = 372/591 (63%), Gaps = 29/591 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+KWG + P+RTAED AY+VARFFQ GG F NYYMYHGGTNFGRT+GGPYI T
Sbjct  252   TENWIGWFQKWGERAPHRTAEDSAYAVARFFQNGGVFNNYYMYHGGTNFGRTSGGPYIIT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIV-YGNITTTKLDNSIQVTVYAFN-  355
             +YDY+AP++EYGNLNQPKYGHLK LH  +   EK +  Y +     L N I +T Y  + 
Sbjct  312   SYDYDAPINEYGNLNQPKYGHLKFLHEAIKLGEKVLTNYTSRNDKDLGNGITLTTYTNSV  371

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
             G + CF SN  +  D  ++ Q    Y VPAWSV+IL  C +EV+NTA+VN+QT++M K+ 
Sbjct  372   GARFCFLSNDKDNTDGNVDLQNDGKYFVPAWSVTILDGCNKEVFNTAKVNSQTSIMEKKI  431

Query  533   GKAAA-ALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               ++   L W+W  E   DT ++G+G   A+Q+L+QK +  D SDY+WYMTSV+++ D  
Sbjct  432   DNSSTNKLTWAWIMEPKKDT-MNGRGSIKAHQLLEQKELTLDASDYLWYMTSVDIN-DTS  489

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYV---DSQWNNNSLFETNIKLNHGKNLLTLLSASIG  877
              WS +  L V  +G  LH Y N +Y+    SQ+ NN  +E  + L +G N++TLLSA++G
Sbjct  490   NWS-NANLHVETSGHTLHGYVNKRYIGYGHSQFGNNFTYEKQVSLKNGTNIITLLSATVG  548

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
               NYG  FD    G+    V++VG+N   +V  +L +  WS+KVGL GE+ + +    + 
Sbjct  549   LANYGARFDEIKTGISDGPVKLVGQN---SVTIDLSTGNWSFKVGLNGEKRRFYDL--QP  603

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
             RS   W +   PT + +TWYKT FK+P G +P+VVDL G+GKG AWVNG ++GRYW    
Sbjct  604   RSGVAWNTSSYPTGKPLTWYKTQFKSPLGPNPIVVDLQGLGKGHAWVNGKSIGRYWTSWI  663

Query  1232  KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSR  1411
                   ++ CDYRG Y   KC + C +P+QR+YHVPRSFLN    N L+LFEE GGN   
Sbjct  664   TSTAGCSDTCDYRGNYKKEKCNTGCASPSQRWYHVPRSFLNDDM-NTLILFEEIGGNPQN  722

Query  1412  VRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggAKD  1591
             V F T  T  +CA+ YE    E+SCQ G+ IT+I +A+FG+ +     G  K     + +
Sbjct  723   VSFLTETTKTICANVYEGGKLELSCQNGQVITSINFASFGNPQ--GQCGSFKKGSWESLN  780

Query  1592  AVNILKTACLGKASCSVTASESVFGTTNCAGSRTK--------KLVVEAVC  1720
             + ++++T+C+GK  C  T +  +FG      S +K        +L V+A C
Sbjct  781   SQSMMETSCIGKTGCGFTVTRDMFGVNLDPLSASKASVKDGIPRLAVQATC  831



>gb|EAZ01758.1| hypothetical protein OsI_23787 [Oryza sativa Indica Group]
Length=828

 Score =   492 bits (1267),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 270/590 (46%), Positives = 355/590 (60%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  258   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G    T   + + VT Y  + T
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDTNYSDKVTVTKYTLDST  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   GT + +PAWSVSILPDCK   +N+A++  QTTVMV +    
Sbjct  378   SACFINNRNDNMDVNVTLDGTTHLLPAWSVSILPDCKTVAFNSAKIKAQTTVMVNKANMV  437

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K   +L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS+N   +   
Sbjct  438   EKEPESLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSINHKGE---  494

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+  KL+ GKN ++LLSA+IG
Sbjct  495   --ASYTLFVNTTGHELYAFVNGMLVGQNHSPNGHFVFQLESPAKLHDGKNYISLLSATIG  552

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  553   LKNYGPLFEKMPAGIVGGPVKLIDNNGKGI---DLSNSSWSYKAGLAGE----YRQIHLD  605

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +    W +++  +P  +  TWYKT+F+APAG D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  606   KPGCTWDNNNGTVPINKPFTWYKTTFQAPAGEDTVVVDLLGLNKGVAWVNGNNLGRYWPS  665

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG    E +  KCL+ CG P+QRFYHVPRSFL     N L+LFEE 
Sbjct  666   YTAAEMGGCHHCDYRGVFQAEGDGQKCLTGCGEPSQRFYHVPRSFLKNGEPNTLILFEEA  725

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S V F+TV  G VCASA       +SC Q  + I+AI   +FG  R   G      
Sbjct  726   GGDPSHVSFRTVAAGSVCASAEVGDTITLSCGQHSKTISAINMTSFGVAR---GQCGAYK  782

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +K A      ACLGK SC+V  + +V G+    G  +  L V+A C
Sbjct  783   GGCESKAAYKAFTEACLGKESCTVQITNAVTGS----GCLSNVLTVQASC  828



>gb|KDP29228.1| hypothetical protein JCGZ_16617 [Jatropha curcas]
Length=846

 Score =   491 bits (1263),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 271/606 (45%), Positives = 372/606 (61%), Gaps = 47/606 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK WGG+ P+RTAED A++VARFFQL GT QNYYMYHGGTNFG T GGPYITT
Sbjct  255   TENWTGWFKHWGGRTPHRTAEDTAFAVARFFQLNGTMQNYYMYHGGTNFGETGGGPYITT  314

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYGNLNQPK+GHLK LH  L+S++ +IVYG+ T      +   T++++ G 
Sbjct  315   SYDYDAPIDEYGNLNQPKWGHLKNLHEALYSMKDHIVYGDKTDIDCGQNKWATIFSYQGK  374

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK-----  526
             ++CFFSN +   D T+ ++G D  +P WSVS+ PDC  EVYNTA+VN QT+VMV      
Sbjct  375   RSCFFSNIDYN-DQTLTFEGADLFLPGWSVSLSPDCFHEVYNTAKVNAQTSVMVNRPIHP  433

Query  527   -EGGKAAAALRWSWRPEVADDTILH-------GKGQFTA-NQILDQK-VANDVSDYIWYM  676
              +       L W   PE     I+H         G F A N +LDQK V N  SDY++ +
Sbjct  434   VDEDDTPYKLEWQSTPE----QIVHINRNGNLDSGAFVASNAVLDQKTVTNGTSDYLYLL  489

Query  677   TSVNLDKDDPIW-SKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS--------LFETNIK  829
             T    +  DP W +KD+ L V   G ++H + N ++V SQ+++           FE  I+
Sbjct  490   TLYFHNSSDPQWVNKDIFLQVRTNGPIIHAFVNKRFVGSQYSDYHGHLDDYGFQFEREIR  549

Query  830   LNHGKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVG--KNGDET-VRKNLGSHKWSY  997
             L +G N + L S S+G  NYGP FD  G G+ G ++++   +NG E  V K++ +++W +
Sbjct  550   LVNGANRIVLASVSVGLPNYGPNFDYWGCGIVGPIQLIARSRNGSEPEVIKDISTNRWIH  609

Query  998   KVGLRG---EENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMG  1168
             K GL G   E +KL    + S SA   +       R  TWYKT+F  P G DPVVVDL G
Sbjct  610   KTGLHGVDLEYHKLLHRYSPSWSAIPQID------RPFTWYKTNFLYPHGTDPVVVDLNG  663

Query  1169  MGKGFAWVNGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSF  1348
             MGKG AW+NG N+GRYW      ++  +  CDY+ +Y++ KC + CG PTQR+YH+PR +
Sbjct  664   MGKGVAWINGINIGRYWPKNVASEEGCSIFCDYKNKYDSGKCSTGCGQPTQRYYHIPRDW  723

Query  1349  LNRRGDNELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANF  1528
             L R  +N LVLFEE GGN   V+ QTV  G VCA+AYE    E++C GG NIT I +A+F
Sbjct  724   L-RPDNNLLVLFEEFGGNPQNVQIQTVTVGKVCANAYEWNKLELACAGGHNITKINFASF  782

Query  1529  GDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFG--TTNCAGSRTKKL  1702
             G+ +     G        A D++++++ ACL + +C++  + + F      C    + +L
Sbjct  783   GNPQ--GKCGDYSPGRCHAIDSLDVVQKACLNQRNCTIDVNINSFALLPPECRQIFSYRL  840

Query  1703  VVEAVC  1720
              VEA C
Sbjct  841   AVEAFC  846



>ref|XP_003566745.1| PREDICTED: beta-galactosidase 13-like [Brachypodium distachyon]
Length=829

 Score =   488 bits (1255),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 269/592 (45%), Positives = 353/592 (60%), Gaps = 38/592 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+A+D+A++VA FFQ  G+ QNYYMYHGGTNFGRTAGGPYITT
Sbjct  257   TENWTGWFKAWDKPDFHRSAQDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTAGGPYITT  316

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ +PKYGHLK+LH VL S+EK +V+G+ +      ++ VT Y  +G+
Sbjct  317   SYDYDAPLDEYGNIREPKYGHLKDLHAVLKSMEKILVHGDFSDINYGRNVTVTKYTLDGS  376

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF SN  +  DA     GT + VPAWSVS+LPDCK   YNTA++  QT+VMVK+    
Sbjct  377   SVCFISNQFDDRDANATIDGTTHVVPAWSVSVLPDCKAVAYNTAKIKAQTSVMVKKPNTV  436

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPI  709
              +    L+WSW PE     +   KG F  N++L+Q   + D SDY+WY TS     +   
Sbjct  437   EQEPENLKWSWMPEHLKPFMTDEKGSFRKNELLEQITTSTDQSDYLWYRTSFEHKGE---  493

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                  +L VN TG  ++ + NGK    Q + N  F    E+ +KL+ GKN L+LLSA++G
Sbjct  494   --AKYKLSVNTTGHQIYAFVNGKLAGRQHSPNGAFIFQLESPVKLHDGKNYLSLLSATMG  551

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYG  F+L   G+ G  V++V  NG      +L +  WSYK GL GE     R  +  
Sbjct  552   LKNYGALFELMPAGIVGGPVKLVDNNGSTI---DLSNSSWSYKAGLAGEH----RQIHLD  604

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W  D+  +P  R  TWYK +F+APAG + VV DLMG+ KG AWVNGNNLGRYW  
Sbjct  605   KPGYKWHGDNGTIPINRAFTWYKATFQAPAGEEAVVADLMGLNKGVAWVNGNNLGRYWPS  664

Query  1226  LAKGDDCPTEACDYRGEYNNN----KCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG +       KCL+ C  P QRFYHVPR FL     N +VLFEE 
Sbjct  665   YVAAEMGGCHHCDYRGAFKAEGDGLKCLTGCNEPAQRFYHVPRVFLRAGEPNTVVLFEEA  724

Query  1394  GGNTSRVRFQTVRTGGVCASAYEN-KVAEISC--QGGRNITAIKYANFGDTRgscgggfe  1564
             GG+ SRV F TV  G VC  A E      +SC    GR I+++  A++G TRG CG    
Sbjct  725   GGDPSRVGFHTVAVGPVCVEAAEKGDNVTLSCGQHKGRTISSVDLASYGVTRGQCGAYQG  784

Query  1565  kgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                   A +A      AC+GK SC+V  +++  G    AG ++  L V+A C
Sbjct  785   GCESKAAYEA---FAEACVGKESCTVQHTDAFSG----AGCQSGVLTVQATC  829



>ref|NP_001043252.1| Os01g0533400 [Oryza sativa Japonica Group]
 sp|Q8RUV9.1|BGAL1_ORYSJ RecName: Full=Beta-galactosidase 1; Short=Lactase 1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB89138.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAB90329.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAF05166.1| Os01g0533400 [Oryza sativa Japonica Group]
 dbj|BAG99649.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score =   485 bits (1248),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 264/589 (45%), Positives = 358/589 (61%), Gaps = 35/589 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  258   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLKELH+VL S+EK +V+G    T   ++I VT Y  + +
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKELHSVLKSMEKTLVHGEYFDTNYGDNITVTKYTLDSS  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF +N  +  D  +   G  + +PAWSVSILPDCK   +N+A++ TQT+VMVK+   A
Sbjct  378   SACFINNRFDDKDVNVTLDGATHLLPAWSVSILPDCKTVAFNSAKIKTQTSVMVKKPNTA  437

Query  542   A---AALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
                  +L+WSW PE     +   KG F  N++L+Q V + D SDY+WY TS+N   +   
Sbjct  438   EQEQESLKWSWMPENLSPFMTDEKGNFRKNELLEQIVTSTDQSDYLWYRTSLNHKGEG--  495

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                  +L VN TG  L+ + NGK +    + +  F    E+ +KL+ GKN ++LLSA++G
Sbjct  496   ---SYKLYVNTTGHELYAFVNGKLIGKNHSADGDFVFQLESPVKLHDGKNYISLLSATVG  552

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL  E    +R  +  
Sbjct  553   LKNYGPSFEKMPTGIVGGPVKLIDSNGTAI---DLSNSSWSYKAGLASE----YRQIHLD  605

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W  ++  +P  R  TWYK +F+AP+G D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  606   KPGYKWNGNNGTIPINRPFTWYKATFEAPSGEDAVVVDLLGLNKGVAWVNGNNLGRYWPS  665

Query  1226  LAKGDDCPTEACDYRGEY----NNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG +    +  +CL+ CG P+QR+YHVPRSFL     N L+LFEE 
Sbjct  666   YTAAEMAGCHRCDYRGAFQAEGDGTRCLTGCGEPSQRYYHVPRSFLAAGEPNTLLLFEEA  725

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgv  1573
             GG+ S V  +TV  G VC S        +SC GG  ++++  A+FG  RG CGG      
Sbjct  726   GGDPSGVALRTVVPGAVCTSGEAGDAVTLSCGGGHAVSSVDVASFGVGRGRCGGYEGGCE  785

Query  1574  cggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                A +A      AC+GK SC+V  + +  G    AG  +  L V+A C
Sbjct  786   SKAAYEA---FTAACVGKESCTVEITGAFAG----AGCLSGVLTVQATC  827



>gb|EEC66762.1| hypothetical protein OsI_33138 [Oryza sativa Indica Group]
Length=828

 Score =   483 bits (1243),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 268/590 (45%), Positives = 357/590 (61%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW++ W   +  R  ED+A++VA FFQ+ G+ QNYYMYHGGTNFGRTAGGPYITT
Sbjct  258   TENWTGWYRDWDQPEFRRPTEDIAFAVAMFFQMRGSLQNYYMYHGGTNFGRTAGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLKELH+VL S+EK +++G+   T   +++ VT Y  N T
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKELHSVLMSMEKILLHGDYIDTNYGDNVTVTKYTLNAT  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N  +  D  +   GT + +PAWSVSILPDCK   +N+A++ TQTTVMV +    
Sbjct  378   SACFINNRFDDRDVNVTLDGTTHFLPAWSVSILPDCKTVAFNSAKIKTQTTVMVNKTSMV  437

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              +     +WSW PE     +   KG F  N++L+Q V   D SDY+WY TS+    +   
Sbjct  438   EQQTEHFKWSWMPENLRPFMTDEKGNFRKNELLEQIVTTTDQSDYLWYRTSLEHKGEG--  495

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NGK V  Q++ N  F    ++ +KL+ GKN ++LLS ++G
Sbjct  496   ---SYVLYVNTTGHELYAFVNGKLVGQQYSPNENFTFQLKSPVKLHDGKNYISLLSGTVG  552

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF--RSSN  1045
              +NYG  F+L   G+ G  V+++  +G      +L ++ WSYK GL GE  K++  +  N
Sbjct  553   LRNYGGSFELLPAGIVGGPVKLIDSSGSAI---DLSNNSWSYKAGLAGEYRKIYLDKPGN  609

Query  1046  KSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             K RS +      +P  R  TWYKT+F+APAG D VVVDL G+ KG AWVNGN+LGRYW  
Sbjct  610   KWRSHNS----TIPINRPFTWYKTTFQAPAGEDSVVVDLHGLNKGVAWVNGNSLGRYWPS  665

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 D      CDYRG    E    KCL+ CG P+Q+ YHVPRSFL++   N L+LFEE 
Sbjct  666   YVAADMPGCHHCDYRGVFKAEVEAQKCLTGCGEPSQQLYHVPRSFLHKGEPNTLILFEEA  725

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQG-GRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S V  +TV  G VCASA       +SC   GR I+++  A+FG  RG CG      
Sbjct  726   GGDPSEVAVRTVVEGSVCASAELGDTVTLSCGAHGRTISSVDVASFGVARGRCGSYDGGC  785

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 A DA      AC+GK SC+V  +++ F    C    +  L V+A C
Sbjct  786   DSKVAYDA---FAAACVGKESCTVLVTDA-FANAGCV---SGVLTVQATC  828



>gb|EEE50782.1| hypothetical protein OsJ_31141 [Oryza sativa Japonica Group]
Length=828

 Score =   483 bits (1243),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 268/590 (45%), Positives = 357/590 (61%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW++ W   +  R  ED+A++VA FFQ+ G+ QNYYMYHGGTNFGRTAGGPYITT
Sbjct  258   TENWTGWYRDWDQPEFRRPTEDIAFAVAMFFQMRGSLQNYYMYHGGTNFGRTAGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLKELH+VL S+EK +++G+   T   +++ VT Y  N T
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKELHSVLMSMEKILLHGDYIDTNYGDNVTVTKYTLNAT  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N  +  D  +   GT + +PAWSVSILP+CK   +N+A++ TQTTVMV +    
Sbjct  378   SACFINNRFDDRDVNVTLDGTTHFLPAWSVSILPNCKTVAFNSAKIKTQTTVMVNKTSMV  437

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              +     +WSW PE     +   KG F  N++L+Q V   D SDY+WY TS+    +   
Sbjct  438   EQQTEHFKWSWMPENLRPFMTDEKGNFRKNELLEQIVTTTDQSDYLWYRTSLEHKGEG--  495

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NGK V  Q++ N  F    ++ +KL+ GKN ++LLS ++G
Sbjct  496   ---SYVLYVNTTGHELYAFVNGKLVGQQYSPNENFTFQLKSPVKLHDGKNYISLLSGTVG  552

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF--RSSN  1045
              +NYG  F+L   G+ G  V+++  +G      +L ++ WSYK GL GE  K++  +  N
Sbjct  553   LRNYGGSFELLPAGIVGGPVKLIDSSGSAI---DLSNNSWSYKAGLAGEYRKIYLDKPGN  609

Query  1046  KSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             K RS +      +P  R  TWYKT+F+APAG D VVVDL G+ KG AWVNGN+LGRYW  
Sbjct  610   KWRSHNS----TIPINRPFTWYKTTFQAPAGEDSVVVDLHGLNKGVAWVNGNSLGRYWPS  665

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 D      CDYRG    E    KCL+ CG P+Q+ YHVPRSFLN+   N L+LFEE 
Sbjct  666   YVAADMPGCHHCDYRGVFKAEVEAQKCLTGCGEPSQQLYHVPRSFLNKGEPNTLILFEEA  725

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQG-GRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S V  +TV  G VCASA       +SC   GR I+++  A+FG  RG CG      
Sbjct  726   GGDPSEVAVRTVVEGSVCASAEVGDTVTLSCGAHGRTISSVDVASFGVARGRCGSYDGGC  785

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 A DA      AC+GK SC+V  +++ F    C    +  L V+A C
Sbjct  786   ESKVAYDA---FAAACVGKESCTVLVTDA-FANAGCV---SGVLTVQATC  828



>ref|NP_001064366.1| Os10g0330600 [Oryza sativa Japonica Group]
 sp|Q7G3T8.1|BGA13_ORYSJ RecName: Full=Beta-galactosidase 13; Short=Lactase 13; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|AAP53027.2| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26280.1| Os10g0330600 [Oryza sativa Japonica Group]
Length=828

 Score =   481 bits (1237),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 263/590 (45%), Positives = 354/590 (60%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  258   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G        +++ VT Y    T
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDANYSDNVTVTKYTLGST  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   G  + +PAWSVSILPDCK   +N+A++  QTT+MVK+    
Sbjct  378   SACFINNRNDNKDLNVTLDGNTHLLPAWSVSILPDCKTVAFNSAKIKAQTTIMVKKANMV  437

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K   +L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS++   +   
Sbjct  438   EKEPESLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSLDHKGE---  494

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+ +KL+ GKN ++LLSA+IG
Sbjct  495   --ASYTLFVNTTGHELYAFVNGMLVGKNHSPNGHFVFQLESAVKLHDGKNYISLLSATIG  552

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  553   LKNYGPLFEKMPAGIVGGPVKLIDNNGTGI---DLSNSSWSYKAGLAGE----YRQIHLD  605

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W +++  +P  R  TWYKT+F+APAG+D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  606   KPGYRWDNNNGTVPINRPFTWYKTTFQAPAGQDTVVVDLLGLNKGVAWVNGNNLGRYWPS  665

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG    E +  KCL+ CG P+QR+YHVPRSFL     N L+LFEE 
Sbjct  666   YTAAEMGGCHHCDYRGVFQAEGDGQKCLTGCGEPSQRYYHVPRSFLKNGEPNTLILFEEA  725

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S+V F +V  G VC SA       +SC Q  + I+ I   +FG  R   G      
Sbjct  726   GGDPSQVIFHSVVAGSVCVSAEVGDAITLSCGQHSKTISTIDVTSFGVAR---GQCGAYE  782

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +K A      ACLGK SC+V    ++ G+    G  +  L V+A C
Sbjct  783   GGCESKAAYKAFTEACLGKESCTVQIINALTGS----GCLSGVLTVQASC  828



>gb|EEC66744.1| hypothetical protein OsI_33101 [Oryza sativa Indica Group]
Length=824

 Score =   481 bits (1237),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 264/590 (45%), Positives = 354/590 (60%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  254   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G    T   +++ VT Y    T
Sbjct  314   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDTNYSDNVTVTKYTLGST  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   G  + +PAWSVSILPDCK   +N+A++  QTT+MVK+    
Sbjct  374   SACFINNRNDNKDLNVTLDGNTHLLPAWSVSILPDCKTVAFNSAKIKAQTTIMVKKANMV  433

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K    L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS++   +   
Sbjct  434   EKEPENLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSLDHKGE---  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+ +KL+ GKN ++LLSA+IG
Sbjct  491   --ASYTLFVNTTGHELYAFVNGMLVGKNHSPNGHFVFQLESAVKLHDGKNYISLLSATIG  548

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  549   LKNYGPLFEKMPAGIVGGPVKLIDNNGTGI---DLSNSSWSYKAGLAGE----YRQIHLD  601

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W +++  +P  R  TWYKT+F+APAG+D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  602   KPGYRWDNNNGTVPINRPFTWYKTTFQAPAGQDTVVVDLLGLNKGVAWVNGNNLGRYWPS  661

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG    E +  KCL+ CG P+QR+YHVPRSFL     N L+LFEE 
Sbjct  662   YTAAEMGGCHHCDYRGVFQAEGDGQKCLTGCGEPSQRYYHVPRSFLKNGEPNTLILFEEA  721

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S+V F +V  G VC SA       +SC Q  + I+ I   +FG  R   G      
Sbjct  722   GGDPSQVIFHSVVAGSVCVSAEVGDAITLSCGQHSKTISTIDVTSFGVAR---GQCGAYE  778

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +K A      ACLGK SC+V    ++ G+    G  +  L V+A C
Sbjct  779   GGCESKAAYKAFTEACLGKESCTVQIINALTGS----GCLSGVLTVQASC  824



>gb|ABU49386.1| beta-galactosidase 15 [Oryza sativa Indica Group]
Length=828

 Score =   481 bits (1237),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 264/590 (45%), Positives = 354/590 (60%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  258   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G    T   +++ VT Y    T
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDTNYSDNVTVTKYTLGST  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   G  + +PAWSVSILPDCK   +N+A++  QTT+MVK+    
Sbjct  378   SACFINNRNDNKDLNVTLDGNTHLLPAWSVSILPDCKTVAFNSAKIKAQTTIMVKKANMV  437

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K    L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS++   +   
Sbjct  438   EKEPENLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSLDHKGE---  494

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+ +KL+ GKN ++LLSA+IG
Sbjct  495   --ASYTLFVNTTGHELYAFVNGMLVGKNHSPNGHFVFQLESAVKLHDGKNYISLLSATIG  552

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  553   LKNYGPLFEKMPAGIVGGPVKLIDNNGTGI---DLSNSSWSYKAGLAGE----YRQIHLD  605

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W +++  +P  R  TWYKT+F+APAG+D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  606   KPGYRWDNNNGTVPINRPFTWYKTTFQAPAGQDTVVVDLLGLNKGVAWVNGNNLGRYWPS  665

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG    E +  KCL+ CG P+QR+YHVPRSFL     N L+LFEE 
Sbjct  666   YTAAEMGGCHHCDYRGVFQAEGDGQKCLTGCGEPSQRYYHVPRSFLKNGEPNTLILFEEA  725

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S+V F +V  G VC SA       +SC Q  + I+ I   +FG  R   G      
Sbjct  726   GGDPSQVIFHSVVAGSVCVSAEVGDAITLSCGQHSKTISTIDVTSFGVAR---GQCGAYE  782

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +K A      ACLGK SC+V    ++ G+    G  +  L V+A C
Sbjct  783   GGCESKAAYKAFTEACLGKESCTVQIINALTGS----GCLSGVLTVQASC  828



>ref|XP_006432580.1| hypothetical protein CICLE_v10001020mg [Citrus clementina]
 gb|ESR45820.1| hypothetical protein CICLE_v10001020mg [Citrus clementina]
Length=476

 Score =   469 bits (1206),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 245/449 (55%), Positives = 307/449 (68%), Gaps = 18/449 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFKKWG KDP+RT +D++++VARFFQ GG  QNYYMYHGGTNFGR AGGP+I T
Sbjct  35    TENWTGWFKKWGDKDPHRTPQDVSFAVARFFQAGGVLQNYYMYHGGTNFGRDAGGPFIIT  94

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDY+APLDEYGNLNQPK+GHLK+LH  +   EK +  GN+TT +  N + +T Y+   +
Sbjct  95    SYDYDAPLDEYGNLNQPKWGHLKQLHEAIKLGEKILTSGNVTTKQFGNGVNLTTYSNTTS  154

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
             G + CF SN+N + DA ++ Q    Y VPAWSVSIL  C +EVYNTA+VNT+TTVMVK+ 
Sbjct  155   GERFCFLSNTNTSQDANVDLQQDGKYFVPAWSVSILHGCNKEVYNTAKVNTETTVMVKKP  214

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSV-NLDKDDP  706
              +    L W W  E   DT LHGKG+F A ++++QK A +D SDY+WYMTS+ N+ K   
Sbjct  215   IELGTKLSWMWAQETIRDT-LHGKGRFNATKLIEQKEATSDESDYLWYMTSIENMGKS--  271

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQN  886
               S +  L V  +GQVLH Y N K++ SQ+  +  F+    L  GKN LTLLSA++G QN
Sbjct  272   --SHNATLYVKSSGQVLHAYVNSKHIGSQFGYDFEFKQPAILRPGKNFLTLLSATVGLQN  329

Query  887   YGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             YG +FDLG  GL G  VE+   N D     NL S+ W+YKVGL GE  +L+  +  S  A
Sbjct  330   YGEFFDLGPEGLAGGPVEL---NVDGMASLNLSSNIWNYKVGLNGEAKRLYDPN--SPHA  384

Query  1061  SQW-LSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               W  S  LP  + M WYKTSFK P G  PVVVDL GMGKG AWVNGN+LGRYW      
Sbjct  385   HIWKTSKKLPIGKPMKWYKTSFKIPPGTSPVVVDLQGMGKGHAWVNGNSLGRYWPSQIAD  444

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQR  1324
              +  ++ CDYRGEY   KC++NCGNP+QR
Sbjct  445   TNGCSDTCDYRGEYKPEKCVTNCGNPSQR  473



>gb|EAZ15685.1| hypothetical protein OsJ_31098 [Oryza sativa Japonica Group]
Length=824

 Score =   480 bits (1236),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 263/590 (45%), Positives = 354/590 (60%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  254   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G        +++ VT Y    T
Sbjct  314   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDANYSDNVTVTKYTLGST  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   G  + +PAWSVSILPDCK   +N+A++  QTT+MVK+    
Sbjct  374   SACFINNRNDNKDLNVTLDGNTHLLPAWSVSILPDCKTVAFNSAKIKAQTTIMVKKANMV  433

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K   +L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS++   +   
Sbjct  434   EKEPESLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSLDHKGE---  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+ +KL+ GKN ++LLSA+IG
Sbjct  491   --ASYTLFVNTTGHELYAFVNGMLVGKNHSPNGHFVFQLESAVKLHDGKNYISLLSATIG  548

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  549   LKNYGPLFEKMPAGIVGGPVKLIDNNGTGI---DLSNSSWSYKAGLAGE----YRQIHLD  601

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W +++  +P  R  TWYKT+F+APAG+D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  602   KPGYRWDNNNGTVPINRPFTWYKTTFQAPAGQDTVVVDLLGLNKGVAWVNGNNLGRYWPS  661

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG    E +  KCL+ CG P+QR+YHVPRSFL     N L+LFEE 
Sbjct  662   YTAAEMGGCHHCDYRGVFQAEGDGQKCLTGCGEPSQRYYHVPRSFLKNGEPNTLILFEEA  721

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S+V F +V  G VC SA       +SC Q  + I+ I   +FG  R   G      
Sbjct  722   GGDPSQVIFHSVVAGSVCVSAEVGDAITLSCGQHSKTISTIDVTSFGVAR---GQCGAYE  778

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +K A      ACLGK SC+V    ++ G+   +G     L V+A C
Sbjct  779   GGCESKAAYKAFTEACLGKESCTVQIINALTGSGGLSGV----LTVQASC  824



>gb|AAL31090.1|AC091749_19 putative beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAN04162.1| Putative beta-galactosidase [Oryza sativa Japonica Group]
Length=824

 Score =   480 bits (1235),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 263/590 (45%), Positives = 354/590 (60%), Gaps = 36/590 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  254   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G        +++ VT Y    T
Sbjct  314   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDANYSDNVTVTKYTLGST  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   G  + +PAWSVSILPDCK   +N+A++  QTT+MVK+    
Sbjct  374   SACFINNRNDNKDLNVTLDGNTHLLPAWSVSILPDCKTVAFNSAKIKAQTTIMVKKANMV  433

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K   +L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS++   +   
Sbjct  434   EKEPESLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSLDHKGE---  490

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+ +KL+ GKN ++LLSA+IG
Sbjct  491   --ASYTLFVNTTGHELYAFVNGMLVGKNHSPNGHFVFQLESAVKLHDGKNYISLLSATIG  548

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  549   LKNYGPLFEKMPAGIVGGPVKLIDNNGTGI---DLSNSSWSYKAGLAGE----YRQIHLD  601

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W +++  +P  R  TWYKT+F+APAG+D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  602   KPGYRWDNNNGTVPINRPFTWYKTTFQAPAGQDTVVVDLLGLNKGVAWVNGNNLGRYWPS  661

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG    E +  KCL+ CG P+QR+YHVPRSFL     N L+LFEE 
Sbjct  662   YTAAEMGGCHHCDYRGVFQAEGDGQKCLTGCGEPSQRYYHVPRSFLKNGEPNTLILFEEA  721

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S+V F +V  G VC SA       +SC Q  + I+ I   +FG  R   G      
Sbjct  722   GGDPSQVIFHSVVAGSVCVSAEVGDAITLSCGQHSKTISTIDVTSFGVAR---GQCGAYE  778

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +K A      ACLGK SC+V    ++ G+    G  +  L V+A C
Sbjct  779   GGCESKAAYKAFTEACLGKESCTVQIINALTGS----GCLSGVLTVQASC  824



>ref|NP_001168270.1| beta-galactosidase precursor [Zea mays]
 gb|ACN27651.1| unknown [Zea mays]
 tpg|DAA57548.1| TPA: beta-galactosidase [Zea mays]
Length=822

 Score =   478 bits (1231),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 258/591 (44%), Positives = 354/591 (60%), Gaps = 37/591 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+  NYYMYHGGTNFGRT+GGPYITT
Sbjct  250   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSVHNYYMYHGGTNFGRTSGGPYITT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPKYGHLK+LH+++ S+EK +V+G    T    ++ VT Y + G+
Sbjct  310   SYDYDAPLDEYGNIRQPKYGHLKDLHDLIRSMEKILVHGKYNDTSYGKNVTVTKYMYGGS  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N     D  +   G  + VPAWSVSILP+CK   YNTA++ TQT+VMVK+    
Sbjct  370   SVCFINNQFVDRDMKVTLGGETHLVPAWSVSILPNCKTVAYNTAKIKTQTSVMVKKANSV  429

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPI  709
              K    +RWSW PE     +   +G F  +Q+L+Q   + D SDY+WY TS+    +   
Sbjct  430   EKEPETMRWSWMPENLKPFMTDHRGSFRQSQLLEQIATSTDQSDYLWYRTSLEHKGEG--  487

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN +G  ++ + NG+ V    + +  F    ++ +KL+ GKN ++LLS ++G
Sbjct  488   ---SYTLYVNTSGHEMYAFVNGRLVGQNHSADGAFVFQLQSPVKLHSGKNYVSLLSGTVG  544

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+L   G+ G  V++VG NG      +L    WSYK GL GE     R  +  
Sbjct  545   LKNYGPSFELVPAGIAGGPVKLVGTNGTAI---DLTKSSWSYKSGLAGE----LRQIHLD  597

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W S +  +P  R  TWYKT+F+APAG + VVVDL+G+ KG AWVNGN+LGRYW  
Sbjct  598   KPGYKWQSHNGTIPVNRPFTWYKTTFEAPAGEEAVVVDLLGLNKGVAWVNGNSLGRYWPS  657

Query  1226  LAKGDDCPTEACDYRGEY----NNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG++    +  +CL+ CG P QRFYHVPRSFL     N L+LFEE 
Sbjct  658   YTAAEMPGCHVCDYRGKFIAEGDGIRCLTGCGEPAQRFYHVPRSFLRAGEPNTLILFEEA  717

Query  1394  GGNTSRVRFQTVRTGGVCASAYE-NKVAEISCQG-GRNITAIKYANFGDTRgscgggfek  1567
             GG+ +R  F TV  G VC +A E      +SC G GR + ++  A+FG  R   G     
Sbjct  718   GGDPTRAAFHTVAVGPVCVAAVELGDDVTLSCGGHGRVVASVDVASFGVAR---GSCGAY  774

Query  1568  gvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                  +K A+     AC+G+ SC+V  + +  G    AG ++  L V+A C
Sbjct  775   KGGCESKAALKAFTDACVGRESCTVKYTAAFAG----AGCQSGALTVQATC  821



>ref|XP_002457961.1| hypothetical protein SORBIDRAFT_03g023500 [Sorghum bicolor]
 gb|EES03081.1| hypothetical protein SORBIDRAFT_03g023500 [Sorghum bicolor]
Length=830

 Score =   478 bits (1229),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 271/593 (46%), Positives = 361/593 (61%), Gaps = 37/593 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+  NYYMYHGGTNFGRT+GGPYITT
Sbjct  255   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSVHNYYMYHGGTNFGRTSGGPYITT  314

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGN+ QPKYGHLK+LHN+L S+EK +V+G    T    ++ VT Y + G+
Sbjct  315   SYDYDAPLDEYGNIRQPKYGHLKDLHNLLKSMEKILVHGEYKDTSHGKNVTVTKYTYGGS  374

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF SN  +  D  +   GT + VPAWSVSILPDCK   YNTA++ TQT+VMVK+    
Sbjct  375   SVCFISNQFDDRDVNVTLAGT-HLVPAWSVSILPDCKTVAYNTAKIKTQTSVMVKKANSV  433

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPI  709
              K   ALRWSW PE     +    G F  +++L+Q   + D SDY+WY TS+    +   
Sbjct  434   EKEPEALRWSWMPENLKPFMTDDHGSFRQSRLLEQIATSTDQSDYLWYRTSLEHKGEG--  491

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  ++ + NGK V    ++N  F    ++ +KL+ GKN ++LLS ++G
Sbjct  492   ---SYTLYVNTTGHKIYAFVNGKLVGQNQSSNGAFVFQLQSPVKLHSGKNYVSLLSGTVG  548

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+L   G+ G  V++VG N D  +  +L    WSYK GL GE  ++       
Sbjct  549   LKNYGPLFELVPAGIAGGPVKLVGAN-DTAI--DLTHSSWSYKSGLAGEHRQIHLDKPGY  605

Query  1052  RSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW--LI  1225
             +  S   S  +P  R  TWYKT+F APAG + VVVDL+G+ KG AWVNGN+LGRYW    
Sbjct  606   KWRSHNGSGSIPVNRPFTWYKTTFAAPAGDEAVVVDLLGLNKGAAWVNGNSLGRYWPSYT  665

Query  1226  LAKGDDCPTEACDYRGEYNNN----KCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
              A+   C   ACDYRG++       +CL+ CG P+QRFYHVPRSFL     N LVLFEE 
Sbjct  666   AAEMGGC-HGACDYRGKFKAEGDGIRCLTGCGEPSQRFYHVPRSFLRAGEPNTLVLFEEA  724

Query  1394  GGNTSRVRFQTVRTGGVCASAYE-NKVAEISCQGGRN---ITAIKYANFGDTRgscgggf  1561
             GG+ +R  F TV  G VC +A E      +SC GG     + ++  A+FG TR   GG  
Sbjct  725   GGDPARAAFHTVAVGHVCVAAAEVGDDVTLSCGGGLGGGVVASVDVASFGVTR---GGCG  781

Query  1562  ekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             +      +K A+   + AC+G+ SC+V  + +  G     G ++ KL V+A C
Sbjct  782   DYQGGCESKAALKAFRDACVGRESCTVKYTPAFAG----PGCQSGKLTVQATC  830



>gb|KDP29226.1| hypothetical protein JCGZ_16615 [Jatropha curcas]
Length=843

 Score =   476 bits (1224),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 267/594 (45%), Positives = 358/594 (60%), Gaps = 30/594 (5%)
 Frame = +2

Query  5     ENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITTT  184
             ENWTG +KKWGG+  +RTAEDLA+SVARFF   G+  NYYMYHGGTNFG TAGGPY+TT+
Sbjct  255   ENWTGSYKKWGGRQAHRTAEDLAFSVARFFLNDGSLVNYYMYHGGTNFGETAGGPYVTTS  314

Query  185   YDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGTK  364
             YDY+APLDEYGN NQPK+GHLK LH VL SL  N+++G+ T   L  SI   + ++ G +
Sbjct  315   YDYDAPLDEYGNPNQPKWGHLKNLHEVLFSLGINLIFGDKTEVNLGGSITAKIISYKGQR  374

Query  365   TCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE-----  529
             +CFFSN  +  D+ I ++G ++ +P+WSVSI PDCK EVYNTA+VN QT++M+       
Sbjct  375   SCFFSNIYDD-DSFITFEGNEFFLPSWSVSISPDCKTEVYNTAKVNAQTSIMMYRPIHPL  433

Query  530   GGKAAAALRWSWRPEVADDTILHG---KGQFTA-NQILDQK-VANDVSDYIWYMTSVNLD  694
             G      L W   PE   +   +G   KG F A N +LDQK V N  SDY+W +T    +
Sbjct  434   GNNTPYQLEWESTPEQIININRYGNLDKGDFIASNYLLDQKTVTNGTSDYLWLLTLYTHN  493

Query  695   KDDPIW-SKDMRLGVNGTGQVLHVYANGKYVDSQW----NNNSLFETNIKLNHGKNLLTL  859
               DP W +KD+ L V+  G V+H + N K+  SQ     N +  FET I L  G N + L
Sbjct  494   STDPEWVNKDIFLQVHTFGPVIHAFVNTKFFGSQTAEDGNFDFQFETKIHLLEGINRIVL  553

Query  860   LSASIGFQNYGPYFDLGGNGLYG-VEIVGKN---GDETVRKNLGSHKWSYKVGLRGEENK  1027
             +S S+G   YG  F+  G G+ G ++I+ ++    D  V +++ +++W YK GL G +  
Sbjct  554   VSVSVGLPYYGASFENLGTGIVGPIKIIARSKTGNDSEVIRDISTNRWVYKTGLHGVD--  611

Query  1028  LFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             L   S      + W S  L T R  TWY+T+F  P G +PVVVDL GMGKG AWVNG N+
Sbjct  612   LGYQSPIHCYRANW-SSALETNRPFTWYRTNFYYPRGNNPVVVDLSGMGKGVAWVNGINI  670

Query  1208  GRYWL-ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW   LA  + C +  CDY+GEY   KC + CG P Q++YH+PR FL +   N  VLF
Sbjct  671   GRYWTKYLASEEGCDSN-CDYKGEYTREKCNTGCGEPAQKYYHIPRGFL-KPHRNMFVLF  728

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfe  1564
             EE GGN   V+  TV  G +CA AYE    E++C GG +I  I +A+FG+ +     G  
Sbjct  729   EELGGNPQNVQIHTVTVGKICAFAYEGSTLELACTGGHSIAKISFASFGNPQ--GKCGEY  786

Query  1565  kgvcggAKDAVNILKTACLGKASCSVTASESVFG--TTNCAGSRTKKLVVEAVC  1720
                   A D++ +++ ACL +  CS+      F     +C    +  L VEAVC
Sbjct  787   DMGTCHASDSMEVVQQACLLQKKCSINVDVDHFAQLPQDCKTRFSYNLAVEAVC  840



>gb|KDO40457.1| hypothetical protein CISIN_1g0453542mg, partial [Citrus sinensis]
Length=614

 Score =   468 bits (1205),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 244/452 (54%), Positives = 309/452 (68%), Gaps = 18/452 (4%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFKKWG KDP+RT +D++++VARFFQ GG  QNYYMYHGGTNFGR AGGP+I T
Sbjct  166   TENWTGWFKKWGDKDPHRTPQDVSFAVARFFQAGGVLQNYYMYHGGTNFGRDAGGPFIIT  225

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA--FN  355
             +YDY+APLDEYGNLNQPK+GHLK+LH  +   EK +  GN+TT +  N + +T Y+   +
Sbjct  226   SYDYDAPLDEYGNLNQPKWGHLKQLHEAIKLGEKLLTSGNVTTKQFGNGVNLTTYSNTTS  285

Query  356   GTKTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEG  532
             G + CF SN+N + DA ++ Q    Y VPAWSVSIL  C +EVYNTA+VNT+TTVMVK+ 
Sbjct  286   GERFCFLSNTNTSQDANVDLQQDGKYFVPAWSVSILHGCNKEVYNTAKVNTETTVMVKKP  345

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKVA-NDVSDYIWYMTSV-NLDKDDP  706
              +    L W W  E   DT LHGKG+F A ++++QK A +D SDY+WYMTS+ N+ K   
Sbjct  346   IELGTKLSWMWAQETIRDT-LHGKGRFNATKLIEQKEATSDESDYLWYMTSIENMGKS--  402

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQN  886
               S +  L V  +GQVLH Y N K++ SQ+  +  F+    L  GKN LTLLSA++G QN
Sbjct  403   --SHNATLYVKSSGQVLHAYVNSKHIGSQFGYDFEFKQPAILRPGKNFLTLLSATVGLQN  460

Query  887   YGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             YG +FDLG  GL G  VE+   N D     NL S+ W+YKVGL GE  +L+  +  S   
Sbjct  461   YGEFFDLGPEGLAGGPVEL---NVDGMASLNLSSNIWNYKVGLNGEAKRLYDPN--SPHP  515

Query  1061  SQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
               W S   LP  + M WY+TSFK P G  PVVVDL GMGKG AWVNGN+LGRYW      
Sbjct  516   QIWKSSKKLPIGKPMKWYRTSFKIPPGTSPVVVDLQGMGKGHAWVNGNSLGRYWPSQIAD  575

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYH  1333
              +  ++ CDYRGEY   KC++NCGNP+QR+Y+
Sbjct  576   TNGCSDTCDYRGEYKPEKCVTNCGNPSQRWYN  607



>dbj|BAK07511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=830

 Score =   471 bits (1212),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 267/595 (45%), Positives = 359/595 (60%), Gaps = 39/595 (7%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A+SVA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  253   TENWTGWFKAWDKPDFHRSAEDIAFSVAMFFQTRGSLQNYYMYHGGTNFGRTSGGPYITT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNS-IQVTVYAFNG  358
             +YDY+APLDEYGN+ QPKYGHLK+LHNVL S+EK +++G+   T + N+ + VT Y  + 
Sbjct  313   SYDYDAPLDEYGNIRQPKYGHLKDLHNVLKSMEKILLHGDYKDTTMGNTNVTVTKYTLDN  372

Query  359   TKTCFFSNSNETADATINYQ-GTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG  535
             +  CF SN  +  +  +    G  + VPAWSVSILPDCK   YN+A++ TQT+VMVK  G
Sbjct  373   SSACFISNKFDDKEVNVTLDNGATHTVPAWSVSILPDCKTVAYNSAKIKTQTSVMVKRPG  432

Query  536   KAAA--ALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDP  706
                    L WSW PE     +   KG F  N++L+Q   + D SDY+WY TS     +  
Sbjct  433   AETVTDGLAWSWMPENLQPFMTDEKGNFRKNELLEQIATSGDQSDYLWYRTSFEHKGE--  490

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASI  874
                 + +L VN TG  L+ + NGK V   ++ N  F    ET +KL+ GKN ++LLSA+I
Sbjct  491   ---SNYKLHVNTTGHELYAFVNGKLVGRHYSPNGGFAFQMETPVKLHSGKNYISLLSATI  547

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS--  1042
             G +NYG  F++   G+ G  V++V    + T   +L +  WSYK GL GE    +R +  
Sbjct  548   GLKNYGALFEMMPAGIVGGPVKLVDTVTNTTAY-DLSNSSWSYKAGLAGE----YRETHL  602

Query  1043  NKSRSASQW---LSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
             +K+   SQW   L+  +P  R  TWYK +F+APAG +PVV DL+G+GKG  WVNGNNLGR
Sbjct  603   DKANDRSQWSGGLNGTIPVHRPFTWYKATFEAPAGEEPVVADLLGLGKGVVWVNGNNLGR  662

Query  1214  YWLILAKGDDCPTEACDYRGEY----NNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVL  1381
             YW      D    + CDYRG +    +  KCL+ C  P+QRFYHVPRSF+     N +VL
Sbjct  663   YWPSYVAADMDGCQRCDYRGTFKAEGDGQKCLTGCNEPSQRFYHVPRSFIKAGEPNTMVL  722

Query  1382  FEETGGNTSRVRFQT--VRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgg  1555
             FEE GG+ +RV F T  V      A+   ++VA ++C  GR I+++  A+ G  R   G 
Sbjct  723   FEEAGGDPTRVSFHTVAVGAACAEAAEVGDEVA-LACSHGRTISSVDVASLGVAR---GK  778

Query  1556  gfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                      +K A+     AC+GK SC+V  +E     + C    +  L V+A C
Sbjct  779   CGAYQGGCESKAALAAFTAACVGKESCTVRHTEDFRAGSGC---DSGVLTVQATC  830



>gb|ABK24373.1| unknown [Picea sitchensis]
Length=861

 Score =   468 bits (1203),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 259/619 (42%), Positives = 369/619 (60%), Gaps = 59/619 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG+ P+R  EDLA+SVARFFQ GGTFQNYYMYHGGTNFGRT GGP+I T
Sbjct  255   TENWSGWFLSFGGRLPFRPTEDLAFSVARFFQRGGTFQNYYMYHGGTNFGRTTGGPFIAT  314

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHLKELH  +   E  +V      T L + ++  VY+  G+
Sbjct  315   SYDYDAPIDEYGIVRQPKWGHLKELHKAIKLCEAALVNAESNYTSLGSGLEAHVYS-PGS  373

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM-----  520
              TC  F +NSN  +DAT+ + G  Y +PAWSVSILPDCK  V+NTA++ +QTT +     
Sbjct  374   GTCAAFLANSNTQSDATVKFNGNSYHLPAWSVSILPDCKNVVFNTAKIGSQTTSVQMNPA  433

Query  521   --------VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
                       +G  +A A  WSW   + +   + G   F+   +L+Q     D SDY+WY
Sbjct  434   NLILAGSNSMKGTDSANAASWSW---LHEQIGIGGSNTFSKPGLLEQINTTVDSSDYLWY  490

Query  674   MTSVNLDKDDPIWSKDMR--LGVNGTGQVLHVYANGKY----VDSQWNNNSLFETNIKLN  835
              TS+ +D ++P      +  L V   G  LHV+ NG++      S  ++    +T I L 
Sbjct  491   TTSIQVDDNEPFLHNGTQPVLHVQSLGHALHVFINGEFAGRGAGSSSSSKIALQTPITLK  550

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
              GKN + LLS ++G QNYG +FD  G G+ G  I+   G +    +L + +W+Y++GL G
Sbjct  551   SGKNNIDLLSITVGLQNYGSFFDTWGAGITGPVIL--QGFKDGEHDLSTQQWTYQIGLTG  608

Query  1016  EENKLFRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  ++  S  +++++QW++   LPT + M WYKT+F AP+G DPV ++L+GMGKG AWV
Sbjct  609   EQLGIY--SGDTKASAQWVAGSDLPTKQPMIWYKTNFDAPSGNDPVALNLLGMGKGVAWV  666

Query  1193  NGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNE  1372
             NG ++GRYW          T++CDYRG Y++ KC +NCG P+Q+ YHVPRS++   G N 
Sbjct  667   NGQSIGRYWPSYIASQSGCTDSCDYRGAYSSTKCQTNCGQPSQKLYHVPRSWIQPTG-NV  725

Query  1373  LVLFEETGGNTSRVRFQTVRTGGVCASAYENKVA----------------------EISC  1486
             LVLFEE GG+ +++ F T   G +CA   E  +                       ++ C
Sbjct  726   LVLFEELGGDPTQISFMTRSVGSLCAQVSETHLPPVDSWKSSATSGLEVNKPKAELQLHC  785

Query  1487  QGGRN-ITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVF  1663
                R+ I +IK+A+FG ++GSCG          +   ++I++ AC+G+ SCSV  S   F
Sbjct  786   PSSRHLIKSIKFASFGTSKGSCGSFTYGHCNTNS--TMSIVEEACIGRESCSVEVSIEKF  843

Query  1664  GTTNCAGSRTKKLVVEAVC  1720
             G   C G+  K L VEA C
Sbjct  844   GDP-CKGT-VKNLAVEASC  860



>gb|EEC70819.1| hypothetical protein OsI_02284 [Oryza sativa Indica Group]
Length=837

 Score =   464 bits (1194),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 240/520 (46%), Positives = 326/520 (63%), Gaps = 28/520 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  258   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLKELH+VL S+EK +V+G    T   ++I VT Y  + +
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKELHSVLKSMEKTLVHGEYFDTNYGDNITVTKYTLDSS  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF +N  +  D  +   G  + +PAWSVSILPDCK   +N+A++ TQT+VMVK+   A
Sbjct  378   SACFINNRFDDKDVNVTLDGATHLLPAWSVSILPDCKTVAFNSAKIKTQTSVMVKKPNTA  437

Query  542   A---AALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
                  +L+WSW PE     +   KG F  N++L+Q V + D SDY+WY TS+N   +   
Sbjct  438   EQEQESLKWSWMPENLSPFMTDEKGNFRKNELLEQIVTSTDQSDYLWYRTSLNHKGEG--  495

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                  +L VN TG  L+ + NGK +    + +  F    E+ +KL+ GKN ++LLSA++G
Sbjct  496   ---SYKLYVNTTGHELYAFVNGKLIGKNHSADGDFVFQLESPVKLHDGKNYISLLSATVG  552

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL  E    +R  +  
Sbjct  553   LKNYGPSFEKMPTGIVGGPVKLIDSNGTAI---DLSNSSWSYKAGLASE----YRQIHLD  605

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +   +W  ++  +P  R  TWYK +F+AP+G D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  606   KPGYKWNGNNGTIPINRPFTWYKATFEAPSGEDAVVVDLLGLNKGVAWVNGNNLGRYWPS  665

Query  1226  LAKGDDCPTEACDYRGEY----NNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG +    +  +CL+ CG P+QR+YHVPRSFL     N L+LFEE 
Sbjct  666   YTAAEMAGCHRCDYRGAFQAEGDGTRCLTGCGEPSQRYYHVPRSFLAAGEPNTLLLFEEA  725

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAI  1513
             GG+ S V  +TV  G VC S        +SC GG  ++++
Sbjct  726   GGDPSGVALRTVVPGPVCTSGEAGDAVTLSCGGGHAVSSV  765



>ref|XP_008791518.1| PREDICTED: beta-galactosidase 6 isoform X2 [Phoenix dactylifera]
Length=804

 Score =   462 bits (1190),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 255/616 (41%), Positives = 359/616 (58%), Gaps = 58/616 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG+ PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  203   TENWSGWFLSFGGRAPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  262

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG + QPK+GHL++LH  +   E  +V  + T T L  +++  VY A +G
Sbjct  263   SYDYDAPIDEYGIIRQPKWGHLRDLHKAIKLCEAALVATDPTNTSLGPNLEAHVYRAGSG  322

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE---  529
                 F +N    +DAT+ + G  Y +PAWSVSILPDC+  V+NTA++N+Q T +      
Sbjct  323   VCAAFLANIGTQSDATVTFNGKSYHLPAWSVSILPDCRNVVFNTAQINSQATHLEMRYLT  382

Query  530   ----------GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYM  676
                           A+   WS+  E      +     FT + +L+Q     DVSDY+WY 
Sbjct  383   SNSQDSDQPIDSSKASQSDWSFAVEPVG---ISKSNAFTRSGLLEQINTTADVSDYLWYS  439

Query  677   TSVNLDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNH  838
               +++  D+   S   +  L V   G V+H + NGK   S   N+       E  I L  
Sbjct  440   IRIDIKGDEQFLSNGTQSNLHVESLGHVVHAFVNGKLSGSGMGNSGNAKVTLEKPITLVQ  499

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLSA++G QNYG +FDL G G+ G V++ G++G     K+L S +W+Y++GL+G
Sbjct  500   GKNKIDLLSATVGLQNYGAFFDLWGAGITGPVKLKGQDGT----KDLSSDEWTYQIGLKG  555

Query  1016  EENKLFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             EE  L+   + S+ +SQW+S   LP  + + WYKT+F AP G DP+ +D  GMGKG AWV
Sbjct  556   EELALY---DGSKDSSQWVSQPTLPKGQPLIWYKTNFDAPEGNDPIAIDFTGMGKGEAWV  612

Query  1193  NGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNE  1372
             NG ++GRYW       +    +C+Y+G YN++KCL NCG P+Q  YHVPRSF+ + G N 
Sbjct  613   NGQSIGRYWPTYISSQNGCATSCNYKGTYNSDKCLKNCGKPSQLMYHVPRSFI-QPGSNT  671

Query  1373  LVLFEETGGNTSRVRFQTVRTGGVCASAYEN-------------------KVAEISCQ-G  1492
             LVLFEE GG+ +++ F T +TG +CA   E+                    V  + C   
Sbjct  672   LVLFEEMGGDPTKISFATRQTGSLCAHVSESHPSPIDAWISSQQKVERLGPVLHLECPYP  731

Query  1493  GRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTT  1672
              + I++IK+A+FG        G        +  A+ +++ AC+G  SC +  S  +FG  
Sbjct  732   NQVISSIKFASFGTPH--GSCGRYNHGNCRSDSALAVVQQACIGAKSCGIGVSTKMFGDP  789

Query  1673  NCAGSRTKKLVVEAVC  1720
              C G  TK L VEA C
Sbjct  790   -CRGI-TKSLAVEAAC  803



>ref|XP_006645968.1| PREDICTED: beta-galactosidase 1-like [Oryza brachyantha]
Length=755

 Score =   460 bits (1183),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 240/498 (48%), Positives = 313/498 (63%), Gaps = 26/498 (5%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  251   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLKELH+VL S+EK +V+G    T    ++ VT Y  + +
Sbjct  311   SYDYDAPLDEYGNLRQPKYGHLKELHSVLKSMEKILVHGQYVDTNYGKNVTVTKYTLDKS  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGKA  541
               CF +N  +  D  +   G+ + +PAWSVSILPDCK   +N+A++ TQT+VMVK+    
Sbjct  371   SACFINNQFDDRDVNVTLDGSTHLLPAWSVSILPDCKTVAFNSAKIKTQTSVMVKKPKSV  430

Query  542   -AAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPIWS  715
                +L+WSW PE     +   KG F  N++L+Q   + D SDY+WY TS+N   D     
Sbjct  431   KPESLKWSWMPENLRPFMTDEKGSFRKNELLEQITTSTDQSDYLWYRTSLNHKGDG----  486

Query  716   KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIGFQ  883
                 L VN TG  L+ + NGK V    + N  F    ++ +KL+ GKN ++LLSA++G +
Sbjct  487   -SYTLYVNTTGHELYAFVNGKLVAQNHSANGDFVFQLKSPVKLHDGKNYISLLSATVGLK  545

Query  884   NYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRS  1057
             NYGP F+    G+ G  V+++  NG +    +L +  WSYK GL GE    +R     + 
Sbjct  546   NYGPLFEKMPAGIVGGPVKLIDNNGTQI---DLSNSSWSYKAGLAGE----YRQIYLDKH  598

Query  1058  ASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILA  1231
               +W   +  +P  R  TWYK +F+AP G D VVVDL+G+ KG AWVNGNNLGRYW    
Sbjct  599   GYKWDGHNGTIPINRPFTWYKATFEAPVGEDAVVVDLLGLNKGVAWVNGNNLGRYWPSYT  658

Query  1232  KGDDCPTEACDYRGEY----NNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGG  1399
               D      CDYRG +    +   CL+ CG P+QRFYHVPRSFL     N LVLFEE GG
Sbjct  659   AADMPGCHRCDYRGAFQAEGDATSCLTGCGEPSQRFYHVPRSFLRAAEPNTLVLFEEAGG  718

Query  1400  NTSRVRFQTVRTGGVCAS  1453
             + S V  +TV  G VCAS
Sbjct  719   DPSEVALRTVAPGAVCAS  736



>ref|XP_008791517.1| PREDICTED: beta-galactosidase 6 isoform X1 [Phoenix dactylifera]
Length=851

 Score =   462 bits (1190),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 255/616 (41%), Positives = 359/616 (58%), Gaps = 58/616 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG+ PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  250   TENWSGWFLSFGGRAPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG + QPK+GHL++LH  +   E  +V  + T T L  +++  VY A +G
Sbjct  310   SYDYDAPIDEYGIIRQPKWGHLRDLHKAIKLCEAALVATDPTNTSLGPNLEAHVYRAGSG  369

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE---  529
                 F +N    +DAT+ + G  Y +PAWSVSILPDC+  V+NTA++N+Q T +      
Sbjct  370   VCAAFLANIGTQSDATVTFNGKSYHLPAWSVSILPDCRNVVFNTAQINSQATHLEMRYLT  429

Query  530   ----------GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYM  676
                           A+   WS+  E      +     FT + +L+Q     DVSDY+WY 
Sbjct  430   SNSQDSDQPIDSSKASQSDWSFAVEPVG---ISKSNAFTRSGLLEQINTTADVSDYLWYS  486

Query  677   TSVNLDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNH  838
               +++  D+   S   +  L V   G V+H + NGK   S   N+       E  I L  
Sbjct  487   IRIDIKGDEQFLSNGTQSNLHVESLGHVVHAFVNGKLSGSGMGNSGNAKVTLEKPITLVQ  546

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLSA++G QNYG +FDL G G+ G V++ G++G     K+L S +W+Y++GL+G
Sbjct  547   GKNKIDLLSATVGLQNYGAFFDLWGAGITGPVKLKGQDG----TKDLSSDEWTYQIGLKG  602

Query  1016  EENKLFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             EE  L+   + S+ +SQW+S   LP  + + WYKT+F AP G DP+ +D  GMGKG AWV
Sbjct  603   EELALY---DGSKDSSQWVSQPTLPKGQPLIWYKTNFDAPEGNDPIAIDFTGMGKGEAWV  659

Query  1193  NGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNE  1372
             NG ++GRYW       +    +C+Y+G YN++KCL NCG P+Q  YHVPRSF+ + G N 
Sbjct  660   NGQSIGRYWPTYISSQNGCATSCNYKGTYNSDKCLKNCGKPSQLMYHVPRSFI-QPGSNT  718

Query  1373  LVLFEETGGNTSRVRFQTVRTGGVCASAYEN-------------------KVAEISCQ-G  1492
             LVLFEE GG+ +++ F T +TG +CA   E+                    V  + C   
Sbjct  719   LVLFEEMGGDPTKISFATRQTGSLCAHVSESHPSPIDAWISSQQKVERLGPVLHLECPYP  778

Query  1493  GRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTT  1672
              + I++IK+A+FG        G        +  A+ +++ AC+G  SC +  S  +FG  
Sbjct  779   NQVISSIKFASFGTPH--GSCGRYNHGNCRSDSALAVVQQACIGAKSCGIGVSTKMFGDP  836

Query  1673  NCAGSRTKKLVVEAVC  1720
              C G  TK L VEA C
Sbjct  837   -CRGI-TKSLAVEAAC  850



>ref|XP_002285084.2| PREDICTED: beta-galactosidase 8 [Vitis vinifera]
 emb|CBI16297.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   461 bits (1185),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 258/612 (42%), Positives = 356/612 (58%), Gaps = 55/612 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARFFQLGGTFQNYYMYHGGTNFGRT GGP+I T
Sbjct  250   TENWTGWFLSFGGAVPYRPVEDIAFAVARFFQLGGTFQNYYMYHGGTNFGRTTGGPFIAT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHLK+LH  +   E  ++  + T T L  +++ +VY   GT
Sbjct  310   SYDYDAPIDEYGLLRQPKWGHLKDLHKAIKLCEAALIATDPTITSLGTNLEASVYK-TGT  368

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------  517
              +C  F +N    +DAT+N+ G  Y +PAWSVSILPDCK    NTA++N+   +      
Sbjct  369   GSCAAFLANVRTNSDATVNFSGNSYHLPAWSVSILPDCKNVALNTAQINSMAVMPRFMQQ  428

Query  518   MVKEGGKAAAALR--WSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
              +K    ++   +  WSW   V +   +     FT   +L+Q  +  D SDY+WY  S  
Sbjct  429   SLKNDIDSSDGFQSGWSW---VDEPVGISKNNAFTKLGLLEQINITADKSDYLWYSLSTE  485

Query  689   LDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNL  850
             +  D+P      +  L V   G  LH + NGK   S   N+       +  + L HGKN 
Sbjct  486   IQGDEPFLEDGSQTVLHVESLGHALHAFINGKLAGSGTGNSGNAKVTVDIPVTLIHGKNT  545

Query  851   LTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENK  1027
             + LLS ++G QNYG ++D  G G+ G +++ G     TV  +L S +W+Y+VGL+GEE  
Sbjct  546   IDLLSLTVGLQNYGAFYDKQGAGITGPIKLKGLANGTTV--DLSSQQWTYQVGLQGEELG  603

Query  1028  LFRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNN  1204
             L      S S+S+W++   LP  + + WYKT+F APAG DPV +D MGMGKG AWVNG +
Sbjct  604   L-----PSGSSSKWVAGSTLPKKQPLIWYKTTFDAPAGNDPVALDFMGMGKGEAWVNGQS  658

Query  1205  LGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             +GRYW      +   T +C+YRG Y++NKCL NCG P+Q+ YHVPRS+L   G N LVLF
Sbjct  659   IGRYWPAYVSSNGGCTSSCNYRGPYSSNKCLKNCGKPSQQLYHVPRSWLQPSG-NTLVLF  717

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQG-----GRN---------------I  1504
             EE GG+ +++ F T +   +C+   E     +   G     GR                I
Sbjct  718   EEIGGDPTQISFATKQVESLCSRVSEYHPLPVDMWGSDLTTGRKSSPMLSLECPFPNQVI  777

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A+FG  R     G        ++ A++I++ AC+G  SCS+  S   FG   C+G
Sbjct  778   SSIKFASFGTPR--GTCGSFSHSKCSSRTALSIVQEACIGSKSCSIGVSIDTFGDP-CSG  834

Query  1685  SRTKKLVVEAVC  1720
                K L VEA C
Sbjct  835   -IAKSLAVEASC  845



>gb|ABF95029.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95030.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=702

 Score =   456 bits (1173),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 263/617 (43%), Positives = 360/617 (58%), Gaps = 60/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARF+Q GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  101   TENWSGWFLSFGGAVPYRPAEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  160

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++    + + L  + + TVY  A N
Sbjct  161   SYDYDAPIDEYGMVRQPKWGHLRDVHKAIKLCEPALIAAEPSYSSLGQNTEATVYQTADN  220

Query  356   GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQ-TTVMVKEG  532
                  F +N +  +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+Q TT  ++  
Sbjct  221   SICAAFLANVDAQSDKTVKFNGNTYKLPAWSVSILPDCKNVVLNTAQINSQVTTSEMRSL  280

Query  533   GKAA------------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
             G +             A   WS+  E    T    +   T   +++Q     D SD++WY
Sbjct  281   GSSIQDTDDSLITPELATAGWSYAIEPVGIT---KENALTKPGLMEQINTTADASDFLWY  337

Query  674   MTSVNLDKDDP-IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNH  838
              TS+ +  D+P +      L VN  G VL +Y NGK   S   + S      +T + L  
Sbjct  338   STSIVVKGDEPYLNGSQSNLLVNSLGHVLQIYINGKLAGSAKGSASSSLISLQTPVTLVP  397

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLS ++G  NYG +FDL G G+ G V++ G NG      NL S  W+Y++GLRG
Sbjct  398   GKNKIDLLSTTVGLSNYGAFFDLVGAGVTGPVKLSGPNG----ALNLSSTDWTYQIGLRG  453

Query  1016  EENKLFRSSNKSRSASQWLSDHL-PTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  L+   N S ++ +W+SD+  PT + + WYKT F APAG DPV +D  GMGKG AWV
Sbjct  454   EDLHLY---NPSEASPEWVSDNAYPTNQPLIWYKTKFTAPAGDDPVAIDFTGMGKGEAWV  510

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   LA    C   +C+YRG Y++NKCL  CG P+Q  YHVPRSFL + G N
Sbjct  511   NGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSNKCLKKCGQPSQTLYHVPRSFL-QPGSN  568

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEI----------SCQG---------  1492
             +LVLFE+ GG+ S + F T +T  +CA   E   A+I            QG         
Sbjct  569   DLVLFEQFGGDPSMISFTTRQTSSICAHVSEMHPAQIDSWISPQQTSQTQGPALRLECPR  628

Query  1493  -GRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+ IK+A+FG        G        +  A+ +++ AC+G  +CSV  S + FG 
Sbjct  629   EGQVISNIKFASFGTPS--GTCGNYNHGECSSSQALAVVQEACVGMTNCSVPVSSNNFGD  686

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C+G  TK LVVEA C
Sbjct  687   P-CSG-VTKSLVVEAAC  701



>ref|XP_010253630.1| PREDICTED: beta-galactosidase 8 [Nelumbo nucifera]
Length=845

 Score =   459 bits (1182),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 258/610 (42%), Positives = 352/610 (58%), Gaps = 52/610 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNFGRT GGP+I T
Sbjct  250   TENWSGWFLSFGGSVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTTGGPFIAT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHLK+LH  +   E+ ++  + T T L  +++  VY  +G 
Sbjct  310   SYDYDAPIDEYGLVRQPKWGHLKDLHKAIKLCEEALIATDPTFTSLGPNLEAHVYKTSGV  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------V  523
                F +N    + AT+N+ G  Y +PAWSVSILPDCK  V+NTA++N+Q   +       
Sbjct  370   CAAFLANVGTQSAATVNFNGNSYTLPAWSVSILPDCKNVVFNTAKINSQAMNLRFEPQTS  429

Query  524   KEGGKAAAALR--WSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             K+   ++ A +  WSW  E      +     F    +L+Q     DVSDY+WY  S  + 
Sbjct  430   KDTVDSSEAFQSGWSWFNEPVG---ISRSNAFMKLGLLEQINTTADVSDYLWYSLSTEIQ  486

Query  695   KDDPIWSK--DMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLT  856
              D+P        R+ V   G  +HV+ NGK+  S   N+       E  I L  GKN + 
Sbjct  487   GDEPFLQDGYQSRIHVESLGHAVHVFINGKFAGSGSGNSGNAKVTLERPITLIPGKNTID  546

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LLS ++G QNYG +FD  G G+ G V++ G     TV  +L S +W+Y++GL+GEE  L 
Sbjct  547   LLSLTVGLQNYGAFFDKWGAGITGPVKLKGSKNGTTV--DLSSSQWTYQIGLKGEELGL-  603

Query  1034  RSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  + S+SQW+S   LP  + + WYKTSF AP+G DP  +D  GMGKG AWVNG ++G
Sbjct  604   ----STASSSQWVSLSDLPKNQPLIWYKTSFDAPSGNDPTALDFTGMGKGEAWVNGQSIG  659

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW          T++CDYRG YN+NKC  NCG  +Q  YHVPRS++   G N LVLFEE
Sbjct  660   RYWPTYISPQSGCTDSCDYRGPYNSNKCHKNCGKASQNLYHVPRSWIQPSG-NTLVLFEE  718

Query  1391  TGGNTSRVRFQTVRTGGVCASAYEN-------------------KVAEISCQ-GGRNITA  1510
              GG+ +++ F T +TG +C+   E+                    V ++ C    + I++
Sbjct  719   VGGDPTQISFATRQTGSLCSHVSESHPPPVDTWDSDTKTGKKSGPVLQLECPFPNQVISS  778

Query  1511  IKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSR  1690
             I +A+FG  R     G  K     +  A+ I++ AC+G  SCS+  S   FG   C G  
Sbjct  779   INFASFGTPR--GACGSFKQGKCSSTSALAIVQQACVGSKSCSIAVSIDSFGDP-CVGV-  834

Query  1691  TKKLVVEAVC  1720
             TK L VEA C
Sbjct  835   TKSLAVEATC  844



>sp|Q7XFK2.1|BGA14_ORYSJ RecName: Full=Beta-galactosidase 14; Short=Lactase 14; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|AAK98719.1|AC090483_9 Putative beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAP53122.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=808

 Score =   458 bits (1178),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 260/586 (44%), Positives = 341/586 (58%), Gaps = 48/586 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGW++ W   +  R  ED+A++VA FFQ+ G+ QNYYMYHGGTNFGRTAGGPYITT
Sbjct  258   TENWTGWYRDWDQPEFRRPTEDIAFAVAMFFQMRGSLQNYYMYHGGTNFGRTAGGPYITT  317

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLKELH+VL S+EK +++G+   T   +++ VT Y  N T
Sbjct  318   SYDYDAPLDEYGNLRQPKYGHLKELHSVLMSMEKILLHGDYIDTNYGDNVTVTKYTLNAT  377

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N  +  D  +   GT + +PAWSVSILP+CK   +N+A++ TQTTVMV +    
Sbjct  378   SACFINNRFDDRDVNVTLDGTTHFLPAWSVSILPNCKTVAFNSAKIKTQTTVMVNKTSMV  437

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              +     +WSW PE     +   KG F  N++L+Q V   D SDY+WY TS+    +   
Sbjct  438   EQQTEHFKWSWMPENLRPFMTDEKGNFRKNELLEQIVTTTDQSDYLWYRTSLEHKGEG--  495

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETNIKLNHGKNLLTLLSASIGFQNY  889
                   L VN TG  L+ + NGK V  Q++ N  F   +K                  NY
Sbjct  496   ---SYVLYVNTTGHELYAFVNGKLVGQQYSPNENFTFQLKS----------------PNY  536

Query  890   GPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF--RSSNKSRS  1057
             G  F+L   G+ G  V+++  +G      +L ++ WSYK GL GE  K++  +  NK RS
Sbjct  537   GGSFELLPAGIVGGPVKLIDSSGSAI---DLSNNSWSYKAGLAGEYRKIYLDKPGNKWRS  593

Query  1058  ASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
              +      +P  R  TWYKT+F+APAG D VVVDL G+ KG AWVNGN+LGRYW      
Sbjct  594   HNS----TIPINRPFTWYKTTFQAPAGEDSVVVDLHGLNKGVAWVNGNSLGRYWPSYVAA  649

Query  1238  DDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
             D      CDYRG    E    KCL+ CG P+Q+ YHVPRSFLN+   N L+LFEE GG+ 
Sbjct  650   DMPGCHHCDYRGVFKAEVEAQKCLTGCGEPSQQLYHVPRSFLNKGEPNTLILFEEAGGDP  709

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQG-GRNITAIKYANFGDTRgscgggfekgvcgg  1582
             S V  +TV  G VCASA       +SC   GR I+++  A+FG  RG CG          
Sbjct  710   SEVAVRTVVEGSVCASAEVGDTVTLSCGAHGRTISSVDVASFGVARGRCGSYDGGCESKV  769

Query  1583  AKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             A DA      AC+GK SC+V  +++ F    C    +  L V+A C
Sbjct  770   AYDA---FAAACVGKESCTVLVTDA-FANAGCV---SGVLTVQATC  808



>ref|XP_003598040.1| Beta-galactosidase [Medicago truncatula]
Length=812

 Score =   457 bits (1176),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 260/585 (44%), Positives = 351/585 (60%), Gaps = 49/585 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+KWG + P+RTAED A+SVARFFQ GG  QNYY+YHGGTNFGRTAGGP+I T
Sbjct  250   TENWVGWFQKWGERRPHRTAEDSAFSVARFFQNGGALQNYYLYHGGTNFGRTAGGPFIIT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYGNL +PKYGHLK LH  +   EK +  G  T     +S+ +T Y   GT
Sbjct  310   TYDYDAPLDEYGNLIEPKYGHLKRLHAAIKLGEKVLTNGTATWESHGDSLWMTTYTNKGT  369

Query  362   --KTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE-  529
               K CF SNS+ + DA ++ Q    Y VPAWS+S+L DC +EVYNTA+   QT + +K+ 
Sbjct  370   GQKFCFLSNSHTSKDAEVDLQQDGKYYVPAWSMSLLQDCNKEVYNTAKTEAQTNIYMKQL  429

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K   +  WSW  +  +DT   GKG FTA+Q+LDQK V    SDY+WYMT V ++ D  
Sbjct  430   DQKLGNSPEWSWTSDPMEDT-FQGKGTFTASQLLDQKSVTVGASDYLWYMTEVVVN-DTN  487

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASI  874
              W K  ++ VN TG +L+++ NG    +Q    S    + E NI LN G N+++LLS ++
Sbjct  488   TWGK-AKVQVNTTGHILYLFINGFLTGTQHGTVSQPGFIHEGNISLNQGTNIISLLSVTV  546

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G  NYG +FD+   G+ G  V++        V  +L    WSYKVG+ G   K +    K
Sbjct  547   GHANYGAFFDMQETGIVGGPVKLFSIENPNNVL-DLSKSTWSYKVGINGMTKKFYDP--K  603

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LI  1225
             +    QW ++++     MTWYKT+FK P G +PVV+DL+G+ KG AWVNG ++GRYW  +
Sbjct  604   TTIGVQWKTNNVSIGVPMTWYKTTFKTPDGTNPVVLDLIGLQKGEAWVNGQSIGRYWPAM  663

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
             LA+   C ++ CDYRGEYN +KCLS CG P+QRFYHVPRSFLN    N LVLFEE G + 
Sbjct  664   LAENKGC-SDTCDYRGEYNADKCLSGCGEPSQRFYHVPRSFLNND-VNTLVLFEEMGFDA  721

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
             +                            G+ ++ I++A++GD       G  K     +
Sbjct  722   TPFN-------------------------GKTMSEIQFASYGDPE--GSCGSFKIGEWES  754

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + +  +++ AC+GK SCS+  + S F      G    +L V+  C
Sbjct  755   RYSKTVVEKACIGKQSCSINVTSSTFRLKK--GGTNGQLAVQLSC  797



>gb|AES68291.2| beta-galactosidase [Medicago truncatula]
Length=824

 Score =   457 bits (1175),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 257/585 (44%), Positives = 352/585 (60%), Gaps = 37/585 (6%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+KWG + P+RTAED A+SVARFFQ GG  QNYY+YHGGTNFGRTAGGP+I T
Sbjct  250   TENWVGWFQKWGERRPHRTAEDSAFSVARFFQNGGALQNYYLYHGGTNFGRTAGGPFIIT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             TYDY+APLDEYGNL +PKYGHLK LH  +   EK +  G  T     +S+ +T Y   GT
Sbjct  310   TYDYDAPLDEYGNLIEPKYGHLKRLHAAIKLGEKVLTNGTATWESHGDSLWMTTYTNKGT  369

Query  362   --KTCFFSNSNETADATINYQGT-DYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE-  529
               K CF SNS+ + DA ++ Q    Y VPAWS+S+L DC +EVYNTA+   QT + +K+ 
Sbjct  370   GQKFCFLSNSHTSKDAEVDLQQDGKYYVPAWSMSLLQDCNKEVYNTAKTEAQTNIYMKQL  429

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQK-VANDVSDYIWYMTSVNLDKDDP  706
               K   +  WSW  +  +DT   GKG FTA+Q+LDQK V    SDY+WYMT V ++ D  
Sbjct  430   DQKLGNSPEWSWTSDPMEDT-FQGKGTFTASQLLDQKSVTVGASDYLWYMTEVVVN-DTN  487

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTLLSASI  874
              W K  ++ VN TG +L+++ NG    +Q    S    + E NI LN G N+++LLS ++
Sbjct  488   TWGK-AKVQVNTTGHILYLFINGFLTGTQHGTVSQPGFIHEGNISLNQGTNIISLLSVTV  546

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G  NYG +FD+   G+ G  V++        V  +L    WSYKVG+ G   K +    K
Sbjct  547   GHANYGAFFDMQETGIVGGPVKLFSIENPNNVL-DLSKSTWSYKVGINGMTKKFYDP--K  603

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW-LI  1225
             +    QW ++++     MTWYKT+FK P G +PVV+DL+G+ KG AWVNG ++GRYW  +
Sbjct  604   TTIGVQWKTNNVSIGVPMTWYKTTFKTPDGTNPVVLDLIGLQKGEAWVNGQSIGRYWPAM  663

Query  1226  LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNT  1405
             LA+   C ++ CDYRGEYN +KCLS CG P+QRFYHVPR +         VL +      
Sbjct  664   LAENKGC-SDTCDYRGEYNADKCLSGCGEPSQRFYHVPRKW---------VLMQPL----  709

Query  1406  SRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggfekgvcggA  1585
               +R        +CA+A   K  E+ C  G+ ++ I++A++GD       G  K     +
Sbjct  710   -SMRLSKQLPLVLCATADYEKTLELKCPEGKTMSEIQFASYGDPE--GSCGSFKIGEWES  766

Query  1586  KDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
             + +  +++ AC+GK SCS+  + S F      G    +L V+  C
Sbjct  767   RYSKTVVEKACIGKQSCSINVTSSTFRLKK--GGTNGQLAVQLSC  809



>ref|XP_010910537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 6-like [Elaeis 
guineensis]
Length=851

 Score =   456 bits (1173),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 253/617 (41%), Positives = 354/617 (57%), Gaps = 60/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE W+GWF  +GG+ PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  250   TEAWSGWFLSFGGRAPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL++LH  +   E  ++  + T T L  +++  VY   G+
Sbjct  310   SYDYDAPIDEYGIIRQPKWGHLRDLHKAIKLCEAALIATDPTYTSLGPNLEAHVYK-GGS  368

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKE--  529
               C  F +N    +DAT+ + G  Y +PAWSVSILPDC+  V+NTA++++Q T +     
Sbjct  369   GVCAAFLANIGTQSDATVTFNGKSYHLPAWSVSILPDCRNVVFNTAQISSQATHLEMRYL  428

Query  530   -----------GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
                            A+   WS+  E      +     FT + +L+Q     DVSDY+WY
Sbjct  429   TSNSQDSDQPIDSSKASQSDWSFAIEPVG---ISKSDAFTKSGLLEQINTTADVSDYLWY  485

Query  674   MTSVNLDKDDPIW--SKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLN  835
               S+ +  D+          L V   G V+H + NGK   S   N+       E  + L 
Sbjct  486   SISIEIKGDEQFLFNGTQSNLHVESLGHVVHAFVNGKLSGSGMGNSGNAKVTLEKPVTLV  545

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
              GKN + LLSA++G QNYG +FDL G G+ G V++ G++G     K+L S +W+Y++GL+
Sbjct  546   QGKNTIDLLSATVGLQNYGAFFDLWGAGITGPVKLKGQDG----TKDLSSDEWTYQIGLK  601

Query  1013  GEENKLFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAW  1189
             GEE  L+   + S+ +SQW+S   LP  R + WYKT+F AP G D + +D  GMGKG AW
Sbjct  602   GEELALY---DNSKDSSQWVSQPTLPKGRPLIWYKTNFDAPEGNDAIGIDFTGMGKGEAW  658

Query  1190  VNGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             VNG ++GRYW       +  T +C+Y+G Y+++KCL NCG P+Q  YHVPRSF+   G N
Sbjct  659   VNGQSIGRYWPTYISSPNGCTTSCNYKGSYSSDKCLKNCGKPSQHMYHVPRSFIQPDG-N  717

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYEN-------------------KVAEISCQG  1492
              LVLFEE GG+ +++ F T +TG +CA   E+                    V  + C  
Sbjct  718   TLVLFEEVGGDPTKISFATRQTGSLCAHVSESHPSPIDDWISSQRKVGKLGPVVHLECPN  777

Query  1493  GRN-ITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
                 I++IK+A+FG        G        +  A+ +++ AC+G  SCSV  S   FG 
Sbjct  778   ANQVISSIKFASFGTPH--GSCGSYNQGNCSSDSALAVVQQACIGAKSCSVGVSTKTFGD  835

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C G  TK L VEA C
Sbjct  836   P-CTG-ITKSLAVEAAC  850



>gb|ABF95028.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
Length=796

 Score =   454 bits (1167),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 263/617 (43%), Positives = 360/617 (58%), Gaps = 60/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARF+Q GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  195   TENWSGWFLSFGGAVPYRPAEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  254

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++    + + L  + + TVY  A N
Sbjct  255   SYDYDAPIDEYGMVRQPKWGHLRDVHKAIKLCEPALIAAEPSYSSLGQNTEATVYQTADN  314

Query  356   GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQ-TTVMVKEG  532
                  F +N +  +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+Q TT  ++  
Sbjct  315   SICAAFLANVDAQSDKTVKFNGNTYKLPAWSVSILPDCKNVVLNTAQINSQVTTSEMRSL  374

Query  533   GKAA------------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
             G +             A   WS+  E    T    +   T   +++Q     D SD++WY
Sbjct  375   GSSIQDTDDSLITPELATAGWSYAIEPVGIT---KENALTKPGLMEQINTTADASDFLWY  431

Query  674   MTSVNLDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNH  838
              TS+ +  D+P  +     L VN  G VL +Y NGK   S   + S      +T + L  
Sbjct  432   STSIVVKGDEPYLNGSQSNLLVNSLGHVLQIYINGKLAGSAKGSASSSLISLQTPVTLVP  491

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLS ++G  NYG +FDL G G+ G V++ G NG      NL S  W+Y++GLRG
Sbjct  492   GKNKIDLLSTTVGLSNYGAFFDLVGAGVTGPVKLSGPNG----ALNLSSTDWTYQIGLRG  547

Query  1016  EENKLFRSSNKSRSASQWLSDHL-PTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  L+   N S ++ +W+SD+  PT + + WYKT F APAG DPV +D  GMGKG AWV
Sbjct  548   EDLHLY---NPSEASPEWVSDNAYPTNQPLIWYKTKFTAPAGDDPVAIDFTGMGKGEAWV  604

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   LA    C   +C+YRG Y++NKCL  CG P+Q  YHVPRSFL + G N
Sbjct  605   NGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSNKCLKKCGQPSQTLYHVPRSFL-QPGSN  662

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEI----------SCQG---------  1492
             +LVLFE+ GG+ S + F T +T  +CA   E   A+I            QG         
Sbjct  663   DLVLFEQFGGDPSMISFTTRQTSSICAHVSEMHPAQIDSWISPQQTSQTQGPALRLECPR  722

Query  1493  -GRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+ IK+A+FG        G        +  A+ +++ AC+G  +CSV  S + FG 
Sbjct  723   EGQVISNIKFASFGTPS--GTCGNYNHGECSSSQALAVVQEACVGMTNCSVPVSSNNFGD  780

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C+G  TK LVVEA C
Sbjct  781   P-CSGV-TKSLVVEAAC  795



>ref|XP_006649762.1| PREDICTED: beta-galactosidase 6-like [Oryza brachyantha]
Length=793

 Score =   453 bits (1165),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 258/611 (42%), Positives = 356/611 (58%), Gaps = 51/611 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARF+Q GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  195   TENWSGWFLSFGGAVPYRPAEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  254

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  +V    + + L  + + TVY   G 
Sbjct  255   SYDYDAPIDEYGMVRQPKWGHLRDVHKAIKLCEPALVAAEPSYSSLGQNAEATVYQTAGN  314

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE  529
               C  F +N +  +D T+ + G  YK+PAWSVSILPDCK  V NTA++NTQ T   M   
Sbjct  315   SVCAAFLANMDAQSDKTVKFNGNMYKLPAWSVSILPDCKNVVLNTAQINTQVTTSEMRSL  374

Query  530   GGKAAAALRWSWRPEVA--------DDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTS  682
             G         S  PE+A        +   +  +   T   +++Q     D SD++WY TS
Sbjct  375   GSSTQGTDDSSITPELATAGWSYAIEPVGITKENALTKPGLMEQINTTADASDFLWYSTS  434

Query  683   VNLDKDDP-IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKN  847
             + +  D+P +      L V+  G VL VY NGK   +   + S      +T + L  GKN
Sbjct  435   IIVKGDEPYLNGSQSNLLVSSLGHVLQVYINGKLAGNAKGSASSSLISLQTPVTLVPGKN  494

Query  848   LLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEEN  1024
              + LLS ++G  NYG +FDL G G+ G V++ G NG      +L S  W+Y+VGLRGE+ 
Sbjct  495   KIDLLSTTVGLSNYGAFFDLVGAGITGPVKLSGLNG----ALDLSSTGWTYQVGLRGEDL  550

Query  1025  KLFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGN  1201
              L+   N S ++ +W+SD+  P  + + WYKT F APAG  PV +D  GMGKG AWVNG 
Sbjct  551   HLY---NPSEASPEWVSDNSYPINQPLIWYKTKFMAPAGDHPVAIDFTGMGKGEAWVNGQ  607

Query  1202  NLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELV  1378
             ++GRYW   LA    C   +C+YRG Y++NKCL+ CG P+Q  YHVPRSFL + G N+LV
Sbjct  608   SIGRYWPTNLAPQSGC-VNSCNYRGAYSSNKCLNKCGQPSQTLYHVPRSFL-QPGSNDLV  665

Query  1379  LFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISC-----------------QGGRNIT  1507
             LFE+ GG+ S + F T +T  +CA   E   A+I                   + G+ I+
Sbjct  666   LFEQFGGDPSMISFTTRQTTSICAHVSEMHPAQIDSWISQSQRPGPAIRLECPREGQVIS  725

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
              IK+A+FG        G        +  A+ +++ AC+G  +C+V  S + FG   C+G 
Sbjct  726   NIKFASFGTPS--GTCGNYNHGECSSSQALAVVQEACVGVRNCTVPVSSTNFGDP-CSGV  782

Query  1688  RTKKLVVEAVC  1720
              TK LVVEA C
Sbjct  783   -TKSLVVEAAC  792



>gb|EAZ24672.1| hypothetical protein OsJ_08441 [Oryza sativa Japonica Group]
Length=861

 Score =   454 bits (1168),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 263/617 (43%), Positives = 360/617 (58%), Gaps = 60/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARF+Q GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  260   TENWSGWFLSFGGAVPYRPAEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  319

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++    + + L  + + TVY  A N
Sbjct  320   SYDYDAPIDEYGMVRQPKWGHLRDVHKAIKLCEPALIAAEPSYSSLGQNTEATVYQTADN  379

Query  356   GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQ-TTVMVKEG  532
                  F +N +  +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+Q TT  ++  
Sbjct  380   SICAAFLANVDAQSDKTVKFNGNTYKLPAWSVSILPDCKNVVLNTAQINSQVTTSEMRSL  439

Query  533   GKAA------------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
             G +             A   WS+  E    T    +   T   +++Q     D SD++WY
Sbjct  440   GSSIQDTDDSLITPELATAGWSYAIEPVGIT---KENALTKPGLMEQINTTADASDFLWY  496

Query  674   MTSVNLDKDDP-IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNH  838
              TS+ +  D+P +      L VN  G VL +Y NGK   S   + S      +T + L  
Sbjct  497   STSIVVKGDEPYLNGSQSNLLVNSLGHVLQIYINGKLAGSAKGSASSSLISLQTPVTLVP  556

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLS ++G  NYG +FDL G G+ G V++ G NG      NL S  W+Y++GLRG
Sbjct  557   GKNKIDLLSTTVGLSNYGAFFDLVGAGVTGPVKLSGPNG----ALNLSSTDWTYQIGLRG  612

Query  1016  EENKLFRSSNKSRSASQWLSDHL-PTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  L+   N S ++ +W+SD+  PT + + WYKT F APAG DPV +D  GMGKG AWV
Sbjct  613   EDLHLY---NPSEASPEWVSDNAYPTNQPLIWYKTKFTAPAGDDPVAIDFTGMGKGEAWV  669

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   LA    C   +C+YRG Y++NKCL  CG P+Q  YHVPRSFL + G N
Sbjct  670   NGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSNKCLKKCGQPSQTLYHVPRSFL-QPGSN  727

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEI----------SCQG---------  1492
             +LVLFE+ GG+ S + F T +T  +CA   E   A+I            QG         
Sbjct  728   DLVLFEQFGGDPSMISFTTRQTSSICAHVSEMHPAQIDSWISPQQTSQTQGPALRLECPR  787

Query  1493  -GRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+ IK+A+FG        G        +  A+ +++ AC+G  +CSV  S + FG 
Sbjct  788   EGQVISNIKFASFGTPS--GTCGNYNHGECSSSQALAVVQEACVGMTNCSVPVSSNNFGD  845

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C+G  TK LVVEA C
Sbjct  846   P-CSGV-TKSLVVEAAC  860



>ref|XP_006340153.1| PREDICTED: beta-galactosidase 8-like [Solanum tuberosum]
Length=852

 Score =   454 bits (1167),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 261/606 (43%), Positives = 352/606 (58%), Gaps = 46/606 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  259   TENWTGWFLSFGGPVPYRPVEDIAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  318

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG + QPK+GHLK+LH  +   E  +V  +   T L ++I+ +VY  +  
Sbjct  319   SYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAAMVATDPNITSLGSTIEASVYKTDSQ  378

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKEGG  535
                F +N+   +DA +++ G  Y +P WSVSILPDCK   +NTA++N+ +T+   V +  
Sbjct  379   CAAFLANTATQSDAAVSFNGNSYHLPPWSVSILPDCKNVAFNTAKINSVSTISTFVTQSS  438

Query  536   KA-AAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPI  709
             +A A+    S    V +   +  +  FT   +++Q  +  D SDY+WY  SVN+  D+P 
Sbjct  439   EADASGASLSGWTSVNEPVGISSENAFTRMGLVEQINITADKSDYLWYSLSVNIKNDEPF  498

Query  710   WS--KDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSAS  871
                     L V   G VLH + NGK   S   N    N   E  + L  G N + LLSA+
Sbjct  499   LQDGSATVLHVKTLGHVLHAFINGKLSGSGKGNSGHSNFTIEVPVTLVPGVNKIDLLSAT  558

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
             +G QNYG +FDL G G+ G V++ G KNG  T   +L S +W+Y+VGL+GEE  L     
Sbjct  559   VGLQNYGAFFDLKGAGITGPVQLKGFKNGSTT---DLSSKQWTYQVGLKGEEMGL-----  610

Query  1046  KSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              S  ++ W S   LPT + + WYK SF APAG  P+ +D  GMGKG AWVNG ++GR+W 
Sbjct  611   SSGGSTLWKSQTELPTNQPLIWYKASFDAPAGDTPLSMDFTGMGKGEAWVNGQSIGRFWP  670

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                  +   T+ C+YRG YN NKCL NCG P+Q  YHVPRS+L   G N LVLFEE GG+
Sbjct  671   TYTAPNSGCTDPCNYRGGYNANKCLKNCGKPSQLLYHVPRSWLKSSG-NVLVLFEEMGGD  729

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEI----SCQGGRN----------------ITAIKYA  1522
              +++ F T     VC+   E     I    S    RN                I++IK+A
Sbjct  730   PTKLSFATREIQSVCSRISEAHPLPIDMWASEDDARNKSGPTLSLECPHPNQVISSIKFA  789

Query  1523  NFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKL  1702
             +FG  +     G        + +A++I+K AC+G  SCS+  S +VFG   C G   K L
Sbjct  790   SFGTPQ--GTCGSFIHGRCSSSNALSIVKKACIGSKSCSLGVSINVFGEP-CKGV-AKSL  845

Query  1703  VVEAVC  1720
              VEA C
Sbjct  846   AVEASC  851



>sp|Q10NX8.2|BGAL6_ORYSJ RecName: Full=Beta-galactosidase 6; Short=Lactase 6; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=858

 Score =   454 bits (1168),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 263/617 (43%), Positives = 360/617 (58%), Gaps = 60/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARF+Q GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  257   TENWSGWFLSFGGAVPYRPAEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  316

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++    + + L  + + TVY  A N
Sbjct  317   SYDYDAPIDEYGMVRQPKWGHLRDVHKAIKLCEPALIAAEPSYSSLGQNTEATVYQTADN  376

Query  356   GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQ-TTVMVKEG  532
                  F +N +  +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+Q TT  ++  
Sbjct  377   SICAAFLANVDAQSDKTVKFNGNTYKLPAWSVSILPDCKNVVLNTAQINSQVTTSEMRSL  436

Query  533   GKAA------------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
             G +             A   WS+  E    T    +   T   +++Q     D SD++WY
Sbjct  437   GSSIQDTDDSLITPELATAGWSYAIEPVGIT---KENALTKPGLMEQINTTADASDFLWY  493

Query  674   MTSVNLDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNH  838
              TS+ +  D+P  +     L VN  G VL +Y NGK   S   + S      +T + L  
Sbjct  494   STSIVVKGDEPYLNGSQSNLLVNSLGHVLQIYINGKLAGSAKGSASSSLISLQTPVTLVP  553

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLS ++G  NYG +FDL G G+ G V++ G NG      NL S  W+Y++GLRG
Sbjct  554   GKNKIDLLSTTVGLSNYGAFFDLVGAGVTGPVKLSGPNG----ALNLSSTDWTYQIGLRG  609

Query  1016  EENKLFRSSNKSRSASQWLSDHL-PTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  L+   N S ++ +W+SD+  PT + + WYKT F APAG DPV +D  GMGKG AWV
Sbjct  610   EDLHLY---NPSEASPEWVSDNAYPTNQPLIWYKTKFTAPAGDDPVAIDFTGMGKGEAWV  666

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   LA    C   +C+YRG Y++NKCL  CG P+Q  YHVPRSFL + G N
Sbjct  667   NGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSNKCLKKCGQPSQTLYHVPRSFL-QPGSN  724

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEI----------SCQG---------  1492
             +LVLFE+ GG+ S + F T +T  +CA   E   A+I            QG         
Sbjct  725   DLVLFEQFGGDPSMISFTTRQTSSICAHVSEMHPAQIDSWISPQQTSQTQGPALRLECPR  784

Query  1493  -GRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+ IK+A+FG        G        +  A+ +++ AC+G  +CSV  S + FG 
Sbjct  785   EGQVISNIKFASFGTPS--GTCGNYNHGECSSSQALAVVQEACVGMTNCSVPVSSNNFGD  842

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C+G  TK LVVEA C
Sbjct  843   P-CSGV-TKSLVVEAAC  857



>ref|XP_009398591.1| PREDICTED: beta-galactosidase 6-like [Musa acuminata subsp. malaccensis]
Length=861

 Score =   454 bits (1167),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 252/611 (41%), Positives = 353/611 (58%), Gaps = 52/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNFGRT GGP+I T
Sbjct  264   TENWTGWFLSFGGGVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTTGGPFIAT  323

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG L QPK+GHL++LH V+   E  +V  + T T L  +++  VY   +G
Sbjct  324   SYDYDAPIDEYGILRQPKWGHLRDLHKVIKLCEGALVATDPTYTSLGQNLEAHVYKTASG  383

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM----VK  526
             +   F +N    +DAT+ + G  Y +PAWSVSILPDC+  V+NTA++N+Q+T++    VK
Sbjct  384   SCAAFLANVGTQSDATVTFNGKTYNLPAWSVSILPDCQNVVFNTAQINSQSTLLETKYVK  443

Query  527   EGGKAA---------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYM  676
                +A+         +   W++  E    T       FT   +L+Q     D SDY+WY 
Sbjct  444   TYSQASDQPINSSEISESSWTFIKEPVGIT---KSSAFTKVGLLEQINTTADASDYLWYS  500

Query  677   TSVNLDKDDPIW--SKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNH  838
             TS++++ ++P         L V   G VLH + NG+   S   N+       + +I L  
Sbjct  501   TSIDINGNEPFLFNGTQTTLHVESLGHVLHAFVNGQLSGSGMGNSDNAKVTLDKSIMLAP  560

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGE  1018
             GKN + LLSA++G QNYG +FDL G G+ G  ++      T   +L S+ W+Y++GL+GE
Sbjct  561   GKNKIDLLSATVGLQNYGAFFDLWGAGITGPVMLKGQKSTT---DLSSNDWTYQIGLKGE  617

Query  1019  ENKLFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVN  1195
             E  ++  S  S   S W+S   LP  + + WYK  F AP G DPV +D  GMGKG AWVN
Sbjct  618   ELGIYEESGDS---SIWISQSALPKNQPLVWYKGYFDAPEGNDPVAIDFTGMGKGEAWVN  674

Query  1196  GNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNEL  1375
             G ++GRYW          T +C+YRG +++NKCL NCG P+QR YHVPRS + + G N L
Sbjct  675   GQSIGRYWPAYVSPQTGCTTSCNYRGAFSSNKCLKNCGKPSQRLYHVPRSLI-QSGKNRL  733

Query  1376  VLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQG----------------GRNIT  1507
             VLFEE  G+ +++ F T +T  +C    E+  A +  QG                 + I+
Sbjct  734   VLFEEMSGDPTQISFATRQTVSLCGHVSESHPALLDAQGTAPSNVPMLRLECPYPNQKIS  793

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A+FG        G        + DA+ +++ AC+G  SC V  S  +FG  +   +
Sbjct  794   SIKFASFGTPH--GTCGSYNHGKCSSDDALAVMQQACIGVQSCDVEVSIKLFG--DPCRN  849

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  850   VIKSLAVEAAC  860



>gb|KDP44070.1| hypothetical protein JCGZ_05537 [Jatropha curcas]
Length=845

 Score =   452 bits (1164),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 253/610 (41%), Positives = 358/610 (59%), Gaps = 53/610 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARFFQLGGTFQNYYMYHGGTNF R++GGP+I T
Sbjct  251   TENWSGWFVSFGGAVPYRPVEDLAFAVARFFQLGGTFQNYYMYHGGTNFDRSSGGPFIAT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG L QPK+GHLK+LH  +   E+ ++  + +TT L ++++ TVY     
Sbjct  311   SYDYDAPLDEYGLLRQPKWGHLKDLHKAIKLCEEALIATDPSTTSLGSNLEATVYKTGSG  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV-------M  520
                 F  +  T D T+ + G  Y +PAWSVSILPDCK  V+NTA++N+ T +       +
Sbjct  371   LCAAFLANVATTDKTVTFNGNSYNLPAWSVSILPDCKNVVFNTAKINSMTVISSFTRQSL  430

Query  521   VKE-GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             V +     A    WSW   + +   +  K  F  + +L+Q     D SDY+WY  S N+ 
Sbjct  431   VGDVQSSKALGSDWSW---INEPVGISKKDAFVKSVLLEQINTTADKSDYLWYSLSTNIK  487

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDS---QWNNNSL-FETNIKLNHGKNLLT  856
              ++P      +  L V   G  LH + NGK   S   +++N  +  +  I +  GKN + 
Sbjct  488   GNEPFLDDGSQTVLHVESLGHALHAFVNGKLAGSATGKYSNPKVAVDIPITVVPGKNTID  547

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LLS ++G QNYG +++L G G+ G V++ G+NG+     +L S +W+Y++GL+GEE  L 
Sbjct  548   LLSLTVGLQNYGAFYELTGAGITGPVKLKGQNGNTV---DLSSEQWTYQIGLQGEELGL-  603

Query  1034  RSSNKSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S+SQW+S  +LPT + + WYKTSF A AG DP+ +D  GMGKG AWVNG ++G
Sbjct  604   ----PSGSSSQWISQPNLPTNQPLIWYKTSFAAAAGDDPIAIDFTGMGKGEAWVNGQSIG  659

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW      +   T++C YRG YN+NKCL NC  P+Q  YHVPRS++   G N LVLFEE
Sbjct  660   RYWPTYVSPNSGCTDSCSYRGSYNSNKCLKNCAKPSQTLYHVPRSWVKPNG-NILVLFEE  718

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEI-------------------SCQGGRN-ITA  1510
              GG+ +++ F T +   +C+   E+    +                    CQ     I++
Sbjct  719   VGGDPTQIAFATRQAESLCSHVSESHPQPVDMWNTDSEATKKSGPKLLLECQNPNQVISS  778

Query  1511  IKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSR  1690
             IK+A+FG        G  K     + +A++I+  AC+G  +C+V  S S FG   C G R
Sbjct  779   IKFASFGTPH--GTCGSFKHGQCSSSNALSIVHKACVGSKTCNVGVSTSTFGDP-CRGVR  835

Query  1691  TKKLVVEAVC  1720
              K L VE +C
Sbjct  836   -KSLAVEVLC  844



>ref|XP_011089316.1| PREDICTED: beta-galactosidase 8-like [Sesamum indicum]
Length=843

 Score =   452 bits (1163),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 257/612 (42%), Positives = 362/612 (59%), Gaps = 55/612 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA+SVARF+QLGGTFQNYYMYHGGTNFGR+ GGP+ITT
Sbjct  247   TENWSGWFSAFGDPLPYRPVEDLAFSVARFYQLGGTFQNYYMYHGGTNFGRSTGGPFITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHLK++H  +   E+ +V  +  TT L ++++ TVY   G+
Sbjct  307   SYDYDAPIDEYGLLRQPKWGHLKDVHKAIKLCEEAMVATDPKTTSLGSNLEATVYK-TGS  365

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE  529
               C  F +N    +DAT+ + G  Y +PAWSVSILPDCK  V NTA++N+ +T+   V++
Sbjct  366   GQCAAFLANVGTQSDATVKFNGNSYNLPAWSVSILPDCKNVVLNTAKINSVSTMTKFVRQ  425

Query  530   GGK------AAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
               K       A    WSW   + +   +     FT   +L+Q     D SDY+WY  SV 
Sbjct  426   PSKDDSTATDAFVSGWSW---INEPVGISSDSAFTKPGLLEQINTTADQSDYLWYSLSVE  482

Query  689   LDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSLFETNI----KLNHGKNL  850
             +  D+P      +  L V+  G VL+ + NGK+  S    +S  + +I     L  GKN 
Sbjct  483   MKGDEPFLGDGSQTVLHVDSLGHVLYAFINGKFAGSGKGGSSNSKVSINVPMSLQPGKNK  542

Query  851   LTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENK  1027
             + LLS ++G  NYG +FD  G G+ G V++       T+  +L S +W+Y++GL+GEE  
Sbjct  543   IDLLSLTVGLANYGAFFDTRGAGVTGPVQLKSSKNGSTI--DLSSQQWTYQIGLKGEELG  600

Query  1028  LFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNN  1204
             L      S ++S W ++  LP  + + WYKT+F AP+G  P+ +D MG+GKG AW+NG +
Sbjct  601   L-----ASGTSSLWTTEPTLPKNQPLVWYKTTFDAPSGSSPLALDFMGLGKGQAWINGQS  655

Query  1205  LGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             +GRYW     G+   T++C+YRG Y+++KCL NCG P+Q+ YHVPRS+L   G N LVLF
Sbjct  656   IGRYWPTNIAGNSGCTDSCNYRGAYSSSKCLKNCGKPSQQLYHVPRSWLKPSG-NILVLF  714

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYEN-------------------KVAEISCQ-GGRNI  1504
             EE GGN +++ F T  T  +CA   EN                    +  ++C    + I
Sbjct  715   EEMGGNPTQLSFATRETQSICARISENHPLPVDMWTSDDETRKTAGPILSLACPLANQVI  774

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             + IK+A+FG  R     G        +K A ++++ AC+G  SCS+  S S FG   CAG
Sbjct  775   SEIKFASFGTPR--GTCGSFSHGRCTSKMARSVVEKACIGSRSCSIGVSVSTFGDP-CAG  831

Query  1685  SRTKKLVVEAVC  1720
               TK L VEA C
Sbjct  832   -ITKSLAVEASC  842



>ref|NP_001049591.1| Os03g0255100 [Oryza sativa Japonica Group]
 gb|ABF95027.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11505.1| Os03g0255100 [Oryza sativa Japonica Group]
 dbj|BAG90437.1| unnamed protein product [Oryza sativa Japonica Group]
Length=956

 Score =   456 bits (1172),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 264/617 (43%), Positives = 361/617 (59%), Gaps = 60/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARF+Q GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  355   TENWSGWFLSFGGAVPYRPAEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  414

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++    + + L  + + TVY  A N
Sbjct  415   SYDYDAPIDEYGMVRQPKWGHLRDVHKAIKLCEPALIAAEPSYSSLGQNTEATVYQTADN  474

Query  356   GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQ-TTVMVKEG  532
                  F +N +  +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+Q TT  ++  
Sbjct  475   SICAAFLANVDAQSDKTVKFNGNTYKLPAWSVSILPDCKNVVLNTAQINSQVTTSEMRSL  534

Query  533   GKAA------------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
             G +             A   WS+  E    T    +   T   +++Q     D SD++WY
Sbjct  535   GSSIQDTDDSLITPELATAGWSYAIEPVGIT---KENALTKPGLMEQINTTADASDFLWY  591

Query  674   MTSVNLDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNH  838
              TS+ +  D+P  +     L VN  G VL +Y NGK   S   + S      +T + L  
Sbjct  592   STSIVVKGDEPYLNGSQSNLLVNSLGHVLQIYINGKLAGSAKGSASSSLISLQTPVTLVP  651

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLS ++G  NYG +FDL G G+ G V++ G NG      NL S  W+Y++GLRG
Sbjct  652   GKNKIDLLSTTVGLSNYGAFFDLVGAGVTGPVKLSGPNG----ALNLSSTDWTYQIGLRG  707

Query  1016  EENKLFRSSNKSRSASQWLSDHL-PTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  L+   N S ++ +W+SD+  PT + + WYKT F APAG DPV +D  GMGKG AWV
Sbjct  708   EDLHLY---NPSEASPEWVSDNAYPTNQPLIWYKTKFTAPAGDDPVAIDFTGMGKGEAWV  764

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   LA    C   +C+YRG Y++NKCL  CG P+Q  YHVPRSFL + G N
Sbjct  765   NGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSNKCLKKCGQPSQTLYHVPRSFL-QPGSN  822

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEI----------SCQG---------  1492
             +LVLFE+ GG+ S + F T +T  +CA   E   A+I            QG         
Sbjct  823   DLVLFEQFGGDPSMISFTTRQTSSICAHVSEMHPAQIDSWISPQQTSQTQGPALRLECPR  882

Query  1493  -GRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+ IK+A+FG    S   G        +  A+ +++ AC+G  +CSV  S + FG 
Sbjct  883   EGQVISNIKFASFGTP--SGTCGNYNHGECSSSQALAVVQEACVGMTNCSVPVSSNNFGD  940

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C+G  TK LVVEA C
Sbjct  941   P-CSGV-TKSLVVEAAC  955



>gb|EAY89299.1| hypothetical protein OsI_10800 [Oryza sativa Indica Group]
Length=861

 Score =   452 bits (1163),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 261/617 (42%), Positives = 358/617 (58%), Gaps = 60/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARF+Q GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  260   TENWSGWFLSFGGAVPYRPAEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  319

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY--AFN  355
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++    + + L  + + TVY  A N
Sbjct  320   SYDYDAPIDEYGMVRQPKWGHLRDVHKAIKLCEPALIAAEPSYSSLGQNTEATVYQTADN  379

Query  356   GTKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQ-TTVMVKEG  532
                  F +N +  +D  + + G  YK+PAWSVSILPDCK  V NTA++N+Q TT  ++  
Sbjct  380   SICAAFLANVDAQSDKAVKFNGNTYKLPAWSVSILPDCKNVVLNTAQINSQVTTSEMRSL  439

Query  533   GKAA------------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWY  673
             G +             A   WS+  E    T    +   T   +++Q     D SD++WY
Sbjct  440   GSSIQDTDDSLITPELATAGWSYAIEPVGIT---KENALTKPGLMEQINTTADASDFLWY  496

Query  674   MTSVNLDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNH  838
              TS+ +  D+P  +     L VN  G VL VY NGK   S   + S      +T + L  
Sbjct  497   STSIVVKGDEPYLNGSQSNLLVNSLGHVLQVYINGKLAGSAKGSASSSLISLQTPVTLVP  556

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             GKN + LLS ++G  NYG +FDL G G+ G V++ G NG      NL S  W+Y++GLRG
Sbjct  557   GKNKIDLLSTTVGLSNYGAFFDLIGAGVTGPVKLSGPNG----ALNLSSTDWTYQIGLRG  612

Query  1016  EENKLFRSSNKSRSASQWLSDHL-PTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  L+   N S ++ +W+SD+  PT + + WYKT F APAG DPV +D  GMGKG AWV
Sbjct  613   EDLHLY---NPSEASPEWVSDNAYPTNQPLIWYKTKFTAPAGDDPVAIDFTGMGKGEAWV  669

Query  1193  NGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             NG ++GRYW   LA    C   +C+YRG Y++NKCL  CG P+Q  YHVPRSFL + G N
Sbjct  670   NGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSNKCLKKCGQPSQTLYHVPRSFL-QPGSN  727

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISC--------------------Q  1489
             +LVLFE+ GG+ S + F T +T  +CA   E   A+I                      +
Sbjct  728   DLVLFEQFGGDPSMISFTTRQTSSICAHVSEMHPAQIDSWISPQQTSQTPGPALRLECPR  787

Query  1490  GGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+ IK+A+FG        G        +  A+ +++ AC+G  +CSV  S + FG 
Sbjct  788   EGQVISNIKFASFGTPS--GTCGNYNHGECSSSQALAVVQEACVGMTNCSVPVSSNNFGD  845

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C+G  TK LVVEA C
Sbjct  846   P-CSGV-TKSLVVEAAC  860



>ref|XP_009766589.1| PREDICTED: beta-galactosidase 8 [Nicotiana sylvestris]
Length=846

 Score =   452 bits (1162),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 254/608 (42%), Positives = 348/608 (57%), Gaps = 50/608 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I+T
Sbjct  253   TENWTGWFLSFGGAVPYRPVEDIAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIST  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG + QPK+GHLK+LH  +   E  +V  + T T   ++I+V+VY     
Sbjct  313   SYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAAMVATDPTITSPGSNIEVSVYKTGSV  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F +N    +DA + + G  Y +P WSVSILPDCK   ++TA++N+ +T+        
Sbjct  373   CAAFLANVGTQSDAAVTFNGNSYHLPPWSVSILPDCKNVAFSTAKINSMSTISKFVTQST  432

Query  524   KEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKD  700
             +  G  A+   W+W   V +   +     FT   +++Q     D SDY+WY  SVN+  D
Sbjct  433   EADGSGASLSGWTW---VNEPVGISSDNAFTKTGLMEQINTTADKSDYLWYSLSVNVKND  489

Query  701   DPIWSKDMR--LGVNGTGQVLHVYANGKYVDS----QWNNNSLFETNIKLNHGKNLLTLL  862
             +P      +  L V   G VLH + NGK   S      N+    +  + L  G+N + LL
Sbjct  490   EPFLQDGSQTVLHVESLGHVLHAFINGKLSGSGKGNSGNSKVTIDVPVTLVPGENKIDLL  549

Query  863   SASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             S ++G QNYG +FDL G G+ G V++ G     T+  +L S +W+Y+VGL+GEE  L   
Sbjct  550   SVTVGLQNYGAFFDLKGAGITGPVQLKGFKNGSTI--DLSSKQWTYQVGLKGEELGL---  604

Query  1040  SNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                  S+S W S   LPT + + WYK SF APAG  P+ +D  GMGKG AWVNG ++GR+
Sbjct  605   --SDGSSSLWKSQSALPTNQPLIWYKASFDAPAGDTPLSLDFTGMGKGEAWVNGQSIGRF  662

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W      +   T++C+YRG YN+NKCL NCG P+Q  YHVPRS+L   G N +VLFEE G
Sbjct  663   WPTNTASNGGCTDSCNYRGSYNSNKCLKNCGKPSQLLYHVPRSWLQSTG-NVIVLFEEMG  721

Query  1397  GNTSRVRFQTVRTGGVCASAYENKVAEI-----------------SCQGGRN---ITAIK  1516
             GN +++ F T  T  +C+   E     I                 S +  R    I+++K
Sbjct  722   GNPTKLSFATRETSSICSRVSEAHPLPIDKWTSDDDARKKVGPTLSLECPRPDQVISSVK  781

Query  1517  YANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK  1696
             +A+FG        G        + +A++ +K AC+G   CSV  S  VFG   C G  TK
Sbjct  782   FASFGTPH--GACGSFSHGRCTSSNALSHVKKACIGSKRCSVGVSIDVFGDP-CIGV-TK  837

Query  1697  KLVVEAVC  1720
              L VEA C
Sbjct  838   SLAVEASC  845



>ref|XP_009595284.1| PREDICTED: beta-galactosidase 8 [Nicotiana tomentosiformis]
 ref|XP_009595285.1| PREDICTED: beta-galactosidase 8 [Nicotiana tomentosiformis]
Length=846

 Score =   451 bits (1160),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 253/608 (42%), Positives = 348/608 (57%), Gaps = 50/608 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I+T
Sbjct  253   TENWTGWFLSFGGAVPYRPVEDIAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIST  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG + QPK+GHLK+LH  +   E  +V  + T T   ++++V+VY     
Sbjct  313   SYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAAMVATDPTITSPGSNLEVSVYKTGSV  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F +N    +DA + + G  Y +P WSVSILPDCK   ++TA++N+ +T+        
Sbjct  373   CAAFLANVGTQSDAAVTFNGNSYHLPPWSVSILPDCKNVAFSTAKINSMSTISKFVTQST  432

Query  524   KEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKD  700
             +  G  A+   W+W   V +   +     FT   +++Q     D SDY+WY  SVN+  D
Sbjct  433   EADGSGASLSGWTW---VNEPVGISSDNAFTKMGLMEQINTTADKSDYLWYSLSVNVKND  489

Query  701   DPIWSKDMR--LGVNGTGQVLHVYANGKYVDS----QWNNNSLFETNIKLNHGKNLLTLL  862
             +P      +  L V   G VLH + NGK   S      N+    +  + L  G+N + LL
Sbjct  490   EPFLQDGSQTVLHVESLGHVLHAFINGKLSGSGKGNSGNSRVTIDVPVTLAPGENKIDLL  549

Query  863   SASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             S ++G QNYG +FDL G G+ G V++ G     T+  +L S +W+Y+VGL+GEE  L   
Sbjct  550   SVTVGLQNYGAFFDLKGAGITGPVQLKGFKNGSTI--DLSSKQWTYQVGLKGEELGL---  604

Query  1040  SNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                  S+S W S   LPT + + WYK SF APAG  P+ +D  GMGKG AWVNG ++GR+
Sbjct  605   --SDGSSSLWKSQSALPTNQPLIWYKASFDAPAGDTPLSLDFTGMGKGEAWVNGQSIGRF  662

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W      +   T++C+YRG YN+NKCL NCG P+Q  YHVPRS+L   G N +VLFEE G
Sbjct  663   WPTYTASNGGCTDSCNYRGSYNSNKCLKNCGKPSQLLYHVPRSWLQSSG-NVIVLFEEMG  721

Query  1397  GNTSRVRFQTVRTGGVCASAYENKVAEI-----------------SCQGGRN---ITAIK  1516
             GN +++ F T  T  +C+   E     I                 S +  R    I++IK
Sbjct  722   GNPTKLSFATRETSSICSRVSEAHPLPIDKWTSDDDARKKVGPTLSLECPRPDQVISSIK  781

Query  1517  YANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK  1696
             +A+FG        G        + +A++ +K AC+G   CS+  S  VFG   C G  TK
Sbjct  782   FASFGTPH--GACGSFSHGRCTSSNALSHVKKACIGSKRCSLGVSIDVFGDP-CIGV-TK  837

Query  1697  KLVVEAVC  1720
              L VEA C
Sbjct  838   SLAVEASC  845



>ref|XP_007015421.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 ref|XP_007015422.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 ref|XP_007015423.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 gb|EOY33040.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 gb|EOY33041.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
 gb|EOY33042.1| Beta-galactosidase 8 isoform 1 [Theobroma cacao]
Length=845

 Score =   451 bits (1159),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 255/613 (42%), Positives = 354/613 (58%), Gaps = 57/613 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  249   TENWTGWFLSFGGAVPYRPVEDIAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG++ QPK+GHL+++H  +   E+ ++  + T + L  +++  VY   G+
Sbjct  309   SYDYDAPIDEYGHVRQPKWGHLRDVHKAIKLCEEALIATDPTISSLGPNLESAVYK-TGS  367

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM-----  520
               C  F +N    +DAT+N+ G+ Y +PAWSVSILPDCK  V NTA++N+ T +      
Sbjct  368   GLCAAFLANVGTQSDATVNFDGSSYHLPAWSVSILPDCKNVVLNTAKINSMTVIPSFMHE  427

Query  521   ---VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
                +      A    WSW   V +   +     F    +L+Q     D SDY+WY  S +
Sbjct  428   PLNINADSTEAIGTSWSW---VYEPVGISKADAFKKLGLLEQINTTADKSDYLWYSFSTD  484

Query  689   LDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNN--NSLFETNIKLN--HGKNL  850
             ++ D+P      +  L V   G  LH + NGK   S   N  N+  + +I +    GKN 
Sbjct  485   IEGDEPFLEDGSQTVLHVESLGHALHAFINGKLAGSGTGNSGNAKVKVDIPVTVGPGKNT  544

Query  851   LTLLSASIGFQNYGPYFDLGGNGLYG-VEIVG-KNGDETVRKNLGSHKWSYKVGLRGEEN  1024
             + LLS ++G QNYG +FDL G G+ G V++ G KNG      +L S +W Y+VGL+GE+ 
Sbjct  545   IDLLSLTVGLQNYGAFFDLVGAGITGPVKLNGLKNGSSI---DLSSQQWMYQVGLKGEDL  601

Query  1025  KLFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGN  1201
              L      S S+SQW+S   LP  + + WYKT+F APAG DP+ +D  GMGKG AWVNG 
Sbjct  602   GL-----PSGSSSQWISKSTLPKNQPLIWYKTNFDAPAGNDPIALDFTGMGKGEAWVNGQ  656

Query  1202  NLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVL  1381
             ++GRYW          T++C+YRG YN+NKCL NCG P+Q+ YHVPRS+L   G N LVL
Sbjct  657   SIGRYWPAYVSRSGGCTDSCNYRGSYNSNKCLKNCGKPSQQLYHVPRSWLQPSG-NILVL  715

Query  1382  FEETGGNTSRVRFQTVRTGGVCASAYE-------------------NKVAEISCQGGRN-  1501
             FEE GG+ +++ F T + G +C+   E                   + +  + C      
Sbjct  716   FEELGGDPTQLAFATRQMGSLCSHVSESHPLPVDMWSSDSKTGRTSSPILSLVCPSPNQV  775

Query  1502  ITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCA  1681
             I++IK+A+FG  R     G        +  A++I++ AC G   CS+  S S FG   C 
Sbjct  776   ISSIKFASFGTPR--GTCGSFSHGRCSSVRALSIVQKACTGSTRCSIGVSTSTFGDP-CK  832

Query  1682  GSRTKKLVVEAVC  1720
             G   K L VE  C
Sbjct  833   GV-MKSLAVEVSC  844



>dbj|BAJ89450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=763

 Score =   446 bits (1148),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 250/612 (41%), Positives = 351/612 (57%), Gaps = 52/612 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GGT QNYYMYHGGTNFGR++GGP+I+T
Sbjct  164   TENWSGWFLSFGGAVPYRPTEDLAFAVARFYQRGGTLQNYYMYHGGTNFGRSSGGPFIST  223

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++  + +   L  + +  VY     
Sbjct  224   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKMCEPALIATDPSYMSLGQNAEAHVYKSGSL  283

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQT----------  511
                F +N ++ +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+Q           
Sbjct  284   CAAFLANIDDQSDKTVTFNGKAYKLPAWSVSILPDCKNVVLNTAQINSQVASTQMRNLGF  343

Query  512   TVMVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
             +    +G    A L  S      +   +  +   T   +++Q     D SD++WY TS+ 
Sbjct  344   STQASDGSSVEAELAASSWSYAVEPVGITKENALTKPGLMEQINTTADASDFLWYSTSIV  403

Query  689   LDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLL  853
             +   +P  +     L VN  G VL V+ NGK   S   + S       T + L  GKN +
Sbjct  404   VAGGEPYLNGSQSNLPVNSLGHVLQVFINGKLAGSSKGSASSSLISLTTPVTLVTGKNKI  463

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLSA++G  NYG +FDL G G+ G V++ G  G      +L S +W+Y++GLRGE+  L
Sbjct  464   DLLSATVGLTNYGAFFDLVGAGITGPVKLTGPKG----TLDLSSAEWTYQIGLRGEDLHL  519

Query  1031  FRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             +   N S ++ +W+SD+  PT   +TWYK+ F APAG DPV +D  GMGKG AWVNG ++
Sbjct  520   Y---NPSEASPEWVSDNSYPTNNPLTWYKSKFTAPAGDDPVAIDFTGMGKGEAWVNGQSI  576

Query  1208  GRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW   +A   DC   +C+YRG Y+  KCL  CG P+Q  YHVPRSFL + G N++VLF
Sbjct  577   GRYWPTNIAPQSDC-VNSCNYRGSYSATKCLKKCGQPSQILYHVPRSFL-QPGSNDIVLF  634

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISC--------------------QGGRNI  1504
             E+ GGN S++ F T +T  VCA   E+   +I                      + G+ I
Sbjct  635   EQFGGNPSKISFTTKQTESVCAHVSEDHPDQIDSWVSSQQKLQRSGPALRLECPKEGQVI  694

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A+FG        G        +  A+ + + AC+G +SCSV  S   FG   C G
Sbjct  695   SSIKFASFGTPS--GTCGSYSHGECSSSQALAVAQEACVGVSSCSVPVSAKNFGDP-CRG  751

Query  1685  SRTKKLVVEAVC  1720
               TK LVVEA C
Sbjct  752   -VTKSLVVEAAC  762



>ref|XP_009398434.1| PREDICTED: beta-galactosidase 8-like [Musa acuminata subsp. malaccensis]
Length=854

 Score =   448 bits (1153),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 248/607 (41%), Positives = 353/607 (58%), Gaps = 46/607 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  259   TENWSGWFLSFGGGVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  318

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY++P+DEYG L QPK+GHL++LH V+   E+ +V  + T T L  +++  VY   +G
Sbjct  319   SYDYDSPIDEYGLLRQPKWGHLRDLHKVIKQCEEALVATDPTYTSLGKNLEAHVYRTSSG  378

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
                 F +N ++ +DAT+ + G  Y++PAWSVSILPDC+   +NTA++N+QTTV+  +  K
Sbjct  379   RCVAFLANIDDHSDATVTFNGKPYQLPAWSVSILPDCQSVAFNTAKINSQTTVLEMKYTK  438

Query  539   A--AAALRWSWRPEVAD-------DTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
                 AA   +   E+++       + I      F    +L+Q     D SDY+WY  S++
Sbjct  439   TFDQAADESTGSSEISESEWKFFTEPIGSINSTFKNVGLLEQINTTADSSDYLWYSISID  498

Query  689   LDKDDPIW--SKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNL  850
             +  ++P         L V+  G VLHV+ NGK   S   +N+      E  I L+ G+N 
Sbjct  499   VIGNEPFLFNGTQTTLHVDSLGHVLHVFVNGKLSASNQGSNADASFKLENVITLSSGQNR  558

Query  851   LTLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
             + LLSA++G +NYG +FDL G G+ GV  + KN + T  ++L S +W+Y++GL+GE+  L
Sbjct  559   IDLLSATVGLKNYGQFFDLSGAGITGV--ILKNHNAT--RDLSSSQWTYQIGLKGEQLAL  614

Query  1031  FRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
               ++  S     W+S   LP  + +TWY T F AP   DPV +D  GMGKG AWVNG+++
Sbjct  615   HDNTQNST----WMSLSSLPKNQPLTWYMTYFDAPEHDDPVAIDFTGMGKGEAWVNGHSI  670

Query  1208  GRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             GRYW           ++CDYRG ++ +KC+ NCG P+Q  YHVPRS + +   N LVLFE
Sbjct  671   GRYWPTYTSPPSGCVQSCDYRGPFSGSKCVRNCGQPSQSLYHVPRSLIQQGNTNRLVLFE  730

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYE---------------NKVAEISC-QGGRNITAIKY  1519
             E GG+ + V F     G +CA   +               + V  + C    R I+++K+
Sbjct  731   EVGGDPTLVSFALRAAGSLCAHVSQSHPPPVDAVNTAQKKDAVLHLECPHSDRVISSVKF  790

Query  1520  ANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKK  1699
             A+FG        G        +  A+ IL+ AC+G  SC V  S  VFG  +      K 
Sbjct  791   ASFGTPH--GTCGSYSHGNCSSTTALAILQQACIGVRSCDVKVSTEVFG--DPCRDVVKS  846

Query  1700  LVVEAVC  1720
             L VEA C
Sbjct  847   LAVEASC  853



>ref|XP_010313192.1| PREDICTED: TBG5 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010313193.1| PREDICTED: TBG5 protein isoform X1 [Solanum lycopersicum]
 gb|ADO34790.3| beta-galactosidase STBG5 [Solanum lycopersicum]
Length=852

 Score =   448 bits (1152),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 256/608 (42%), Positives = 349/608 (57%), Gaps = 50/608 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  259   TENWTGWFLSFGGPVPYRPVEDIAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  318

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG +NQPK+GHLK+LH  +   E  +V      T L ++I+V+VY  +  
Sbjct  319   SYDYDAPLDEYGLINQPKWGHLKDLHKAIKLCEAAMVATEPNITSLGSNIEVSVYKTDSQ  378

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV---MVKEG  532
                F +N+   +DA +++ G  Y +P WSVSILPDCK   ++TA++N+ +T+   + +  
Sbjct  379   CAAFLANTATQSDAAVSFNGNSYHLPPWSVSILPDCKNVAFSTAKINSASTISTFVTRSS  438

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPI  709
                A+    S    V +   +  +  FT   +L+Q     D SDY+WY  SVN+  D+P 
Sbjct  439   EADASGGSLSGWTSVNEPVGISNENAFTRMGLLEQINTTADKSDYLWYSLSVNIKNDEPF  498

Query  710   WS--KDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSAS  871
                     L V   G VLH Y NGK   S   N    N   E  + L  G+N + LLSA+
Sbjct  499   LQDGSATVLHVKTLGHVLHAYINGKLSGSGKGNSRHSNFTIEVPVTLVPGENKIDLLSAT  558

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
             +G QNYG +FDL G G+ G V++ G KNG  T   +L S +W+Y+VGL+GE+  L    +
Sbjct  559   VGLQNYGAFFDLKGAGITGPVQLKGFKNGSTT---DLSSKQWTYQVGLKGEDLGLSNGGS  615

Query  1046  ---KSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                KS++A       LPT + + WYK SF APAG  P+ +D  GMGKG AWVNG ++GR+
Sbjct  616   TLWKSQTA-------LPTNQPLIWYKASFDAPAGDTPLSMDFTGMGKGEAWVNGQSIGRF  668

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W      +D  T+ C+YRG YN  KCL NCG P+Q  YHVPRS+L   G N LVLFEE G
Sbjct  669   WPAYIAPNDGCTDPCNYRGGYNAEKCLKNCGKPSQLLYHVPRSWLKSSG-NVLVLFEEMG  727

Query  1397  GNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRN--------------------ITAIK  1516
             G+ +++ F T     VC+   +     I      +                    I++IK
Sbjct  728   GDPTKLSFATREIQSVCSRISDAHPLPIDMWASEDDARKKSGPTLSLECPHPNQVISSIK  787

Query  1517  YANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK  1696
             +A+FG  +     G        + +A++I+K AC+G  SCS+  S + FG   C G   K
Sbjct  788   FASFGTPQ--GTCGSFIHGRCSSSNALSIVKKACIGSKSCSLGVSINAFGDP-CKGV-AK  843

Query  1697  KLVVEAVC  1720
              L VEA C
Sbjct  844   SLAVEASC  851



>ref|XP_010228859.1| PREDICTED: beta-galactosidase 6 [Brachypodium distachyon]
Length=852

 Score =   447 bits (1149),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 254/612 (42%), Positives = 353/612 (58%), Gaps = 52/612 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GGT QNYYMYHGGTNFGR++GGP+I+T
Sbjct  253   TENWSGWFLSFGGAVPYRPTEDLAFAVARFYQRGGTLQNYYMYHGGTNFGRSSGGPFIST  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHLK++H  +   E  ++  + +   +  + +  VY     
Sbjct  313   SYDYDAPIDEYGLVRQPKWGHLKDVHKAIKQCEPALIATDPSYMSMGQNAEAHVYKAGSV  372

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKEGG  535
                F +N +  +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+QTT   M   G 
Sbjct  373   CAAFLANMDTQSDKTVTFNGNAYKLPAWSVSILPDCKNVVLNTAQINSQTTTSEMRSLGS  432

Query  536   KAAAALRWSWRPEVA--------DDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
                A+   S   E+A        +   +  +   T   +++Q     D SD++WY TSV 
Sbjct  433   STKASDGSSIETELALSGWSYAIEPVGITTENALTKPGLMEQINTTADASDFLWYSTSVV  492

Query  689   LDKDDP-IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNN--NSL--FETNIKLNHGKNLL  853
             +   +P +      L VN  G VL  Y NGK+  S   +  +SL   +T I L  GKN +
Sbjct  493   VKGGEPYLNGSQSNLLVNSLGHVLQAYINGKFAGSAKGSATSSLISLQTPITLVPGKNKI  552

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLS ++G  NYG +FDL G G+ G V++ G  G      +L S  W+Y+VGLRGE   L
Sbjct  553   DLLSGTVGLSNYGAFFDLVGAGITGPVKLSGPKG----VLDLSSTDWTYQVGLRGEGLHL  608

Query  1031  FRSSNKSRSASQWLSDHL-PTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             +   N S ++ +W+SD   PT + + WYK+ F  PAG DPV +D  GMGKG AWVNG ++
Sbjct  609   Y---NPSEASPEWVSDKAYPTNQPLIWYKSKFTTPAGDDPVAIDFTGMGKGEAWVNGQSI  665

Query  1208  GRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW   LA    C   +C+YRG Y+++KCL  CG P+Q  YHVPRSFL + G N++VLF
Sbjct  666   GRYWPTNLAPQSGC-VNSCNYRGPYSSSKCLKKCGQPSQTLYHVPRSFL-QPGSNDIVLF  723

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISC--------------------QGGRNI  1504
             E+ GG+ S++ F T +T  VCA   E+   +I                      + G+ I
Sbjct  724   EQFGGDPSKISFTTKQTASVCAHVSEDHPDQIDSWISPQQKVQRSGPALRLECPKAGQVI  783

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A+FG        G        +  A+ + + AC+G +SCSV  S   FG   C G
Sbjct  784   SSIKFASFGTPS--GTCGNYNHGECSSPQALAVAQEACIGVSSCSVPVSTKNFGDP-CTG  840

Query  1685  SRTKKLVVEAVC  1720
               TK LVVEA C
Sbjct  841   -VTKSLVVEAAC  851



>ref|NP_001234312.1| TBG5 protein precursor [Solanum lycopersicum]
 gb|AAF70824.1|AF154423_1 putative beta-galactosidase [Solanum lycopersicum]
Length=852

 Score =   447 bits (1149),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 255/608 (42%), Positives = 349/608 (57%), Gaps = 50/608 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  259   TENWTGWFLSFGGPVPYRPVEDIAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  318

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG +NQPK+GHLK+LH  +   E  +V      T L ++I+V+VY  +  
Sbjct  319   SYDYDAPLDEYGLINQPKWGHLKDLHKAIKLCEAAMVATEPNVTSLGSNIEVSVYKTDSQ  378

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV---MVKEG  532
                F +N+   +DA +++ G  Y +P WSVSILPDCK   ++TA++N+ +T+   + +  
Sbjct  379   CAAFLANTATQSDAAVSFNGNSYHLPPWSVSILPDCKNVAFSTAKINSASTISTFVTRSS  438

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPI  709
                A+    S    V +   +  +  FT   +L+Q     D SDY+WY  SVN+  D+P 
Sbjct  439   EADASGGSLSGWTSVNEPVGISNENAFTRMGLLEQINTTADKSDYLWYSLSVNIKNDEPF  498

Query  710   WS--KDMRLGVNGTGQVLHVYANGKYVDSQWNN----NSLFETNIKLNHGKNLLTLLSAS  871
                     L V   G VLH Y NG+   S   N    N   E  + L  G+N + LLSA+
Sbjct  499   LQDGSATVLHVKTLGHVLHAYINGRLSGSGKGNSRHSNFTIEVPVTLVPGENKIDLLSAT  558

Query  872   IGFQNYGPYFDLGGNGLYG-VEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
             +G QNYG +FDL G G+ G V++ G KNG  T   +L S +W+Y+VGL+GE+  L    +
Sbjct  559   VGLQNYGAFFDLKGAGITGPVQLKGFKNGSTT---DLSSKQWTYQVGLKGEDLGLSNGGS  615

Query  1046  ---KSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                KS++A       LPT + + WYK SF APAG  P+ +D  GMGKG AWVNG ++GR+
Sbjct  616   TLWKSQTA-------LPTNQPLIWYKASFDAPAGDTPLSMDFTGMGKGEAWVNGQSIGRF  668

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W      +D  T+ C+YRG YN  KCL NCG P+Q  YHVPRS+L   G N LVLFEE G
Sbjct  669   WPAYIAPNDGCTDPCNYRGGYNAEKCLKNCGKPSQLLYHVPRSWLKSSG-NVLVLFEEMG  727

Query  1397  GNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRN--------------------ITAIK  1516
             G+ +++ F T     VC+   +     I      +                    I++IK
Sbjct  728   GDPTKLSFATREIQSVCSRTSDAHPLPIDMWASEDDARKKSGPTLSLECPHPNQVISSIK  787

Query  1517  YANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK  1696
             +A+FG  +     G        + +A++I+K AC+G  SCS+  S + FG   C G   K
Sbjct  788   FASFGTPQ--GTCGSFIHGRCSSSNALSIVKKACIGSKSCSLGVSINAFGDP-CKGV-AK  843

Query  1697  KLVVEAVC  1720
              L VEA C
Sbjct  844   SLAVEASC  851



>ref|XP_008463829.1| PREDICTED: beta-galactosidase 8 [Cucumis melo]
Length=844

 Score =   446 bits (1148),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 249/610 (41%), Positives = 354/610 (58%), Gaps = 54/610 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GG+ QNYYMYHGGTNFGRT+GGP+I T
Sbjct  251   TENWSGWFLSFGGALPYRPVEDLAFAVARFYQTGGSLQNYYMYHGGTNFGRTSGGPFIAT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E+ ++  +   T L  +++ TVY     
Sbjct  311   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKMCEEALISTDPAVTSLGPNLEATVYKSGSQ  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTT--------V  517
              + F +N +  +D T+ + G  Y +PAWSVSILPDCK  V NTA++N+ TT        +
Sbjct  371   CSAFLANVDSQSDKTVTFNGNSYHLPAWSVSILPDCKNVVLNTAKINSVTTRPSFSNQPL  430

Query  518   MVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV--ANDVSDYIWYMTSVNL  691
              V      A    WSW     D+ +   K    AN  L +++    D SDY+WY  S ++
Sbjct  431   KVDVSASEAFDSGWSW----IDEPVGISKNNSFANLGLSEQINTTADKSDYLWYSLSTDI  486

Query  692   DKDDPIWS--KDMRLGVNGTGQVLHVYANGKYV----DSQWNNNSLFETNIKLNHGKNLL  853
               D+P  +   +  L V+  G  LHV+ N K       S  ++    +  I L  G+N +
Sbjct  487   KGDEPYLANGSNTVLHVDSLGHALHVFINKKLAGSGKGSGGSSKVSLDIPITLVPGRNTI  546

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLS ++G QNYG +F+L G G+ G V++  +N + TV  +L S +W+Y++GL GE+  L
Sbjct  547   DLLSLTVGLQNYGAFFELRGAGVTGPVKLESQNNNITV--DLSSEQWTYQIGLEGEDLGL  604

Query  1031  FRSSNKSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
                   S S SQWLS  +LP  + +TWYKT+F APAG DP+ +D  G GKG AW+NG+++
Sbjct  605   -----PSGSTSQWLSQPNLPKNKPLTWYKTTFDAPAGSDPLALDFTGFGKGEAWINGHSI  659

Query  1208  GRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             GRYW        C T  CDY+G Y+ NKCL NCG P+Q  YHVPRS+L +   N LVLFE
Sbjct  660   GRYWPSYTASGQC-TSYCDYKGSYSANKCLRNCGKPSQTLYHVPRSWL-KPTSNTLVLFE  717

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYEN------------------KVAEISCQGGRN-ITA  1510
             E G + +R+ F + + G +C+   E+                   V  + C      I++
Sbjct  718   EIGSDPTRLSFASKQLGSLCSHVSESHPAPVEMWSSDSKQQKTGPVLSLECPSPNQVISS  777

Query  1511  IKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSR  1690
             IK+A+FG  R     G        +++A++I++ AC+G  SCSV  S   FG   C G +
Sbjct  778   IKFASFGTPR--GTCGSFSHGKCSSQNALSIVQKACIGSKSCSVDVSIKAFGDP-CRG-K  833

Query  1691  TKKLVVEAVC  1720
             TK L VEA C
Sbjct  834   TKSLAVEAYC  843



>ref|XP_004169598.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 8-like [Cucumis 
sativus]
Length=844

 Score =   446 bits (1147),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 249/609 (41%), Positives = 351/609 (58%), Gaps = 52/609 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GG+ QNYYMYHGGTNFGRT+GGP+I T
Sbjct  251   TENWSGWFLSFGGALPYRPVEDLAFAVARFYQTGGSLQNYYMYHGGTNFGRTSGGPFIAT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E+ +V  +   T L  +++ TVY     
Sbjct  311   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKMCEEALVSTDPAVTSLGPNLEATVYKSGSQ  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTT--------V  517
              + F +N +  +D T+ + G  Y +PAWSVSILPDCK  V NTA++N+ TT        +
Sbjct  371   CSAFLANVDTQSDKTVTFNGNSYHLPAWSVSILPDCKNVVLNTAKINSVTTRPSFSNQPL  430

Query  518   MVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV--ANDVSDYIWYMTSVNL  691
              V      A    WSW     D+ I   K    AN  L +++    D SDY+WY  S ++
Sbjct  431   KVDVSASEAFDSGWSW----IDEPIGISKNNSFANLGLSEQINTTADKSDYLWYSLSTDI  486

Query  692   DKDDPIWS--KDMRLGVNGTGQVLHVYANGKYV----DSQWNNNSLFETNIKLNHGKNLL  853
               D+P  +   +  L V+  G VLHV+ N K       S  ++    +  I L  GKN +
Sbjct  487   KGDEPYLANGSNTVLHVDSLGHVLHVFINKKLAGSGKGSGGSSKVSLDIPITLVPGKNTI  546

Query  854   TLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
              LLS ++G QNYG +F+L G G+ G  +  +N    +  +L S +W+Y++GL GE+  L 
Sbjct  547   DLLSLTVGLQNYGAFFELRGAGVTG-PVKLENXKNNITVDLSSGQWTYQIGLEGEDLGL-  604

Query  1034  RSSNKSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S SQWLS  +LP  + +TWYKT+F APAG DP+ +D  G GKG AW+NG+++G
Sbjct  605   ----PSGSTSQWLSQPNLPKNKPLTWYKTTFDAPAGSDPLALDFTGFGKGEAWINGHSIG  660

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW        C T  CDY+G Y+ NKCL NCG P+Q  YHVP+S+L   G N LVLFEE
Sbjct  661   RYWPSYIASGQC-TSYCDYKGAYSANKCLRNCGKPSQTLYHVPQSWLKPTG-NTLVLFEE  718

Query  1391  TGGNTSRVRFQTVRTGGVCASAYEN------------------KVAEISCQG-GRNITAI  1513
              G + +R+ F + + G +C+   E+                   V  + C    + I++I
Sbjct  719   IGSDPTRLTFASKQLGSLCSHVSESHPPPVEMWSSDSKQQKTGPVLSLECPSPSQVISSI  778

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A+FG  R     G         ++A++I++ AC+G  SCS+  S   FG   C G +T
Sbjct  779   KFASFGTPR--GTCGSFSHGQCSTRNALSIVQKACIGSKSCSIDVSIKAFGDP-CRG-KT  834

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  835   KSLAVEAYC  843



>ref|XP_004148770.1| PREDICTED: beta-galactosidase 8-like [Cucumis sativus]
Length=844

 Score =   446 bits (1147),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 249/609 (41%), Positives = 351/609 (58%), Gaps = 52/609 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GG+ QNYYMYHGGTNFGRT+GGP+I T
Sbjct  251   TENWSGWFLSFGGALPYRPVEDLAFAVARFYQTGGSLQNYYMYHGGTNFGRTSGGPFIAT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E+ +V  +   T L  +++ TVY     
Sbjct  311   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKMCEEALVSTDPAVTSLGPNLEATVYKSGSQ  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTT--------V  517
              + F +N +  +D T+ + G  Y +PAWSVSILPDCK  V NTA++N+ TT        +
Sbjct  371   CSAFLANVDTQSDKTVTFNGNSYHLPAWSVSILPDCKNVVLNTAKINSVTTRPSFSNQPL  430

Query  518   MVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV--ANDVSDYIWYMTSVNL  691
              V      A    WSW     D+ I   K    AN  L +++    D SDY+WY  S ++
Sbjct  431   KVDVSASEAFDSGWSW----IDEPIGISKNNSFANLGLSEQINTTADKSDYLWYSLSTDI  486

Query  692   DKDDPIWS--KDMRLGVNGTGQVLHVYANGKYV----DSQWNNNSLFETNIKLNHGKNLL  853
               D+P  +   +  L V+  G VLHV+ N K       S  ++    +  I L  GKN +
Sbjct  487   KGDEPYLANGSNTVLHVDSLGHVLHVFINKKLAGSGKGSGGSSKVSLDIPITLVPGKNTI  546

Query  854   TLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
              LLS ++G QNYG +F+L G G+ G  +  +N    +  +L S +W+Y++GL GE+  L 
Sbjct  547   DLLSLTVGLQNYGAFFELRGAGVTG-PVKLENQKNNITVDLSSGQWTYQIGLEGEDLGL-  604

Query  1034  RSSNKSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S SQWLS  +LP  + +TWYKT+F APAG DP+ +D  G GKG AW+NG+++G
Sbjct  605   ----PSGSTSQWLSQPNLPKNKPLTWYKTTFDAPAGSDPLALDFTGFGKGEAWINGHSIG  660

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW        C T  CDY+G Y+ NKCL NCG P+Q  YHVP+S+L   G N LVLFEE
Sbjct  661   RYWPSYIASGQC-TSYCDYKGAYSANKCLRNCGKPSQTLYHVPQSWLKPTG-NTLVLFEE  718

Query  1391  TGGNTSRVRFQTVRTGGVCASAYEN------------------KVAEISCQG-GRNITAI  1513
              G + +R+ F + + G +C+   E+                   V  + C    + I++I
Sbjct  719   IGSDPTRLTFASKQLGSLCSHVSESHPPPVEMWSSDSKQQKTGPVLSLECPSPSQVISSI  778

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A+FG  R     G         ++A++I++ AC+G  SCS+  S   FG   C G +T
Sbjct  779   KFASFGTPR--GTCGSFSHGQCSTRNALSIVQKACIGSKSCSIDVSIKAFGDP-CRG-KT  834

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  835   KSLAVEAYC  843



>ref|XP_006853356.1| hypothetical protein AMTR_s00032p00109160 [Amborella trichopoda]
 gb|ERN14823.1| hypothetical protein AMTR_s00032p00109160 [Amborella trichopoda]
Length=841

 Score =   445 bits (1145),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 247/608 (41%), Positives = 351/608 (58%), Gaps = 57/608 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TEN++GWF+ +G   P+R  EDLA++VARFF+ GGTFQNYYMY GGTNFGRTAGGP I +
Sbjct  251   TENYSGWFQAFGSPTPFRPVEDLAFAVARFFETGGTFQNYYMYFGGTNFGRTAGGPLIAS  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG L QPK+GHL+ LHN +   EK +V  + T        +   Y  NG+
Sbjct  311   SYDYDAPLDEYGYLRQPKWGHLRNLHNAIKQCEKILVTEDPTYISFGAKTEAHYY--NGS  368

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQ-------TT  514
               C  F +N ++++DA + +    Y +PAWSVSILPDCK  ++NTA+V+ Q       T+
Sbjct  369   DGCAAFLANIDDSSDANVTFNERSYFLPAWSVSILPDCKNVIFNTAKVSAQQSISAHGTS  428

Query  515   VMVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
               VKE   A ++  WSW  E      + G+  FT   +L+Q     DVSD++WY TSVN+
Sbjct  429   TFVKEYSLALSS--WSWHKEQVG---IWGRNSFTKPGLLEQINTTRDVSDFLWYTTSVNV  483

Query  692   DKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTL  859
             D+   + S+D+ L V   G  L ++ N K     + N+       +T I LN G N L L
Sbjct  484   DEK--LSSEDLYLDVESLGHALLLFVNKKPAAFGYGNHEDASFTLKTPIVLNQGNNTLDL  541

Query  860   LSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             LS  IG QNYGP+FD+ G G++ V +VG      + K+  S +W+Y++G+ GE  +L++S
Sbjct  542   LSMMIGLQNYGPWFDIAGAGIFSVMLVGS---ANILKDFSSIEWTYQIGMEGEYLELYKS  598

Query  1040  SNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
              N S     W++ + +P  + + WYK +F AP G  P+ ++L  MGKG  WVNG  +GRY
Sbjct  599   ENNSL----WVTGNDIPNNQSLMWYKATFDAPEGNSPLALNLASMGKGQVWVNGLGIGRY  654

Query  1217  W-LILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             W   LA    C  + CDYRG Y+  KCL NCG P+Q  YHVPRS+LN  G N LVL EE 
Sbjct  655   WPAYLAPAAGC-ADPCDYRGTYDAQKCLKNCGQPSQTLYHVPRSWLNPTG-NVLVLLEEL  712

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKV-------------------AEISCQGGRNITAIK  1516
             GG+ +++   T     +C+ A E+ +                     ISC+ G  I+++ 
Sbjct  713   GGDPTKITIVTRTGQQICSHASESDIPPVDFWDKNKLDFEAVSPEVRISCERGWQISSVD  772

Query  1517  YANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK  1696
             +A+FG  +     G        AKD +++++  C+G  SCS+  S SV G  +   S  K
Sbjct  773   FASFGTPQ--GKCGLYSHGSCSAKDVLSLVRKTCVGHESCSIPVSASVLG--DPCPSVVK  828

Query  1697  KLVVEAVC  1720
              L ++A C
Sbjct  829   SLAIQATC  836



>sp|Q67VU7.1|BGA10_ORYSJ RecName: Full=Putative beta-galactosidase 10; Short=Lactase 10; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD37397.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAD37722.1| putative beta-galactosidase [Oryza sativa Japonica Group]
Length=809

 Score =   444 bits (1142),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 253/590 (43%), Positives = 337/590 (57%), Gaps = 55/590 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ                     GGPYITT
Sbjct  258   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQ-------------------KRGGPYITT  298

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G    T   + + VT Y  + T
Sbjct  299   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDTNYSDKVTVTKYTLDST  358

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   GT + +PAWSVSILPDCK   +N+A++  QTTVMV +    
Sbjct  359   SACFINNRNDNMDVNVTLDGTTHLLPAWSVSILPDCKTVAFNSAKIKAQTTVMVNKAKMV  418

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K   +L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS+N   +   
Sbjct  419   EKEPESLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSINHKGE---  475

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+  KL+ GKN ++LLSA+IG
Sbjct  476   --ASYTLFVNTTGHELYAFVNGMLVGQNHSPNGHFVFQLESPAKLHDGKNYISLLSATIG  533

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  534   LKNYGPLFEKMPAGIVGGPVKLIDNNGKGI---DLSNSSWSYKAGLAGE----YRQIHLD  586

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +    W +++  +P  +  TWYKT+F+APAG D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  587   KPGCTWDNNNGTVPINKPFTWYKTTFQAPAGEDTVVVDLLGLNKGVAWVNGNNLGRYWPS  646

Query  1226  LAKGDDCPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
                 +      CDYRG    E +  KCL+ CG P+QRFYHVPRSFL     N ++LFEE 
Sbjct  647   YTAAEMGGCHHCDYRGVFQAEGDGQKCLTGCGEPSQRFYHVPRSFLKNGEPNTVILFEEA  706

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggfekg  1570
             GG+ S V F+TV  G VCASA       +SC Q  + I+AI   +FG  R   G      
Sbjct  707   GGDPSHVSFRTVAAGSVCASAEVGDTITLSCGQHSKTISAINVTSFGVAR---GQCGAYK  763

Query  1571  vcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                 +K A      ACLGK SC+V  + +V G+    G  +  L V+A C
Sbjct  764   GGCESKAAYKAFTEACLGKESCTVQITNAVTGS----GCLSNVLTVQASC  809



>ref|XP_009338266.1| PREDICTED: beta-galactosidase 8-like isoform X2 [Pyrus x bretschneideri]
Length=697

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 245/611 (40%), Positives = 352/611 (58%), Gaps = 54/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P R  ED+A++VARFFQ GGTFQNYYMYHGGTNFGR+AGGP+I T
Sbjct  102   TENWSGWFLSFGGAVPQRPVEDVAFAVARFFQKGGTFQNYYMYHGGTNFGRSAGGPFIAT  161

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHLK++H  +   E+ +V  +   + L  +++ TVY     
Sbjct  162   SYDYDAPIDEYGFLRQPKWGHLKDVHKAVKLCEEAMVATDPKNSSLGPNLEATVYQTGSA  221

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F SNS+  +DAT+ + G  Y++PAWSVSILPDCK    NTA++N+   +       V
Sbjct  222   CAAFLSNSDTKSDATVTFNGNSYQLPAWSVSILPDCKNVALNTAKINSAAMIPSFMHHSV  281

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
              +   ++ AL   WSW   + +   +  K  FT   +L+Q     D SDY+WY  S+++ 
Sbjct  282   IDNIDSSEALGSGWSW---INEPVGISKKDAFTRVGLLEQINTTADKSDYLWYSLSIDVT  338

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLT  856
               D       +  L V   G  LH + NGK   S   + S      E  +    GKN + 
Sbjct  339   SSDAFLQDGSQTVLHVESLGHALHAFINGKPAGSGTGSTSNPTVSVEIPVTFASGKNTID  398

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LL+ ++G QNYG +FD  G G+ G V++ G     T+  +L S +W+Y++GL+GE+    
Sbjct  399   LLNLTVGLQNYGAFFDKTGAGITGPVQLKGLKNGTTI--DLSSQQWTYQIGLQGEDLDF-  455

Query  1034  RSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S+SQW+S   LP  + +TWYK +F AP G +PV +D  GMGKG AWVNG ++G
Sbjct  456   ----PSGSSSQWVSQPTLPKKQPLTWYKATFNAPDGSNPVALDFTGMGKGEAWVNGQSIG  511

Query  1211  RYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             RYW   ++    CP ++CD+RG YN++KC  NCG P+Q  YHVPRS+L +  DN LVLFE
Sbjct  512   RYWPTNISPTSGCP-DSCDFRGPYNSDKCRKNCGKPSQELYHVPRSWL-KPSDNTLVLFE  569

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYENKVAEI-----SCQGGRN---------------IT  1507
             E GG+ +++ F T +   +C+   E+ ++ +       + GR                I+
Sbjct  570   EIGGDPTQISFATRQIESLCSHVSESHLSPVDTWSSDSKVGRKLGPVLSLECPFPNQVIS  629

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A++G  +     G        +  A++I++ AC+G  SCS+  S   FG   C G 
Sbjct  630   SIKFASYG--KPQGTCGSFSHGQCKSSSALSIVQKACVGSKSCSIEVSVKTFGDP-CKG-  685

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  686   VAKSLAVEASC  696



>ref|XP_002530296.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF32103.1| beta-galactosidase, putative [Ricinus communis]
Length=842

 Score =   443 bits (1140),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 251/610 (41%), Positives = 353/610 (58%), Gaps = 54/610 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF+ +GG  PYR  EDLA++VARF+QL GTFQNYYMYHGGTNFGRT GGP+I+T
Sbjct  249   TENWSGWFQSFGGAVPYRPVEDLAFAVARFYQLSGTFQNYYMYHGGTNFGRTTGGPFIST  308

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG L QPK+GHLK++H  +   E+ ++  + TTT L ++++ TVY     
Sbjct  309   SYDYDAPLDEYGLLRQPKWGHLKDVHKAIKLCEEALIATDPTTTSLGSNLEATVYKTGSL  368

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV-------M  520
                F +N   T D T+ + G  Y +PAWSVSILPDCK    NTA++N+ T V       +
Sbjct  369   CAAFLANI-ATTDKTVTFNGNSYNLPAWSVSILPDCKNVALNTAKINSVTIVPSFARQSL  427

Query  521   VKE-GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             V +     A    WSW   + +   +     F  + +L+Q     D SDY+WY  S N+ 
Sbjct  428   VGDVDSSKAIGSGWSW---INEPVGISKNDAFVKSGLLEQINTTADKSDYLWYSLSTNIK  484

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDS----QWNNNSLFETNIKLNHGKNLLT  856
              D+P      +  L V   G  LH + NGK   S      N     +  I L  GKN + 
Sbjct  485   GDEPFLEDGSQTVLHVESLGHALHAFINGKLAGSGTGKSSNAKVTVDIPITLTPGKNTID  544

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LLS ++G QNYG +++L G G+ G V++  +NG+     +L S +W+Y++GL+GE+    
Sbjct  545   LLSLTVGLQNYGAFYELTGAGITGPVKLKAQNGNTV---DLSSQQWTYQIGLKGED----  597

Query  1034  RSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
              S   S S+S+W+S   LP  + + WYKTSF APAG DPV +D  GMGKG AWVNG ++G
Sbjct  598   -SGISSGSSSEWVSQPTLPKNQPLIWYKTSFDAPAGNDPVAIDFTGMGKGEAWVNGQSIG  656

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW           ++C+YRG Y++NKCL NCG P+Q FYH+PRS++   G N LVL EE
Sbjct  657   RYWPTNVSPSSGCADSCNYRGGYSSNKCLKNCGKPSQTFYHIPRSWIKSSG-NILVLLEE  715

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEI-----SCQGGRN---------------ITA  1510
              GG+ +++ F T + G +C+   E+    +       +GG+                I++
Sbjct  716   IGGDPTQIAFATRQVGSLCSHVSESHPQPVDMWNTDSEGGKRSGPVLSLQCPHPDKVISS  775

Query  1511  IKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSR  1690
             IK+A+FG        G        +  A++I++ AC+G  SC+V  S + FG   C G +
Sbjct  776   IKFASFGTPH--GSCGSYSHGKCSSTSALSIVQKACVGSKSCNVGVSINTFGDP-CRGVK  832

Query  1691  TKKLVVEAVC  1720
              K L VEA C
Sbjct  833   -KSLAVEASC  841



>dbj|BAJ95568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=853

 Score =   442 bits (1138),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 249/612 (41%), Positives = 350/612 (57%), Gaps = 52/612 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GGT QNYYMYHGGTNFGR++GGP+I+T
Sbjct  254   TENWSGWFLSFGGAVPYRPTEDLAFAVARFYQRGGTLQNYYMYHGGTNFGRSSGGPFIST  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++  + +   L  + +  VY     
Sbjct  314   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKMCEPALIATDPSYMSLGQNAEAHVYKSGSL  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQT----------  511
                F +N ++ +D T+ + G  YK+PAWSVSILPDCK  V NTA++N+Q           
Sbjct  374   CAAFLANIDDQSDKTVTFNGKAYKLPAWSVSILPDCKNVVLNTAQINSQVASTQMRNLGF  433

Query  512   TVMVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
             +    +G    A L  S      +   +  +   T   +++Q     D SD++WY TS+ 
Sbjct  434   STQASDGSSVEAELAASSWSYAVEPVGITKENALTKPGLMEQINTTADASDFLWYSTSIV  493

Query  689   LDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLL  853
             +   +P  +     L VN  G VL V+ NGK   S   + S       T + L  GKN +
Sbjct  494   VAGGEPYLNGSQSNLLVNSLGHVLQVFINGKLAGSSKGSASSSLISLTTPVTLVTGKNKI  553

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLSA++G  NYG +FDL G G+ G V++ G  G      +L S +W+Y++GLRGE+  L
Sbjct  554   DLLSATVGLTNYGAFFDLVGAGITGPVKLTGPKG----TLDLSSAEWTYQIGLRGEDLHL  609

Query  1031  FRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             +   N S ++ +W+SD+  PT   +TWYK+ F APAG DPV +D  GMGKG AWVNG ++
Sbjct  610   Y---NPSEASPEWVSDNSYPTNNPLTWYKSKFTAPAGDDPVAIDFTGMGKGEAWVNGQSI  666

Query  1208  GRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW   +A    C   +C+YRG Y+  KCL  CG P+Q  YHVPRSFL + G N++VLF
Sbjct  667   GRYWPTNIAPQSGC-VNSCNYRGSYSATKCLKKCGQPSQILYHVPRSFL-QPGSNDIVLF  724

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISC--------------------QGGRNI  1504
             E+ GGN S++ F T +T  VCA   E+   +I                      + G+ I
Sbjct  725   EQFGGNPSKISFTTKQTESVCAHVSEDHPDQIDSWVSSQQKLQRSGPALRLECPKEGQVI  784

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A+FG        G        +  A+ + + AC+G +SCSV  S   FG   C G
Sbjct  785   SSIKFASFGTPS--GTCGSYSHGECSSSQALAVAQEACVGVSSCSVPVSAKNFGDP-CRG  841

Query  1685  SRTKKLVVEAVC  1720
               TK LVVEA C
Sbjct  842   V-TKSLVVEAAC  852



>ref|XP_011044378.1| PREDICTED: beta-galactosidase 8 [Populus euphratica]
Length=849

 Score =   441 bits (1135),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 256/613 (42%), Positives = 351/613 (57%), Gaps = 60/613 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+QLGGTFQNYYMYHGGTNFGR+ GGP+I+T
Sbjct  256   TENWSGWFLSFGGAVPYRPVEDLAFAVARFYQLGGTFQNYYMYHGGTNFGRSTGGPFIST  315

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG   QPK+GHLK+LH  +   E+ +V  +  T+ L  +++ TVY   GT
Sbjct  316   SYDYDAPLDEYGLTRQPKWGHLKDLHKSIKLCEEALVATDPVTSSLGQNLEATVYK-TGT  374

Query  362   KTC--FFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------  517
               C  F +N   T+D T+N+ G  Y +P WSVSILPDCK    NTA++N+ T +      
Sbjct  375   GLCSAFLANFG-TSDKTVNFNGNSYNLPGWSVSILPDCKNVALNTAKINSMTVIPSFVHQ  433

Query  518   MVKEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVN  688
              +K    +A  L   WSW   + +   +     F    +L+Q     D SDY+WY  S  
Sbjct  434   SIKGDADSADTLGSSWSW---IYEPVGISKNDAFVKPGLLEQINTTADKSDYLWYSLSTV  490

Query  689   LDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDS----QWNNNSLFETNIKLNHGKNL  850
             +  ++P      +  L V   G  LH + NGK   S      N     E  + L  GKN 
Sbjct  491   IKDNEPFLEDGSQTVLHVESLGHALHAFVNGKLAGSGTGNAGNAKVAVEIPVTLLPGKNT  550

Query  851   LTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENK  1027
             + LLS + G QNYG +F+L G G+ G V++ G     TV  +L S +W+Y++GL+GEE  
Sbjct  551   IDLLSLTAGLQNYGAFFELTGAGITGPVKLEGLKNGTTV--DLSSLQWTYQIGLKGEELG  608

Query  1028  LFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNN  1204
             L      S   SQW++   LPT + + WYKTSF APAG DP+ +D +GMGKG AWVNG +
Sbjct  609   L------SSGNSQWVTQPALPTKQPLIWYKTSFNAPAGNDPIAIDFLGMGKGEAWVNGQS  662

Query  1205  LGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVL  1381
             +GRYW   ++    C    C+YRG Y+++KCL NC  P+Q  YHVPRS++   G N LVL
Sbjct  663   IGRYWPTKVSPTSGC--SNCNYRGSYSSSKCLKNCAKPSQTLYHVPRSWVESSG-NTLVL  719

Query  1382  FEETGGNTSRVRFQTVRTGGVCASAYEN-------------------KVAEISCQ-GGRN  1501
             FEE GG+ +++ F T ++  +C+   E+                    V  + C    + 
Sbjct  720   FEEIGGDPTQIVFATRQSASLCSHVSESHPLPVDMWSSNSEAERKAGPVLSLECPFPNQV  779

Query  1502  ITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCA  1681
             I++IK+A+FG  R     G        +  A++I+K AC+G  SCS+ AS S FG   C 
Sbjct  780   ISSIKFASFGTPR--GTCGSFSHGQCKSTRALSIVKKACIGSKSCSIGASASTFGDP-CR  836

Query  1682  GSRTKKLVVEAVC  1720
             G   K L VEA C
Sbjct  837   G-VAKSLAVEASC  848



>gb|KDO73224.1| hypothetical protein CISIN_1g003095mg [Citrus sinensis]
Length=738

 Score =   438 bits (1126),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 252/611 (41%), Positives = 354/611 (58%), Gaps = 52/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNF RT+GGP+I+T
Sbjct  141   TENWSGWFLSFGGAVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPFIST  200

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+APLDEYG + QPK+GHLK+LH  +   E  +V  + T   L  +++ TVY   +G
Sbjct  201   SYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAALVATDPTYPSLGPNLEATVYKTGSG  260

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV-------  517
               + F +N    +D T+ + G  Y +PAWSVSILPDCK  V+NTA++N+ T V       
Sbjct  261   LCSAFLANIGTNSDVTVKFNGNSYLLPAWSVSILPDCKNVVFNTAKINSVTLVPSFSRQS  320

Query  518   -MVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
               V      A    WS+   + +   +     FT   +L+Q     D SDY+WY  S N+
Sbjct  321   LQVAADSSDAIGSGWSY---INEPVGISKDDAFTKPGLLEQINTTADQSDYLWYSLSTNI  377

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLL  853
               D+P+     +  L V   G  LH + NGK V S + ++S      +  I L  GKN  
Sbjct  378   KADEPLLEDGSKTVLHVQSLGHALHAFINGKLVGSGYGSSSNAKVTVDFPIALAPGKNTF  437

Query  854   TLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
              LLS ++G QNYG +++  G G+ G   +  +G+ T   +L S +W+Y+ GL+GEE    
Sbjct  438   DLLSLTVGLQNYGAFYEKTGAGITGPVQLKGSGNGT-NIDLSSQQWTYQTGLKGEELNF-  495

Query  1034  RSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S++QW S   LP  + + WYKT+F APAG +PV +D  GMGKG AWVNG ++G
Sbjct  496   ----PSGSSTQWDSKSTLPKLQPLVWYKTTFDAPAGSEPVAIDFTGMGKGEAWVNGQSIG  551

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW      +   T++C+YRG Y++NKCL NCG P+Q  YHVPRS+L   G N LVLFEE
Sbjct  552   RYWPTYVSQNGGCTDSCNYRGAYSSNKCLKNCGKPSQSLYHVPRSWLKSSG-NTLVLFEE  610

Query  1391  TGGNTSRVRFQTVRTG-GVCASAYENKVAEISCQGGRN--------------------IT  1507
              GG+ +++ F T + G  +C+   ++    +   G  +                    I+
Sbjct  611   IGGDPTKISFVTKQLGSSLCSHVTDSHPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVIS  670

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A+FG T     G F +G C  A+ ++++++ AC+G  SCS+  S + FG   C G 
Sbjct  671   SIKFASFG-TPLGTCGSFSRGRCSSAR-SLSVVRQACVGSKSCSIGVSVNTFGDP-CKG-  726

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  727   VMKSLAVEASC  737



>ref|XP_010232635.1| PREDICTED: beta-galactosidase 3 [Brachypodium distachyon]
Length=846

 Score =   441 bits (1133),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 242/604 (40%), Positives = 348/604 (58%), Gaps = 45/604 (7%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWF+ +G  +P+R  ED+A+SVARFFQ GG+ QNYY+YHGGTNFGRT GGP+ITT
Sbjct  256   TENWPGWFQTFGESNPHRPPEDVAFSVARFFQKGGSVQNYYVYHGGTNFGRTTGGPFITT  315

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA-FNG  358
             +YDY+AP+DEYG    PK+ HL++LH  +   E +++YGN+T+  L    +  VY   +G
Sbjct  316   SYDYDAPIDEYGLTRLPKWAHLRDLHKSIKLCEHSLLYGNLTSLSLGTKQEADVYTDHSG  375

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKEG  532
                 F +N +   D  + ++   Y +PAWSVSILPDCK  V+NTA+V +QT +  MV E 
Sbjct  376   GCVAFLANIDPENDTVVTFRSRQYDLPAWSVSILPDCKNAVFNTAKVQSQTLMVDMVPET  435

Query  533   GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPI  709
              ++    RWS      + T +  K  F  N  +D      D +DY+W+ TS N+D+  P 
Sbjct  436   LQSTKPDRWS---IFREKTGIWDKNDFIRNGFVDHINTTKDSTDYLWHTTSFNVDRSYPT  492

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETN----IKLNHGKNLLTLLSASIG  877
                   L ++  G  +H + N + + S + N S    N    IKL  GKN + LLS ++G
Sbjct  493   NGNRELLSIDSKGHAVHAFLNNELIGSAYGNGSKSSFNVHMPIKLKPGKNEIALLSMTVG  552

Query  878   FQNYGPYFDLGGNGLYGVEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS--NK  1048
              QN GP+++  G GL  V I G KNG      +L S+ W+YK+GL GE   LF+    N 
Sbjct  553   LQNAGPHYEWVGAGLTSVNISGMKNGS----IDLSSNNWAYKIGLEGEHYGLFKPDQGNN  608

Query  1049  SRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLIL  1228
              R + Q      P  + +TWYK +   P G DPV +D+  MGKG AW+NGN +GRYW   
Sbjct  609   QRWSPQ---SEPPKGQPLTWYKVNVDVPQGDDPVGIDMQSMGKGLAWLNGNAIGRYWPRT  665

Query  1229  AKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTS  1408
             +  DD  T +C+YRG +N +KC + CG PTQR+YHVPRS+ +  G N LV+FEE GG+ +
Sbjct  666   SSSDDRCTPSCNYRGPFNPSKCRTGCGKPTQRWYHVPRSWFHPSG-NTLVVFEEQGGDPT  724

Query  1409  RVRFQTVRTGGVCASAYENKVA--------------------EISCQGGRNITAIKYANF  1528
             ++ F       VC+   EN  +                    ++SC  G+NI+++K+A+F
Sbjct  725   KITFSRRVATKVCSFVSENYPSIDLESWDKSISDDGKDTAKVQLSCPKGKNISSVKFASF  784

Query  1529  GDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVV  1708
             GD  G+C    +      +  ++++++ ACL   SC+V+ S+  FG   C G   K L +
Sbjct  785   GDPSGTCRSYQQGRCHHPS--SLSVVEKACLNINSCTVSLSDEGFGKDLCPGV-AKTLAI  841

Query  1709  EAVC  1720
             EA C
Sbjct  842   EADC  845



>gb|ACR35639.1| unknown [Zea mays]
Length=677

 Score =   434 bits (1116),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 254/617 (41%), Positives = 356/617 (58%), Gaps = 63/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GGTFQNYYMYHGGTN  R++GGP+I T
Sbjct  79    TENWSGWFLSFGGAVPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNLDRSSGGPFIAT  138

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++  + + T L  +++  VY     
Sbjct  139   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKLCEPALIATDPSYTSLGPNVEAAVYKVGSV  198

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTT---VMVKEG  532
                F +N +  +D T+ + G  Y++PAWSVSILPDCK  V NTA++N+QTT   +   E 
Sbjct  199   CAAFLANIDGQSDKTVTFNGKMYRLPAWSVSILPDCKNVVLNTAQINSQTTGSEMRYLES  258

Query  533   GKAA----------AALRWSWRPE---VADDTILHGKGQFTANQILDQ-KVANDVSDYIW  670
                A          A   WS+  E   +  D  L   G      +++Q     D SD++W
Sbjct  259   SNVASDGSFVTPELAVSDWSYAIEPVGITKDNALTKAG------LMEQINTTADASDFLW  312

Query  671   YMTSVNLDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLN  835
             Y TS+ +  D+P  +     L VN  G VL VY NGK   S   + S     ++  I+L 
Sbjct  313   YSTSITVKGDEPYLNGSQSNLAVNSLGHVLQVYINGKIAGSAQGSASSSLISWQKPIELV  372

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
              GKN + LLSA++G  NYG +FDL G G+ G V++ G NG      +L S +W+Y++GLR
Sbjct  373   PGKNKIDLLSATVGLSNYGAFFDLVGAGITGPVKLSGLNG----ALDLSSAEWTYQIGLR  428

Query  1013  GEENKLFRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAW  1189
             GE+  L+   + S ++ +W+S +  P    + WYKT F  PAG DPV +D  GMGKG AW
Sbjct  429   GEDLHLY---DPSEASPEWVSANAYPINHPLIWYKTKFTPPAGDDPVAIDFTGMGKGEAW  485

Query  1190  VNGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGD  1366
             VNG ++GRYW   LA    C   +C+YRG Y+++KCL  CG P+Q  YHVPRSFL + G 
Sbjct  486   VNGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSSKCLKKCGQPSQTLYHVPRSFL-QPGS  543

Query  1367  NELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISC-------------------Q  1489
             N+LVLFE  GG+ S++ F   +TG VCA   E   A+I                     +
Sbjct  544   NDLVLFEHFGGDPSKISFVMRQTGSVCAQVSEAHPAQIDSWSSQQPMQRYGPALRLECPK  603

Query  1490  GGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+++K+A+FG        G        +  A++I++ AC+G +SCSV  S + FG 
Sbjct  604   EGQVISSVKFASFGTPS--GTCGSYSHGECSSTQALSIVQEACIGVSSCSVPVSSNYFGN  661

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C G  TK L VEA C
Sbjct  662   P-CTG-VTKSLAVEAAC  676



>ref|XP_010521771.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 8 [Tarenaya 
hassleriana]
Length=874

 Score =   439 bits (1129),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 248/626 (40%), Positives = 355/626 (57%), Gaps = 65/626 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNFGR+ GGP+ITT
Sbjct  260   TENWSGWFSSFGEPLPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRSTGGPFITT  319

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  +V  + T T L ++++ +VY   +G
Sbjct  320   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALVATDPTITSLGSNLEASVYKTASG  379

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVN--TQTTVMVKEG  532
             +   F +N    +DAT+ + G  Y +PAWSVSILPDCK  V+NTA++N  T++    ++ 
Sbjct  380   SCAAFLANIGTHSDATVAFNGNTYHLPAWSVSILPDCKNVVFNTAKINSATESETFARQS  439

Query  533   GKAAA------ALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
              K  A        +WS+   + +   +   G F    +L+Q     D SDY+WY  S+++
Sbjct  440   LKPDADSSGDLGSQWSY---IKEPVGISKAGAFVKPGLLEQINTTADKSDYLWYSLSMDI  496

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLL  862
               D+P      +  L +   G VLHV+ NG+   S      +     I L  GKN + LL
Sbjct  497   KGDEPFLDDGSKSVLHIESLGHVLHVFINGELAGSATGKPRVSLAIPISLVPGKNTIALL  556

Query  863   SASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             S ++G QNYG +FDL G G+ G  ++ KNG+     +L S +W+Y+VGL+GE+  L    
Sbjct  557   SVTVGLQNYGAFFDLTGAGITG-PVILKNGNSGSTIDLSSKQWTYQVGLKGEDTGL----  611

Query  1043  NKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW  1219
               +  +S+W+S+  LPT + + WYKT+F APAG DPV +D  G GKG AWVNG ++GR+W
Sbjct  612   -STGDSSEWVSESPLPTKQPLIWYKTTFDAPAGSDPVAIDFTGAGKGMAWVNGESIGRFW  670

Query  1220  LILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGG  1399
                   D   T++CDYRG Y +NKCL NCG P+Q  YHVPRS++   G N LVL  E GG
Sbjct  671   PTNIARDSGCTDSCDYRGSYRSNKCLKNCGKPSQSLYHVPRSWIKESG-NTLVLLVEAGG  729

Query  1400  NTSRVRFQTVRTG-GVCASAYEN-------------------KVAEISC-QGGRNITAIK  1516
             + + + F T + G  +C    ++                    V  + C +    I++++
Sbjct  730   DVAGISFATKQGGSSLCLRVSQSHPPPVDTWTSSSNRTRRTTPVLSLQCPKPDHVISSVE  789

Query  1517  YANFGDTRgs---------cgggfekgvcggAKDAVNILKT---------ACLGKASCSV  1642
             +A+FG   G+                 +    ++  N +KT         AC+G  SCS+
Sbjct  790   FASFGTPTGTCGGFSHGRCSSSLALSYMXLYMREDWNYVKTENDVGWMVQACVGSRSCSL  849

Query  1643  TASESVFGTTNCAGSRTKKLVVEAVC  1720
               S SVFG   C G+  K L V+A C
Sbjct  850   PVSTSVFGDA-CRGT-VKTLAVQASC  873



>ref|XP_009338265.1| PREDICTED: beta-galactosidase 8-like isoform X1 [Pyrus x bretschneideri]
Length=842

 Score =   438 bits (1126),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 245/611 (40%), Positives = 352/611 (58%), Gaps = 54/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P R  ED+A++VARFFQ GGTFQNYYMYHGGTNFGR+AGGP+I T
Sbjct  247   TENWSGWFLSFGGAVPQRPVEDVAFAVARFFQKGGTFQNYYMYHGGTNFGRSAGGPFIAT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHLK++H  +   E+ +V  +   + L  +++ TVY     
Sbjct  307   SYDYDAPIDEYGFLRQPKWGHLKDVHKAVKLCEEAMVATDPKNSSLGPNLEATVYQTGSA  366

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F SNS+  +DAT+ + G  Y++PAWSVSILPDCK    NTA++N+   +       V
Sbjct  367   CAAFLSNSDTKSDATVTFNGNSYQLPAWSVSILPDCKNVALNTAKINSAAMIPSFMHHSV  426

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
              +   ++ AL   WSW   + +   +  K  FT   +L+Q     D SDY+WY  S+++ 
Sbjct  427   IDNIDSSEALGSGWSW---INEPVGISKKDAFTRVGLLEQINTTADKSDYLWYSLSIDVT  483

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLT  856
               D       +  L V   G  LH + NGK   S   + S      E  +    GKN + 
Sbjct  484   SSDAFLQDGSQTVLHVESLGHALHAFINGKPAGSGTGSTSNPTVSVEIPVTFASGKNTID  543

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LL+ ++G QNYG +FD  G G+ G V++ G     T+  +L S +W+Y++GL+GE+    
Sbjct  544   LLNLTVGLQNYGAFFDKTGAGITGPVQLKGLKNGTTI--DLSSQQWTYQIGLQGEDLDF-  600

Query  1034  RSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S+SQW+S   LP  + +TWYK +F AP G +PV +D  GMGKG AWVNG ++G
Sbjct  601   ----PSGSSSQWVSQPTLPKKQPLTWYKATFNAPDGSNPVALDFTGMGKGEAWVNGQSIG  656

Query  1211  RYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             RYW   ++    CP ++CD+RG YN++KC  NCG P+Q  YHVPRS+L +  DN LVLFE
Sbjct  657   RYWPTNISPTSGCP-DSCDFRGPYNSDKCRKNCGKPSQELYHVPRSWL-KPSDNTLVLFE  714

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYENKVAEI-----SCQGGRN---------------IT  1507
             E GG+ +++ F T +   +C+   E+ ++ +       + GR                I+
Sbjct  715   EIGGDPTQISFATRQIESLCSHVSESHLSPVDTWSSDSKVGRKLGPVLSLECPFPNQVIS  774

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A++G  +     G        +  A++I++ AC+G  SCS+  S   FG   C G 
Sbjct  775   SIKFASYG--KPQGTCGSFSHGQCKSSSALSIVQKACVGSKSCSIEVSVKTFGDP-CKGV  831

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  832   -AKSLAVEASC  841



>ref|XP_007132236.1| hypothetical protein PHAVU_011G077600g [Phaseolus vulgaris]
 gb|ESW04230.1| hypothetical protein PHAVU_011G077600g [Phaseolus vulgaris]
Length=831

 Score =   437 bits (1124),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 247/604 (41%), Positives = 354/604 (59%), Gaps = 54/604 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  PYR  ED+A++VARF+Q GGTFQNYYMYHGGTNFGR++GGP+I+T
Sbjct  250   TENWTGWFLSFGGAVPYRPVEDIAFAVARFYQRGGTFQNYYMYHGGTNFGRSSGGPFIST  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHLK++H  +   E+ ++  + T T    +I+  VY     
Sbjct  310   SYDYDAPIDEYGIVRQPKWGHLKDVHKAIKLCEEALIATDPTITTPGPNIEAAVYKTGSA  369

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV-------M  520
                F +N   T+DAT+ + G  Y +PAWSVSILPDCK  V NTA++N+ + +       +
Sbjct  370   CAAFLANI-ATSDATVTFNGNSYHLPAWSVSILPDCKNVVLNTAKINSASMISSFRTESL  428

Query  521   VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDK  697
              +E G  +    W+W   +++   +     F+   +L+Q     D SDY+WY +S++L+ 
Sbjct  429   KEEVGSGSG---WNW---ISEPVGISKADSFSKFGLLEQINTTADKSDYLWYSSSIDLED  482

Query  698   DDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLLTLLS  865
             D         L +   G  LH + NGK   S   N++      +  IKL  GKN++ LLS
Sbjct  483   DA---DSQTVLHIESLGHALHAFINGKLAGSGTGNSNKAKVEVDIPIKLVAGKNMIDLLS  539

Query  866   ASIGFQNYGPYFDLGGNGLYGVEIVG--KNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
              ++G QNYG +FD  G G+ G  I+   KNG      +L S +W+Y+VGL+GE+      
Sbjct  540   LTVGLQNYGAFFDTWGAGITGPVILKGLKNGSTV---DLSSQQWTYQVGLKGED-----L  591

Query  1040  SNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                S S+ QW S   LPT + +TWYKT+F AP+G +PV +D  GMGKG AWVNG ++GRY
Sbjct  592   GPSSGSSGQWNSQSDLPTNQPLTWYKTNFVAPSGSNPVAIDFTGMGKGEAWVNGQSIGRY  651

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W      +    ++C+YRG Y+++KCL NCG P+Q  YHVPRS+L +   N LVLFEE+G
Sbjct  652   WPTYVSPNGGCADSCNYRGAYSSSKCLKNCGKPSQTLYHVPRSWL-QPDSNTLVLFEESG  710

Query  1397  GNTSRVRFQTVRTGGVCASAYEN---------------KVAEISCQ-GGRNITAIKYANF  1528
             G+ +++ F T + G VC+   E+                V  + C    + I++I++A+F
Sbjct  711   GDPTQISFATKQIGSVCSHVSESHPPPVDLWNSDTKAGPVLSLECPYPNQAISSIQFASF  770

Query  1529  GDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVV  1708
             G        G  K     +  A++I++ AC+G  SCSV  S   FG   C G   K L V
Sbjct  771   GTP--YGTCGNFKHGRCRSNKALSIVQKACIGSNSCSVGLSLDTFGDP-CKG-VAKSLAV  826

Query  1709  EAVC  1720
             EA C
Sbjct  827   EASC  830



>ref|XP_011089891.1| PREDICTED: beta-galactosidase 8-like isoform X1 [Sesamum indicum]
Length=851

 Score =   438 bits (1126),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 246/611 (40%), Positives = 346/611 (57%), Gaps = 53/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  ED+A+S ARF+QLGG F NYYMYHGGTNFGRT+GGP+ITT
Sbjct  255   TENWSGWFSSFGDPVPYRPVEDIAFSTARFYQLGGMFLNYYMYHGGTNFGRTSGGPFITT  314

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+AP+DEYG L QPK+GHLK++H  +   E  +V  +  TT L ++++ TVY   +G
Sbjct  315   SYDYDAPIDEYGLLRQPKWGHLKDVHKAIKLCEGALVATDPETTSLGSNLEATVYKTESG  374

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV-------  517
                 F +N +  ++AT+N+ G  Y +PAWSVSILPDCK  V NTA++N+  T+       
Sbjct  375   VCAAFLANVDSQSEATVNFNGNSYHLPAWSVSILPDCKTVVLNTAKINSLATISEFVHQS  434

Query  518   MVKEGGKAAAALR-WSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
              + +       L  WSW   + +   +     F    +L+Q     D SDY+WY  S+  
Sbjct  435   SIDDSTATDTFLSGWSW---IHEPIGISTDSSFMKLGLLEQINTTADQSDYLWYSLSIET  491

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLL  853
               D+P      +  L V+  G  L+V+ N +   S    NS      +  I L HG+N +
Sbjct  492   KGDEPFMQDGSQTVLHVDSLGHALYVFLNKELAGSAKGRNSEPKVSVDVPISLIHGRNKI  551

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLS ++G QNYG YFD  G G+ G V++ G     TV  +L S +W+Y++GLRGEE  L
Sbjct  552   DLLSLTVGLQNYGAYFDKKGAGVTGPVQLKGLRNGSTV--DLSSQQWTYQIGLRGEELAL  609

Query  1031  FRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
                   S ++S W+S   LP  + + WYKT+F AP G  PV +D  GMGKG AW+NG ++
Sbjct  610   -----SSGTSSLWVSQPTLPKDQPLVWYKTTFDAPTGISPVALDFSGMGKGQAWINGQSI  664

Query  1208  GRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             GRYW      D   T++C+YRG ++ +KC+ NCG PTQ+FYHVPRS+L +  +N LVLFE
Sbjct  665   GRYWPKYTAPDSGCTDSCNYRGSFSPSKCMKNCGQPTQKFYHVPRSWL-QASENVLVLFE  723

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYENKVAEISC----QGGRN----------------IT  1507
             E GG+  ++   T  TG +C+   E    E+      Q  R+                ++
Sbjct  724   EMGGDPEQISLATRETGSICSQILETHPMEVDMWTTDQKSRSRTGPTLSLNCPFPNQVMS  783

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
              IK+A+FG        G        ++ A++I++  C+G  SC +  S   FG   C G 
Sbjct  784   EIKFASFGTPH--GTCGSFSHGRCSSEKALSIVQKTCIGSRSCRIGVSVDTFGDP-CRG-  839

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  840   MIKSLAVEASC  850



>ref|XP_008358406.1| PREDICTED: beta-galactosidase 8-like [Malus domestica]
Length=842

 Score =   437 bits (1123),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 246/611 (40%), Positives = 349/611 (57%), Gaps = 54/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P R  EDLA++VARFFQ GGTFQNYYMYHGGTNFGR+AGGP+I T
Sbjct  247   TENWSGWFLSFGGAVPQRPVEDLAFAVARFFQKGGTFQNYYMYHGGTNFGRSAGGPFIAT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHLK++H  +   E+ +V  +   + L  +++ TVY     
Sbjct  307   SYDYDAPIDEYGFLRQPKWGHLKDVHKAVKLCEEAMVATDPKNSSLGPNVEATVYQTGSA  366

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F SNS+  +DAT+ + G  Y++PAWSVSILPDCK    NTA++N+   +       V
Sbjct  367   CAAFLSNSDTKSDATVTFNGNSYQLPAWSVSILPDCKNVALNTAKINSAAMIPSFMHHSV  426

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
              +   ++ AL   WSW   + +   +  K  F    +L+Q     D SDY+WY  S+++ 
Sbjct  427   IDDIDSSEALGSGWSW---INEPVGISKKDAFARVGLLEQINTTADKSDYLWYSLSIDVT  483

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYV----DSQWNNNSLFETNIKLNHGKNLLT  856
               D       +  L V   G  LH + NGK       S  N     E  +    GKN + 
Sbjct  484   SSDTFLQDGSQTVLHVESLGHALHAFINGKPAGSGTGSASNPTVSVEIPVTFASGKNTID  543

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
             LLS ++G QNYG +FD  G G+ G V++ G     T+  +L S +W+Y++GL+GE+    
Sbjct  544   LLSLTVGLQNYGAFFDKTGAGITGPVQLKGLKNGTTI--DLSSQRWTYQIGLQGEDLDF-  600

Query  1034  RSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S+SQW+S   LP  + +TWYK +F AP G +PV +D  GMGKG AWVNG ++G
Sbjct  601   ----PSGSSSQWVSQPTLPKKQPLTWYKATFNAPDGSNPVALDFTGMGKGEAWVNGQSIG  656

Query  1211  RYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             RYW   ++    CP ++CD+RG YN++KC  NCG P+Q  YHVPRS+L +  DN LVLFE
Sbjct  657   RYWPTNISPTSGCP-DSCDFRGPYNSDKCRKNCGKPSQELYHVPRSWL-KPSDNTLVLFE  714

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYENKVAEI-----SCQGGRN---------------IT  1507
             E GG+ +++ F T +   +C+   E+ ++ +       + GR                I+
Sbjct  715   EIGGDPTQISFATRQIESLCSHVSESHLSPVDTWSSDSKVGRKLGPVLSLECPFPNQVIS  774

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A++G  +     G        +  A++I++ AC+G  SCS   S   FG   C G 
Sbjct  775   SIKFASYG--KPQGTCGSFSHGQCKSSSALSIVQKACVGSKSCSXEVSVKTFGDP-CNGV  831

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  832   -AKSLAVEASC  841



>gb|EAZ37702.1| hypothetical protein OsJ_22044 [Oryza sativa Japonica Group]
Length=811

 Score =   436 bits (1121),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 254/593 (43%), Positives = 337/593 (57%), Gaps = 59/593 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A++VA FFQ                     GGPYITT
Sbjct  258   TENWTGWFKAWDKPDFHRSAEDIAFAVAMFFQ-------------------KRGGPYITT  298

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYGNL QPKYGHLK+LH+V+ S+EK +V+G    T   + + VT Y  + T
Sbjct  299   SYDYDAPLDEYGNLRQPKYGHLKDLHSVIKSIEKILVHGEYVDTNYSDKVTVTKYTLDST  358

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGG--  535
               CF +N N+  D  +   GT + +PAWSVSILPDCK   +N+A++  QTTVMV +    
Sbjct  359   SACFINNRNDNMDVNVTLDGTTHLLPAWSVSILPDCKTVAFNSAKIKAQTTVMVNKAKMV  418

Query  536   -KAAAALRWSWRPEVADDTILHGKGQFTANQILDQKV-ANDVSDYIWYMTSVNLDKDDPI  709
              K   +L+WSW  E     +   KG +  N++L+Q V + D SDY+WY TS+N   +   
Sbjct  419   EKEPESLKWSWMRENLTPFMTDEKGSYRKNELLEQIVTSTDQSDYLWYRTSINHKGE---  475

Query  710   WSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASIG  877
                   L VN TG  L+ + NG  V    + N  F    E+  KL+ GKN ++LLSA+IG
Sbjct  476   --ASYTLFVNTTGHELYAFVNGMLVGQNHSPNGHFVFQLESPAKLHDGKNYISLLSATIG  533

Query  878   FQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKS  1051
              +NYGP F+    G+ G  V+++  NG      +L +  WSYK GL GE    +R  +  
Sbjct  534   LKNYGPLFEKMPAGIVGGPVKLIDNNGKGI---DLSNSSWSYKAGLAGE----YRQIHLD  586

Query  1052  RSASQWLSDH--LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLI  1225
             +    W +++  +P  +  TWYKT+F+APAG D VVVDL+G+ KG AWVNGNNLGRYW  
Sbjct  587   KPGCTWDNNNGTVPINKPFTWYKTTFQAPAGEDTVVVDLLGLNKGVAWVNGNNLGRYWPS  646

Query  1226  LAKGDD---CPTEACDYRG----EYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
                       PT A  YRG    E +  KCL+ CG P+QRFYHVPRSFL     N ++LF
Sbjct  647   YTAARSMRRLPTTA-HYRGVFQAEGDGQKCLTGCGEPSQRFYHVPRSFLKNGEPNTVILF  705

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISC-QGGRNITAIKYANFGDTRgscgggf  1561
             EE GG+ S V F+TV  G VCASA       +SC Q  + I+AI   +FG  R   G   
Sbjct  706   EEAGGDPSHVSFRTVAAGSVCASAEVGDTITLSCGQHSKTISAINVTSFGVAR---GQCG  762

Query  1562  ekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                    +K A      ACLGK SC+V  + +V G+    G  +  L V+A C
Sbjct  763   AYKGGCESKAAYKAFTEACLGKESCTVQITNAVTGS----GCLSNVLTVQASC  811



>ref|XP_006854486.1| hypothetical protein AMTR_s00175p00032740 [Amborella trichopoda]
 gb|ERN15953.1| hypothetical protein AMTR_s00175p00032740 [Amborella trichopoda]
Length=882

 Score =   437 bits (1125),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 243/617 (39%), Positives = 347/617 (56%), Gaps = 56/617 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P+R  EDLA++VARFFQ GGTFQNYYMYHGGTNFGRT+GGP+I T
Sbjct  277   TENWSGWFLSFGGAVPHRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRTSGGPFIAT  336

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+AP+DEYG + QPK+GHL++LH  +   E+ +   +   T L  +++  VY   +G
Sbjct  337   SYDYDAPIDEYGLVRQPKWGHLRDLHKSIKLCEEVLTGTDPVLTSLGPNLEAHVYRLGSG  396

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
                 F +N    +DA + + G  Y +PAWSVSILPDCK  V+NTA++ +Q      E  K
Sbjct  397   KCAAFLANVGTQSDAMVTFNGNSYHLPAWSVSILPDCKNAVFNTAKITSQANHFEMEWLK  456

Query  539   AAAALR---------------WSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIW  670
              A  L+               WSW   V +   +     FT   +L+Q     D SDY+W
Sbjct  457   PAFKLQSSQQVGDSLNVLQSDWSW---VIEPVGISMSTAFTKLGLLEQINTTADESDYLW  513

Query  671   YMTSVNLDKDDPIWS--KDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKL  832
             Y  S+++DKD+P  S    + L V+  G VLH + NG++      NN       +  I +
Sbjct  514   YSISMDVDKDEPFLSNGSQVSLHVSSLGHVLHAFINGEFAGRAIGNNGNVKVTMDKPITM  573

Query  833   NHGKNLLTLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
               G N + LLS ++G QNYG +FD  G G+ G   V   G ++   +L S +W+Y++GL+
Sbjct  574   RAGHNTIDLLSVTVGLQNYGAFFDTSGAGITGP--VTLKGFKSGTVDLSSKQWTYQIGLK  631

Query  1013  GEENKLFRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAW  1189
             GE++ L+ S   + +   W+S   LP  R M WYKT+F AP G DPV +DL G+GKG AW
Sbjct  632   GEQSSLYGSEGTNDAP--WVSGSELPKNRPMIWYKTNFDAPDGSDPVALDLTGLGKGQAW  689

Query  1190  VNGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDN  1369
             VNG ++GRYW          ++ C+Y+G Y ++KC  NCG P+Q  YHVPR++    G N
Sbjct  690   VNGQSIGRYWPTYIAPQSGCSDTCNYQGSYTSSKCQRNCGKPSQTLYHVPRAWTQPSG-N  748

Query  1370  ELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISC--------------------Q  1489
              LVLFEE GG+ +++ F     G +C    E   A +                       
Sbjct  749   TLVLFEEIGGDPNQISFAMRSFGSMCGHVSELHPAPVDAWDSRSEARAMSGPELRLECPS  808

Query  1490  GGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I++IK+A+FG  +     G  +     +  A++I++ AC+G  +CS++ S   FG 
Sbjct  809   PGQVISSIKFASFGTPQ--GACGSFRQSKCSSNTALSIVQEACIGLRNCSLSVSIKKFGD  866

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C G  TK L +EAVC
Sbjct  867   P-CKGV-TKSLAIEAVC  881



>gb|KDO73220.1| hypothetical protein CISIN_1g003095mg [Citrus sinensis]
Length=848

 Score =   436 bits (1121),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 252/611 (41%), Positives = 354/611 (58%), Gaps = 52/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNF RT+GGP+I+T
Sbjct  251   TENWSGWFLSFGGAVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPFIST  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+APLDEYG + QPK+GHLK+LH  +   E  +V  + T   L  +++ TVY   +G
Sbjct  311   SYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAALVATDPTYPSLGPNLEATVYKTGSG  370

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV-------  517
               + F +N    +D T+ + G  Y +PAWSVSILPDCK  V+NTA++N+ T V       
Sbjct  371   LCSAFLANIGTNSDVTVKFNGNSYLLPAWSVSILPDCKNVVFNTAKINSVTLVPSFSRQS  430

Query  518   -MVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
               V      A    WS+   + +   +     FT   +L+Q     D SDY+WY  S N+
Sbjct  431   LQVAADSSDAIGSGWSY---INEPVGISKDDAFTKPGLLEQINTTADQSDYLWYSLSTNI  487

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLL  853
               D+P+     +  L V   G  LH + NGK V S + ++S      +  I L  GKN  
Sbjct  488   KADEPLLEDGSKTVLHVQSLGHALHAFINGKLVGSGYGSSSNAKVTVDFPIALAPGKNTF  547

Query  854   TLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
              LLS ++G QNYG +++  G G+ G   +  +G+ T   +L S +W+Y+ GL+GEE    
Sbjct  548   DLLSLTVGLQNYGAFYEKTGAGITGPVQLKGSGNGT-NIDLSSQQWTYQTGLKGEELNF-  605

Query  1034  RSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S++QW S   LP  + + WYKT+F APAG +PV +D  GMGKG AWVNG ++G
Sbjct  606   ----PSGSSTQWDSKSTLPKLQPLVWYKTTFDAPAGSEPVAIDFTGMGKGEAWVNGQSIG  661

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW      +   T++C+YRG Y++NKCL NCG P+Q  YHVPRS+L   G N LVLFEE
Sbjct  662   RYWPTYVSQNGGCTDSCNYRGAYSSNKCLKNCGKPSQSLYHVPRSWLKSSG-NTLVLFEE  720

Query  1391  TGGNTSRVRFQTVRTG-GVCASAYENKVAEISCQGGRN--------------------IT  1507
              GG+ +++ F T + G  +C+   ++    +   G  +                    I+
Sbjct  721   IGGDPTKISFVTKQLGSSLCSHVTDSHPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVIS  780

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A+FG T     G F +G C  A+ ++++++ AC+G  SCS+  S + FG   C G 
Sbjct  781   SIKFASFG-TPLGTCGSFSRGRCSSAR-SLSVVRQACVGSKSCSIGVSVNTFGDP-CKG-  836

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  837   VMKSLAVEASC  847



>ref|XP_010470077.1| PREDICTED: beta-galactosidase 8-like [Camelina sativa]
 ref|XP_010470078.1| PREDICTED: beta-galactosidase 8-like [Camelina sativa]
Length=849

 Score =   436 bits (1121),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 238/609 (39%), Positives = 352/609 (58%), Gaps = 50/609 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  254   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHL++LH  +   E +++  + T T L ++++  VY  +GT
Sbjct  314   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEGSLIASDPTITSLGSNLEAAVYKTSGT  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------V  523
                F +N    +DAT+ + G  Y +PAWSVSILPDCK   +NTA++N+ T         +
Sbjct  374   CAAFLANVGTKSDATVTFNGQSYHLPAWSVSILPDCKNVAFNTAKINSATVSAAFARQSL  433

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             K  G ++  L  +WS+   + +   +     F    +L+Q     D SDY+WY   +++ 
Sbjct  434   KPDGGSSGELGSQWSY---IKEPIGISKTDAFLKPGLLEQINTTADKSDYLWYSLRMDIK  490

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLLS  865
              D+    +  +  L +   GQV++ + NGK   S      +  +  I L  GKN + LLS
Sbjct  491   GDETFLDEGSKAVLHIESIGQVVYAFINGKLAGSGHGKQKITLDIPIDLIAGKNTIDLLS  550

Query  866   ASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
              ++G  NYG +FDL G G+ G  +  K+       +L S +W+Y+VGL+GE+  L     
Sbjct  551   VTVGLANYGAFFDLVGAGITG-PVTLKSAKSGSSIDLASQQWTYQVGLKGEDTGL-----  604

Query  1046  KSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              +  +S+W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRYW 
Sbjct  605   ATGDSSEWVSKTPLPTKQPLVWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRYWP  664

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                 G++  T++CDYRG Y+ NKCL NCG P+Q  YHVPRS+L +  +N LVL EE GG+
Sbjct  665   TSIAGNNGCTDSCDYRGSYSANKCLKNCGKPSQTLYHVPRSWL-KPSENTLVLLEEMGGD  723

Query  1403  TSRVRFQTVRTG-GVCASAYEN---------------------KVAEISCQ-GGRNITAI  1513
              +++ F T +TG  +C    ++                      V  + C    + I++I
Sbjct  724   PTQISFTTKQTGSSLCLMVSQSHPAPVDTWTSGSKISKKKRTRPVLSLQCPVSTQVISSI  783

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A+FG  +     G        +  ++++++ AC+G  SC++  S  VFG   C G   
Sbjct  784   KFASFGTPK--GTCGSFTHGHCNSSRSLSLVQKACIGLRSCNLEVSTRVFGEP-CRGV-V  839

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  840   KTLAVEASC  848



>gb|EYU18852.1| hypothetical protein MIMGU_mgv1a001263mg [Erythranthe guttata]
Length=851

 Score =   436 bits (1121),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 251/613 (41%), Positives = 354/613 (58%), Gaps = 56/613 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+QLGGTFQNYYMYHGGTNFGR++GGP+ITT
Sbjct  254   TENWSGWFSAFGDSLPYRPTEDLAFAVARFYQLGGTFQNYYMYHGGTNFGRSSGGPFITT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+AP+DEYG L QPK+GHLK++H  +   E+ +V  +  TT L ++++ TVY   +G
Sbjct  314   SYDYDAPIDEYGLLRQPKWGHLKDVHKAIKLCEEAMVETDPKTTSLGSNLEATVYKTESG  373

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVN--TQTTVMVKEG  532
                 F +N    +DAT+ + G  Y +PAWSVSILPDC   V NTA++N  + TT  V++ 
Sbjct  374   KCAAFLANVGTHSDATVKFNGNSYNLPAWSVSILPDCNNVVLNTAKINSVSTTTKFVRQT  433

Query  533   GKAA------AALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
              K +      A   WSW   + +   +     FT   +++Q     D+SDY+WY  SV+ 
Sbjct  434   SKDSTTATTDAFSSWSW---INEPVGISSDIAFTKPGLMEQINTTGDLSDYLWYSLSVDT  490

Query  692   DKDDPIWS--KDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLL  853
               ++P      +  L VN  G  L+ + NG+ V S    NS      +  I L  GKN +
Sbjct  491   KGNEPFLEDGSETVLHVNSLGHALYAFINGELVGSGKGRNSNPKVSIDVPISLKPGKNKI  550

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLS ++G QNYG +FD  G G+ G V++ G     T+  +L S +W+Y+VGL GE+  L
Sbjct  551   DLLSLTVGLQNYGAFFDKTGAGITGPVQLKGLKNGSTL--DLSSQQWTYQVGLSGEDLGL  608

Query  1031  FRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
                   S   S W+S   LP  + + WYKT+F AP+G  PV +D  GMGKG AW+NG ++
Sbjct  609   -----SSGGTSFWVSQPTLPKNQPLMWYKTTFDAPSGSSPVALDFTGMGKGQAWINGQSI  663

Query  1208  GRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW   +A    C T++C+YRG Y++ KC  NCG P+Q  YHVPRS++   G N LV+F
Sbjct  664   GRYWPTNIAPSSGC-TDSCNYRGAYSDGKCRRNCGKPSQHLYHVPRSWMKPSG-NILVVF  721

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRN---------------------  1501
             EE GG+ +++ F T  T  +C+   ++    I      N                     
Sbjct  722   EEGGGDPTQLSFATRETESICSRISQSHPIPIDTWTSSNKETRKHTKPTLSLSCPFPNQV  781

Query  1502  ITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCA  1681
             I+ IK+A+FG+ +     G        +K+A  I++ AC+G  SCS+  S + FG   CA
Sbjct  782   ISKIKFASFGNPK--GTCGSFSHGQCSSKNARTIVEKACIGSRSCSIGVSVNTFGEP-CA  838

Query  1682  GSRTKKLVVEAVC  1720
             G  +K L VEA C
Sbjct  839   G-ISKSLAVEASC  850



>dbj|BAD20774.2| beta-galactosidase [Raphanus sativus]
Length=851

 Score =   435 bits (1119),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 247/609 (41%), Positives = 357/609 (59%), Gaps = 51/609 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  257   TENWSGWFLGFGEPSPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFERTSGGPLIST  316

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN-G  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  ++  +   T L ++++  VY  + G
Sbjct  317   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALIATDPKITSLGSNLEAAVYKTSTG  376

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVN--TQTTVMVKEG  532
             +   F +N    +DAT+ + G  Y++PAWSVSILPDCK   +NTA++N  T++T   ++ 
Sbjct  377   SCAAFLANIGTKSDATVTFNGKSYRLPAWSVSILPDCKNVAFNTAKINSATESTAFARQS  436

Query  533   GK------AAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
              K      A    +WS+   + +   +     F    +L+Q     D SDY+WY   +++
Sbjct  437   LKPNADSSAELGSQWSY---IKEPVGISKADAFVKPGLLEQINTTADKSDYLWYSLRMDI  493

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLL  862
               D+    +  +  L V   GQ+++ + NGK   S      +  +  I L  GKN + LL
Sbjct  494   KGDETFLDEGSKAVLHVQSIGQLVYAFINGKLAGSGNGKQKISLDIPINLVTGKNTIDLL  553

Query  863   SASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSS  1042
             S ++G  NYGP+FDL G G+ G  +  K+       +L S +W+Y+VGL+GE+  L    
Sbjct  554   SVTVGLANYGPFFDLTGAGITG-PVSLKSAKTGSSTDLSSQQWTYQVGLKGEDKGL----  608

Query  1043  NKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW  1219
               S  +S+W+S+  LPT++ + WYKT+F AP+G DPV +D  G GKG AWVNG ++GRYW
Sbjct  609   -GSGDSSEWVSNSPLPTSQPLIWYKTTFDAPSGSDPVAIDFTGTGKGIAWVNGQSIGRYW  667

Query  1220  LI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
                +A+ D C   +CDYRG Y +NKCL NCG P+Q  YHVPRS++   G N LVL EE G
Sbjct  668   PTSIARTDGC-VGSCDYRGSYRSNKCLKNCGKPSQTLYHVPRSWIKPSG-NTLVLLEEMG  725

Query  1397  GNTSRVRFQTVRTGG-----------------VCASAYENK---VAEISCQ-GGRNITAI  1513
             G+ +++ F T +TG                  +  S + N+   V  + C    + I++I
Sbjct  726   GDPTKISFATKQTGSNLCLTVSQSHPAPVDTWISDSKFSNRTSPVLSLKCPVSTQVISSI  785

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             ++A+FG T     G F  G C  A+ ++++++ AC+G  SC V  S  VFG   C G   
Sbjct  786   RFASFG-TPTGTCGSFSYGHCSSAR-SLSVVQKACVGSRSCKVEVSTRVFGEP-CRGV-V  841

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  842   KSLAVEASC  850



>emb|CAC44501.1| beta-galactosidase [Fragaria x ananassa]
Length=840

 Score =   435 bits (1118),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 251/610 (41%), Positives = 351/610 (58%), Gaps = 61/610 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P R  EDLA++VARF+Q GGTFQNYYMYHGGTNFGR++GGP+I T
Sbjct  254   TENWSGWFLSFGGAVPQRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFGRSSGGPFIAT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+APLDEYG L QPK+GHLK++H  +   E  +V  + T + L  +I+  VY     
Sbjct  314   SYDYDAPLDEYGLLRQPKWGHLKDVHKAIKLCEPAMVATDPTISSLGQNIEAAVYKTGSV  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKEGG  535
              + F +N +  +DAT+ + G  Y++PAWSVSILPDCK  V NTA++NT T V    ++  
Sbjct  374   CSAFLANVDTKSDATVTFNGNSYQLPAWSVSILPDCKNVVINTAKINTATMVPSFTRQSI  433

Query  536   KA------AAALRWSWRPEVADDTILHGKGQ-FTANQILDQ-KVANDVSDYIWYMTSVNL  691
              A      A    WSW     ++ +   KG  FT   +L+Q     D SDY+WY TS+++
Sbjct  434   SADVEPTEAVGSGWSW----INEPVGISKGDAFTRVGLLEQINTTADKSDYLWYSTSIDV  489

Query  692   DKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTL  859
                   +  D+   V   G  LH + NGK   S   N+       E  ++   GKN + L
Sbjct  490   KGG---YKADLH--VQSLGHALHAFVNGKLAGSGTGNSGNAKVSVEIPVEFASGKNTIDL  544

Query  860   LSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFR  1036
             LS ++G QNYG +FDL G G+ G V++ G     T+  +L S +W+Y++GL+GE+  L  
Sbjct  545   LSLTVGLQNYGAFFDLVGAGITGPVQLKGSANGTTI--DLSSQQWTYQIGLKGEDEDLPS  602

Query  1037  SSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
              S      SQW+S   LP  + +TWYKT F AP G +PV +D  GMGKG AWVNG ++GR
Sbjct  603   GS------SQWISQPTLPKNQPLTWYKTQFDAPGGSNPVALDFTGMGKGEAWVNGQSIGR  656

Query  1214  YWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             YW   +A    C    C+YRG Y+ +KC  NCG P+Q+ YHVPRS++   G N LVLFEE
Sbjct  657   YWPTNVAPKTGC--TDCNYRGAYSADKCRKNCGMPSQKLYHVPRSWMKSSG-NTLVLFEE  713

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEI------SCQGGRN--------------ITA  1510
              GG+ +++ F T +   +C+   E+  + +      S  G ++              I++
Sbjct  714   VGGDPTQLSFATRQVESLCSHVSESHPSPVDMWSSDSKAGSKSRPRLSLECPFPNQVISS  773

Query  1511  IKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSR  1690
             IK+A++G  R S   G        +  A++I++ AC+G  SCS+  S   FG   C G  
Sbjct  774   IKFASYG--RPSGTCGSFSHGSCRSSRALSIVQKACVGSKSCSIEVSTHTFGDP-CKG-L  829

Query  1691  TKKLVVEAVC  1720
              K L VEA C
Sbjct  830   AKSLAVEASC  839



>ref|XP_007137754.1| hypothetical protein PHAVU_009G153100g [Phaseolus vulgaris]
 gb|ESW09748.1| hypothetical protein PHAVU_009G153100g [Phaseolus vulgaris]
Length=843

 Score =   434 bits (1117),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 248/610 (41%), Positives = 354/610 (58%), Gaps = 50/610 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK +GG+DP+R AED+A+SVARFFQ GG+  NYYMYHGGTNFGRTAGGP+ITT
Sbjct  246   TENWPGWFKTFGGRDPHRPAEDVAFSVARFFQKGGSVHNYYMYHGGTNFGRTAGGPFITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA-FNG  358
             +YDY+AP+DEYG    PK+ HLKELH  +   E  ++ G      L  S++V VY   +G
Sbjct  306   SYDYDAPIDEYGLPRLPKWDHLKELHRAIKLCEHALLNGKSVNVSLGPSVEVDVYTDSSG  365

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------  520
                 F SN+++  D T+ ++ T Y +PAWSVSILPDCK  V+NTA+V++QT V+      
Sbjct  366   ACAAFISNADDKNDRTVEFRNTSYHLPAWSVSILPDCKNVVFNTAKVSSQTNVVAMIPGS  425

Query  521   VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDK  697
             +++  K   +L+W     V +   + G   F  N  +D      D +DY+W+ TS+++ +
Sbjct  426   LQQSNKGVNSLKWD---IVKEKPGIWGTADFVKNGFVDLINTTKDTTDYLWHTTSISVGE  482

Query  698   DDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTL  859
             ++    K  +  L +  TG  LH + N +Y  +   N +     F+  I L  GKN + L
Sbjct  483   NEEFLKKGSKPVLLIESTGHALHAFVNQEYQGTGTGNGTHSPFTFKNPISLRAGKNEIAL  542

Query  860   LSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             L  ++G Q  GP++D  G GL  V+I G N       +L S+ W+YK+G++GE  KL  +
Sbjct  543   LCLTVGLQTAGPFYDFVGAGLTSVKIEGLNNGTI---DLSSYAWTYKIGVQGEHLKL--N  597

Query  1040  SNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                  +   W S    P  + +TWYK    AP G +PV +D++ MGKG AW+NG  +GRY
Sbjct  598   QGDGLNNVNWTSTSEPPKMQPLTWYKAIVDAPPGDEPVGLDMLHMGKGLAWLNGEEIGRY  657

Query  1217  WLILA--KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             W   +  K +DC  E CDYRG++N +KC + CG PTQR+YHVPRS+    G N LVLFEE
Sbjct  658   WPRKSEFKSEDCVKE-CDYRGKFNPDKCDTGCGEPTQRWYHVPRSWFKPSG-NILVLFEE  715

Query  1391  TGGNTSRVRFQTVRTGGVCA------------SAYENKV--------AEISCQGGRNITA  1510
              GG   ++RF   +  G CA            S  E+K+        A ++C    +I+A
Sbjct  716   KGGEPDKIRFVRRKISGACALVAEDYPSVGLLSQGEDKIQNNKNIPFARLTCPSNTHISA  775

Query  1511  IKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSR  1690
             +K+A+FG T     G + KG C     ++ +++ ACL K  C +  +E  F T  C G  
Sbjct  776   VKFASFG-TPSGSCGSYLKGDCHDPNSSI-VVEKACLNKNDCVIKLTEENFKTNLCPG-L  832

Query  1691  TKKLVVEAVC  1720
             ++KL VEA+C
Sbjct  833   SRKLAVEAIC  842



>ref|XP_006424599.1| hypothetical protein CICLE_v10027805mg [Citrus clementina]
 ref|XP_006488120.1| PREDICTED: beta-galactosidase 8-like [Citrus sinensis]
 gb|ESR37839.1| hypothetical protein CICLE_v10027805mg [Citrus clementina]
Length=848

 Score =   434 bits (1116),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 251/611 (41%), Positives = 353/611 (58%), Gaps = 52/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNF RT+GGP+I+T
Sbjct  251   TENWSGWFLSFGGAVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPFIST  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+APLDEYG + QPK+GHLK+LH  +   E  +V  + T   L  +++ TVY   +G
Sbjct  311   SYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAALVATDPTYPSLGPNLEATVYKTGSG  370

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV-------  517
               + F +N    +D T+ + G  Y +PAWSVSILPDCK  V+NTA++N+ T V       
Sbjct  371   LCSAFLANIGTNSDVTVKFNGNSYLLPAWSVSILPDCKNVVFNTAKINSVTLVPSFSRQS  430

Query  518   -MVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
               V      A    WS+   + +   +     FT   +L+Q     D SDY+WY  S N+
Sbjct  431   LQVAADSSDAIGSGWSY---INEPVGISKDDAFTKPGLLEQINTTADQSDYLWYSLSTNI  487

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLL  853
               D+P+     +  L V   G  LH + NGK V S + ++S      +  I L  GKN  
Sbjct  488   KADEPLLEDGSKTVLHVQSLGHALHAFINGKLVGSGYGSSSNAKVTVDFPIALAPGKNTF  547

Query  854   TLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLF  1033
              LLS ++G QNYG +++  G G+ G   +  +G+ T   +L S +W+Y+ GL+GEE    
Sbjct  548   DLLSLTVGLQNYGAFYEKTGAGITGPVQLKGSGNGT-NIDLSSQQWTYQTGLKGEELNF-  605

Query  1034  RSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLG  1210
                  S S++QW S   LP  + + WYKT+F APAG +PV +D  GMGKG AWVNG ++G
Sbjct  606   ----PSGSSTQWDSKSTLPKLQPLVWYKTTFDAPAGSEPVAIDFTGMGKGEAWVNGQSIG  661

Query  1211  RYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             RYW      +   T++C+YRG Y++NKCL NCG P+Q  YHVPRS+L   G N LVLFEE
Sbjct  662   RYWPTYVSQNGGCTDSCNYRGAYSSNKCLKNCGKPSQSLYHVPRSWLKSSG-NTLVLFEE  720

Query  1391  TGGNTSRVRFQTVRTG-GVCASAYENKVAEISCQGGRN--------------------IT  1507
              GG+ +++ F T + G  +C+   ++    +   G  +                    I+
Sbjct  721   IGGDPTKISFVTKQLGSSLCSHVTDSHPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVIS  780

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A+FG T     G F +G C  A+ ++++++ AC+G  SC +  S + FG   C G 
Sbjct  781   SIKFASFG-TPLGTCGSFSRGRCSSAR-SLSVVRQACVGSKSCIIGVSVNTFGDP-CKGV  837

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  838   -MKSLAVEASC  847



>gb|AHC32021.1| beta-galactosidase 3 [Camellia sinensis]
Length=893

 Score =   435 bits (1119),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 247/612 (40%), Positives = 353/612 (58%), Gaps = 53/612 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK +GG+DP+R  ED+AYSVARFFQ GG+ QNYYMYHGGTNFGRT+GGP+ITT
Sbjct  295   TENWPGWFKTFGGRDPHRPPEDIAYSVARFFQKGGSLQNYYMYHGGTNFGRTSGGPFITT  354

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA-FNG  358
             +YDYNAP+DEYG    PK+ HLKELH  +   E  ++    T   L    +  VYA  +G
Sbjct  355   SYDYNAPIDEYGLARLPKWAHLKELHRAIKLCEHALLNSESTLLSLGPLQEADVYADPSG  414

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTT--VMVKEG  532
                 F +N+++  D  + +Q   Y +PAWSVSILPDCK  V+NTA+V +QT+   MV E 
Sbjct  415   ACAAFIANNDDKNDKIVEFQNMSYHLPAWSVSILPDCKNVVFNTAKVGSQTSNVEMVPED  474

Query  533   GKAAAA------LRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
              + ++       L+W    E A    + G+  F  N  +D      D +DY+WY TS+++
Sbjct  475   LQPSSVNKDLKGLQWEVFVEKAG---IWGEADFVKNGFVDHINTTKDTTDYLWYTTSLHV  531

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLL  853
             D+++    K  +  L V   G  LH + N K   S   N S+    F+T I L  GKN +
Sbjct  532   DENEEFLKKGSQPMLVVESKGHALHAFVNQKLQASASGNGSVSPFKFQTPISLKAGKNEI  591

Query  854   TLLSASIGFQNYGPYFDLGGNGLYGVEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLS ++G QN GP+++  G GL  V I G +NG     K+L ++ W+YK+GL GE   +
Sbjct  592   ALLSMTVGLQNGGPFYEWVGAGLTSVLIKGFRNG----TKDLTTYNWNYKIGLEGEHLSI  647

Query  1031  FRSSNKSRSASQWL-SDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             +++     ++ +W+ +   P  + +TWYK    AP G +P+ +D++ MGKG AW+NG  +
Sbjct  648   YKAD--GLNSVKWVPTSEPPKEQPLTWYKAVVNAPPGDEPIGLDMIHMGKGLAWLNGEEI  705

Query  1208  GRYWLILA-KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW I A K D+C  + CDYRG+++ NKC + CG PTQR+YHVPRS+    G N LV+F
Sbjct  706   GRYWPIKASKHDEC-VQQCDYRGKFSPNKCSTGCGEPTQRWYHVPRSWFKPSG-NFLVIF  763

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENK--------------------VAEISCQGGRNI  1504
             EE GG+ + +RF   +T GVCA   E+                     V ++ C    +I
Sbjct  764   EEKGGDPTNIRFSKRKTSGVCALVSEDHPSFEPESLLEDGTRDHKNSAVVQLKCPINTHI  823

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             + +K+A+FG   G+CG            ++ ++++  CL +  C V  +   F    C G
Sbjct  824   STVKFASFGTPSGTCGSYTMGDCHD--PNSTSVVEKVCLNENECRVELTRVNFNKGLCPG  881

Query  1685  SRTKKLVVEAVC  1720
             +  KKL VE VC
Sbjct  882   T-IKKLAVEVVC  892



>ref|XP_009335064.1| PREDICTED: beta-galactosidase 8-like isoform X2 [Pyrus x bretschneideri]
Length=697

 Score =   429 bits (1103),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 248/612 (41%), Positives = 350/612 (57%), Gaps = 56/612 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P R  EDLA++VARFFQ GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  102   TENWSGWFLSFGGAVPQRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  161

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHLK++H  +   E+ +V  +   +    +++ TVY     
Sbjct  162   SYDYDAPIDEYGLLRQPKWGHLKDVHKAIKLCEEAMVATDPKYSSFGPNVEATVYKTGSA  221

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F +NS+  +DAT+ + G  Y +PAWSVSILPDCK  V NTA++N+   +       V
Sbjct  222   CAAFLANSDTKSDATVTFNGNSYHLPAWSVSILPDCKNVVLNTAKINSAAMIPSFMHHSV  281

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
              +   ++ AL   WSW   + +   +  K  FT   +L+Q     D SDY+WY  S+++ 
Sbjct  282   IDDTDSSEALGSGWSW---INEPVGISKKDAFTRVGLLEQINTTADKSDYLWYSLSIDVT  338

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKY----VDSQWNNNSLFETNIKLNHGKNLLT  856
               D       +  L V   G  LH + NGK     + +  N     +  +    GKN + 
Sbjct  339   SSDTFLQDGSQTILHVESLGHALHAFINGKPAGRGIITANNGKISVDIPVTFASGKNTID  398

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
             LLS +IG QNYG +FD  G G+ G V++ G KNG  T   +L S +W+Y++GL+GE+   
Sbjct  399   LLSLTIGLQNYGAFFDKSGAGITGPVQLKGLKNGTTT---DLSSQRWTYQIGLQGED---  452

Query  1031  FRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
               S   S S+SQW+S   LP  + +TWYK +F AP G +PV +D  GMGKG AWVNG ++
Sbjct  453   --SGFSSGSSSQWISQPTLPKKQPLTWYKATFNAPDGSNPVALDFTGMGKGEAWVNGQSI  510

Query  1208  GRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW    A    CP ++C++RG Y++NKC  NCG P+Q  YHVPRS+L   G N LVLF
Sbjct  511   GRYWPTNNAPTSGCP-DSCNFRGPYDSNKCRKNCGKPSQELYHVPRSWLKPSG-NTLVLF  568

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEI-----SCQGGRN---------------I  1504
             EE GG+ +++ F T +   +C+   E+  + +       + GR                I
Sbjct  569   EEIGGDPTQISFATRQIESLCSHVSESHPSPVDTWSSDSKAGRKLGPVLSLECPFPNQVI  628

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A++G  +     G        +  A++I++ AC+G  SCS+  S   FG   C G
Sbjct  629   SSIKFASYG--KPHGTCGSFSHGQCKSTSALSIVQKACVGSKSCSIEVSVKTFGDP-CKG  685

Query  1685  SRTKKLVVEAVC  1720
                K L VEA C
Sbjct  686   -VAKSLAVEASC  696



>ref|XP_006581786.1| PREDICTED: beta-galactosidase 10-like [Glycine max]
Length=845

 Score =   433 bits (1114),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 244/610 (40%), Positives = 353/610 (58%), Gaps = 50/610 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK +GG+DP+R AED+A+SVARFFQ GG+  NYYMYHGGTNFGRTAGGP+ITT
Sbjct  248   TENWPGWFKTFGGRDPHRPAEDVAFSVARFFQKGGSVHNYYMYHGGTNFGRTAGGPFITT  307

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA-FNG  358
             +YDY+AP+DEYG    PK+GHLKELH  +   E  ++ G      L  S++  VY   +G
Sbjct  308   SYDYDAPVDEYGLPRLPKWGHLKELHRAIKLCEHVLLNGKSVNISLGPSVEADVYTDSSG  367

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------  520
                 F SN ++  D T+ ++   + +PAWSVSILPDCK  V+NTA+V +QT+V+      
Sbjct  368   ACAAFISNVDDKNDKTVEFRNASFHLPAWSVSILPDCKNVVFNTAKVTSQTSVVAMVPES  427

Query  521   VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDK  697
             +++  K   + +W     V +   + GK  F  N  +D      D +DY+W+ TS+ + +
Sbjct  428   LQQSDKVVNSFKWD---IVKEKPGIWGKADFVKNGFVDLINTTKDTTDYLWHTTSIFVSE  484

Query  698   DDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTL  859
             ++    K  +  L +  TG  LH + N +Y  +   N +     F+  I L  GKN + L
Sbjct  485   NEEFLKKGNKPVLLIESTGHALHAFVNQEYEGTGSGNGTHAPFTFKNPISLRAGKNEIAL  544

Query  860   LSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             L  ++G Q  GP++D  G GL  V+I G N       +L S+ W+YK+G++GE  +L++ 
Sbjct  545   LCLTVGLQTAGPFYDFVGAGLTSVKIKGLNNGTI---DLSSYAWTYKIGVQGEYLRLYQG  601

Query  1040  SNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
             +  +     W S    P  + +TWYK    AP G +PV +D++ MGKG AW+NG  +GRY
Sbjct  602   NGLNN--VNWTSTSEPPKMQPLTWYKAIVDAPPGDEPVGLDMLHMGKGLAWLNGEEIGRY  659

Query  1217  WLILA--KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             W   +  K +DC  E CDYRG++N +KC + CG PTQR+YHVPRS+    G N LVLFEE
Sbjct  660   WPRKSEFKSEDCVKE-CDYRGKFNPDKCDTGCGEPTQRWYHVPRSWFKPSG-NILVLFEE  717

Query  1391  TGGNTSRVRFQTVRTGGVCA------------SAYENKV--------AEISCQGGRNITA  1510
              GG+  +++F   +  G CA            S  E+K+        A ++C G   I+A
Sbjct  718   KGGDPEKIKFVRRKVSGACALVAEDYPSVALVSQGEDKIQSNKNIPFARLACPGNTRISA  777

Query  1511  IKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSR  1690
             +K+A+FG   G+CG   +        ++  I++ ACL K  C +  +E  F +  C G  
Sbjct  778   VKFASFGSPSGTCGSYLKGDCHD--PNSSTIVEKACLNKNDCVIKLTEENFKSNLCPG-L  834

Query  1691  TKKLVVEAVC  1720
             ++KL VEAVC
Sbjct  835   SRKLAVEAVC  844



>ref|XP_002465536.1| hypothetical protein SORBIDRAFT_01g040750 [Sorghum bicolor]
 gb|EER92534.1| hypothetical protein SORBIDRAFT_01g040750 [Sorghum bicolor]
Length=860

 Score =   434 bits (1115),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 251/612 (41%), Positives = 351/612 (57%), Gaps = 52/612 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GGTFQNYYMYHGGTN  R++GGP+I T
Sbjct  261   TENWSGWFLSFGGAVPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNLDRSSGGPFIAT  320

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + +PK+GHL+++H  +   E  ++  + + T L  + +  VY     
Sbjct  321   SYDYDAPIDEYGLVREPKWGHLRDVHKAIKLCEPALIATDPSYTSLGQNAEAAVYKTGSV  380

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--------  517
                F +N +  +D T+ + G  Y++PAWSVSILPDCK  V NTA++N+Q T         
Sbjct  381   CAAFLANIDGQSDKTVTFNGRMYRLPAWSVSILPDCKNVVLNTAQINSQVTSSEMRYLES  440

Query  518   --MVKEGGKAAAALRWS-WRPEVADDTILHGKGQFTANQILDQKVANDVSDYIWYMTSVN  688
               M  +G      L  S W   +    I        A  +       D SD++WY TS+ 
Sbjct  441   SNMASDGSFITPELAVSGWSYAIEPVGITKDNALTKAGLMEQINTTADASDFLWYSTSIT  500

Query  689   LDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLNHGKNLL  853
             +  D+P  +     L VN  G VL VY NGK   S   + S     ++  I+L  GKN +
Sbjct  501   VKGDEPYLNGSQSNLVVNSLGHVLQVYINGKIAGSAQGSASSSLISWQKPIELVPGKNKI  560

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLSA++G  NYG +FDL G G+ G V++ G NG      +L S +W+Y++GLRGE+  L
Sbjct  561   DLLSATVGLSNYGAFFDLVGAGITGPVKLSGTNG----ALDLSSAEWTYQIGLRGEDLHL  616

Query  1031  FRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             +   + S ++ +W+S +  P  + + WYKT F  PAG DPV +D  GMGKG AWVNG ++
Sbjct  617   Y---DPSEASPEWVSANAYPINQPLIWYKTKFTPPAGDDPVAIDFTGMGKGEAWVNGQSI  673

Query  1208  GRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW   LA    C   +C+YRG YN+NKCL  CG P+Q  YHVPRSFL + G N++VLF
Sbjct  674   GRYWPTNLAPQSGC-VNSCNYRGSYNSNKCLKKCGQPSQTLYHVPRSFL-QPGSNDIVLF  731

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEISC--------------------QGGRNI  1504
             E+ GG+ S++ F   +TG VCA   E   A+I                      + G+ I
Sbjct  732   EQFGGDPSKISFVIRQTGSVCAQVSEEHPAQIDSWNSSQQTMQRYGPELRLECPKDGQVI  791

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A+FG    S   G        +  A+++++ AC+G +SCSV  S + FG   C G
Sbjct  792   SSIKFASFGTP--SGTCGSYSHGECSSTQALSVVQEACIGVSSCSVPVSSNYFGNP-CTG  848

Query  1685  SRTKKLVVEAVC  1720
               TK L VEA C
Sbjct  849   V-TKSLAVEAAC  859



>ref|XP_006296187.1| hypothetical protein CARUB_v10025350mg [Capsella rubella]
 gb|EOA29085.1| hypothetical protein CARUB_v10025350mg [Capsella rubella]
Length=846

 Score =   433 bits (1114),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 239/609 (39%), Positives = 353/609 (58%), Gaps = 50/609 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGG+NF RT+GGP I+T
Sbjct  251   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGSNFDRTSGGPLIST  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHL++LH  +   E +++  + T T L ++++  VY  +G+
Sbjct  311   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDSLIATDPTITSLGSNLEAAVYKTSGS  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVN--TQTTVM----V  523
                F +N    +DAT+ + G  Y +PAWSVSILPDCK   +NTA+ N  T++T      +
Sbjct  371   CAAFLANVGTKSDATVVFNGQSYVLPAWSVSILPDCKNVAFNTAKKNAATESTTFAPQSL  430

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             K  G ++A L  +WS+   + +   +     F    +L+Q     D SDY+WY   +++ 
Sbjct  431   KPDGGSSAELGSQWSY---IKEPIGISKTDAFLKPGLLEQINTTADKSDYLWYSLRMDIK  487

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLLS  865
              D+    +  +  L +   GQV++ + NGK   S  +   +     I L  GKN + LLS
Sbjct  488   GDETFLDEGSKAVLHIESIGQVVYAFINGKLAGSGHDKQKISLVIPINLVPGKNTIDLLS  547

Query  866   ASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
              ++G  NYGP+FDL G G+ G  +  K+       +L + +W+Y+VGL+GE+  L     
Sbjct  548   VTVGLANYGPFFDLVGAGITG-PVTLKSAKSGSSIDLATQQWTYQVGLKGEDTGL-----  601

Query  1046  KSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              +  +S+W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRYW 
Sbjct  602   ATGDSSEWVSKSPLPTKQPLIWYKTTFNAPSGSEPVAIDFTGTGKGIAWVNGQSIGRYWP  661

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                  ++  T++CDYRG Y   KC+ NCG P+Q  YHVPRS+LN  G N LVL EE GG+
Sbjct  662   TSIAANNGCTDSCDYRGSYTAKKCVKNCGKPSQTLYHVPRSWLNPSG-NTLVLLEEMGGD  720

Query  1403  TSRVRFQTVRTG-GVCASAYEN---------------------KVAEISCQGGRN-ITAI  1513
              +++ F T +TG  +C +  ++                      V  + C    + IT+I
Sbjct  721   PTQISFATKQTGSSLCLTVSQSHPPPVDTWTSDSKISNKHRTRPVLSLKCPVSTHVITSI  780

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A+FG  +     G        +  ++++++ AC+G  SC+V  S  VFG   C G   
Sbjct  781   KFASFGTPK--GTCGSFTYGHCSSSRSLSLVQKACIGLRSCNVEVSTRVFGEP-CRGV-V  836

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  837   KSLAVEASC  845



>tpg|DAA44443.1| TPA: hypothetical protein ZEAMMB73_968467 [Zea mays]
Length=830

 Score =   432 bits (1112),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 255/617 (41%), Positives = 357/617 (58%), Gaps = 63/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GGTFQNYYMYHGGTN  R++GGP+I T
Sbjct  232   TENWSGWFLSFGGAVPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNLDRSSGGPFIAT  291

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++  + + T L  +++  VY     
Sbjct  292   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKLCEPALIATDPSYTSLGPNVEAAVYKVGSV  351

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTT---VMVKEG  532
                F +N +  +D T+ + G  Y++PAWSVSILPDCK  V NTA++N+QTT   +   E 
Sbjct  352   CAAFLANIDGQSDKTVTFNGKMYRLPAWSVSILPDCKNVVLNTAQINSQTTGSEMRYLES  411

Query  533   GKAA----------AALRWSWRPE---VADDTILHGKGQFTANQILDQ-KVANDVSDYIW  670
                A          A   WS+  E   +  D  L   G      +++Q     D SD++W
Sbjct  412   SNVASDGSFVTPELAVSDWSYAIEPVGITKDNALTKAG------LMEQINTTADASDFLW  465

Query  671   YMTSVNLDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLN  835
             Y TS+ +  D+P  +     L VN  G VL VY NGK   S   + S     ++  I+L 
Sbjct  466   YSTSITVKGDEPYLNGSQSNLAVNSLGHVLQVYINGKIAGSAQGSASSSLISWQKPIELV  525

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
              GKN + LLSA++G  NYG +FDL G G+ G V++ G NG      +L S +W+Y++GLR
Sbjct  526   PGKNKIDLLSATVGLSNYGAFFDLVGAGITGPVKLSGLNG----ALDLSSAEWTYQIGLR  581

Query  1013  GEENKLFRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAW  1189
             GE+  L+   + S ++ +W+S +  P    + WYKT F  PAG DPV +D  GMGKG AW
Sbjct  582   GEDLHLY---DPSEASPEWVSANAYPINHPLIWYKTKFTPPAGDDPVAIDFTGMGKGEAW  638

Query  1190  VNGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGD  1366
             VNG ++GRYW   LA    C   +C+YRG Y+++KCL  CG P+Q  YHVPRSFL + G 
Sbjct  639   VNGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSSKCLKKCGQPSQTLYHVPRSFL-QPGS  696

Query  1367  NELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISC-------------------Q  1489
             N+LVLFE  GG+ S++ F   +TG VCA   E   A+I                     +
Sbjct  697   NDLVLFEHFGGDPSKISFVMRQTGSVCAQVSEAHPAQIDSWSSQQPMQRYGPALRLECPK  756

Query  1490  GGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+++K+A+FG    S   G        +  A++I++ AC+G +SCSV  S + FG 
Sbjct  757   EGQVISSVKFASFGTP--SGTCGSYSHGECSSTQALSIVQEACIGVSSCSVPVSSNYFGN  814

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C G  TK L VEA C
Sbjct  815   P-CTGV-TKSLAVEAAC  829



>ref|NP_001146370.1| beta-galactosidase precursor [Zea mays]
 gb|ACL53803.1| unknown [Zea mays]
 tpg|DAA44442.1| TPA: beta-galactosidase [Zea mays]
Length=852

 Score =   433 bits (1113),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 254/617 (41%), Positives = 356/617 (58%), Gaps = 63/617 (10%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARF+Q GGTFQNYYMYHGGTN  R++GGP+I T
Sbjct  254   TENWSGWFLSFGGAVPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNLDRSSGGPFIAT  313

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++  + + T L  +++  VY     
Sbjct  314   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKLCEPALIATDPSYTSLGPNVEAAVYKVGSV  373

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTT---VMVKEG  532
                F +N +  +D T+ + G  Y++PAWSVSILPDCK  V NTA++N+QTT   +   E 
Sbjct  374   CAAFLANIDGQSDKTVTFNGKMYRLPAWSVSILPDCKNVVLNTAQINSQTTGSEMRYLES  433

Query  533   GKAA----------AALRWSWRPE---VADDTILHGKGQFTANQILDQ-KVANDVSDYIW  670
                A          A   WS+  E   +  D  L   G      +++Q     D SD++W
Sbjct  434   SNVASDGSFVTPELAVSDWSYAIEPVGITKDNALTKAG------LMEQINTTADASDFLW  487

Query  671   YMTSVNLDKDDPIWS-KDMRLGVNGTGQVLHVYANGKYVDSQWNNNSL----FETNIKLN  835
             Y TS+ +  D+P  +     L VN  G VL VY NGK   S   + S     ++  I+L 
Sbjct  488   YSTSITVKGDEPYLNGSQSNLAVNSLGHVLQVYINGKIAGSAQGSASSSLISWQKPIELV  547

Query  836   HGKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLR  1012
              GKN + LLSA++G  NYG +FDL G G+ G V++ G NG      +L S +W+Y++GLR
Sbjct  548   PGKNKIDLLSATVGLSNYGAFFDLVGAGITGPVKLSGLNG----ALDLSSAEWTYQIGLR  603

Query  1013  GEENKLFRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAW  1189
             GE+  L+   + S ++ +W+S +  P    + WYKT F  PAG DPV +D  GMGKG AW
Sbjct  604   GEDLHLY---DPSEASPEWVSANAYPINHPLIWYKTKFTPPAGDDPVAIDFTGMGKGEAW  660

Query  1190  VNGNNLGRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGD  1366
             VNG ++GRYW   LA    C   +C+YRG Y+++KCL  CG P+Q  YHVPRSFL + G 
Sbjct  661   VNGQSIGRYWPTNLAPQSGC-VNSCNYRGAYSSSKCLKKCGQPSQTLYHVPRSFL-QPGS  718

Query  1367  NELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISC-------------------Q  1489
             N+LVLFE  GG+ S++ F   +TG VCA   E   A+I                     +
Sbjct  719   NDLVLFEHFGGDPSKISFVMRQTGSVCAQVSEAHPAQIDSWSSQQPMQRYGPALRLECPK  778

Query  1490  GGRNITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGT  1669
              G+ I+++K+A+FG        G        +  A++I++ AC+G +SCSV  S + FG 
Sbjct  779   EGQVISSVKFASFGTPS--GTCGSYSHGECSSTQALSIVQEACIGVSSCSVPVSSNYFGN  836

Query  1670  TNCAGSRTKKLVVEAVC  1720
               C G  TK L VEA C
Sbjct  837   P-CTGV-TKSLAVEAAC  851



>gb|EYU18851.1| hypothetical protein MIMGU_mgv1a001293mg [Erythranthe guttata]
Length=845

 Score =   432 bits (1112),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 254/612 (42%), Positives = 355/612 (58%), Gaps = 56/612 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TE W+GWF  WG   PYR AED+A++VARF+Q  GT  NYYMYHGGTNFGRT+GGP+I+T
Sbjct  250   TELWSGWFTSWGDPVPYRPAEDVAFAVARFYQNNGTLMNYYMYHGGTNFGRTSGGPFIST  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG L QPK+GHLK+LH  +   E+ +V     TT L  +++VTVY + +G
Sbjct  310   SYDYDAPIDEYGLLRQPKWGHLKDLHKAIKLCEEAMVAAFGNTTSLGQNLEVTVYQSESG  369

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE-  529
             +   F +N +   D T+N+ G  + +PAWSVSILPDCK  VYNTA+VN+ T +   VK+ 
Sbjct  370   SCAAFLANLDNQLDTTVNFNGNSFDLPAWSVSILPDCKNVVYNTAKVNSITGISKFVKQL  429

Query  530   -----GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
                   G  A    WSW  E      +     F    +L+Q     D SDY+WY  S+ L
Sbjct  430   AQTNSSGNGATFSSWSWYSEPVG---ISSSNAFVLPGLLEQINTTADRSDYLWYSLSMGL  486

Query  692   DKDDPIW--SKDMRLGVNGTGQVLHVYANGKYVDS----QWNNNSLFETNIKLNHGKNLL  853
             + +DP+      + L ++  G VL+ + NGK   S      N+N   E  + L  G N +
Sbjct  487   NDNDPLLRDGSQIVLHIDSLGHVLYTFINGKLAGSGKGSAKNSNVSIEVPVNLEPGNNTI  546

Query  854   TLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
              LLS ++G +NYG +FD  G G+ G V++ G +   TV  +L   +W+Y+VGL+GE+++L
Sbjct  547   DLLSVTVGLKNYGAFFDEAGAGICGPVQLKGLSNGSTV--DLSGEQWTYQVGLKGEQSEL  604

Query  1031  FRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
                   S S++ WLS+  LP    +TWYKT+F APAG  PV +D  GMGKG AWVNG  +
Sbjct  605   -----SSGSSALWLSEPTLPKNTPLTWYKTTFSAPAGNSPVAIDFTGMGKGHAWVNGQGI  659

Query  1208  GRYWL--ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVL  1381
             GRYW   I+     C T  C+YRG Y+ NKCL+NCG P+Q+  HVPRS+L ++G+N LVL
Sbjct  660   GRYWPSNIVDPNGYCTT--CNYRGTYDQNKCLANCGKPSQQQNHVPRSWL-KQGENVLVL  716

Query  1382  FEETGGNTSRVRFQTVRTGGVCA--------------SAYENKVAE----ISCQG-GRNI  1504
              EE GG+ + + F T     VC+              S Y  +V +    + C    + I
Sbjct  717   LEEVGGDPTMISFVTREVATVCSKVSESYPPPMDLWSSNYLTRVIKPTLLLECPSPSQVI  776

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             +  ++ +FG+  G CGG         +K A  ++  AC+GK  CS+  +    G  N   
Sbjct  777   SQFQFVSFGNPHGGCGGFTHGRCR--SKRARRVVHKACMGKPKCSIEVTVENLG--NPCA  832

Query  1685  SRTKKLVVEAVC  1720
             + TK L VEA C
Sbjct  833   NITKSLAVEASC  844



>ref|XP_010414520.1| PREDICTED: beta-galactosidase 8 [Camelina sativa]
Length=790

 Score =   431 bits (1107),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 236/609 (39%), Positives = 348/609 (57%), Gaps = 50/609 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  195   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  254

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHL++LH  +   E +++  + T T L ++++  VY  +G+
Sbjct  255   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDSLIATDPTITSLGSNLEAAVYKTSGS  314

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------V  523
                F +N    +DAT+ + G  Y +PAWSVSILPDCK   +NTA++N+ T         +
Sbjct  315   CAAFLANVGTKSDATVTFNGQSYHLPAWSVSILPDCKNVAFNTAKINSATVSTAFALQSL  374

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             K  G ++A L  +WS+   + +   +     F    +L+Q     D SDY+WY   +++ 
Sbjct  375   KPDGGSSAELGSQWSY---IKEPIGISKTDAFLKPGLLEQINTTADKSDYLWYSLRMDIK  431

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLLS  865
              D+    +  +  L +   GQV++ + NGK   S      +  +  I L  GKN + LLS
Sbjct  432   GDETFLDEGSKAVLHIESIGQVVYAFINGKLAGSGHGKQKITLDIPIDLVAGKNTIDLLS  491

Query  866   ASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
              ++G  NYG +FDL G G+ G  +  K+       +L S +W+Y+VGL+GE+  L     
Sbjct  492   VTVGLANYGAFFDLVGAGITG-PVTLKSAKSGSSIDLASQQWTYQVGLKGEDTGL-----  545

Query  1046  KSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              +  + +W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRYW 
Sbjct  546   TTGDSPEWVSKTPLPTKQPLVWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRYWP  605

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                 G++  T++CDYRG Y  NKCL NCG P+Q  YHVPRS+L   G N LVL EE GG+
Sbjct  606   TSIAGNNGCTDSCDYRGSYRANKCLKNCGKPSQTLYHVPRSWLKPSG-NTLVLLEEMGGD  664

Query  1403  TSRVRFQTVRTG-GVCASAYEN---------------------KVAEISCQ-GGRNITAI  1513
              +++ F   +TG  +C    ++                      V  + C    + I++I
Sbjct  665   PTQISFTKKQTGSSLCLMVSQSHPAPVDTWTSDSKISKKKRTRPVLSLQCPVSTQVISSI  724

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A+FG  +     G        +  ++++++ AC+G  SC++  S  VFG   C G   
Sbjct  725   KFASFGTPK--GTCGSFTRGHCNSSRSLSVVQKACIGLRSCNLEVSTRVFGEP-CRGV-V  780

Query  1694  KKLVVEAVC  1720
               L VEA C
Sbjct  781   MSLAVEASC  789



>gb|AAQ21371.2| beta-galactosidase [Sandersonia aurantiaca]
Length=818

 Score =   431 bits (1109),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 250/616 (41%), Positives = 342/616 (56%), Gaps = 58/616 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P R  EDLA++VARFFQ GGTFQNYYMY  G NFG T+GGP+I T
Sbjct  217   TENWSGWFLSFGGPVPQRPVEDLAFAVARFFQRGGTFQNYYMYTWGNNFGHTSGGPFIAT  276

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG   QPK+GHLKELH  +   E  +V  +  T +L  +++  VY   +G
Sbjct  277   SYDYDAPIDEYGITRQPKWGHLKELHKAIKLCEPALVATDHHTLRLGPNLEAHVYKTASG  336

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQT---------  511
                 F +N    +DAT+ + G  Y +PAWSVSILPDC+  V+NTA++N+Q          
Sbjct  337   VCAAFLANIGTQSDATVTFNGKSYSLPAWSVSILPDCRTVVFNTAQINSQAIHSEMKYLN  396

Query  512   ----TVMVKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYM  676
                 T   + G        WS+   V +   +          +L+Q     DVSDY+WY 
Sbjct  397   SESLTSDQQIGSSEVFQSDWSF---VIEPVGISKSNAIRKTGLLEQINTTADVSDYLWYS  453

Query  677   TSVNLDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNH  838
              S+ +D D+P  S   +  L     G VLH + NGK   S   N+     +FE  I L  
Sbjct  454   ISIAIDGDEPFLSNGTQSNLHAESLGHVLHAFVNGKLAGSGIGNSGNAKIIFEKLIMLTP  513

Query  839   GKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRG  1015
             G N + LLSA++G QNYG +FDL G G+ G V++ G+NG      +L S+ W+Y++GL+G
Sbjct  514   GNNSIDLLSATVGLQNYGAFFDLMGAGITGPVKLKGQNG----TLDLSSNAWTYQIGLKG  569

Query  1016  EENKLFRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWV  1192
             E+  L  +S      SQW+S+  LP  + + WYKT+F AP G DPV +D  GMGKG AWV
Sbjct  570   EDLSLHENSGD---VSQWISESTLPKNQPLIWYKTTFNAPDGNDPVAIDFTGMGKGEAWV  626

Query  1193  NGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNE  1372
             NG ++GRYW   +   +  + AC+YRG Y+ +KC+ NCG P+Q  YHVPRSF+     N 
Sbjct  627   NGQSIGRYWPTYSSPQNGCSTACNYRGPYSASKCIKNCGKPSQILYHVPRSFIQSE-SNT  685

Query  1373  LVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISC-----QGGRN------------  1501
             LVLFEE GG+ +++   T +   +CA   E+  A +       Q G+             
Sbjct  686   LVLFEEMGGDPTQISLATKQMTSLCAHVSESHPAPVDTWLSLQQKGKKSGPTIQLECPYP  745

Query  1502  ---ITAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTT  1672
                I++IK+A+FG   G CG          +  AV  ++ AC+G   CSV  S    G  
Sbjct  746   NQVISSIKFASFGTPSGMCGSFNHSQCSSASVLAV--VQKACVGSKRCSVGISSKTLGDP  803

Query  1673  NCAGSRTKKLVVEAVC  1720
              C G   K L VEA C
Sbjct  804   -CRG-VIKSLAVEAAC  817



>gb|EMT04926.1| Beta-galactosidase 1 [Aegilops tauschii]
Length=812

 Score =   431 bits (1108),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 252/593 (42%), Positives = 342/593 (58%), Gaps = 53/593 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWFK W   D +R+AED+A+SVA FFQ  G+ QNYYMYHGGTNFGRT+GGPYITT
Sbjct  253   TENWTGWFKAWDKPDFHRSAEDIAFSVAMFFQKRGSLQNYYMYHGGTNFGRTSGGPYITT  312

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNS-IQVTVYAFNG  358
             +YDY+APLDEYGN+ QPKYGHLK+LHNVL S+EK +++G+   T + ++ + +T Y  + 
Sbjct  313   SYDYDAPLDEYGNIRQPKYGHLKDLHNVLKSMEKILLHGDYKDTNMSSTNVTMTKYTLDN  372

Query  359   TKTCFFSNSNETADATINYQ-GTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVK--E  529
             +  CF SN  +  +  +    G  + VPAWSVSILPDCK   YN+A++ TQT+VMVK  E
Sbjct  373   SSACFISNKFDDKEVNVTLDTGATHVVPAWSVSILPDCKTVAYNSAKIKTQTSVMVKRPE  432

Query  530   GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDP  706
                   +L WSW P      +   KG F  N++L+Q   + D SDY+WY TS    ++  
Sbjct  433   VETVRESLAWSWMPVNLQPFMTDEKGNFRKNELLEQIATSGDQSDYLWYRTSFEHKEE--  490

Query  707   IWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKNLLTLLSASI  874
                   +L VN TG  L+ + NGK V  Q + N  F    ET +KL+ GKN ++LLSA+I
Sbjct  491   ---ATYKLHVNTTGHELYAFVNGKLVGKQHSPNGGFVFQMETPVKLHSGKNYISLLSATI  547

Query  875   GFQNYGPYFDLGGNGLYG--VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNK  1048
             G +NYG  F++   G+ G  V++V    + T   +L +  WSYK GL GE+ +     +K
Sbjct  548   GLKNYGALFEMMPAGIVGGPVKLVDTVTNTTAY-DLSNSSWSYKAGLAGEDRETHL--DK  604

Query  1049  SRSASQW---LSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYW  1219
             +   SQW   L+  +P                  +PVV DL+G  +G  WVNGNNLGRYW
Sbjct  605   ADDRSQWSGGLNGTIP------------------EPVVADLLGARQGVVWVNGNNLGRYW  646

Query  1220  LILAKGDDCPTEACDYRGEYNNN----KCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
                   D    + CDYRG +       KCL+ C  P+QRFYHVPRSFL     N +VLFE
Sbjct  647   PSYVAADMGGCKQCDYRGTFKAEGDGLKCLTGCNEPSQRFYHVPRSFLKAGEPNTMVLFE  706

Query  1388  ETGGNTSRVRFQT--VRTGGVCASAYENKVAEISCQGGRNITAIKYANFGDTRgscgggf  1561
             E GG+ +RV   T  V      A+   ++VA ++C  GR I+++  A  G  R   G   
Sbjct  707   EAGGDPTRVNLHTVAVGAACAEAAEVGDQVA-LACSHGRTISSVDVARTGRAR---GKCG  762

Query  1562  ekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVVEAVC  1720
                    +K A++    AC+GK SC+V  +E     + C    +  L V+A C
Sbjct  763   AAEAGCESKAALSAFTAACVGKESCTVRHTEDFRAGSGC---DSGVLTVQATC  812



>ref|XP_003523206.1| PREDICTED: beta-galactosidase 10 [Glycine max]
Length=843

 Score =   432 bits (1110),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 248/611 (41%), Positives = 355/611 (58%), Gaps = 52/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK +GG+DP+R AED+A+SVARFFQ GG+  NYYMYHGGTNFGRTAGGP+ITT
Sbjct  246   TENWPGWFKTFGGRDPHRPAEDVAFSVARFFQKGGSVHNYYMYHGGTNFGRTAGGPFITT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA-FNG  358
             +YDY+AP+DEYG    PK+GHLKELH  +   E  ++ G      L  S++  VY   +G
Sbjct  306   SYDYDAPVDEYGLPRLPKWGHLKELHRAIKLCEHVLLNGKSVNISLGPSVEADVYTDSSG  365

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------  520
                 F SN ++  D T+ ++   Y +PAWSVSILPDCK  V+NTA+V +QT V+      
Sbjct  366   ACAAFISNVDDKNDKTVEFRNASYHLPAWSVSILPDCKNVVFNTAKVTSQTNVVAMIPES  425

Query  521   VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDK  697
             +++  K   +L+W     V +   + GK  F  +  +D      D +DY+W+ TS+ + +
Sbjct  426   LQQSDKGVNSLKWD---IVKEKPGIWGKADFVKSGFVDLINTTKDTTDYLWHTTSIFVSE  482

Query  698   DDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTL  859
             ++    K  +  L +  TG  LH + N +Y  +   N +     F+  I L  GKN + L
Sbjct  483   NEEFLKKGSKPVLLIESTGHALHAFVNQEYQGTGTGNGTHSPFSFKNPISLRAGKNEIAL  542

Query  860   LSASIGFQNYGPYFDLGGNGLYGVEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKLFR  1036
             L  ++G Q  GP++D  G GL  V+I G KNG      +L S+ W+YK+G++GE  +L++
Sbjct  543   LCLTVGLQTAGPFYDFIGAGLTSVKIKGLKNG----TIDLSSYAWTYKIGVQGEYLRLYQ  598

Query  1037  SSNKSRSASQWLSDHLPTARR-MTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
              +  ++    W S   P   + +TWYK    AP G +PV +D++ MGKG AW+NG  +GR
Sbjct  599   GNGLNK--VNWTSTSEPQKMQPLTWYKAIVDAPPGDEPVGLDMLHMGKGLAWLNGEEIGR  656

Query  1214  YWLILA--KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             YW   +  K +DC  E CDYRG++N +KC + CG PTQR+YHVPRS+    G N LVLFE
Sbjct  657   YWPRKSEFKSEDCVKE-CDYRGKFNPDKCDTGCGEPTQRWYHVPRSWFKPSG-NILVLFE  714

Query  1388  ETGGNTSRVRFQTVRTGGVCA------------SAYENKV--------AEISCQGGRNIT  1507
             E GG+  +++F   +  G CA            S  E+K+        A ++C     I+
Sbjct  715   EKGGDPEKIKFVRRKVSGACALVAEDYPSVGLLSQGEDKIQNNKNVPFAHLTCPSNTRIS  774

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             A+K+A+FG   GSCG   +        ++  I++ ACL K  C +  +E  F T  C G 
Sbjct  775   AVKFASFGTPSGSCGSYLKGDCHD--PNSSTIVEKACLNKNDCVIKLTEENFKTNLCPG-  831

Query  1688  RTKKLVVEAVC  1720
              ++KL VEAVC
Sbjct  832   LSRKLAVEAVC  842



>ref|XP_004487127.1| PREDICTED: beta-galactosidase 8-like [Cicer arietinum]
Length=836

 Score =   431 bits (1109),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 253/609 (42%), Positives = 350/609 (57%), Gaps = 55/609 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNF RT+GGP+I T
Sbjct  246   TENWSGWFLSFGGAVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPFIAT  305

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHLK++H  +   E+ ++  +   T L  +++  VY     
Sbjct  306   SYDYDAPIDEYGIIRQPKWGHLKDVHKAIKLCEEALIATDPKITSLGQNLEAAVYRTESV  365

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F +N +  +D T+N+ G  Y +PAWSVSILPDCK  V NTA++N+ T +        
Sbjct  366   CAAFLANVDTKSDVTVNFSGNSYHLPAWSVSILPDCKNVVLNTAKINSATVISSFTTESS  425

Query  524   KE--GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             KE  G   A++ +WSW  E    + +    +     +L+Q     D SDY+WY  S++L 
Sbjct  426   KEDIGSLDASSSKWSWISEPVGISKVESSSKI---GLLEQINTTADRSDYLWYSLSIDL-  481

Query  695   KDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNSLFETN----IKLNHGKNLLTLL  862
             KDDP       L +   G  LH + NGK   SQ  N+   + N    I L  GKN + LL
Sbjct  482   KDDP--GSQTVLHIESLGHALHAFINGKLAGSQAGNSGKAKLNVDIPITLVSGKNSIDLL  539

Query  863   SASIGFQNYGPYFDLGGNGLYGVEIVG--KNGDETVRKNLGSHKWSYKVGLRGEENKLFR  1036
             S ++G QNYG +FD  G G+ G  I+   KNG+     +L S KW+Y+VGL+GEE  L  
Sbjct  540   SLTVGLQNYGAFFDTVGAGITGPVILKGLKNGNTL---DLSSQKWTYQVGLKGEELGL--  594

Query  1037  SSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                   S+ +W S    P  + +TWYKT+F AP+G +PV +D  GMGKG AWVNG ++GR
Sbjct  595   ---SIGSSGEWNSQSTFPKNQPLTWYKTNFDAPSGSNPVAIDFTGMGKGEAWVNGQSIGR  651

Query  1214  YWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEET  1393
             YW      +   T++C+YRG Y ++KC  NCG P+Q  YHVPR +L +  DN LVLFEE+
Sbjct  652   YWPTYVSSNAGCTDSCNYRGPYTSSKCRKNCGKPSQTLYHVPRFWL-KPNDNILVLFEES  710

Query  1394  GGNTSRVRFQTVRTGGVCASAYENKVAEISC-----QGGRN---------------ITAI  1513
             GG+ +++ F T   G +CA   E+    I       + GR                I++I
Sbjct  711   GGDPAQISFATKELGSLCAHVSESHPPPIDLWNSDTESGRKIGPALLLKCPIHNQVISSI  770

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A++G        G        +  A++I++ AC+G +SCSV  S   FG   C G  +
Sbjct  771   KFASYGTP--LGTCGNFYHGRCSSNKALSIVQKACIGSSSCSVGVSTDTFGNP-CKGV-S  826

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  827   KSLAVEATC  835



>ref|NP_001189624.1| beta-galactosidase 8 [Arabidopsis thaliana]
 gb|AEC08128.1| beta-galactosidase 8 [Arabidopsis thaliana]
Length=846

 Score =   432 bits (1110),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 241/611 (39%), Positives = 350/611 (57%), Gaps = 53/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  250   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  ++  + T T L ++++  VY   +G
Sbjct  310   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALIATDPTITSLGSNLEAAVYKTESG  369

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVN--TQTTVMVKE-  529
             +   F +N +  +DAT+ + G  Y +PAWSVSILPDCK   +NTA++N  T++T   ++ 
Sbjct  370   SCAAFLANVDTKSDATVTFNGKSYNLPAWSVSILPDCKNVAFNTAKINSATESTAFARQS  429

Query  530   -----GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
                  G  A    +WS+   + +   +     F    +L+Q     D SDY+WY    ++
Sbjct  430   LKPDGGSSAELGSQWSY---IKEPIGISKADAFLKPGLLEQINTTADKSDYLWYSLRTDI  486

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLL  862
               D+    +  +  L +   GQV++ + NGK   S      +  +  I L  G N + LL
Sbjct  487   KGDETFLDEGSKAVLHIESLGQVVYAFINGKLAGSGHGKQKISLDIPINLVTGTNTIDLL  546

Query  863   SASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             S ++G  NYG +FDL G G+ G V +    G  ++  +L S +W+Y+VGL+GE+  L   
Sbjct  547   SVTVGLANYGAFFDLVGAGITGPVTLKSAKGGSSI--DLASQQWTYQVGLKGEDTGL---  601

Query  1040  SNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                +  +S+W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRY
Sbjct  602   --ATVDSSEWVSKSPLPTKQPLIWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRY  659

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W     G+   TE+CDYRG Y  NKCL NCG P+Q  YHVPRS+L   G N LVLFEE G
Sbjct  660   WPTSIAGNGGCTESCDYRGSYRANKCLKNCGKPSQTLYHVPRSWLKPSG-NILVLFEEMG  718

Query  1397  GNTSRVRFQTVRTGG-VCASAYEN---------------------KVAEISCQ-GGRNIT  1507
             G+ +++ F T +TG  +C +  ++                      V  + C    + I 
Sbjct  719   GDPTQISFATKQTGSNLCLTVSQSHPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIF  778

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A+FG  +     G        +  ++++++ AC+G  SC+V  S  VFG   C G 
Sbjct  779   SIKFASFGTPK--GTCGSFTQGHCNSSRSLSLVQKACIGLRSCNVEVSTRVFGEP-CRGV  835

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  836   -VKSLAVEASC  845



>emb|CDP07127.1| unnamed protein product [Coffea canephora]
Length=843

 Score =   432 bits (1110),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 242/606 (40%), Positives = 344/606 (57%), Gaps = 48/606 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENWTGWF  +GG  P R  ED+A++VARFFQLGGTFQNYYMYHGGTNFGRT GGP+I T
Sbjct  252   TENWTGWFLSFGGAVPTRPVEDVAFAVARFFQLGGTFQNYYMYHGGTNFGRTTGGPFIAT  311

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG + QPK+GHLK+LH  +   E+ ++  + T T L  +++  VY   +G
Sbjct  312   SYDYDAPIDEYGLIRQPKWGHLKDLHKAIKLCEEAMIATDPTITSLGPNLEAGVYRTGSG  371

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKEG  532
               + F +N    +DAT+N+ G  YK+PAWSVSILPDCK  V+NTA++N+   +   + + 
Sbjct  372   LCSAFLANVGTQSDATVNFNGNSYKLPAWSVSILPDCKNVVFNTAKINSMRMLSRFISQS  431

Query  533   GKAAAALR-WSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDP  706
              +  A+   WSW   V +   +  +  F    + +Q     D SDY+WY  S+ +  ++P
Sbjct  432   SEDVASFSGWSW---VNEPVGISSQNAFMKLGLAEQINTTGDKSDYLWYSASIEIKGNEP  488

Query  707   IWS--KDMRLGVNGTGQVLHVYANGKYV----DSQWNNNSLFETNIKLNHGKNLLTLLSA  868
                      L V   G  L+ + N K       S  N     E  I L  GKN + LLS 
Sbjct  489   FLQDGSQTALHVQSLGHALYAFINKKLAGSVKGSSGNAKVALEVPISLVTGKNTIDLLSL  548

Query  869   SIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
             ++G QNYG +FDL G G+ G V++ G     T+  +L S +W+Y++GL+GEE  L     
Sbjct  549   TVGLQNYGAFFDLKGAGVTGPVQLKGLTNGSTI--DLSSQQWTYQIGLKGEEIGL-----  601

Query  1046  KSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              +  +S W+S   LP  + + WYKT+F A  G +P+ +DL  +GKG AWVNG ++GRYW 
Sbjct  602   SNGGSSLWISQPALPKNQPLIWYKTNFDAAGGNEPLALDLSSLGKGEAWVNGQSIGRYWP  661

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                  +     +C+YRG +N NKCL +CG P+Q  YHVPR +L   G N LVLFEE GG+
Sbjct  662   TNNAPNGGCVSSCNYRGSFNANKCLKDCGKPSQLLYHVPRDWLKPSG-NILVLFEEMGGD  720

Query  1403  TSRVRFQTVRTGGVCASAYENKVAEI-------------------SCQGGRN-ITAIKYA  1522
              +++ F T + G +C+   E+    I                    C      I++IK+A
Sbjct  721   PTQISFATRQIGSLCSRVSESHPVPIDIWTSDQEAAKKAGPTMLLECPSANQVISSIKFA  780

Query  1523  NFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKL  1702
             +FG        G        +K+A++I++ AC+G   C++  S + FG   C G  TK L
Sbjct  781   SFGTP--GGACGSFSHGKCSSKNAISIIQKACVGSRKCNIGVSIATFGDP-CVG-ITKTL  836

Query  1703  VVEAVC  1720
              VEA C
Sbjct  837   AVEASC  842



>gb|KHN31190.1| Beta-galactosidase 10 [Glycine soja]
Length=862

 Score =   432 bits (1111),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 248/611 (41%), Positives = 355/611 (58%), Gaps = 52/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK +GG+DP+R AED+A+SVARFFQ GG+  NYYMYHGGTNFGRTAGGP+ITT
Sbjct  265   TENWPGWFKTFGGRDPHRPAEDVAFSVARFFQKGGSVHNYYMYHGGTNFGRTAGGPFITT  324

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA-FNG  358
             +YDY+AP+DEYG    PK+GHLKELH  +   E  ++ G      L  S++  VY   +G
Sbjct  325   SYDYDAPVDEYGLPRLPKWGHLKELHRAIKLCEHVLLNGKSVNISLGPSVEADVYTDSSG  384

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------  520
                 F SN ++  D T+ ++   Y +PAWSVSILPDCK  V+NTA+V +QT V+      
Sbjct  385   ACAAFISNVDDKNDKTVEFRNASYHLPAWSVSILPDCKNVVFNTAKVTSQTNVVAMIPES  444

Query  521   VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDK  697
             +++  K   +L+W     V +   + GK  F  +  +D      D +DY+W+ TS+ + +
Sbjct  445   LQQSDKGVNSLKWD---IVKEKPGIWGKADFVKSGFVDLINTTKDTTDYLWHTTSIFVSE  501

Query  698   DDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKNLLTL  859
             ++    K  +  L +  TG  LH + N +Y  +   N +     F+  I L  GKN + L
Sbjct  502   NEEFLKKGSKPVLLIESTGHALHAFVNQEYQGTGTGNGTHSPFSFKNPISLRAGKNEIAL  561

Query  860   LSASIGFQNYGPYFDLGGNGLYGVEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKLFR  1036
             L  ++G Q  GP++D  G GL  V+I G KNG      +L S+ W+YK+G++GE  +L++
Sbjct  562   LCLTVGLQTAGPFYDFIGAGLTSVKIKGLKNG----TIDLSSYAWTYKIGVQGEYLRLYQ  617

Query  1037  SSNKSRSASQWLSDHLPTARR-MTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
              +  ++    W S   P   + +TWYK    AP G +PV +D++ MGKG AW+NG  +GR
Sbjct  618   GNGLNK--VNWTSTSEPQKMQPLTWYKAIVDAPPGDEPVGLDMLHMGKGLAWLNGEEIGR  675

Query  1214  YWLILA--KGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             YW   +  K +DC  E CDYRG++N +KC + CG PTQR+YHVPRS+    G N LVLFE
Sbjct  676   YWPRKSEFKSEDCVKE-CDYRGKFNPDKCDTGCGEPTQRWYHVPRSWFKPSG-NILVLFE  733

Query  1388  ETGGNTSRVRFQTVRTGGVCA------------SAYENKV--------AEISCQGGRNIT  1507
             E GG+  +++F   +  G CA            S  E+K+        A ++C     I+
Sbjct  734   EKGGDPEKIKFVRRKVSGACALVAEDYPSVGLLSQGEDKIQNNKNVPFAHLTCPSNTRIS  793

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             A+K+A+FG   GSCG   +        ++  I++ ACL K  C +  +E  F T  C G 
Sbjct  794   AVKFASFGTPSGSCGSYLKGDCHD--PNSSTIVEKACLNKNDCVIKLTEENFKTNLCPG-  850

Query  1688  RTKKLVVEAVC  1720
              ++KL VEAVC
Sbjct  851   LSRKLAVEAVC  861



>ref|XP_002879094.1| beta-glactosidase 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55353.1| beta-glactosidase 8 [Arabidopsis lyrata subsp. lyrata]
Length=846

 Score =   431 bits (1109),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 240/609 (39%), Positives = 350/609 (57%), Gaps = 49/609 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  250   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  ++  + T + L ++++  VY   +G
Sbjct  310   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALIATDPTISSLGSNLEAAVYKTASG  369

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------  520
             +   F +N    +DAT+++ G  Y +PAWSVSILPDCK   +NTA++N+ T         
Sbjct  370   SCAAFLANVGTKSDATVSFNGESYHLPAWSVSILPDCKNVAFNTAKINSATEPTAFARQS  429

Query  521   VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDK  697
             +K  G ++A L   W   + +   +     F    +L+Q     D SDY+WY   +++  
Sbjct  430   LKPDGGSSAELGSEWS-YIKEPIGISKADAFLKPGLLEQINTTADKSDYLWYSLRMDIKG  488

Query  698   DDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLLSA  868
             D+    +  +  L +   GQV++ + NGK   S      +  +  I L  GKN + LLS 
Sbjct  489   DETFLDEGSKAVLHIESLGQVVYAFINGKLAGSGHGKQKISLDIPINLAAGKNTVDLLSV  548

Query  869   SIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
             ++G  NYG +FDL G G+ G V +    G  ++  +L S +W+Y+VGL+GE+  L     
Sbjct  549   TVGLANYGAFFDLVGAGITGPVTLKSAKGGSSI--DLASQQWTYQVGLKGEDTGL-----  601

Query  1046  KSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              +  +S+W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRYW 
Sbjct  602   ATVDSSEWVSKSPLPTKQPLIWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRYWP  661

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                 G+   T++CDYRG Y  NKCL NCG P+Q  YHVPRS+L   G N LVLFEE GG+
Sbjct  662   TSIAGNGGCTDSCDYRGSYRANKCLKNCGKPSQTLYHVPRSWLKPSG-NTLVLFEEMGGD  720

Query  1403  TSRVRFQTVRTGG-VCASAYEN---------------------KVAEISCQ-GGRNITAI  1513
              +++ F T +TG  +C    ++                      V  + C    + I++I
Sbjct  721   PTQISFGTKQTGSNLCLMVSQSHPPPVDTWTSDSKISNRNRTRPVLSLKCPVSTQVISSI  780

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A+FG  +     G        +  ++++++ AC+G  SC+V  S  VFG   C G   
Sbjct  781   KFASFGTPQ--GTCGSFTHGHCNSSRSLSVVQKACIGSRSCNVEVSTRVFGEP-CRGV-I  836

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  837   KSLAVEASC  845



>gb|AAD21482.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=839

 Score =   431 bits (1109),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 240/604 (40%), Positives = 347/604 (57%), Gaps = 46/604 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  250   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  309

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  ++  + T T L ++++  VY   +G
Sbjct  310   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALIATDPTITSLGSNLEAAVYKTESG  369

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVMVKEGGK  538
             +   F +N +  +DAT+ + G  Y +PAWSVSILPDCK   +NTA+V   +     +GG 
Sbjct  370   SCAAFLANVDTKSDATVTFNGKSYNLPAWSVSILPDCKNVAFNTAKVKFNSISKTPDGGS  429

Query  539   AAA-ALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDKDDPIW  712
             +A    +WS+   + +   +     F    +L+Q     D SDY+WY    ++  D+   
Sbjct  430   SAELGSQWSY---IKEPIGISKADAFLKPGLLEQINTTADKSDYLWYSLRTDIKGDETFL  486

Query  713   SKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLLSASIGFQ  883
              +  +  L +   GQV++ + NGK   S      +  +  I L  G N + LLS ++G  
Sbjct  487   DEGSKAVLHIESLGQVVYAFINGKLAGSGHGKQKISLDIPINLVTGTNTIDLLSVTVGLA  546

Query  884   NYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSNKSRSA  1060
             NYG +FDL G G+ G V +    G  ++  +L S +W+Y+VGL+GE+  L      +  +
Sbjct  547   NYGAFFDLVGAGITGPVTLKSAKGGSSI--DLASQQWTYQVGLKGEDTGL-----ATVDS  599

Query  1061  SQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWLILAKG  1237
             S+W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRYW     G
Sbjct  600   SEWVSKSPLPTKQPLIWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRYWPTSIAG  659

Query  1238  DDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGNTSRVR  1417
             +   TE+CDYRG Y  NKCL NCG P+Q  YHVPRS+L   G N LVLFEE GG+ +++ 
Sbjct  660   NGGCTESCDYRGSYRANKCLKNCGKPSQTLYHVPRSWLKPSG-NILVLFEEMGGDPTQIS  718

Query  1418  FQTVRTGG-VCASAYEN---------------------KVAEISCQ-GGRNITAIKYANF  1528
             F T +TG  +C +  ++                      V  + C    + I +IK+A+F
Sbjct  719   FATKQTGSNLCLTVSQSHPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIFSIKFASF  778

Query  1529  GDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKLVV  1708
             G  +     G        +  ++++++ AC+G  SC+V  S  VFG   C G   K L V
Sbjct  779   GTPK--GTCGSFTQGHCNSSRSLSLVQKACIGLRSCNVEVSTRVFGEP-CRGV-VKSLAV  834

Query  1709  EAVC  1720
             EA C
Sbjct  835   EASC  838



>emb|CAB64744.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=852

 Score =   431 bits (1109),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 241/611 (39%), Positives = 350/611 (57%), Gaps = 53/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  256   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  315

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  ++  + T T L ++++  VY   +G
Sbjct  316   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALIATDPTITSLGSNLEAAVYKTESG  375

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVN--TQTTVMVKE-  529
             +   F +N +  +DAT+ + G  Y +PAWSVSILPDCK   +NTA++N  T++T   ++ 
Sbjct  376   SCAAFLANVDTKSDATVTFNGKSYNLPAWSVSILPDCKNVAFNTAKINSATESTAFARQS  435

Query  530   -----GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
                  G  A    +WS+   + +   +     F    +L+Q     D SDY+WY    ++
Sbjct  436   LKPDGGSSAELGSQWSY---IKEPIGISKADAFLKPGLLEQINTTADKSDYLWYSLRTDI  492

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLL  862
               D+    +  +  L +   GQV++ + NGK   S      +  +  I L  G N + LL
Sbjct  493   KGDETFLDEGSKAVLHIESLGQVVYAFINGKLAGSGHGKQKISLDIPINLVTGTNTIDLL  552

Query  863   SASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             S ++G  NYG +FDL G G+ G V +    G  ++  +L S +W+Y+VGL+GE+  L   
Sbjct  553   SVTVGLANYGAFFDLMGAGITGPVTLKSAKGGSSI--DLASQQWTYQVGLKGEDTGL---  607

Query  1040  SNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                +  +S+W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRY
Sbjct  608   --ATVDSSEWVSKSPLPTKQPLIWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRY  665

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W     G+   TE+CDYRG Y  NKCL NCG P+Q  YHVPRS+L   G N LVLFEE G
Sbjct  666   WPTSIAGNGGCTESCDYRGSYRANKCLKNCGKPSQTLYHVPRSWLKPSG-NILVLFEEMG  724

Query  1397  GNTSRVRFQTVRTGG-VCASAYEN---------------------KVAEISCQ-GGRNIT  1507
             G+ +++ F T +TG  +C +  ++                      V  + C    + I 
Sbjct  725   GDPTQISFATKQTGSNLCLTVSQSHPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIF  784

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A+FG  +     G        +  ++++++ AC+G  SC+V  S  VFG   C G 
Sbjct  785   SIKFASFGTPK--GTCGSFTQGHCNSSRSLSLVQKACIGLRSCNVEVSTRVFGEP-CRGV  841

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  842   -VKSLAVEASC  851



>ref|NP_850121.1| beta-galactosidase 8 [Arabidopsis thaliana]
 sp|Q9SCV4.2|BGAL8_ARATH RecName: Full=Beta-galactosidase 8; Short=Lactase 8; AltName: 
Full=Protein AR782; Flags: Precursor [Arabidopsis thaliana]
 gb|AEC08127.1| beta-galactosidase 8 [Arabidopsis thaliana]
Length=852

 Score =   431 bits (1109),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 241/611 (39%), Positives = 350/611 (57%), Gaps = 53/611 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  256   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  315

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAF-NG  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  ++  + T T L ++++  VY   +G
Sbjct  316   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALIATDPTITSLGSNLEAAVYKTESG  375

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVN--TQTTVMVKE-  529
             +   F +N +  +DAT+ + G  Y +PAWSVSILPDCK   +NTA++N  T++T   ++ 
Sbjct  376   SCAAFLANVDTKSDATVTFNGKSYNLPAWSVSILPDCKNVAFNTAKINSATESTAFARQS  435

Query  530   -----GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNL  691
                  G  A    +WS+   + +   +     F    +L+Q     D SDY+WY    ++
Sbjct  436   LKPDGGSSAELGSQWSY---IKEPIGISKADAFLKPGLLEQINTTADKSDYLWYSLRTDI  492

Query  692   DKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLL  862
               D+    +  +  L +   GQV++ + NGK   S      +  +  I L  G N + LL
Sbjct  493   KGDETFLDEGSKAVLHIESLGQVVYAFINGKLAGSGHGKQKISLDIPINLVTGTNTIDLL  552

Query  863   SASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRS  1039
             S ++G  NYG +FDL G G+ G V +    G  ++  +L S +W+Y+VGL+GE+  L   
Sbjct  553   SVTVGLANYGAFFDLVGAGITGPVTLKSAKGGSSI--DLASQQWTYQVGLKGEDTGL---  607

Query  1040  SNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRY  1216
                +  +S+W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRY
Sbjct  608   --ATVDSSEWVSKSPLPTKQPLIWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRY  665

Query  1217  WLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETG  1396
             W     G+   TE+CDYRG Y  NKCL NCG P+Q  YHVPRS+L   G N LVLFEE G
Sbjct  666   WPTSIAGNGGCTESCDYRGSYRANKCLKNCGKPSQTLYHVPRSWLKPSG-NILVLFEEMG  724

Query  1397  GNTSRVRFQTVRTGG-VCASAYEN---------------------KVAEISCQ-GGRNIT  1507
             G+ +++ F T +TG  +C +  ++                      V  + C    + I 
Sbjct  725   GDPTQISFATKQTGSNLCLTVSQSHPPPVDTWTSDSKISNRNRTRPVLSLKCPISTQVIF  784

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             +IK+A+FG  +     G        +  ++++++ AC+G  SC+V  S  VFG   C G 
Sbjct  785   SIKFASFGTPK--GTCGSFTQGHCNSSRSLSLVQKACIGLRSCNVEVSTRVFGEP-CRGV  841

Query  1688  RTKKLVVEAVC  1720
               K L VEA C
Sbjct  842   -VKSLAVEASC  851



>ref|XP_010032010.1| PREDICTED: beta-galactosidase 8 [Eucalyptus grandis]
 gb|KCW51399.1| hypothetical protein EUGRSUZ_J00936 [Eucalyptus grandis]
Length=852

 Score =   431 bits (1109),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 242/612 (40%), Positives = 349/612 (57%), Gaps = 54/612 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  PYR AEDLA++VARFFQ GGT QNYYMYHGGTNFGRT+GGP+I T
Sbjct  255   TENWSGWFLSFGGAVPYRPAEDLAFAVARFFQRGGTLQNYYMYHGGTNFGRTSGGPFIAT  314

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG + QPK+GHL+++H  +   E  ++  +   T L ++++ TVY  +  
Sbjct  315   SYDYDAPIDEYGLVRQPKWGHLRDVHKAIKLCEDALIATDPAYTSLGSNLEATVYKTDAG  374

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKEG-  532
                 F  +  T+DAT  + G  Y++P WSVSILPDCK    NTA++N+ + +   V E  
Sbjct  375   LCAAFLANWGTSDATATFNGKSYQLPGWSVSILPDCKNVALNTAKINSMSMIPTFVYESL  434

Query  533   -----GKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
                    A     WSW   + +   +     F    +L+Q     D SDY+WY  S N+ 
Sbjct  435   SEVVDSSATVNADWSW---INEPVGISKNDSFVKPGLLEQINTTADSSDYLWYSLSTNIP  491

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNN--NSLFETNIK--LNHGKNLLT  856
              D+P      +  L +   G  LH + N K   S+  N  NS    +I   L  GKN + 
Sbjct  492   GDNPFLDDGSQGVLHIESLGHALHAFVNKKLAGSKAGNSGNSKIAVDIPVTLLPGKNTID  551

Query  857   LLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFR  1036
             LLS ++G QNYG ++D  G G+ G   +  + + ++  +L S +W+Y++GL+GE+  L  
Sbjct  552   LLSLTVGLQNYGAFYDQTGAGITGPVKLKSSANGSII-DLSSQQWTYQIGLKGEDQGL--  608

Query  1037  SSNKSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGR  1213
                 S S+S W++   LP  + +TWYKT+F APAG DPV +D  GMGKG AWVNG ++GR
Sbjct  609   ---PSGSSSMWITQPSLPKNQPLTWYKTTFAAPAGDDPVAIDFSGMGKGEAWVNGQSIGR  665

Query  1214  YWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEE  1390
             YW   +A G  C T++C+YRG Y ++KCL +CG P+Q+ YHVPRS+L   G N LV+FEE
Sbjct  666   YWPTNVAPGSGC-TDSCNYRGTYGSSKCLKSCGKPSQKLYHVPRSWLKPSG-NILVMFEE  723

Query  1391  TGGNTSRVRFQTVRTGGVCASAYENKVAEISC----------------------QGGRNI  1504
              GG+ +++ F T +   +C+   E+  + +                        +  + I
Sbjct  724   VGGDPTQISFATRQIQSLCSHVSESHPSPVDMWNPESESKTGKTSRPTLSLECPRPNQVI  783

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A+FG  +     G        +K A+ +++ AC+G  SC V  S   FG   C G
Sbjct  784   SSIKFASFGTPQ--GTCGSFGHGKCSSKRALAVVQKACIGSKSCMVGVSIDAFGDP-CKG  840

Query  1685  SRTKKLVVEAVC  1720
               TK L VEA C
Sbjct  841   V-TKSLAVEASC  851



>ref|XP_010674348.1| PREDICTED: beta-galactosidase 10 [Beta vulgaris subsp. vulgaris]
Length=851

 Score =   431 bits (1109),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 239/611 (39%), Positives = 343/611 (56%), Gaps = 49/611 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK +G  DP+R  ED+AY+V RFF+ GG+  NYYMYHGGTNFGRTAGGP+ITT
Sbjct  251   TENWPGWFKTFGSMDPHRPVEDVAYAVTRFFENGGSVHNYYMYHGGTNFGRTAGGPFITT  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFN-G  358
             +YDY+AP+DEYG    PK+GHLKELH      E  +++G  T   L    + +VY  + G
Sbjct  311   SYDYDAPIDEYGLPRFPKWGHLKELHGAFKLCENALLFGERTNLSLGPLQEASVYTESTG  370

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKEG  532
                 F +N +   D  + ++   Y +PAWSVSILPDCK  VYNTA+V +Q +V  MV E 
Sbjct  371   VCAAFLANMDNKTDTVVKFRNMTYHLPAWSVSILPDCKNVVYNTAKVGSQASVVDMVPED  430

Query  533   GKAAA--------ALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSV  685
              + +         AL+W       +   +  K +F+    +D      D +DY+W  TS+
Sbjct  431   LRPSVVSPKKDLKALQWE---VFVEKPGIWEKPEFSKTGFVDHINTTKDTTDYLWVTTSL  487

Query  686   NLDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSLF----ETNIKLNHGKN  847
              +D D+    K +   L V   G  LHV+ N +   S   N ++F    E  I L  GKN
Sbjct  488   YVDGDEMFLKKGIPPILSVKSKGHALHVFVNQELQGSASGNGTIFPFASEIPISLKAGKN  547

Query  848   LLTLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENK  1027
              + LLS ++G Q  GP ++  G GL  VEI G N       NL    W+YK+GL GE   
Sbjct  548   EIALLSMTVGLQTAGPQYEWIGAGLTSVEIKGLNNGNV---NLSKFTWTYKIGLLGEHLN  604

Query  1028  LFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
             +++  +  +S +  L+   P  + +TWYK     P+G +PV +D++ MGKG AW+NG  +
Sbjct  605   IYK-GDGLKSKNWVLTTEPPKRKPLTWYKALVDPPSGNEPVGLDMIHMGKGLAWLNGEEI  663

Query  1208  GRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFE  1387
             GRYW   +   D   + CDYRG+++ NKC + CG PTQR+YHVPRS+    G NELV+FE
Sbjct  664   GRYWPRKSSKHDACVDHCDYRGKFSPNKCSTGCGEPTQRWYHVPRSWFKSSG-NELVIFE  722

Query  1388  ETGGNTSRVRFQTVRTGGVCASAYENK--------------------VAEISCQGGRNIT  1507
             ETGG+ +++RF   +T GVC+   E+                      A++ C     ++
Sbjct  723   ETGGDPTQIRFSKRKTSGVCSLMSEDHPSISVESWTTATKDTNDKKATAQLRCPSNTRVS  782

Query  1508  AIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGS  1687
             AIK+A+FG+  G+CG            ++ ++++  CL ++ CS+  S+  F   +C G 
Sbjct  783   AIKFASFGNPMGACGSYSHGDCHD--PESASVVEKMCLNRSECSIELSKENFNFGSCPG-  839

Query  1688  RTKKLVVEAVC  1720
             + K+L VEAVC
Sbjct  840   KIKRLAVEAVC  850



>emb|CDY04567.1| BnaA07g13930D [Brassica napus]
Length=850

 Score =   430 bits (1106),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 247/608 (41%), Positives = 355/608 (58%), Gaps = 49/608 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARFFQ GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  256   TENWSGWFLGFGEPTPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFERTSGGPLIST  315

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVY-AFNG  358
             +YDY+AP+DEYG L QPK+GHL++LH  +   E  ++  +   T L ++++  VY   +G
Sbjct  316   SYDYDAPIDEYGLLRQPKWGHLRDLHKAIKLCEDALIATDPEITSLGSNLEAAVYKTSSG  375

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------  520
             +   F +N    +DAT+ + G  Y++PAWSVSILPDCK   +NTA++N+ T         
Sbjct  376   SCAAFLANIGTQSDATVTFNGKSYRLPAWSVSILPDCKNVAFNTAKINSATESTAFARQS  435

Query  521   VKEGGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLDK  697
             +K  G ++A L   W   + +   +          +L+Q     D SDY+WY   +++  
Sbjct  436   LKPDGGSSAELGSQWS-HIKEPIGISKADALVKPGLLEQINTTADKSDYLWYSLRMDIKG  494

Query  698   DDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLLSA  868
             D+    +  +  L +   GQV++ + NGK   S  +  ++  +  I L +GKN + LLS 
Sbjct  495   DETFLDEGSKAILHIQSIGQVVYAFINGKLAGSGNDRTNISLDIPINLVNGKNTIDLLSV  554

Query  869   SIGFQNYGPYFDLGGNGLYGVEIVGKNGDET-VRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
             ++G  NYG +FD+ G G+ G   V  N  +T    +L S +W+Y+VGL+GE+  L     
Sbjct  555   TVGLANYGAFFDIIGAGITGP--VSLNSAKTGSSMDLSSQQWTYQVGLKGEDTGL-----  607

Query  1046  KSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              S  +S+W+S+  LPT + + WYKT+F AP+G DPV +D  G GKG AWVNG ++GRYW 
Sbjct  608   GSGDSSEWVSNSPLPTNQPLVWYKTTFNAPSGSDPVAIDFTGTGKGIAWVNGQSIGRYWP  667

Query  1223  I-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGG  1399
               +A+ D C   +CDYRG Y N+KCL NCG P+Q  YHVPRS++   G N LVL EE GG
Sbjct  668   TSIARADGC-VGSCDYRGTYRNDKCLKNCGKPSQTLYHVPRSWIKPSG-NTLVLLEEMGG  725

Query  1400  NTSRVRFQTVRTGG-VCASAYE-------------------NKVAEISCQ-GGRNITAIK  1516
             + +++ F T  TG  +C    E                   + V  + C    + I++I+
Sbjct  726   DPTKISFATKHTGSNLCLKVSESHPAPVDTWTSDSKFSNRTSPVLSLKCPVSTQVISSIR  785

Query  1517  YANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTK  1696
             +A+FG T     G F  G C  A+ ++++++ AC+G  SC V  S  VFG   C G   K
Sbjct  786   FASFG-TPTGTCGSFNHGRCSSAR-SLSVVQKACVGSRSCKVEVSTRVFGEP-CHGV-VK  841

Query  1697  KLVVEAVC  1720
              L VEAVC
Sbjct  842   SLAVEAVC  849



>ref|XP_010510620.1| PREDICTED: beta-galactosidase 8-like [Camelina sativa]
Length=846

 Score =   430 bits (1106),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 236/609 (39%), Positives = 349/609 (57%), Gaps = 50/609 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +G   PYR  EDLA++VARF+Q GGTFQNYYMYHGGTNF RT+GGP I+T
Sbjct  251   TENWSGWFLGFGDPSPYRPVEDLAFAVARFYQRGGTFQNYYMYHGGTNFDRTSGGPLIST  310

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L Q K+GHL++LH  +   E +++    T T L ++++  VY  +G+
Sbjct  311   SYDYDAPIDEYGLLRQSKWGHLRDLHKAIKLCEDSLIATEPTITSLGSNLEAAVYKTSGS  370

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTVM------V  523
              + F +N    +DAT+ + G  Y +PAWSVSILPDCK   +NTA++N+ T         +
Sbjct  371   CSAFLANVGTKSDATVTFNGQSYHLPAWSVSILPDCKNVAFNTAKINSATVSTAFARQSL  430

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
             K  G ++A L  +WS+   + +   +     F    +L+Q     D SDY+WY   +++ 
Sbjct  431   KPDGGSSAELCSQWSY---IKEPIGISKTDAFLKPGLLEQINTTADKSDYLWYSLRMDIK  487

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNSL-FETNIKLNHGKNLLTLLS  865
              D+    +  +  L +   GQV++ + NGK   S      +  +  + L  GKN + LLS
Sbjct  488   GDETFLDEGSKAVLHIESIGQVVYAFINGKLAGSGHGKQKITLDIPVDLVSGKNTIDLLS  547

Query  866   ASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENKLFRSSN  1045
              ++G  NYG +FDL G G+ G  +  K+       +L S +W+Y+VGL+GE+  L     
Sbjct  548   VTVGLANYGAFFDLVGAGVTG-PVTLKSAKSGSSVDLASQQWTYQVGLKGEDTGL-----  601

Query  1046  KSRSASQWLSD-HLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNLGRYWL  1222
              +  + +W+S   LPT + + WYKT+F AP+G +PV +D  G GKG AWVNG ++GRYW 
Sbjct  602   ATGDSPEWVSKTPLPTKQPLVWYKTTFDAPSGSEPVAIDFTGTGKGIAWVNGQSIGRYWP  661

Query  1223  ILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLFEETGGN  1402
                 G++  T++CDYRG Y  NKCL NCG P+Q  YHVPRS+L   G N LVL EE GG+
Sbjct  662   TSIAGNNGCTDSCDYRGSYRANKCLKNCGKPSQTLYHVPRSWLKPSG-NTLVLLEEMGGD  720

Query  1403  TSRVRFQTVRTG-GVCASAYENKVAEIS---------------------CQ-GGRNITAI  1513
              +++ F T +TG  +C    ++  A +                      C    + I++I
Sbjct  721   PTQISFTTKQTGSSLCLMVSQSHPAPVDTWTSDSKISKKKRTRPVLSLHCPVSTQVISSI  780

Query  1514  KYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRT  1693
             K+A+FG  +     G        +  ++++++ AC+G  SC++  S  VFG   C G   
Sbjct  781   KFASFGTPK--GTCGSFTHGHCNSSRSLSLVQKACIGLRSCNLEVSTRVFGEP-CRGV-V  836

Query  1694  KKLVVEAVC  1720
             K L VEA C
Sbjct  837   KSLAVEASC  845



>ref|XP_003632537.1| PREDICTED: beta-galactosidase 10 [Vitis vinifera]
 emb|CBI21600.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   430 bits (1105),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 246/612 (40%), Positives = 343/612 (56%), Gaps = 51/612 (8%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW GWFK +G  DP+R  ED+A+SVARFFQ GG+ QNYYMYHGGTNFGRT+GGP+ITT
Sbjct  247   TENWPGWFKTFGAPDPHRPHEDIAFSVARFFQKGGSLQNYYMYHGGTNFGRTSGGPFITT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYA-FNG  358
             +YDYNAP+DEYG    PK+GHLKELH  + S E  ++YG      L  S +V VY   +G
Sbjct  307   SYDYNAPIDEYGLARLPKWGHLKELHRAIKSCEHVLLYGEPINLSLGPSQEVDVYTDSSG  366

Query  359   TKTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV--MVKE-  529
                 F SN +E  D  I +Q   Y VPAWSVSILPDCK  V+NTA+V +QT+   MV E 
Sbjct  367   GCAAFISNVDEKEDKIIVFQNVSYHVPAWSVSILPDCKNVVFNTAKVGSQTSQVEMVPEE  426

Query  530   -------GGKAAAALRWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSV  685
                      K    L+W    E A    + G+  F  N  +D      D +DY+WY  S+
Sbjct  427   LQPSLVPSNKDLKGLQWETFVEKAG---IWGEADFVKNGFVDHINTTKDTTDYLWYTVSL  483

Query  686   NLDKDDPIWSKDMR--LGVNGTGQVLHVYANGKYVDSQWNNNS----LFETNIKLNHGKN  847
              + + +    +  +  L V   G  LH + N K   S   N S     FE  I L  GKN
Sbjct  484   TVGESENFLKEISQPVLLVESKGHALHAFVNQKLQGSASGNGSHSPFKFECPISLKAGKN  543

Query  848   LLTLLSASIGFQNYGPYFDLGGNGLYGVEIVGKNGDETVRKNLGSHKWSYKVGLRGEENK  1027
              + LLS ++G QN GP+++  G GL  V+I G N       +L ++ W+YK+GL+GE   
Sbjct  544   DIALLSMTVGLQNAGPFYEWVGAGLTSVKIKGLNNGIM---DLSTYTWTYKIGLQGEHLL  600

Query  1028  LFRSSNKSRSASQWLS-DHLPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNN  1204
             +++   +  ++ +WLS    P  + +TWYK     P+G +P+ +D++ MGKG AW+NG  
Sbjct  601   IYKP--EGLNSVKWLSTPEPPKQQPLTWYKAVVDPPSGNEPIGLDMVHMGKGLAWLNGEE  658

Query  1205  LGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             +GRYW   +   D   + CDYRG++  NKC + CG PTQR+YHVPRS+    G N LV+F
Sbjct  659   IGRYWPRKSSIHDKCVQECDYRGKFMPNKCSTGCGEPTQRWYHVPRSWFKPSG-NILVIF  717

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENK--------------------VAEISCQGGRNI  1504
             EE GG+ +++RF   +T GVCA   E+                        + C    +I
Sbjct  718   EEKGGDPTKIRFSRRKTTGVCALVSEDHPTYELESWHKDANENNKNKATIHLKCPENTHI  777

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             +++K+A++G   G CG   +        ++ ++++  C+ K  C++  +E  F    C  
Sbjct  778   SSVKFASYGTPTGKCGSYSQGDCHD--PNSASVVEKLCIRKNDCAIELAEKNFSKDLCP-  834

Query  1685  SRTKKLVVEAVC  1720
             S TKKL VEAVC
Sbjct  835   STTKKLAVEAVC  846



>emb|CDX98326.1| BnaC06g16870D [Brassica napus]
Length=484

 Score =   418 bits (1074),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 215/426 (50%), Positives = 285/426 (67%), Gaps = 16/426 (4%)
 Frame = +2

Query  470   KREVYNTARVNTQTTVMVKEGGKA---AAALRWSWRPEVADDTILHGKGQFTANQILDQK  640
             K+E YNTA++ TQT++MVK+  +A    + L+WSWRPE  D+ +L GKG+ T  Q+ DQK
Sbjct  66    KKEAYNTAKITTQTSMMVKKPNEAEDTPSTLKWSWRPENMDNFLLKGKGESTQTQLFDQK  125

Query  641   VA-NDVSDYIWYMTSVNLDKDDPIWSKDMRLGVNGTGQVLHVYANGKYVDSQWNNNS---  808
             V  ND SDY+WYMT+V   K DP+  K M L VN T  VLH + NGK + +Q   N    
Sbjct  126   VVTNDQSDYLWYMTTVKFKKRDPLLGKTMSLRVNSTAHVLHAFVNGKNIGNQHAENGKFN  185

Query  809   -LFETNIKLNHGKNLLTLLSASIGFQNYGPYFDLGGNGLYG-VEIVGKNGDETVRKNLGS  982
              +FE ++K   G+N++ LLS ++G  NYG +F+    G+ G + I G NGDET+ K+L +
Sbjct  186   YVFEKDVKFKSGRNVIALLSITVGLANYGAFFESKPAGITGPIFITGINGDETIVKDLSA  245

Query  983   HKWSYKVGLRGEENKLFRSSNKSRSASQWLSDHLPTARRMTWYKTSFKAPAGRDPVVVDL  1162
             HKWSYK GL G +N+LFR+     S S+W  +++P  R MTWYK +FK+P G DPVVVDL
Sbjct  246   HKWSYKTGLNGFDNQLFRT----ESMSKWSVENVPFNRTMTWYKATFKSPLGNDPVVVDL  301

Query  1163  MGMGKGFAWVNGNNLGRYWLILAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPR  1342
             MG+GKG AWVNGNN+GRYW      ++     C+YRG Y+  KCL+NCG PTQR+YHVPR
Sbjct  302   MGLGKGTAWVNGNNIGRYWPAFISSENGCDAKCNYRGAYHAEKCLTNCGEPTQRWYHVPR  361

Query  1343  SFLNRRGDNELVLFEETGGNTSRVRFQTVRTGGVCASAYENKVAEISCQGGRNITAIKYA  1522
             SFLN  GDN LVLFEE GGN S V FQT R G VCA+ YE K+ E+SC   + I+AIK+A
Sbjct  362   SFLNAEGDNTLVLFEEMGGNPSLVSFQTTRVGSVCANVYEKKIIELSCD-RKPISAIKFA  420

Query  1523  NFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAGSRTKKL  1702
             +FG+      G FEKG C  +K+ V+IL   C+GK  C +  S   FG  +C+G+  ++L
Sbjct  421   SFGNPN-GNCGSFEKGTCESSKNTVDILTQECVGKEKCCIDVSTERFGAPDCSGA-PRRL  478

Query  1703  VVEAVC  1720
              VEA+C
Sbjct  479   AVEAIC  484



>ref|NP_001289207.1| beta-galactosidase 8-like precursor [Pyrus x bretschneideri]
 gb|AGR44465.1| beta-D-galactosidase 6 [Pyrus x bretschneideri]
Length=842

 Score =   430 bits (1105),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 249/612 (41%), Positives = 351/612 (57%), Gaps = 56/612 (9%)
 Frame = +2

Query  2     TENWTGWFKKWGGKDPYRTAEDLAYSVARFFQLGGTFQNYYMYHGGTNFGRTAGGPYITT  181
             TENW+GWF  +GG  P R  EDLA++VARFFQ GGTFQNYYMYHGGTNFGR+ GGP+I T
Sbjct  247   TENWSGWFLSFGGAVPQRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFGRSTGGPFIAT  306

Query  182   TYDYNAPLDEYGNLNQPKYGHLKELHNVLHSLEKNIVYGNITTTKLDNSIQVTVYAFNGT  361
             +YDY+AP+DEYG L QPK+GHLK++H  +   E+ +V  +   +    +++ TVY     
Sbjct  307   SYDYDAPIDEYGLLRQPKWGHLKDVHKAIKLCEEAMVATDPKYSSFGPNVEATVYKTGSA  366

Query  362   KTCFFSNSNETADATINYQGTDYKVPAWSVSILPDCKREVYNTARVNTQTTV------MV  523
                F +NS+  +DAT+ + G  Y +PAWSVSILPDCK  V NTA++N+   +       V
Sbjct  367   CAAFLANSDTKSDATVTFNGNSYHLPAWSVSILPDCKNVVLNTAKINSAAMIPSFMHHSV  426

Query  524   KEGGKAAAAL--RWSWRPEVADDTILHGKGQFTANQILDQ-KVANDVSDYIWYMTSVNLD  694
              +   ++ AL   WSW   + +   +  K  FT   +L+Q     D SDY+WY  S+++ 
Sbjct  427   IDDTDSSEALGSGWSW---INEPVGISKKDAFTRVGLLEQINTTADKSDYLWYSLSIDVT  483

Query  695   KDDPIWSKDMR--LGVNGTGQVLHVYANGKY----VDSQWNNNSLFETNIKLNHGKNLLT  856
               D       +  L V   G  LH + NGK     + +  N     +  +    GKN + 
Sbjct  484   SSDTFLQDGSQTILHVESLGHALHAFINGKPAGRGIITANNGKISVDIPVTFASGKNTID  543

Query  857   LLSASIGFQNYGPYFDLGGNGLYG-VEIVG-KNGDETVRKNLGSHKWSYKVGLRGEENKL  1030
             LLS +IG QNYG +FD  G G+ G V++ G KNG  T   +L S +W+Y++GL+GE+   
Sbjct  544   LLSLTIGLQNYGAFFDKSGAGITGPVQLKGLKNGTTT---DLSSQRWTYQIGLQGED---  597

Query  1031  FRSSNKSRSASQWLSDH-LPTARRMTWYKTSFKAPAGRDPVVVDLMGMGKGFAWVNGNNL  1207
               S   S S+SQW+S   LP  + +TWYK +F AP G +PV +D  GMGKG AWVNG ++
Sbjct  598   --SGFSSGSSSQWISQPTLPKKQPLTWYKATFNAPDGSNPVALDFTGMGKGEAWVNGQSI  655

Query  1208  GRYWLI-LAKGDDCPTEACDYRGEYNNNKCLSNCGNPTQRFYHVPRSFLNRRGDNELVLF  1384
             GRYW    A    CP ++C++RG Y++NKC  NCG P+Q  YHVPRS+L   G N LVLF
Sbjct  656   GRYWPTNNAPTSGCP-DSCNFRGPYDSNKCRKNCGKPSQELYHVPRSWLKPSG-NTLVLF  713

Query  1385  EETGGNTSRVRFQTVRTGGVCASAYENKVAEI-----SCQGGRN---------------I  1504
             EE GG+ +++ F T +   +C+   E+  + +       +GGR                I
Sbjct  714   EEIGGDPTQISFATRQIESLCSHVSESHPSPVDTWSSDSKGGRKLGPVLSLECPFPNQVI  773

Query  1505  TAIKYANFGDTRgscgggfekgvcggAKDAVNILKTACLGKASCSVTASESVFGTTNCAG  1684
             ++IK+A++G  +     G        +  A++I++ AC+G  SCS+  S   FG   C G
Sbjct  774   SSIKFASYG--KPHGTCGSFSHGQCKSTSALSIVQKACVGSKSCSIEVSVKTFGDP-CKG  830

Query  1685  SRTKKLVVEAVC  1720
                K L VEA C
Sbjct  831   V-AKSLAVEASC  841



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5309665725034