BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33675_g1_i1 len=416 path=[394:0-415]

Length=416
                                                                      Score     E

ref|XP_011097028.1|  PREDICTED: kinesin-4-like                          252   2e-75   
ref|XP_010314384.1|  PREDICTED: kinesin-4-like                          249   2e-74   
gb|EYU38173.1|  hypothetical protein MIMGU_mgv1a025662mg                248   5e-74   
ref|XP_006365419.1|  PREDICTED: kinesin-4-like                          245   6e-74   
ref|XP_009761313.1|  PREDICTED: kinesin-4-like isoform X4               246   9e-74   
ref|XP_010322613.1|  PREDICTED: kinesin-4-like isoform X3               247   1e-73   
ref|XP_009761312.1|  PREDICTED: kinesin-4-like isoform X3               246   1e-73   
ref|XP_009761311.1|  PREDICTED: kinesin-4-like isoform X2               248   1e-73   
ref|XP_010322614.1|  PREDICTED: kinesin-4-like isoform X4               247   1e-73   
ref|XP_009761307.1|  PREDICTED: kinesin-4-like isoform X1               247   1e-73   
ref|XP_010322612.1|  PREDICTED: kinesin-4-like isoform X2               247   2e-73   
ref|XP_009763271.1|  PREDICTED: kinesin-4-like isoform X2               246   2e-73   
ref|XP_010322609.1|  PREDICTED: kinesin-4-like isoform X1               246   2e-73   
ref|XP_009763270.1|  PREDICTED: kinesin-4-like isoform X1               246   3e-73   
gb|EPS62917.1|  hypothetical protein M569_11869                         244   8e-73   
ref|XP_009605734.1|  PREDICTED: kinesin-4-like                          243   1e-72   
ref|XP_009606579.1|  PREDICTED: kinesin-4-like                          243   4e-72   
ref|XP_006353799.1|  PREDICTED: kinesin-4-like                          243   1e-71   
gb|EYU26757.1|  hypothetical protein MIMGU_mgv1a020027mg                234   6e-71   
gb|EYU35383.1|  hypothetical protein MIMGU_mgv1a018937mg                232   9e-71   
ref|XP_002318552.1|  kinesin motor family protein                       236   4e-70   Populus trichocarpa [western balsam poplar]
emb|CDO98431.1|  unnamed protein product                                236   7e-70   
ref|XP_002318551.2|  hypothetical protein POPTR_0012s05330g             235   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010242700.1|  PREDICTED: kinesin-4-like isoform X5               230   2e-69   
ref|XP_010242695.1|  PREDICTED: kinesin-4-like isoform X1               231   5e-69   
ref|XP_010249559.1|  PREDICTED: kinesin-4-like isoform X5               233   3e-68   
ref|XP_010249532.1|  PREDICTED: kinesin-4-like isoform X2               233   3e-68   
ref|XP_010249516.1|  PREDICTED: kinesin-4-like isoform X1               233   4e-68   
ref|XP_010249541.1|  PREDICTED: kinesin-4-like isoform X3               233   4e-68   
ref|XP_010249550.1|  PREDICTED: kinesin-4-like isoform X4               233   4e-68   
ref|XP_010243529.1|  PREDICTED: kinesin KP1-like                        231   5e-68   
ref|XP_011005503.1|  PREDICTED: kinesin KP1-like                        231   5e-68   
ref|XP_011045866.1|  PREDICTED: kinesin KP1-like                        231   5e-68   
ref|XP_010249569.1|  PREDICTED: kinesin KP1-like isoform X6             231   5e-68   
gb|KDO57448.1|  hypothetical protein CISIN_1g042277mg                   229   1e-67   
ref|XP_007036524.1|  P-loop nucleoside triphosphate hydrolases su...    229   5e-67   
ref|XP_006485789.1|  PREDICTED: kinesin-4-like isoform X1               228   5e-67   
ref|XP_006440967.1|  hypothetical protein CICLE_v10023895mg             227   9e-67   
ref|XP_008443607.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    230   1e-66   
ref|XP_002893001.1|  hypothetical protein ARALYDRAFT_335100             228   1e-66   
ref|XP_009348139.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-4          227   2e-66   
emb|CDY19209.1|  BnaC05g14100D                                          227   2e-66   
ref|XP_008804600.1|  PREDICTED: kinesin-4-like                          227   2e-66   
gb|AAF25983.1|AC013354_2  F15H18.10                                     228   4e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CDY26163.1|  BnaA06g12540D                                          226   6e-66   
ref|XP_010459454.1|  PREDICTED: kinesin-4-like isoform X1               226   6e-66   
ref|XP_002321471.2|  hypothetical protein POPTR_0015s03640g             225   7e-66   Populus trichocarpa [western balsam poplar]
ref|XP_009149282.1|  PREDICTED: kinesin-2                               226   7e-66   
ref|XP_010459455.1|  PREDICTED: kinesin-4-like isoform X2               225   8e-66   
gb|AFW76522.1|  hypothetical protein ZEAMMB73_429262                    219   8e-66   
ref|XP_010537451.1|  PREDICTED: kinesin-4-like isoform X3               224   1e-65   
ref|XP_010471464.1|  PREDICTED: kinesin-4                               225   1e-65   
ref|XP_010537450.1|  PREDICTED: kinesin-4-like isoform X2               224   1e-65   
ref|XP_010537447.1|  PREDICTED: kinesin-4-like isoform X1               224   1e-65   
ref|XP_010416204.1|  PREDICTED: kinesin-4-like                          225   1e-65   
ref|XP_011013061.1|  PREDICTED: kinesin-4-like isoform X2               224   1e-65   
gb|KCW83857.1|  hypothetical protein EUGRSUZ_B00722                     224   1e-65   
ref|NP_173277.2|  kinesin motor domain-containing protein               226   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477019.1|  PREDICTED: carboxy-terminal kinesin 2-like         224   2e-65   
ref|XP_004301828.1|  PREDICTED: kinesin-4-like                          225   2e-65   
ref|XP_007210907.1|  hypothetical protein PRUPE_ppa000796mg             224   2e-65   
ref|XP_010915519.1|  PREDICTED: kinesin-4-like                          224   2e-65   
ref|XP_002304498.1|  kinesin motor family protein                       225   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010031995.1|  PREDICTED: kinesin-4 isoform X2                    224   3e-65   
ref|XP_010031985.1|  PREDICTED: kinesin-4 isoform X1                    224   3e-65   
gb|AAG52083.1|AC012679_21  kinesin-related protein; 103921-99132        224   4e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CBI15451.3|  unnamed protein product                                223   4e-65   
ref|XP_002298032.2|  kinesin motor family protein                       223   4e-65   Populus trichocarpa [western balsam poplar]
gb|AAG52533.1|AC016662_27  putative kinesin; 97201-101676               223   4e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AFW76521.1|  hypothetical protein ZEAMMB73_429262                    222   4e-65   
ref|XP_008238831.1|  PREDICTED: kinesin-4                               224   4e-65   
ref|XP_011013060.1|  PREDICTED: kinesin-4-like isoform X1               223   5e-65   
ref|XP_006301495.1|  hypothetical protein CARUB_v10021921mg             223   5e-65   
ref|XP_008650465.1|  PREDICTED: kinesin-4-like                          222   5e-65   
ref|XP_009397984.1|  PREDICTED: kinesin-4-like                          224   5e-65   
emb|CDX68208.1|  BnaA07g22480D                                          223   5e-65   
ref|NP_177527.3|  putative Kinesin motor protein-related protein        223   5e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11085.1|  BnaC06g23370D                                          223   6e-65   
ref|XP_008346792.1|  PREDICTED: kinesin-4-like                          223   6e-65   
ref|XP_006390498.1|  hypothetical protein EUTSA_v10018060mg             223   7e-65   
ref|XP_011029282.1|  PREDICTED: kinesin-4 isoform X2                    223   8e-65   
ref|XP_010428332.1|  PREDICTED: kinesin-4-like isoform X2               223   8e-65   
ref|XP_010428329.1|  PREDICTED: kinesin-4-like isoform X1               223   8e-65   
ref|XP_011029283.1|  PREDICTED: kinesin-4 isoform X3                    223   9e-65   
ref|XP_011029280.1|  PREDICTED: kinesin-4 isoform X1                    223   9e-65   
ref|XP_002532147.1|  kinesin heavy chain, putative                      222   9e-65   Ricinus communis
emb|CDX73023.1|  BnaC06g34710D                                          222   1e-64   
ref|XP_007209035.1|  hypothetical protein PRUPE_ppa014950mg             223   1e-64   
ref|XP_009104788.1|  PREDICTED: kinesin-4-like                          222   1e-64   
ref|XP_010660655.1|  PREDICTED: uncharacterized protein LOC100256435    223   1e-64   
ref|XP_007040243.1|  P-loop nucleoside triphosphate hydrolases su...    222   1e-64   
ref|XP_004965598.1|  PREDICTED: kinesin-4-like isoform X3               221   2e-64   
ref|XP_004965596.1|  PREDICTED: kinesin-4-like isoform X1               223   2e-64   
ref|XP_004965597.1|  PREDICTED: kinesin-4-like isoform X2               221   2e-64   
ref|XP_006306421.1|  hypothetical protein CARUB_v10012358mg             221   2e-64   
emb|CBI34668.3|  unnamed protein product                                222   2e-64   
ref|XP_010695142.1|  PREDICTED: kinesin-1                               222   2e-64   
ref|XP_007040244.1|  P-loop nucleoside triphosphate hydrolases su...    221   2e-64   
emb|CDX96493.1|  BnaA07g31040D                                          221   2e-64   
ref|XP_010498229.1|  PREDICTED: kinesin KP1-like isoform X2             220   2e-64   
ref|XP_009106042.1|  PREDICTED: kinesin-4                               221   2e-64   
gb|KHG09229.1|  Kinesin-4 -like protein                                 221   3e-64   
ref|XP_008393307.1|  PREDICTED: kinesin KP1 isoform X1                  221   3e-64   
ref|XP_008393310.1|  PREDICTED: kinesin-4 isoform X4                    220   3e-64   
ref|XP_006416608.1|  hypothetical protein EUTSA_v10006662mg             221   3e-64   
ref|XP_008393308.1|  PREDICTED: kinesin KP1 isoform X2                  220   4e-64   
ref|XP_008393309.1|  PREDICTED: kinesin KP1 isoform X3                  220   4e-64   
ref|XP_010498228.1|  PREDICTED: kinesin KP1-like isoform X1             221   4e-64   
ref|XP_010663596.1|  PREDICTED: kinesin-4 isoform X1                    221   6e-64   
ref|XP_010663597.1|  PREDICTED: kinesin-4 isoform X2                    221   6e-64   
emb|CDP12027.1|  unnamed protein product                                214   8e-64   
gb|AFW71235.1|  hypothetical protein ZEAMMB73_791260                    207   8e-64   
ref|XP_006654662.1|  PREDICTED: kinesin-4-like                          219   1e-63   
ref|XP_008437282.1|  PREDICTED: kinesin-4 isoform X2                    220   1e-63   
gb|EEC80804.1|  hypothetical protein OsI_23351                          220   2e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_002509807.1|  kinesin heavy chain, putative                      219   2e-63   Ricinus communis
ref|XP_009360158.1|  PREDICTED: kinesin-4-like                          219   2e-63   
ref|XP_008437280.1|  PREDICTED: kinesin-4 isoform X1                    219   2e-63   
gb|EEE65873.1|  hypothetical protein OsJ_21674                          219   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004171275.1|  PREDICTED: kinesin-4-like                          218   3e-63   
ref|XP_010053254.1|  PREDICTED: kinesin KP1                             218   3e-63   
ref|XP_004143905.1|  PREDICTED: kinesin-4-like                          219   3e-63   
ref|XP_009408813.1|  PREDICTED: kinesin KP1-like                        216   3e-63   
ref|XP_006656158.1|  PREDICTED: kinesin-4-like isoform X2               216   5e-63   
ref|XP_006656157.1|  PREDICTED: kinesin-4-like isoform X1               217   7e-63   
gb|EEC77443.1|  hypothetical protein OsI_16245                          219   7e-63   Oryza sativa Indica Group [Indian rice]
gb|AFW85112.1|  kinesin heavy chain                                     214   8e-63   
ref|XP_010915403.1|  PREDICTED: kinesin-4-like                          218   8e-63   
gb|AAT69670.1|  putative kinesin                                        216   9e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044222.1|  Os01g0744000                                       216   9e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644693.1|  PREDICTED: kinesin-4-like                          216   1e-62   
gb|EEE61154.1|  hypothetical protein OsJ_15116                          216   1e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245601.1|  PREDICTED: kinesin KP1                             216   1e-62   
gb|KDO76229.1|  hypothetical protein CISIN_1g001464mg                   216   2e-62   
ref|XP_009364926.1|  PREDICTED: kinesin-4-like                          218   2e-62   
dbj|BAD26164.1|  putative Carboxy-terminal kinesin 2                    215   2e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653506.1|  PREDICTED: kinesin-4-like                          216   2e-62   
ref|XP_006343979.1|  PREDICTED: kinesin-4-like                          215   2e-62   
emb|CAH67371.1|  OSIGBa0128P10.5                                        215   3e-62   Oryza sativa [red rice]
ref|XP_009387623.1|  PREDICTED: kinesin-4-like                          216   3e-62   
ref|XP_004961465.1|  PREDICTED: kinesin-4-like                          215   3e-62   
gb|KDO76228.1|  hypothetical protein CISIN_1g001464mg                   216   3e-62   
ref|XP_011072725.1|  PREDICTED: carboxy-terminal kinesin 2-like         214   3e-62   
ref|XP_004969922.1|  PREDICTED: kinesin-4-like                          215   4e-62   
ref|XP_003569788.1|  PREDICTED: kinesin-4-like isoform X2               215   4e-62   
ref|XP_006439545.1|  hypothetical protein CICLE_v10018623mg             216   4e-62   
gb|KDO76227.1|  hypothetical protein CISIN_1g001464mg                   216   4e-62   
ref|XP_006439546.1|  hypothetical protein CICLE_v10018623mg             216   4e-62   
gb|KDP25433.1|  hypothetical protein JCGZ_20589                         216   4e-62   
ref|XP_010232310.1|  PREDICTED: kinesin-4-like isoform X1               215   4e-62   
emb|CAN65659.1|  hypothetical protein VITISV_000953                     217   5e-62   Vitis vinifera
ref|NP_001046361.1|  Os02g0229600                                       215   5e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EYU23471.1|  hypothetical protein MIMGU_mgv1a000947mg                214   5e-62   
ref|XP_006476565.1|  PREDICTED: kinesin-4-like isoform X1               215   6e-62   
ref|XP_011022686.1|  PREDICTED: kinesin-4-like isoform X2               215   6e-62   
ref|XP_011022688.1|  PREDICTED: kinesin-4-like isoform X4               215   6e-62   
ref|XP_011022687.1|  PREDICTED: kinesin-4-like isoform X3               215   6e-62   
ref|XP_009592482.1|  PREDICTED: kinesin KP1-like                        214   7e-62   
ref|XP_011022683.1|  PREDICTED: kinesin-4-like isoform X1               215   7e-62   
ref|XP_011022689.1|  PREDICTED: kinesin-4-like isoform X5               215   8e-62   
ref|XP_004300795.1|  PREDICTED: kinesin-4-like                          215   8e-62   
dbj|BAJ97665.1|  predicted protein                                      214   8e-62   
ref|XP_011080953.1|  PREDICTED: kinesin-4-like isoform X2               214   8e-62   
ref|XP_011080952.1|  PREDICTED: kinesin-4-like isoform X1               214   9e-62   
emb|CDM84045.1|  unnamed protein product                                214   9e-62   
ref|XP_008795115.1|  PREDICTED: kinesin-4-like                          214   9e-62   
ref|XP_006648475.1|  PREDICTED: calponin homology domain-containi...    214   1e-61   
ref|XP_009391867.1|  PREDICTED: kinesin KP1                             213   1e-61   
gb|EEE56604.1|  hypothetical protein OsJ_05972                          216   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64402.1|  hypothetical protein OsJ_19246                          214   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80283.1|  hypothetical protein OsI_22285                          214   1e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_004975905.1|  PREDICTED: kinesin-4-like                          214   1e-61   
ref|XP_008675058.1|  PREDICTED: kinesin KP1-like                        211   1e-61   
ref|XP_006853662.1|  hypothetical protein AMTR_s00056p00106770          208   2e-61   
ref|XP_008794166.1|  PREDICTED: kinesin-4-like                          214   2e-61   
ref|NP_001056074.1|  Os05g0521300                                       212   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533671.1|  PREDICTED: kinesin-4 isoform X2                    213   3e-61   
ref|XP_010533669.1|  PREDICTED: kinesin-4 isoform X1                    213   3e-61   
ref|XP_008668261.1|  PREDICTED: uncharacterized protein LOC100381...    213   3e-61   
ref|XP_009795668.1|  PREDICTED: kinesin KP1                             211   5e-61   
emb|CDP13670.1|  unnamed protein product                                213   5e-61   
ref|XP_007146665.1|  hypothetical protein PHAVU_006G059300g             211   6e-61   
ref|XP_004165900.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-4-like     210   7e-61   
ref|XP_003545084.1|  PREDICTED: kinesin-4-like                          213   8e-61   
ref|XP_006405988.1|  hypothetical protein EUTSA_v10027628mg             212   9e-61   
ref|XP_010473610.1|  PREDICTED: kinesin-4-like isoform X2               212   9e-61   
ref|XP_010473609.1|  PREDICTED: kinesin-4-like isoform X1               212   9e-61   
gb|EPS60229.1|  hypothetical protein M569_14574                         207   1e-60   
gb|EPS68131.1|  hypothetical protein M569_06641                         204   1e-60   
gb|KHN23820.1|  Kinesin-4                                               212   1e-60   
gb|EMS55440.1|  Kinesin-4                                               211   1e-60   
ref|XP_004951394.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    213   1e-60   
ref|XP_010252852.1|  PREDICTED: kinesin KP1                             212   1e-60   
ref|XP_008656472.1|  PREDICTED: kinesin-4 isoform X3                    209   1e-60   
ref|XP_002300575.2|  kinesin motor family protein                       211   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008657237.1|  PREDICTED: kinesin KP1                             210   2e-60   
ref|XP_009112752.1|  PREDICTED: kinesin-4-like isoform X2               211   2e-60   
ref|XP_007142452.1|  hypothetical protein PHAVU_008G281800g             211   2e-60   
gb|ADN33985.1|  kinesin heavy chain                                     212   2e-60   
ref|XP_009112751.1|  PREDICTED: kinesin-4-like isoform X1               211   2e-60   
emb|CDY62807.1|  BnaCnng41050D                                          211   2e-60   
emb|CDY45358.1|  BnaA09g12430D                                          211   2e-60   
ref|XP_008647385.1|  PREDICTED: uncharacterized protein LOC100193...    210   2e-60   
gb|KGN59396.1|  hypothetical protein Csa_3G816090                       212   2e-60   
ref|XP_008647384.1|  PREDICTED: uncharacterized protein LOC100193...    210   2e-60   
ref|XP_006300383.1|  hypothetical protein CARUB_v10019703mg             210   3e-60   
gb|KHG17675.1|  Kinesin-4 -like protein                                 207   3e-60   
gb|KHN43918.1|  Kinesin-4                                               211   3e-60   
gb|AET05326.2|  kinesin motor catalytic domain protein                  211   3e-60   
ref|XP_010431727.1|  PREDICTED: kinesin-4-like                          210   3e-60   
gb|AFW82518.1|  hypothetical protein ZEAMMB73_648725                    207   3e-60   
ref|XP_003518562.1|  PREDICTED: kinesin-4-like                          211   4e-60   
ref|XP_004136617.1|  PREDICTED: uncharacterized protein LOC101213894    211   4e-60   
ref|XP_010418391.1|  PREDICTED: kinesin-4-like isoform X2               210   4e-60   
ref|XP_010418390.1|  PREDICTED: kinesin-4-like isoform X1               210   4e-60   
ref|XP_010418392.1|  PREDICTED: kinesin-4-like isoform X3               210   4e-60   
ref|XP_010418393.1|  PREDICTED: kinesin-4-like isoform X4               210   4e-60   
ref|XP_002868605.1|  hypothetical protein ARALYDRAFT_330390             209   4e-60   
emb|CDY34366.1|  BnaA09g11080D                                          209   5e-60   
ref|XP_009392079.1|  PREDICTED: kinesin KP1                             209   5e-60   
ref|XP_004512859.1|  PREDICTED: kinesin-4-like                          209   6e-60   
gb|AES70665.2|  kinesin heavy chain                                     210   6e-60   
ref|XP_006857693.1|  hypothetical protein AMTR_s00061p00165490          210   7e-60   
gb|AES76706.2|  P-loop nucleoside triphosphate hydrolase superfam...    208   7e-60   
ref|XP_003600414.1|  Kinesin-4                                          209   8e-60   
ref|XP_008656471.1|  PREDICTED: kinesin KP1 isoform X2                  207   8e-60   
ref|XP_010441293.1|  PREDICTED: kinesin KP1-like                        209   8e-60   
ref|XP_008656473.1|  PREDICTED: kinesin KP1 isoform X4                  207   9e-60   
ref|XP_008656470.1|  PREDICTED: kinesin-4 isoform X1                    209   9e-60   
ref|XP_008240320.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-2          209   1e-59   
emb|CDY25511.1|  BnaC09g11360D                                          209   1e-59   
ref|XP_009112934.1|  PREDICTED: kinesin-4-like isoform X2               209   1e-59   
ref|XP_003620488.1|  Kinesin                                            206   1e-59   
ref|XP_009112933.1|  PREDICTED: kinesin-4-like isoform X1               209   1e-59   
ref|XP_006580580.1|  PREDICTED: kinesin-4-like isoform X4               209   1e-59   
ref|XP_006580577.1|  PREDICTED: kinesin-4-like isoform X1               209   1e-59   
gb|AFW82519.1|  hypothetical protein ZEAMMB73_648725                    207   1e-59   
gb|AFW82517.1|  kinesin heavy chain                                     207   1e-59   
gb|AAK91816.1|AF272753_1  kinesin heavy chain                           200   1e-59   Zea mays [maize]
dbj|BAJ94982.1|  predicted protein                                      205   2e-59   
ref|XP_006855341.1|  hypothetical protein AMTR_s00057p00096030          208   2e-59   
ref|XP_002886395.1|  hypothetical protein ARALYDRAFT_474991             208   2e-59   
ref|XP_006584721.1|  PREDICTED: kinesin-4-like isoform X1               208   2e-59   
ref|XP_008645618.1|  PREDICTED: kinesin KP1-like                        205   2e-59   
ref|XP_010447313.1|  PREDICTED: kinesin KP1                             207   2e-59   
ref|XP_011039821.1|  PREDICTED: kinesin KP1-like isoform X2             208   2e-59   
gb|KHN23642.1|  Kinesin-4                                               207   3e-59   
ref|XP_011039818.1|  PREDICTED: kinesin KP1-like isoform X1             208   4e-59   
emb|CDY46382.1|  BnaC04g33010D                                          206   4e-59   
gb|KHN32041.1|  Kinesin-4                                               205   4e-59   
ref|XP_006595426.1|  PREDICTED: kinesin-4-like                          206   5e-59   
ref|XP_007160066.1|  hypothetical protein PHAVU_002G289700g             207   5e-59   
emb|CDY39749.1|  BnaA04g11040D                                          206   6e-59   
ref|XP_006286204.1|  hypothetical protein CARUB_v10007770mg             206   6e-59   
ref|XP_010677989.1|  PREDICTED: kinesin-4                               207   6e-59   
ref|XP_010227622.1|  PREDICTED: kinesin-4-like isoform X5               206   7e-59   
ref|XP_009140202.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-4          206   7e-59   
ref|XP_004500158.1|  PREDICTED: kinesin-4-like                          206   1e-58   
ref|XP_010089102.1|  hypothetical protein L484_024275                   207   1e-58   
ref|XP_004491537.1|  PREDICTED: kinesin-4-like isoform X2               205   1e-58   
ref|XP_008803198.1|  PREDICTED: kinesin KP1                             206   1e-58   
emb|CBI39798.3|  unnamed protein product                                206   1e-58   
gb|AAG52420.1|AC011622_8  kinesin-like protein; 73641-79546             206   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974079.1|  microtubule motor protein KinG                        206   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491536.1|  PREDICTED: kinesin-4-like isoform X1               206   1e-58   
ref|NP_176551.3|  microtubule motor protein KinG                        206   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ADL28383.1|  kinesin KinG                                            206   2e-58   
gb|KHN16578.1|  Kinesin-4                                               206   2e-58   
ref|XP_003530813.1|  PREDICTED: kinesin-4-like                          206   2e-58   
gb|KHN01778.1|  Kinesin-4                                               206   2e-58   
ref|XP_010942908.1|  PREDICTED: kinesin KP1                             205   2e-58   
gb|KDP32619.1|  hypothetical protein JCGZ_13169                         205   2e-58   
ref|XP_010227620.1|  PREDICTED: kinesin-4-like isoform X3               205   2e-58   
ref|XP_010644627.1|  PREDICTED: kinesin KP1 isoform X1                  206   2e-58   
ref|XP_010227621.1|  PREDICTED: kinesin-4-like isoform X4               205   3e-58   
ref|XP_006377968.1|  kinesin motor family protein                       205   3e-58   
gb|KHN31694.1|  Kinesin-4                                               206   3e-58   
ref|XP_011000321.1|  PREDICTED: kinesin KP1-like                        205   3e-58   
ref|XP_006405368.1|  hypothetical protein EUTSA_v10027635mg             204   3e-58   
ref|XP_010242696.1|  PREDICTED: kinesin-4-like isoform X2               202   3e-58   
ref|XP_011095593.1|  PREDICTED: kinesin KP1-like isoform X2             205   3e-58   
ref|XP_010227618.1|  PREDICTED: kinesin-4-like isoform X1               205   3e-58   
ref|XP_003537070.1|  PREDICTED: kinesin-4-like                          205   3e-58   
ref|XP_010644628.1|  PREDICTED: kinesin KP1 isoform X2                  205   3e-58   
ref|XP_010227619.1|  PREDICTED: kinesin-4-like isoform X2               205   3e-58   
gb|KDO59225.1|  hypothetical protein CISIN_1g0013342mg                  202   4e-58   
ref|XP_011095590.1|  PREDICTED: kinesin KP1-like isoform X1             205   4e-58   
ref|XP_006452673.1|  hypothetical protein CICLE_v10007289mg             205   4e-58   
gb|KGN44121.1|  hypothetical protein Csa_7G197290                       205   5e-58   
ref|XP_006586333.1|  PREDICTED: kinesin-4-like                          205   5e-58   
ref|XP_010644629.1|  PREDICTED: kinesin KP1 isoform X3                  204   5e-58   
ref|XP_010925550.1|  PREDICTED: kinesin-4-like                          203   5e-58   
ref|XP_003566026.1|  PREDICTED: kinesin-4-like                          204   5e-58   
ref|XP_006474811.1|  PREDICTED: kinesin-4-like                          204   5e-58   
ref|XP_004512926.1|  PREDICTED: kinesin-5-like isoform X1               204   6e-58   
ref|XP_004512928.1|  PREDICTED: kinesin-5-like isoform X3               204   6e-58   
ref|XP_002532168.1|  kinesin heavy chain, putative                      204   6e-58   
ref|XP_008447779.1|  PREDICTED: kinesin KP1                             204   6e-58   
ref|XP_004512927.1|  PREDICTED: kinesin-5-like isoform X2               204   6e-58   
ref|XP_001768325.1|  predicted protein                                  201   6e-58   
ref|XP_009367273.1|  PREDICTED: kinesin KP1                             204   7e-58   
ref|XP_003630503.1|  Kinesin-like protein                               202   9e-58   
ref|XP_007152758.1|  hypothetical protein PHAVU_004G157000g             204   9e-58   
emb|CAZ40331.1|  putative kinesin-like protein                          203   9e-58   
ref|XP_002968424.1|  hypothetical protein SELMODRAFT_169724             201   1e-57   
ref|XP_002970585.1|  hypothetical protein SELMODRAFT_93581              201   1e-57   
ref|XP_007208232.1|  hypothetical protein PRUPE_ppa017673mg             203   1e-57   
ref|XP_003617887.1|  Kinesin-4                                          204   1e-57   
ref|XP_010234073.1|  PREDICTED: kinesin-4-like                          204   2e-57   
ref|XP_004503714.1|  PREDICTED: kinesin-4-like isoform X1               203   2e-57   
gb|AET00846.2|  kinesin heavy chain, putative                           204   2e-57   
ref|XP_008353203.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin KP1        203   2e-57   
ref|XP_003579936.2|  PREDICTED: kinesin KP1                             202   2e-57   
ref|NP_198947.1|  kinesin-like protein                                  201   2e-57   
ref|XP_003630850.1|  Kinesin 4-like protein                             203   2e-57   
dbj|BAB11107.1|  kinesin-like protein                                   201   3e-57   
ref|XP_006293324.1|  hypothetical protein CARUB_v100166151mg            198   3e-57   
ref|XP_008218827.1|  PREDICTED: kinesin KP1                             202   3e-57   
gb|AET04979.2|  P-loop nucleoside triphosphate hydrolase superfam...    202   3e-57   
ref|XP_007040242.1|  P-loop nucleoside triphosphate hydrolases su...    202   4e-57   
gb|KEH21062.1|  P-loop nucleoside triphosphate hydrolase superfam...    202   4e-57   
ref|XP_011097801.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin KP1-...    201   5e-57   
ref|XP_006580891.1|  PREDICTED: kinesin-4-like                          202   6e-57   
gb|KHN21564.1|  Kinesin-4                                               201   8e-57   
gb|KHG24792.1|  Kinesin-4 -like protein                                 200   1e-56   
ref|XP_010674116.1|  PREDICTED: kinesin-4-like                          200   1e-56   
dbj|BAK01300.1|  predicted protein                                      201   1e-56   
gb|AAB70034.1|  putative kinesin-like protein                           198   2e-56   
gb|KDP20118.1|  hypothetical protein JCGZ_05887                         201   2e-56   
ref|XP_010914521.1|  PREDICTED: kinesin-4                               199   3e-56   
ref|XP_010425890.1|  PREDICTED: kinesin KP1                             199   4e-56   
ref|XP_010514796.1|  PREDICTED: kinesin KP1-like                        199   4e-56   
dbj|BAK05262.1|  predicted protein                                      199   4e-56   
ref|XP_007020398.1|  Kinesin-like protein 1 isoform 2                   199   4e-56   
ref|XP_006279372.1|  hypothetical protein CARUB_v10007986mg             199   5e-56   
ref|XP_009586634.1|  PREDICTED: kinesin KP1                             199   5e-56   
ref|XP_009801901.1|  PREDICTED: kinesin KP1                             199   7e-56   
ref|XP_010259428.1|  PREDICTED: kinesin-4-like isoform X1               198   9e-56   
ref|XP_010259429.1|  PREDICTED: kinesin-4-like isoform X2               197   1e-55   
ref|XP_007020397.1|  Kinesin-like protein 1 isoform 1                   198   1e-55   
ref|XP_002875682.1|  hypothetical protein ARALYDRAFT_484877             197   1e-55   
tpg|DAA44966.1|  TPA: hypothetical protein ZEAMMB73_419454              193   2e-55   
ref|XP_001764480.1|  predicted protein                                  194   2e-55   
ref|XP_010259430.1|  PREDICTED: kinesin-4-like isoform X3               195   2e-55   
gb|EYU27472.1|  hypothetical protein MIMGU_mgv1a000636mg                197   2e-55   
ref|NP_190059.3|  kinesin-like protein 1                                197   3e-55   
ref|XP_008797167.1|  PREDICTED: kinesin-4-like isoform X2               196   3e-55   
ref|XP_001766365.1|  predicted protein                                  195   3e-55   
ref|XP_010324237.1|  PREDICTED: kinesin KP1 isoform X2                  196   3e-55   
ref|XP_008797166.1|  PREDICTED: kinesin-4-like isoform X1               196   3e-55   
ref|XP_006346106.1|  PREDICTED: kinesin-4-like                          196   4e-55   
ref|XP_006419109.1|  hypothetical protein EUTSA_v10002379mg             196   4e-55   
gb|EEE55367.1|  hypothetical protein OsJ_03421                          197   4e-55   
gb|EMS50422.1|  Kinesin-4                                               196   5e-55   
ref|XP_010324236.1|  PREDICTED: kinesin KP1 isoform X1                  196   5e-55   
gb|EEC71463.1|  hypothetical protein OsI_03702                          195   5e-55   
gb|EMT26630.1|  Kinesin-4                                               196   8e-55   
emb|CDY31108.1|  BnaA08g26580D                                          194   9e-55   
gb|AAK92458.3|AF398149_1  kinesin-like protein heavy chain              195   1e-54   
ref|XP_009149645.1|  PREDICTED: kinesin KP1                             195   1e-54   
ref|XP_010063235.1|  PREDICTED: kinesin KP1                             195   1e-54   
gb|AFW88632.1|  hypothetical protein ZEAMMB73_479429                    184   2e-54   
emb|CDY32155.1|  BnaCnng06640D                                          194   2e-54   
ref|XP_009110848.1|  PREDICTED: kinesin-4                               194   2e-54   
emb|CDY29715.1|  BnaAnng03370D                                          194   3e-54   
ref|XP_010905682.1|  PREDICTED: kinesin-4-like                          193   3e-54   
ref|XP_010245442.1|  PREDICTED: kinesin-4-like                          193   4e-54   
ref|XP_010503121.1|  PREDICTED: kinesin KP1-like                        193   4e-54   
ref|XP_004230273.1|  PREDICTED: kinesin-4-like                          192   7e-54   
gb|KHG23518.1|  Kinesin-4 -like protein                                 192   7e-54   
ref|XP_010110618.1|  hypothetical protein L484_000522                   191   8e-54   
ref|XP_004296130.1|  PREDICTED: kinesin-4-like                          193   8e-54   
ref|XP_009399323.1|  PREDICTED: kinesin-4                               192   1e-53   
ref|XP_010676106.1|  PREDICTED: kinesin KP1                             192   1e-53   
ref|XP_002465392.1|  hypothetical protein SORBIDRAFT_01g037790          187   1e-53   
gb|EEC72779.1|  hypothetical protein OsI_06451                          191   1e-53   
gb|KGN66027.1|  hypothetical protein Csa_1G568560                       192   1e-53   
emb|CDP17097.1|  unnamed protein product                                192   1e-53   
ref|XP_009384143.1|  PREDICTED: kinesin-4-like isoform X1               191   2e-53   
ref|XP_008643690.1|  PREDICTED: uncharacterized protein LOC100381...    191   2e-53   
ref|XP_009384144.1|  PREDICTED: kinesin-4-like isoform X2               191   2e-53   
ref|XP_007160373.1|  hypothetical protein PHAVU_002G316200g             191   2e-53   
ref|XP_008450576.1|  PREDICTED: kinesin-4-like isoform X2               190   2e-53   
ref|XP_008807759.1|  PREDICTED: kinesin-4-like                          191   3e-53   
gb|AAF19694.1|AC008047_1  F2K11.1                                       191   3e-53   
ref|XP_008797404.1|  PREDICTED: kinesin-4-like                          190   4e-53   
ref|XP_010552347.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin KP1        191   5e-53   
gb|ABF95490.1|  Kinesin-4, putative, expressed                          190   6e-53   
ref|XP_006382432.1|  hypothetical protein POPTR_0005s02100g             189   8e-53   
ref|XP_006433492.1|  hypothetical protein CICLE_v10000131mg             189   8e-53   
ref|XP_009799455.1|  PREDICTED: kinesin-4-like                          189   1e-52   
gb|KDO81741.1|  hypothetical protein CISIN_1g001666mg                   189   1e-52   
ref|XP_008450575.1|  PREDICTED: kinesin-4-like isoform X1               189   1e-52   
ref|XP_002986476.1|  hypothetical protein SELMODRAFT_124154             186   1e-52   
ref|XP_004984654.1|  PREDICTED: kinesin-4-like                          189   1e-52   
gb|EEC75071.1|  hypothetical protein OsI_11198                          189   1e-52   
ref|XP_009411647.1|  PREDICTED: kinesin-4-like isoform X2               189   2e-52   
gb|KDP23424.1|  hypothetical protein JCGZ_23257                         189   2e-52   
ref|XP_009411646.1|  PREDICTED: kinesin-4-like isoform X1               189   2e-52   
ref|XP_006651299.1|  PREDICTED: kinesin-4-like                          189   2e-52   
ref|XP_008370398.1|  PREDICTED: kinesin-4-like                          188   2e-52   
ref|XP_002318969.1|  hypothetical protein POPTR_0013s01280g             188   2e-52   
gb|KHN03951.1|  Kinesin-4                                               188   2e-52   
ref|XP_003520795.1|  PREDICTED: kinesin-4-like                          188   2e-52   
gb|KGN53978.1|  hypothetical protein Csa_4G219360                       184   2e-52   
ref|XP_010069889.1|  PREDICTED: kinesin-4 isoform X2                    188   2e-52   
ref|XP_010069888.1|  PREDICTED: kinesin-4 isoform X1                    188   2e-52   
ref|XP_003558101.1|  PREDICTED: kinesin-4-like                          188   3e-52   
ref|XP_006663656.1|  PREDICTED: kinesin-4-like                          187   3e-52   
ref|XP_009338208.1|  PREDICTED: kinesin-4                               187   6e-52   
ref|XP_011036919.1|  PREDICTED: kinesin-4-like                          187   7e-52   
ref|XP_010103408.1|  hypothetical protein L484_007477                   182   7e-52   
ref|XP_008246359.1|  PREDICTED: kinesin-4-like                          187   7e-52   
emb|CBI39561.3|  unnamed protein product                                187   7e-52   
ref|XP_011023739.1|  PREDICTED: kinesin-4-like                          187   8e-52   
ref|XP_007207794.1|  hypothetical protein PRUPE_ppa025571mg             186   8e-52   
ref|XP_010424368.1|  PREDICTED: kinesin-4-like                          184   8e-52   
dbj|BAJ93602.1|  predicted protein                                      186   9e-52   
gb|EMS67364.1|  Kinesin-4                                               186   9e-52   
gb|KHN43330.1|  Kinesin-4                                               186   1e-51   
ref|XP_003553709.1|  PREDICTED: kinesin-4-like                          186   1e-51   
emb|CAN74504.1|  hypothetical protein VITISV_015888                     186   1e-51   
gb|KDO87109.1|  hypothetical protein CISIN_1g001820mg                   184   1e-51   
emb|CDY20350.1|  BnaC01g23900D                                          186   1e-51   
ref|XP_002523135.1|  kinesin heavy chain, putative                      186   1e-51   
ref|XP_003625931.1|  Kinesin-4                                          182   1e-51   
ref|XP_010659667.1|  PREDICTED: kinesin-4-like                          186   2e-51   
ref|XP_006444423.1|  hypothetical protein CICLE_v10018670mg             186   2e-51   
ref|XP_010094755.1|  hypothetical protein L484_019965                   185   2e-51   
gb|KCW60537.1|  hypothetical protein EUGRSUZ_H03277                     186   2e-51   
gb|EMT27883.1|  Kinesin-4                                               185   2e-51   
ref|XP_010458194.1|  PREDICTED: kinesin-4-like isoform X2               184   2e-51   
ref|XP_007028684.1|  Kinesin heavy chain, putative isoform 4            184   2e-51   
emb|CDP17227.1|  unnamed protein product                                185   2e-51   
ref|XP_010024106.1|  PREDICTED: kinesin-4                               185   2e-51   
ref|XP_010489767.1|  PREDICTED: kinesin-4-like isoform X2               184   3e-51   
ref|XP_004290823.1|  PREDICTED: kinesin-4-like                          186   3e-51   
ref|XP_002512478.1|  kinesin heavy chain, putative                      185   3e-51   
gb|AAW03152.1|  kinesin                                                 185   3e-51   
ref|XP_010931712.1|  PREDICTED: kinesin-4                               185   3e-51   
ref|XP_010238999.1|  PREDICTED: kinesin-4-like                          185   3e-51   
ref|XP_007163151.1|  hypothetical protein PHAVU_001G210500g             185   4e-51   
gb|KHN43486.1|  Kinesin-4                                               185   4e-51   
ref|XP_011087452.1|  PREDICTED: kinesin-4-like                          184   4e-51   
ref|XP_009591173.1|  PREDICTED: kinesin-4-like                          184   5e-51   
ref|XP_010458190.1|  PREDICTED: kinesin-4-like isoform X1               184   8e-51   
ref|XP_010528917.1|  PREDICTED: kinesin-4-like                          184   8e-51   
ref|XP_007051020.1|  P-loop nucleoside triphosphate hydrolases su...    184   9e-51   
ref|XP_007051021.1|  P-loop nucleoside triphosphate hydrolases su...    184   9e-51   
ref|XP_004240576.1|  PREDICTED: kinesin-4-like                          184   9e-51   
ref|XP_010475743.1|  PREDICTED: kinesin-4-like                          184   9e-51   
ref|XP_007031085.1|  Kinesin heavy chain, putative                      184   1e-50   
emb|CDY53341.1|  BnaCnng24990D                                          183   1e-50   
ref|XP_008660229.1|  PREDICTED: kinesin-4-like                          184   1e-50   
ref|XP_010489762.1|  PREDICTED: kinesin-4-like isoform X1               183   1e-50   
gb|EYU37267.1|  hypothetical protein MIMGU_mgv1a000609mg                183   2e-50   
gb|KDO87108.1|  hypothetical protein CISIN_1g001820mg                   182   2e-50   
gb|KEH24416.1|  P-loop nucleoside triphosphate hydrolase superfam...    181   2e-50   
ref|XP_010549575.1|  PREDICTED: kinesin-4-like                          183   2e-50   
gb|EYU46766.1|  hypothetical protein MIMGU_mgv1a000861mg                182   2e-50   
ref|XP_006577158.1|  PREDICTED: kinesin-4-like isoform X3               183   2e-50   
ref|XP_007028683.1|  Kinesin heavy chain, putative isoform 3            183   2e-50   
gb|KHG14658.1|  Kinesin-4 -like protein                                 182   2e-50   
ref|XP_004150762.1|  PREDICTED: kinesin-4-like                          182   2e-50   
gb|KEH24417.1|  P-loop nucleoside triphosphate hydrolase superfam...    181   2e-50   
ref|XP_003521579.1|  PREDICTED: kinesin-4-like isoform X1               182   2e-50   
ref|XP_009111772.1|  PREDICTED: kinesin-4-like                          182   2e-50   
gb|KHN20380.1|  Kinesin-4                                               182   3e-50   
ref|XP_007028682.1|  Kinesin heavy chain, putative isoform 2            182   3e-50   
ref|XP_009624301.1|  PREDICTED: kinesin-4-like                          182   3e-50   
gb|KFK43213.1|  hypothetical protein AALP_AA1G095200                    182   3e-50   
ref|XP_006286994.1|  hypothetical protein CARUB_v10000139mg             182   3e-50   
ref|XP_006604730.1|  PREDICTED: kinesin-4-like isoform X1               182   3e-50   
ref|XP_004168948.1|  PREDICTED: kinesin-4-like                          182   3e-50   
ref|XP_006355844.1|  PREDICTED: kinesin-4-like                          182   4e-50   
ref|XP_010493959.1|  PREDICTED: kinesin-4 isoform X2                    180   4e-50   
gb|AES61721.2|  P-loop nucleoside triphosphate hydrolase superfam...    182   4e-50   
ref|XP_002456344.1|  hypothetical protein SORBIDRAFT_03g034310          181   4e-50   
ref|XP_010455070.1|  PREDICTED: kinesin-4-like                          181   5e-50   
emb|CDY19745.1|  BnaA09g03980D                                          181   5e-50   
ref|XP_009800664.1|  PREDICTED: kinesin-4-like                          181   5e-50   
emb|CDX80606.1|  BnaC07g28380D                                          181   7e-50   
ref|XP_006394926.1|  hypothetical protein EUTSA_v10003600mg             181   7e-50   
ref|NP_001066967.1|  Os12g0547500                                       181   8e-50   
ref|XP_009151170.1|  PREDICTED: kinesin-4                               181   8e-50   
ref|XP_010493958.1|  PREDICTED: kinesin-4 isoform X1                    181   8e-50   
gb|KEH24415.1|  P-loop nucleoside triphosphate hydrolase superfam...    181   8e-50   
gb|AES82149.2|  P-loop nucleoside triphosphate hydrolase superfam...    181   9e-50   
ref|XP_007200953.1|  hypothetical protein PRUPE_ppa000821mg             181   9e-50   
ref|XP_008457614.1|  PREDICTED: kinesin-4 isoform X4                    181   9e-50   
ref|XP_004247392.1|  PREDICTED: kinesin-4-like                          181   9e-50   
ref|XP_002978963.1|  hypothetical protein SELMODRAFT_109778             178   1e-49   
gb|EMT25397.1|  Kinesin-4                                               180   1e-49   
ref|XP_010108212.1|  hypothetical protein L484_003410                   181   1e-49   
gb|KHG19036.1|  Kinesin-4 -like protein                                 181   1e-49   
ref|XP_009605508.1|  PREDICTED: kinesin-4-like isoform X1               180   2e-49   
ref|XP_007163341.1|  hypothetical protein PHAVU_001G226700g             181   2e-49   
ref|XP_003625129.1|  Kinesin-like polypeptide                           180   2e-49   
ref|XP_006421309.1|  hypothetical protein CICLE_v10004492mg             178   2e-49   
gb|KEH23620.1|  kinesin motor catalytic domain protein                  180   2e-49   



>ref|XP_011097028.1| PREDICTED: kinesin-4-like, partial [Sesamum indicum]
Length=983

 Score =   252 bits (644),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 116/138 (84%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK KQ+IVEY+G+NGELIV+NP+KQ KEGRRSFKF++VYGP+ATQA+VF+D
Sbjct  600  CRIRPFLPGQKGKQSIVEYIGENGELIVVNPAKQGKEGRRSFKFDKVYGPTATQAEVFSD  659

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEE+WGVNYRALN+LFRISQ+R S
Sbjct  660  TQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEEDWGVNYRALNNLFRISQSRQS  719

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F+YEV VQMVEIYNEQV
Sbjct  720  SFTYEVSVQMVEIYNEQV  737



>ref|XP_010314384.1| PREDICTED: kinesin-4-like [Solanum lycopersicum]
Length=924

 Score =   249 bits (636),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 112/138 (81%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQ++VEY+G+NGELI++NPSKQ KEGRRSFKFN+VY P+ATQA V++D
Sbjct  534  CRIRPFLRGQKEKQSVVEYIGENGELIIVNPSKQGKEGRRSFKFNKVYNPAATQADVYSD  593

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPD ATEENWGVNYRALND+FRISQTR +
Sbjct  594  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDKATEENWGVNYRALNDIFRISQTRVN  653

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQM+EIYNEQV
Sbjct  654  TFTYEITVQMMEIYNEQV  671



>gb|EYU38173.1| hypothetical protein MIMGU_mgv1a025662mg, partial [Erythranthe 
guttata]
Length=986

 Score =   248 bits (634),  Expect = 5e-74, Method: Composition-based stats.
 Identities = 113/138 (82%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK K +I+EYVGDNGELIV NPSKQ KEGRRSFKF++VY P+ATQA+VF+D
Sbjct  615  CRIRPFLPGQKGKSSIIEYVGDNGELIVSNPSKQGKEGRRSFKFDKVYSPAATQAEVFSD  674

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL+QSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEE WGVNYRALN+LFRISQ+R S
Sbjct  675  TQPLVQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEEEWGVNYRALNNLFRISQSRES  734

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQ+VEIYNEQV
Sbjct  735  NFTYEISVQIVEIYNEQV  752



>ref|XP_006365419.1| PREDICTED: kinesin-4-like [Solanum tuberosum]
Length=737

 Score =   245 bits (626),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQT++EY+G+NGEL+V+NPSKQ KEGRRSFKFN VY P++ QAQV++D
Sbjct  377  CRIRPFLRGQKEKQTVIEYIGENGELVVVNPSKQGKEGRRSFKFNTVYSPASAQAQVYSD  436

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL+QSVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLFRISQ R S
Sbjct  437  IQPLVQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFRISQMRES  496

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  497  TFKYEIKVQMMEIYNEQV  514



>ref|XP_009761313.1| PREDICTED: kinesin-4-like isoform X4 [Nicotiana sylvestris]
Length=833

 Score =   246 bits (628),  Expect = 9e-74, Method: Composition-based stats.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQ++VEY+G+NGELIV+NPSKQ KEG RSFKFN+VY P+ATQA+V++D
Sbjct  681  CRIRPFLRGQKEKQSVVEYIGENGELIVVNPSKQGKEGHRSFKFNKVYSPAATQAEVYSD  740

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPD ATEEN GVNYRALNDLFRISQ RGS
Sbjct  741  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDKATEENLGVNYRALNDLFRISQMRGS  800

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQM+EIYNEQV
Sbjct  801  TFTYEITVQMIEIYNEQV  818



>ref|XP_010322613.1| PREDICTED: kinesin-4-like isoform X3 [Solanum lycopersicum]
Length=905

 Score =   247 bits (630),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQT++EY+G+NGEL+V+NPSKQ KEGRRSFKFN VY P++ QAQV++D
Sbjct  519  CRIRPFLRGQKEKQTVIEYIGENGELVVVNPSKQGKEGRRSFKFNMVYSPASVQAQVYSD  578

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL+QSVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLFRISQ R S
Sbjct  579  IQPLVQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFRISQMRES  638

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  639  TFKYEIKVQMMEIYNEQV  656



>ref|XP_009761312.1| PREDICTED: kinesin-4-like isoform X3 [Nicotiana sylvestris]
Length=838

 Score =   246 bits (628),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQ++VEY+G+NGELIV+NPSKQ KEG RSFKFN+VY P+ATQA+V++D
Sbjct  681  CRIRPFLRGQKEKQSVVEYIGENGELIVVNPSKQGKEGHRSFKFNKVYSPAATQAEVYSD  740

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPD ATEEN GVNYRALNDLFRISQ RGS
Sbjct  741  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDKATEENLGVNYRALNDLFRISQMRGS  800

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQM+EIYNEQV
Sbjct  801  TFTYEITVQMIEIYNEQV  818



>ref|XP_009761311.1| PREDICTED: kinesin-4-like isoform X2 [Nicotiana sylvestris]
Length=1031

 Score =   248 bits (632),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQ++VEY+G+NGELIV+NPSKQ KEG RSFKFN+VY P+ATQA+V++D
Sbjct  681  CRIRPFLRGQKEKQSVVEYIGENGELIVVNPSKQGKEGHRSFKFNKVYSPAATQAEVYSD  740

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPD ATEEN GVNYRALNDLFRISQ RGS
Sbjct  741  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDKATEENLGVNYRALNDLFRISQMRGS  800

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQM+EIYNEQV
Sbjct  801  TFTYEITVQMIEIYNEQV  818



>ref|XP_010322614.1| PREDICTED: kinesin-4-like isoform X4 [Solanum lycopersicum]
Length=904

 Score =   247 bits (630),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQT++EY+G+NGEL+V+NPSKQ KEGRRSFKFN VY P++ QAQV++D
Sbjct  519  CRIRPFLRGQKEKQTVIEYIGENGELVVVNPSKQGKEGRRSFKFNMVYSPASVQAQVYSD  578

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL+QSVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLFRISQ R S
Sbjct  579  IQPLVQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFRISQMRES  638

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  639  TFKYEIKVQMMEIYNEQV  656



>ref|XP_009761307.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009761308.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009761309.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009761310.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
Length=1063

 Score =   247 bits (631),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQ++VEY+G+NGELIV+NPSKQ KEG RSFKFN+VY P+ATQA+V++D
Sbjct  681  CRIRPFLRGQKEKQSVVEYIGENGELIVVNPSKQGKEGHRSFKFNKVYSPAATQAEVYSD  740

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPD ATEEN GVNYRALNDLFRISQ RGS
Sbjct  741  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDKATEENLGVNYRALNDLFRISQMRGS  800

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQM+EIYNEQV
Sbjct  801  TFTYEITVQMIEIYNEQV  818



>ref|XP_010322612.1| PREDICTED: kinesin-4-like isoform X2 [Solanum lycopersicum]
Length=985

 Score =   247 bits (630),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQT++EY+G+NGEL+V+NPSKQ KEGRRSFKFN VY P++ QAQV++D
Sbjct  509  CRIRPFLRGQKEKQTVIEYIGENGELVVVNPSKQGKEGRRSFKFNMVYSPASVQAQVYSD  568

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL+QSVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLFRISQ R S
Sbjct  569  IQPLVQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFRISQMRES  628

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  629  TFKYEIKVQMMEIYNEQV  646



>ref|XP_009763271.1| PREDICTED: kinesin-4-like isoform X2 [Nicotiana sylvestris]
Length=918

 Score =   246 bits (629),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 111/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQT+VEY+G+NGEL+V+NPS+Q KEGRRSFKFN VY P+ATQAQV++D
Sbjct  533  CRIRPFLRGQKEKQTVVEYIGENGELVVVNPSRQGKEGRRSFKFNTVYSPTATQAQVYSD  592

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQS LDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLFRISQ R S
Sbjct  593  IQPLIQSALDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFRISQMRES  652

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  653  TFKYEIKVQMLEIYNEQV  670



>ref|XP_010322609.1| PREDICTED: kinesin-4-like isoform X1 [Solanum lycopersicum]
 ref|XP_010322610.1| PREDICTED: kinesin-4-like isoform X1 [Solanum lycopersicum]
 ref|XP_010322611.1| PREDICTED: kinesin-4-like isoform X1 [Solanum lycopersicum]
Length=995

 Score =   246 bits (629),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQT++EY+G+NGEL+V+NPSKQ KEGRRSFKFN VY P++ QAQV++D
Sbjct  519  CRIRPFLRGQKEKQTVIEYIGENGELVVVNPSKQGKEGRRSFKFNMVYSPASVQAQVYSD  578

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL+QSVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLFRISQ R S
Sbjct  579  IQPLVQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFRISQMRES  638

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  639  TFKYEIKVQMMEIYNEQV  656



>ref|XP_009763270.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
Length=1006

 Score =   246 bits (629),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 111/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQT+VEY+G+NGEL+V+NPS+Q KEGRRSFKFN VY P+ATQAQV++D
Sbjct  533  CRIRPFLRGQKEKQTVVEYIGENGELVVVNPSRQGKEGRRSFKFNTVYSPTATQAQVYSD  592

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQS LDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLFRISQ R S
Sbjct  593  IQPLIQSALDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFRISQMRES  652

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  653  TFKYEIKVQMLEIYNEQV  670



>gb|EPS62917.1| hypothetical protein M569_11869, partial [Genlisea aurea]
Length=929

 Score =   244 bits (624),  Expect = 8e-73, Method: Composition-based stats.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF P QK KQ+IVEY+G+NGELI+MNPSK  KEGRRSFKFN+VYGP ATQA+VFAD
Sbjct  583  CRIRPFHPGQKSKQSIVEYIGENGELIIMNPSKPGKEGRRSFKFNKVYGPPATQAEVFAD  642

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PL+QSVLDGYN+CIFAYGQTGSGKTYTM GPDG TE+ WGVNYRALN+LFRISQ+R  
Sbjct  643  TKPLVQSVLDGYNICIFAYGQTGSGKTYTMMGPDGGTEDEWGVNYRALNNLFRISQSREG  702

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQMVEIYNEQV
Sbjct  703  TFTYEISVQMVEIYNEQV  720



>ref|XP_009605734.1| PREDICTED: kinesin-4-like, partial [Nicotiana tomentosiformis]
Length=822

 Score =   243 bits (620),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+ QT+VEY+G+NGEL+V+NPSKQ KEGRRSFKFN VY P+A QAQV++D
Sbjct  534  CRIRPFLRGQKENQTVVEYIGENGELVVVNPSKQGKEGRRSFKFNTVYSPTAIQAQVYSD  593

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQSVLDG+NVCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLFRISQ R S
Sbjct  594  IQPLIQSVLDGFNVCIFAYGQTGSGKTYTMTGPEGASEEDWGVNYRALNDLFRISQMRES  653

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQV
Sbjct  654  TFKYEIKVQMMEIYNEQV  671



>ref|XP_009606579.1| PREDICTED: kinesin-4-like [Nicotiana tomentosiformis]
Length=1050

 Score =   243 bits (620),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QK+KQ++VEY+G+NGELIV+NPSKQ KEGRRSFKFN+VY P+ATQA+V+ D
Sbjct  676  CRIRPFLRGQKEKQSVVEYIGENGELIVVNPSKQGKEGRRSFKFNKVYSPAATQAEVYTD  735

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTG D ATEEN GVNYRALNDLF ISQ RGS
Sbjct  736  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGADRATEENLGVNYRALNDLFTISQMRGS  795

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQM+EIYNEQV
Sbjct  796  TFTYEITVQMIEIYNEQV  813



>ref|XP_006353799.1| PREDICTED: kinesin-4-like [Solanum tuberosum]
Length=1331

 Score =   243 bits (621),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415   CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
             CR+RPF   QK+KQ++VEY+G+NGELI++NPSKQ KEGRRSFKFN+VY P+ATQA V++D
Sbjct  949   CRIRPFFRGQKEKQSVVEYIGENGELIIVNPSKQGKEGRRSFKFNKVYNPAATQADVYSD  1008

Query  235   IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPD ATEENWGVNYRALND+FRISQ R +
Sbjct  1009  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDKATEENWGVNYRALNDIFRISQMRVN  1068

Query  55    AFSYEVIVQMVEIYNEQV  2
              F+YE+ VQM+EIYNEQV
Sbjct  1069  TFTYEITVQMMEIYNEQV  1086



>gb|EYU26757.1| hypothetical protein MIMGU_mgv1a020027mg, partial [Erythranthe 
guttata]
Length=562

 Score =   234 bits (596),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK K +I EY+GDNG+LIV +P K+ KEG RSFKF++VY P ATQA+VF+D
Sbjct  219  CRIRPFLPGQKRKHSIFEYIGDNGDLIVSDPFKRGKEGFRSFKFDKVYSPEATQAEVFSD  278

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL+QSVLDGYNVCIFAYGQTGSGKTYTM+GPDGATEE WGVNYRALN+ FRISQ+R S
Sbjct  279  TQPLVQSVLDGYNVCIFAYGQTGSGKTYTMSGPDGATEEEWGVNYRALNNFFRISQSRES  338

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQ+VEIYNEQV
Sbjct  339  NFTYEISVQIVEIYNEQV  356



>gb|EYU35383.1| hypothetical protein MIMGU_mgv1a018937mg, partial [Erythranthe 
guttata]
Length=516

 Score =   232 bits (592),  Expect = 9e-71, Method: Composition-based stats.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK K +I EY+GDNG+LIV +P K+ KEG RSFKF++VY P ATQA+VF+D
Sbjct  214  CRIRPFLPGQKRKHSIFEYIGDNGDLIVSDPFKRGKEGFRSFKFDKVYSPEATQAEVFSD  273

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL+QSVLDGYNVCIFAYGQTGSGKTYTM+GPDGATEE WGVN+RALN+ FRISQ+R S
Sbjct  274  TQPLVQSVLDGYNVCIFAYGQTGSGKTYTMSGPDGATEEEWGVNFRALNNFFRISQSRES  333

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YE+ VQ+VEIYNEQV
Sbjct  334  NFTYEISVQIVEIYNEQV  351



>ref|XP_002318552.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE96772.1| kinesin motor family protein [Populus trichocarpa]
Length=847

 Score =   236 bits (603),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 104/138 (75%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT VEY+G+NGE+ V+NPSKQ K+ RR+FKFN+V+GP +TQA+V++D
Sbjct  507  CRIRPFLPGQVAKQTAVEYIGENGEVAVVNPSKQGKDRRRNFKFNKVFGPDSTQAEVYSD  566

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGY+VCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLF+ISQ+RG 
Sbjct  567  TQPLIRSVLDGYSVCIFAYGQTGSGKTYTMTGPNGASEEDWGVNYRALNDLFKISQSRGG  626

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F+YE+ VQMVEIYNEQV
Sbjct  627  SFNYEIQVQMVEIYNEQV  644



>emb|CDO98431.1| unnamed protein product [Coffea canephora]
Length=959

 Score =   236 bits (603),  Expect = 7e-70, Method: Composition-based stats.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q++KQ+ +EYVG+NGELI++NP+KQ KE RRSFKFN+VY  +ATQA+VF+D
Sbjct  530  CRIRPFLPGQREKQSSIEYVGENGELIIVNPAKQGKESRRSFKFNKVYSQAATQAEVFSD  589

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPD A+E+ WGVNYRALN LF+ SQ R  
Sbjct  590  TQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDKASEDEWGVNYRALNHLFQTSQNREH  649

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYE+ VQMVEIYNEQV
Sbjct  650  AFSYEISVQMVEIYNEQV  667



>ref|XP_002318551.2| hypothetical protein POPTR_0012s05330g [Populus trichocarpa]
 gb|EEE96771.2| hypothetical protein POPTR_0012s05330g [Populus trichocarpa]
Length=814

 Score =   235 bits (599),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 104/138 (75%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT VEY+G+NGE+ V+NPSKQ K+ RR+FKFN+V+GP +TQA+V++D
Sbjct  391  CRIRPFLPGQVAKQTAVEYIGENGEVAVVNPSKQGKDRRRNFKFNKVFGPDSTQAEVYSD  450

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGY+VCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLF+ISQ+RG 
Sbjct  451  TQPLIRSVLDGYSVCIFAYGQTGSGKTYTMTGPNGASEEDWGVNYRALNDLFKISQSRGG  510

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F+YE+ VQMVEIYNEQV
Sbjct  511  SFNYEIQVQMVEIYNEQV  528



>ref|XP_010242700.1| PREDICTED: kinesin-4-like isoform X5 [Nelumbo nucifera]
Length=566

 Score =   230 bits (586),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 106/138 (77%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+GDNGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  415  CRIRPFLPGQNGKQTTIEYIGDNGELAVVNPSKQGKDSCRMFKFNKVFGPTATQAEVFLD  474

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ+R S
Sbjct  475  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQSRKS  534

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYEV VQMVEIYNEQV
Sbjct  535  SVSYEVGVQMVEIYNEQV  552



>ref|XP_010242695.1| PREDICTED: kinesin-4-like isoform X1 [Nelumbo nucifera]
Length=696

 Score =   231 bits (590),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 106/138 (77%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+GDNGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  545  CRIRPFLPGQNGKQTTIEYIGDNGELAVVNPSKQGKDSCRMFKFNKVFGPTATQAEVFLD  604

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ+R S
Sbjct  605  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQSRKS  664

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYEV VQMVEIYNEQV
Sbjct  665  SVSYEVGVQMVEIYNEQV  682



>ref|XP_010249559.1| PREDICTED: kinesin-4-like isoform X5 [Nelumbo nucifera]
Length=1097

 Score =   233 bits (593),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  508  CRIRPFLPGQNGKQTTIEYIGENGELGVVNPSKQGKDSHRMFKFNKVFGPTATQAEVFLD  567

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ R  
Sbjct  568  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQNRKG  627

Query  55   AFSYEVIVQMVEIYNEQV  2
            +FSYEV VQMVEIYNEQV
Sbjct  628  SFSYEVGVQMVEIYNEQV  645



>ref|XP_010249532.1| PREDICTED: kinesin-4-like isoform X2 [Nelumbo nucifera]
Length=1125

 Score =   233 bits (594),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  536  CRIRPFLPGQNGKQTTIEYIGENGELGVVNPSKQGKDSHRMFKFNKVFGPTATQAEVFLD  595

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ R  
Sbjct  596  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQNRKG  655

Query  55   AFSYEVIVQMVEIYNEQV  2
            +FSYEV VQMVEIYNEQV
Sbjct  656  SFSYEVGVQMVEIYNEQV  673



>ref|XP_010249516.1| PREDICTED: kinesin-4-like isoform X1 [Nelumbo nucifera]
 ref|XP_010249524.1| PREDICTED: kinesin-4-like isoform X1 [Nelumbo nucifera]
Length=1134

 Score =   233 bits (593),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  545  CRIRPFLPGQNGKQTTIEYIGENGELGVVNPSKQGKDSHRMFKFNKVFGPTATQAEVFLD  604

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ R  
Sbjct  605  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQNRKG  664

Query  55   AFSYEVIVQMVEIYNEQV  2
            +FSYEV VQMVEIYNEQV
Sbjct  665  SFSYEVGVQMVEIYNEQV  682



>ref|XP_010249541.1| PREDICTED: kinesin-4-like isoform X3 [Nelumbo nucifera]
Length=1114

 Score =   233 bits (593),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  545  CRIRPFLPGQNGKQTTIEYIGENGELGVVNPSKQGKDSHRMFKFNKVFGPTATQAEVFLD  604

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ R  
Sbjct  605  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQNRKG  664

Query  55   AFSYEVIVQMVEIYNEQV  2
            +FSYEV VQMVEIYNEQV
Sbjct  665  SFSYEVGVQMVEIYNEQV  682



>ref|XP_010249550.1| PREDICTED: kinesin-4-like isoform X4 [Nelumbo nucifera]
Length=1107

 Score =   233 bits (593),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  518  CRIRPFLPGQNGKQTTIEYIGENGELGVVNPSKQGKDSHRMFKFNKVFGPTATQAEVFLD  577

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ R  
Sbjct  578  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQNRKG  637

Query  55   AFSYEVIVQMVEIYNEQV  2
            +FSYEV VQMVEIYNEQV
Sbjct  638  SFSYEVGVQMVEIYNEQV  655



>ref|XP_010243529.1| PREDICTED: kinesin KP1-like, partial [Nelumbo nucifera]
Length=905

 Score =   231 bits (589),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V+NPSKQ K+  R FKFN+V+GP+ATQ +VF D
Sbjct  329  CRIRPFLPGQNRKQTTIEYIGENGELVVVNPSKQGKDSHRLFKFNKVFGPTATQEEVFLD  388

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYN+CIFAYGQTGSGKTYTM+GPD + +E+WGVNYRALNDLF+ISQ R  
Sbjct  389  TQPLIRSVLDGYNICIFAYGQTGSGKTYTMSGPDASCKEDWGVNYRALNDLFQISQKRRG  448

Query  55   AFSYEVIVQMVEIYNEQV  2
            +FSYEV VQMVEIYNEQV
Sbjct  449  SFSYEVGVQMVEIYNEQV  466



>ref|XP_011005503.1| PREDICTED: kinesin KP1-like [Populus euphratica]
Length=847

 Score =   231 bits (588),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT VEY+G+NGE+ V+NPSKQ K+ RR+FKFN+V+GP +TQA+V++D
Sbjct  507  CRIRPFLPGQVAKQTAVEYIGENGEVAVVNPSKQGKDRRRNFKFNKVFGPDSTQAEVYSD  566

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDG++VCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLF+IS +RG 
Sbjct  567  TQPLIRSVLDGFSVCIFAYGQTGSGKTYTMTGPNGASEEDWGVNYRALNDLFKISLSRGG  626

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F+YE+ VQMVEIYNEQV
Sbjct  627  SFNYEIQVQMVEIYNEQV  644



>ref|XP_011045866.1| PREDICTED: kinesin KP1-like [Populus euphratica]
Length=847

 Score =   231 bits (588),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT VEY+G+NGE+ V+NPSKQ K+ RR+FKFN+V+GP +TQA+V++D
Sbjct  507  CRIRPFLPGQVAKQTAVEYIGENGEVAVVNPSKQGKDRRRNFKFNKVFGPDSTQAEVYSD  566

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDG++VCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLF+IS +RG 
Sbjct  567  TQPLIRSVLDGFSVCIFAYGQTGSGKTYTMTGPNGASEEDWGVNYRALNDLFKISLSRGG  626

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F+YE+ VQMVEIYNEQV
Sbjct  627  SFNYEIQVQMVEIYNEQV  644



>ref|XP_010249569.1| PREDICTED: kinesin KP1-like isoform X6 [Nelumbo nucifera]
Length=965

 Score =   231 bits (589),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL V+NPSKQ K+  R FKFN+V+GP+ATQA+VF D
Sbjct  376  CRIRPFLPGQNGKQTTIEYIGENGELGVVNPSKQGKDSHRMFKFNKVFGPTATQAEVFLD  435

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTMTGPD A +E+WGVNYRALNDLF ISQ R  
Sbjct  436  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMTGPDAARKEDWGVNYRALNDLFEISQNRKG  495

Query  55   AFSYEVIVQMVEIYNEQV  2
            +FSYEV VQMVEIYNEQV
Sbjct  496  SFSYEVGVQMVEIYNEQV  513



>gb|KDO57448.1| hypothetical protein CISIN_1g042277mg, partial [Citrus sinensis]
Length=899

 Score =   229 bits (585),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGELI  NPSK  K+G+R FKFN+V+GP ATQA+VF+D
Sbjct  506  CRIRPFLPGQTKKQTTIEYIGENGELIFGNPSKPGKDGQRMFKFNKVFGPDATQAEVFSD  565

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP G  EE+WGVNYRALNDLF +SQ R S
Sbjct  566  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSGPHEEDWGVNYRALNDLFNLSQNRRS  625

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  626  SIMYEVAVQMVEIYNEQV  643



>ref|XP_007036524.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH domain, putative [Theobroma cacao]
 gb|EOY21025.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH domain, putative [Theobroma cacao]
Length=979

 Score =   229 bits (583),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQTI+E +G+NG+L++ NPSK  K+G+RSFKFN+V+GP+ATQ +VF D
Sbjct  490  CRIRPFLPGQTGKQTIIENIGENGQLVIANPSKPGKDGQRSFKFNKVFGPAATQGEVFQD  549

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQP +QSV+DGYNVCIFAYGQTGSGKTYTMTGP+GATEE WGVNYRALN LF+ISQ R S
Sbjct  550  IQPFVQSVVDGYNVCIFAYGQTGSGKTYTMTGPNGATEEEWGVNYRALNCLFKISQNRRS  609

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  610  TILYEVGVQMVEIYNEQV  627



>ref|XP_006485789.1| PREDICTED: kinesin-4-like isoform X1 [Citrus sinensis]
Length=905

 Score =   228 bits (581),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGELI  NPSK  K+G+R FKFN+V+GP ATQA+VF+D
Sbjct  519  CRIRPFLPGQTKKQTTIEYIGENGELIFGNPSKPGKDGQRMFKFNKVFGPDATQAEVFSD  578

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP G  EE+WGVNYRALNDLF +SQ R S
Sbjct  579  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSGPHEEDWGVNYRALNDLFNLSQNRRS  638

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  639  SIMYEVAVQMVEIYNEQV  656



>ref|XP_006440967.1| hypothetical protein CICLE_v10023895mg, partial [Citrus clementina]
 gb|ESR54207.1| hypothetical protein CICLE_v10023895mg, partial [Citrus clementina]
Length=819

 Score =   227 bits (578),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGELI  NPSK  K+G+R FKFN+V+GP ATQA+VF+D
Sbjct  452  CRIRPFLPGQTKQQTTIEYIGENGELIFANPSKPGKDGQRMFKFNKVFGPDATQAEVFSD  511

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S LDGYNVCIFAYGQTGSGKTYTM+GP G  EE+WGVNYRALNDLF +SQ R S
Sbjct  512  TQPLIRSALDGYNVCIFAYGQTGSGKTYTMSGPSGPHEEDWGVNYRALNDLFNLSQNRRS  571

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  572  SIMYEVAVQMVEIYNEQV  589



>ref|XP_008443607.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103487162 
[Cucumis melo]
Length=1377

 Score =   230 bits (586),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QKDK+  +EY+G+NGE+++ NP+K  KEG + FKFN+VY P++TQ +VF+D
Sbjct  823  CRIRPFLTGQKDKRMTIEYIGENGEVVIANPTKPGKEGHKLFKFNKVYSPASTQGEVFSD  882

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+GAT+ENWGVNYRALNDLF ISQ R  
Sbjct  883  IQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGATKENWGVNYRALNDLFEISQNRSG  942

Query  55   AFSYEVIVQMVEIYNEQV  2
            A SYEV  QMVE+YNEQV
Sbjct  943  AISYEVGAQMVEVYNEQV  960



>ref|XP_002893001.1| hypothetical protein ARALYDRAFT_335100 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69260.1| hypothetical protein ARALYDRAFT_335100 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   228 bits (580),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q   +T+VE++GD+GEL+V+NP+K  K+G R FKFN+VY P++TQA+VF+D
Sbjct  489  CRVRPFLRGQGASKTVVEHIGDHGELVVLNPTKPGKDGLRKFKFNKVYSPASTQAEVFSD  548

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQTR S
Sbjct  549  IKPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQTRKS  608

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  609  NIAYEVGVQMVEIYNEQV  626



>ref|XP_009348139.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-4 [Pyrus x bretschneideri]
Length=932

 Score =   227 bits (578),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +K+K+T+VE +G+NGEL+V + SK  KEG R FKFN VYG  ATQA+V+AD
Sbjct  512  CRIRPFLPGEKEKKTLVERIGENGELVVADRSKPGKEGHRLFKFNEVYGSDATQAKVYAD  571

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+G+T+ENWG+NYRALNDLF ISQ R S
Sbjct  572  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGSTKENWGINYRALNDLFDISQRRQS  631

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  632  SITYEIQVQMVEIYNEQV  649



>emb|CDY19209.1| BnaC05g14100D [Brassica napus]
Length=933

 Score =   227 bits (578),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VE++G++GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  402  CRVRPFLPGQGASNTVVEHIGEHGELVVLNPTKPGKDGLRKFRFNKVYSPASTQAEVFSD  461

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  462  IKPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  521

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  522  NIAYEVGVQMVEIYNEQV  539



>ref|XP_008804600.1| PREDICTED: kinesin-4-like [Phoenix dactylifera]
Length=1010

 Score =   227 bits (578),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  + T ++++G+NGEL++ NPSKQ K+G R FKFN+VY P+ATQA+VF D
Sbjct  503  CRIRPFLPGQNKRSTTIDFIGENGELLIANPSKQGKDGHRMFKFNKVYSPAATQAEVFLD  562

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+  ++E WGVNYRALNDLF IS+ R S
Sbjct  563  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNSVSKEYWGVNYRALNDLFDISRNRRS  622

Query  55   AFSYEVIVQMVEIYNEQV  2
             FSYEV VQMVEIYNEQV
Sbjct  623  TFSYEVGVQMVEIYNEQV  640



>gb|AAF25983.1|AC013354_2 F15H18.10 [Arabidopsis thaliana]
Length=1162

 Score =   228 bits (580),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q   +T+VE++GD+GEL+V+NP+K  K+  R F+FN+VY P++TQA+VF+D
Sbjct  626  CRVRPFLRGQGASKTVVEHIGDHGELVVLNPTKPGKDAHRKFRFNKVYSPASTQAEVFSD  685

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLFRISQ+R S
Sbjct  686  IKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFRISQSRKS  745

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  746  NIAYEVGVQMVEIYNEQV  763



>emb|CDY26163.1| BnaA06g12540D [Brassica napus]
Length=1088

 Score =   226 bits (577),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VE++G++GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  557  CRVRPFLPGQGASNTVVEHIGEHGELVVLNPTKPGKDGLRKFRFNKVYSPASTQAEVFSD  616

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  617  IKPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  676

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  677  NIAYEVGVQMVEIYNEQV  694



>ref|XP_010459454.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=994

 Score =   226 bits (575),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q    T+VE++GD+GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  472  CRVRPFLRGQGAANTVVEHIGDHGELVVLNPTKPGKDGLRKFRFNKVYSPASTQAEVFSD  531

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  532  IKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  591

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  592  NIAYEVGVQMVEIYNEQV  609



>ref|XP_002321471.2| hypothetical protein POPTR_0015s03640g, partial [Populus trichocarpa]
 gb|EEF05598.2| hypothetical protein POPTR_0015s03640g, partial [Populus trichocarpa]
Length=965

 Score =   225 bits (574),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP   +K T VEY+G++GEL V+NPSKQ K+ RR+FKFN+V+GP +TQA+V++D
Sbjct  512  CRIRPFLPGHGEKHTTVEYIGEHGELAVVNPSKQGKDRRRNFKFNKVFGPDSTQAEVYSD  571

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGY+VCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLF ISQ R  
Sbjct  572  TQPLIRSVLDGYSVCIFAYGQTGSGKTYTMTGPNGASEEDWGVNYRALNDLFSISQNRRD  631

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  632  SLIYEIQVQMVEIYNEQV  649



>ref|XP_009149282.1| PREDICTED: kinesin-2 [Brassica rapa]
Length=1091

 Score =   226 bits (576),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VE++G++GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  572  CRVRPFLPGQGASNTVVEHIGEHGELVVLNPTKPGKDGLRKFRFNKVYSPASTQAEVFSD  631

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  632  IKPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  691

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  692  NIAYEVGVQMVEIYNEQV  709



>ref|XP_010459455.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
 ref|XP_010459456.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=986

 Score =   225 bits (574),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q    T+VE++GD+GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  464  CRVRPFLRGQGAANTVVEHIGDHGELVVLNPTKPGKDGLRKFRFNKVYSPASTQAEVFSD  523

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  524  IKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  583

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  584  NIAYEVGVQMVEIYNEQV  601



>gb|AFW76522.1| hypothetical protein ZEAMMB73_429262, partial [Zea mays]
Length=501

 Score =   219 bits (557),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF+P +  K T ++YVGDNG+LI+ NP++  KEG +SFKFN+V+GP+ +Q  VF D
Sbjct  355  CRIRPFIPGEDQKSTTIKYVGDNGDLIIANPTRHGKEGSKSFKFNKVFGPTTSQDDVFKD  414

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE  WGVNYRALNDLF IS  RG 
Sbjct  415  IEPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATENEWGVNYRALNDLFHISHNRGD  474

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQM+EIYNEQ+
Sbjct  475  TIMYEINVQMIEIYNEQI  492



>ref|XP_010537451.1| PREDICTED: kinesin-4-like isoform X3 [Tarenaya hassleriana]
Length=928

 Score =   224 bits (572),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q ++ T+ EY+G +GEL+V NP++  K+G R F+FN+VY P++TQA+VF+D
Sbjct  426  CRVRPFLPGQSEQNTVTEYIGKDGELVVTNPTRPGKDGLRQFRFNKVYSPASTQAEVFSD  485

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            ++PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPDGATEE WGVNYRALNDLF ISQ+R S
Sbjct  486  VKPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDGATEEEWGVNYRALNDLFSISQSRKS  545

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  546  TITYEVGVQMVEIYNEQV  563



>ref|XP_010471464.1| PREDICTED: kinesin-4 [Camelina sativa]
Length=1031

 Score =   225 bits (574),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+ATQA VF+D
Sbjct  515  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPAATQADVFSD  574

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  575  IRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKG  634

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQV
Sbjct  635  NISYEVGVQMVEIYNEQV  652



>ref|XP_010537450.1| PREDICTED: kinesin-4-like isoform X2 [Tarenaya hassleriana]
Length=943

 Score =   224 bits (572),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q ++ T+ EY+G +GEL+V NP++  K+G R F+FN+VY P++TQA+VF+D
Sbjct  443  CRVRPFLPGQSEQNTVTEYIGKDGELVVTNPTRPGKDGLRQFRFNKVYSPASTQAEVFSD  502

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            ++PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPDGATEE WGVNYRALNDLF ISQ+R S
Sbjct  503  VKPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDGATEEEWGVNYRALNDLFSISQSRKS  562

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  563  TITYEVGVQMVEIYNEQV  580



>ref|XP_010537447.1| PREDICTED: kinesin-4-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010537448.1| PREDICTED: kinesin-4-like isoform X1 [Tarenaya hassleriana]
Length=945

 Score =   224 bits (572),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q ++ T+ EY+G +GEL+V NP++  K+G R F+FN+VY P++TQA+VF+D
Sbjct  443  CRVRPFLPGQSEQNTVTEYIGKDGELVVTNPTRPGKDGLRQFRFNKVYSPASTQAEVFSD  502

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            ++PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPDGATEE WGVNYRALNDLF ISQ+R S
Sbjct  503  VKPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDGATEEEWGVNYRALNDLFSISQSRKS  562

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  563  TITYEVGVQMVEIYNEQV  580



>ref|XP_010416204.1| PREDICTED: kinesin-4-like [Camelina sativa]
 ref|XP_010416205.1| PREDICTED: kinesin-4-like [Camelina sativa]
Length=1031

 Score =   225 bits (573),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+ATQA VF+D
Sbjct  515  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPAATQADVFSD  574

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  575  IRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKG  634

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQV
Sbjct  635  NISYEVGVQMVEIYNEQV  652



>ref|XP_011013061.1| PREDICTED: kinesin-4-like isoform X2 [Populus euphratica]
Length=888

 Score =   224 bits (571),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP   +K + VEY+G++GEL V+NPSKQ K+ RR+FKFN+V+GP +TQA+V++D
Sbjct  511  CRIRPFLPGHGEKHSTVEYIGEHGELTVVNPSKQGKDRRRNFKFNKVFGPDSTQAEVYSD  570

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGY+VCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLF ISQ R  
Sbjct  571  TQPLIRSVLDGYSVCIFAYGQTGSGKTYTMTGPNGASEEDWGVNYRALNDLFSISQNRRD  630

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  631  SLIYEIQVQMVEIYNEQV  648



>gb|KCW83857.1| hypothetical protein EUGRSUZ_B00722 [Eucalyptus grandis]
Length=939

 Score =   224 bits (571),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RP LP Q  KQ+I+E++GD+G+L+V NPSKQ K+G R FKFN+VYGP+A+Q  V++D
Sbjct  489  CRIRPLLPGQSGKQSIIEHIGDDGQLVVTNPSKQGKDGHRMFKFNKVYGPAASQEMVYSD  548

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQP I+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ATEE+WGVNYRALNDLF +S++R  
Sbjct  549  IQPFIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGAATEESWGVNYRALNDLFNLSESRSR  608

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YE+ VQMVEIYNEQV
Sbjct  609  AIVYEIWVQMVEIYNEQV  626



>ref|NP_173277.2| kinesin motor domain-containing protein [Arabidopsis thaliana]
 gb|AEE29712.1| kinesin motor domain-containing protein [Arabidopsis thaliana]
Length=1140

 Score =   226 bits (575),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q   +T+VE++GD+GEL+V+NP+K  K+  R F+FN+VY P++TQA+VF+D
Sbjct  637  CRVRPFLRGQGASKTVVEHIGDHGELVVLNPTKPGKDAHRKFRFNKVYSPASTQAEVFSD  696

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLFRISQ+R S
Sbjct  697  IKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFRISQSRKS  756

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  757  NIAYEVGVQMVEIYNEQV  774



>ref|XP_010477019.1| PREDICTED: carboxy-terminal kinesin 2-like [Camelina sativa]
Length=1009

 Score =   224 bits (571),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q    T+VE++GD+GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  485  CRVRPFLRGQGAANTVVEHIGDHGELVVLNPTKPGKDGLRKFRFNKVYSPASTQAEVFSD  544

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            ++PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  545  VKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  604

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  605  NIAYEVGVQMVEIYNEQV  622



>ref|XP_004301828.1| PREDICTED: kinesin-4-like [Fragaria vesca subsp. vesca]
Length=1069

 Score =   225 bits (573),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QKDK+T+VE +GDNGEL+V + SK  K+G R FKFN+VYG  ATQAQV+ D
Sbjct  603  CRIRPFLPGQKDKRTLVEQIGDNGELVVADHSKPGKDGHRLFKFNKVYGSDATQAQVYTD  662

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QP I+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ AT+ENWGVNYRALNDLF ISQ R S
Sbjct  663  TQPFIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNKATKENWGVNYRALNDLFDISQKRKS  722

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQM+EIYNEQV
Sbjct  723  SILYEIGVQMIEIYNEQV  740



>ref|XP_007210907.1| hypothetical protein PRUPE_ppa000796mg [Prunus persica]
 gb|EMJ12106.1| hypothetical protein PRUPE_ppa000796mg [Prunus persica]
Length=1000

 Score =   224 bits (571),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT VEYVG+NG+++V NPSKQ K+ RR FKFN+V+GP+ATQ +VF D
Sbjct  433  CRIRPFLPGQSQKQTTVEYVGENGDIVVANPSKQGKDSRRLFKFNKVFGPAATQEEVFLD  492

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ ++WGVNYRALNDLF+ISQ+R S
Sbjct  493  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSVSSTDDWGVNYRALNDLFQISQSRES  552

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YEV VQMVEIYNEQV
Sbjct  553  SIAYEVGVQMVEIYNEQV  570



>ref|XP_010915519.1| PREDICTED: kinesin-4-like [Elaeis guineensis]
Length=1031

 Score =   224 bits (571),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  + T +++VG+NGEL++ NPSKQ K+G R FKFN+VY P+ATQA+VF D
Sbjct  508  CRIRPFLPGQNKRSTTIDFVGENGELLIANPSKQGKDGHRMFKFNKVYSPAATQAEVFLD  567

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+  ++E WGVNYRALNDLF IS+ R +
Sbjct  568  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNSVSKEYWGVNYRALNDLFDISRNRRN  627

Query  55   AFSYEVIVQMVEIYNEQV  2
             FSYEV VQMVEIYNEQV
Sbjct  628  TFSYEVGVQMVEIYNEQV  645



>ref|XP_002304498.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE79477.1| kinesin motor family protein [Populus trichocarpa]
Length=1133

 Score =   225 bits (573),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K+T VEY+G+NGEL++ NPSKQ K+  R FKFN+V+GP+ATQ +VF D
Sbjct  511  CRIRPFLPGQSKKRTTVEYIGENGELVISNPSKQGKDSHRLFKFNKVFGPAATQEEVFLD  570

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  571  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNITSQEDWGVNYRALHDLFQISQHRKS  630

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYEV VQMVEIYNEQV
Sbjct  631  SISYEVGVQMVEIYNEQV  648



>ref|XP_010031995.1| PREDICTED: kinesin-4 isoform X2 [Eucalyptus grandis]
Length=1040

 Score =   224 bits (570),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RP LP Q  KQ+I+E++GD+G+L+V NPSKQ K+G R FKFN+VYGP+A+Q  V++D
Sbjct  535  CRIRPLLPGQSGKQSIIEHIGDDGQLVVTNPSKQGKDGHRMFKFNKVYGPAASQEMVYSD  594

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQP I+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ATEE+WGVNYRALNDLF +S++R  
Sbjct  595  IQPFIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGAATEESWGVNYRALNDLFNLSESRSR  654

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YE+ VQMVEIYNEQV
Sbjct  655  AIVYEIWVQMVEIYNEQV  672



>ref|XP_010031985.1| PREDICTED: kinesin-4 isoform X1 [Eucalyptus grandis]
Length=1044

 Score =   224 bits (570),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RP LP Q  KQ+I+E++GD+G+L+V NPSKQ K+G R FKFN+VYGP+A+Q  V++D
Sbjct  539  CRIRPLLPGQSGKQSIIEHIGDDGQLVVTNPSKQGKDGHRMFKFNKVYGPAASQEMVYSD  598

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQP I+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ATEE+WGVNYRALNDLF +S++R  
Sbjct  599  IQPFIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGAATEESWGVNYRALNDLFNLSESRSR  658

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YE+ VQMVEIYNEQV
Sbjct  659  AIVYEIWVQMVEIYNEQV  676



>gb|AAG52083.1|AC012679_21 kinesin-related protein; 103921-99132 [Arabidopsis thaliana]
Length=1050

 Score =   224 bits (570),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+A+QA VF+D
Sbjct  534  CRVRPFLPAQGAANTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPTASQADVFSD  593

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDG++EE+WGVNYRALNDLF+ISQ+R  
Sbjct  594  IRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGSSEEDWGVNYRALNDLFKISQSRKG  653

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQV
Sbjct  654  NISYEVGVQMVEIYNEQV  671



>emb|CBI15451.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   223 bits (568),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  KQT +EY+G++GEL ++NPSKQ K+  R FKFN+VYGP+ATQA+VF+D
Sbjct  444  CRIRPFLRGQNGKQTTIEYIGEDGELGIVNPSKQGKDSHRLFKFNKVYGPAATQAEVFSD  503

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+ A++E WGVNYRAL+DLF I+Q+R S
Sbjct  504  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNAASKEEWGVNYRALSDLFEITQSRRS  563

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F YE+ VQMVEIYNEQV
Sbjct  564  SFMYEIGVQMVEIYNEQV  581



>ref|XP_002298032.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE82837.2| kinesin motor family protein [Populus trichocarpa]
Length=1018

 Score =   223 bits (569),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K+T VEY+G+NGEL++ NPSKQ K+  R FK N+V+GP+ATQ +VF D
Sbjct  462  CRIRPFLPGQSKKRTTVEYIGENGELVISNPSKQGKDSHRLFKLNKVFGPAATQEEVFLD  521

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  522  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNMTSQEDWGVNYRALHDLFQISQNRKS  581

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYEV VQMVEIYNEQV
Sbjct  582  SISYEVGVQMVEIYNEQV  599



>gb|AAG52533.1|AC016662_27 putative kinesin; 97201-101676 [Arabidopsis thaliana]
Length=987

 Score =   223 bits (569),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+A+QA VF+D
Sbjct  504  CRVRPFLPAQGAANTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPTASQADVFSD  563

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDG++EE+WGVNYRALNDLF+ISQ+R  
Sbjct  564  IRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGSSEEDWGVNYRALNDLFKISQSRKG  623

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQV
Sbjct  624  NISYEVGVQMVEIYNEQV  641



>gb|AFW76521.1| hypothetical protein ZEAMMB73_429262, partial [Zea mays]
Length=777

 Score =   222 bits (565),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF+P +  K T ++YVGDNG+LI+ NP++  KEG +SFKFN+V+GP+ +Q  VF D
Sbjct  631  CRIRPFIPGEDQKSTTIKYVGDNGDLIIANPTRHGKEGSKSFKFNKVFGPTTSQDDVFKD  690

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE  WGVNYRALNDLF IS  RG 
Sbjct  691  IEPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATENEWGVNYRALNDLFHISHNRGD  750

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQM+EIYNEQ+
Sbjct  751  TIMYEINVQMIEIYNEQI  768



>ref|XP_008238831.1| PREDICTED: kinesin-4 [Prunus mume]
 ref|XP_008238832.1| PREDICTED: kinesin-4 [Prunus mume]
Length=1194

 Score =   224 bits (572),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EYVG+NG+++V NPSKQ K+ RR FKFN+V+GP+ATQ +VF D
Sbjct  533  CRIRPFLPGQSQKQTTIEYVGENGDIVVANPSKQGKDSRRLFKFNKVFGPAATQEEVFLD  592

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ ++WGVNYRALNDLF+ISQ+R S
Sbjct  593  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSVSSTDDWGVNYRALNDLFQISQSRES  652

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YEV VQMVEIYNEQV
Sbjct  653  SIAYEVGVQMVEIYNEQV  670



>ref|XP_011013060.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
Length=1050

 Score =   223 bits (569),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP   +K + VEY+G++GEL V+NPSKQ K+ RR+FKFN+V+GP +TQA+V++D
Sbjct  511  CRIRPFLPGHGEKHSTVEYIGEHGELTVVNPSKQGKDRRRNFKFNKVFGPDSTQAEVYSD  570

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGY+VCIFAYGQTGSGKTYTMTGP+GA+EE+WGVNYRALNDLF ISQ R  
Sbjct  571  TQPLIRSVLDGYSVCIFAYGQTGSGKTYTMTGPNGASEEDWGVNYRALNDLFSISQNRRD  630

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  631  SLIYEIQVQMVEIYNEQV  648



>ref|XP_006301495.1| hypothetical protein CARUB_v10021921mg [Capsella rubella]
 gb|EOA34393.1| hypothetical protein CARUB_v10021921mg [Capsella rubella]
Length=1041

 Score =   223 bits (569),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+ATQA VF+D
Sbjct  514  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPTATQADVFSD  573

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++S LDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  574  IRPLVRSALDGYNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKG  633

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQ+
Sbjct  634  NISYEVGVQMVEIYNEQI  651



>ref|XP_008650465.1| PREDICTED: kinesin-4-like [Zea mays]
Length=789

 Score =   222 bits (565),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF+P +  K T ++YVGDNG+LI+ NP++  KEG +SFKFN+V+GP+ +Q  VF D
Sbjct  632  CRIRPFIPGEDQKSTTIKYVGDNGDLIIANPTRHGKEGSKSFKFNKVFGPTTSQDDVFKD  691

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE  WGVNYRALNDLF IS  RG 
Sbjct  692  IEPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATENEWGVNYRALNDLFHISHNRGD  751

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQM+EIYNEQ+
Sbjct  752  TIMYEINVQMIEIYNEQI  769



>ref|XP_009397984.1| PREDICTED: kinesin-4-like [Musa acuminata subsp. malaccensis]
 ref|XP_009397987.1| PREDICTED: kinesin-4-like [Musa acuminata subsp. malaccensis]
Length=1104

 Score =   224 bits (570),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  KQT  EY+GDNGEL++ NPSKQ K+ +R FKFN+V+GP+ATQ +VF D
Sbjct  539  CRIRPFLPGENVKQTTTEYIGDNGELLIANPSKQGKDVQRMFKFNKVFGPAATQEEVFLD  598

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP  ATE+ WGVNYRALNDLF IS  R  
Sbjct  599  IQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPHSATEKEWGVNYRALNDLFHISWNRRD  658

Query  55   AFSYEVIVQMVEIYNEQV  2
            A+ YEV VQMVEIYNEQV
Sbjct  659  AYVYEVCVQMVEIYNEQV  676



>emb|CDX68208.1| BnaA07g22480D [Brassica napus]
Length=1012

 Score =   223 bits (568),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP+K  K+G R F+FN+VY P+ATQA+VF D
Sbjct  502  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTKPGKDGLRKFRFNKVYSPAATQAEVFTD  561

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  562  IKPLVRSVLDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKG  621

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  622  NINYEVGVQMVEIYNEQV  639



>ref|NP_177527.3| putative Kinesin motor protein-related protein [Arabidopsis thaliana]
 dbj|BAF01431.1| kinesin-related protein [Arabidopsis thaliana]
 gb|AEE35517.1| putative Kinesin motor protein-related protein [Arabidopsis thaliana]
Length=1025

 Score =   223 bits (569),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+A+QA VF+D
Sbjct  514  CRVRPFLPAQGAANTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPTASQADVFSD  573

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDG++EE+WGVNYRALNDLF+ISQ+R  
Sbjct  574  IRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGSSEEDWGVNYRALNDLFKISQSRKG  633

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQV
Sbjct  634  NISYEVGVQMVEIYNEQV  651



>emb|CDY11085.1| BnaC06g23370D [Brassica napus]
Length=1012

 Score =   223 bits (568),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R F+FN+VY P+ATQA+VF D
Sbjct  502  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTRPGKDGLRKFRFNKVYSPAATQAEVFTD  561

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  562  IKPLVRSVLDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKG  621

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  622  NINYEVGVQMVEIYNEQV  639



>ref|XP_008346792.1| PREDICTED: kinesin-4-like [Malus domestica]
Length=977

 Score =   223 bits (567),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +K+K+T+VE +G+NGEL+V + SK  KEG R FKFN VYG  A+Q +V+AD
Sbjct  585  CRIRPFLPGEKEKKTLVERIGENGELVVADRSKPGKEGHRLFKFNEVYGSDASQGEVYAD  644

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+G+T+ENWG+NYRALNDLF ISQ R S
Sbjct  645  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGSTKENWGINYRALNDLFDISQRRKS  704

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  705  SITYEIRVQMVEIYNEQV  722



>ref|XP_006390498.1| hypothetical protein EUTSA_v10018060mg [Eutrema salsugineum]
 gb|ESQ27784.1| hypothetical protein EUTSA_v10018060mg [Eutrema salsugineum]
Length=1027

 Score =   223 bits (567),  Expect = 7e-65, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP+K  K+G R FKFN+VY P+ATQA+VF+D
Sbjct  517  CRVRPFLPGQGGANTVVEYVGEDGELVVTNPTKLGKDGLRQFKFNKVYSPNATQAEVFSD  576

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTM+GPDGA+EE+WGVNYRALNDLF+ISQ R  
Sbjct  577  IKPLVRSVLDGYNVCIFAYGQTGSGKTYTMSGPDGASEEDWGVNYRALNDLFKISQFRKG  636

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  637  NINYEVGVQMVEIYNEQV  654



>ref|XP_011029282.1| PREDICTED: kinesin-4 isoform X2 [Populus euphratica]
Length=1098

 Score =   223 bits (569),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K+T VEY+G+NGEL++ NPSKQ K+  R FK N+V+GP+ATQ +VF D
Sbjct  503  CRIRPFLPGQSKKRTTVEYIGENGELVISNPSKQGKDSHRLFKLNKVFGPAATQEEVFLD  562

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  563  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNMTSQEDWGVNYRALHDLFQISQNRKS  622

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYEV VQMVEIYNEQV
Sbjct  623  SISYEVGVQMVEIYNEQV  640



>ref|XP_010428332.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=1025

 Score =   223 bits (567),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+ATQA VF+D
Sbjct  516  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPAATQADVFSD  575

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPD A+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  576  IRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDNASEEDWGVNYRALNDLFKISQSRKG  635

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQV
Sbjct  636  NISYEVGVQMVEIYNEQV  653



>ref|XP_010428329.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
 ref|XP_010428330.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
 ref|XP_010428331.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=1032

 Score =   223 bits (567),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R FKFN+VY P+ATQA VF+D
Sbjct  516  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTRPGKDGLRQFKFNKVYSPAATQADVFSD  575

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPD A+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  576  IRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDNASEEDWGVNYRALNDLFKISQSRKG  635

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQMVEIYNEQV
Sbjct  636  NISYEVGVQMVEIYNEQV  653



>ref|XP_011029283.1| PREDICTED: kinesin-4 isoform X3 [Populus euphratica]
Length=1098

 Score =   223 bits (568),  Expect = 9e-65, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K+T VEY+G+NGEL++ NPSKQ K+  R FK N+V+GP+ATQ +VF D
Sbjct  504  CRIRPFLPGQSKKRTTVEYIGENGELVISNPSKQGKDSHRLFKLNKVFGPAATQEEVFLD  563

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  564  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNMTSQEDWGVNYRALHDLFQISQNRKS  623

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYEV VQMVEIYNEQV
Sbjct  624  SISYEVGVQMVEIYNEQV  641



>ref|XP_011029280.1| PREDICTED: kinesin-4 isoform X1 [Populus euphratica]
 ref|XP_011029281.1| PREDICTED: kinesin-4 isoform X1 [Populus euphratica]
Length=1099

 Score =   223 bits (568),  Expect = 9e-65, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K+T VEY+G+NGEL++ NPSKQ K+  R FK N+V+GP+ATQ +VF D
Sbjct  504  CRIRPFLPGQSKKRTTVEYIGENGELVISNPSKQGKDSHRLFKLNKVFGPAATQEEVFLD  563

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  564  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNMTSQEDWGVNYRALHDLFQISQNRKS  623

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYEV VQMVEIYNEQV
Sbjct  624  SISYEVGVQMVEIYNEQV  641



>ref|XP_002532147.1| kinesin heavy chain, putative [Ricinus communis]
 gb|EEF30221.1| kinesin heavy chain, putative [Ricinus communis]
Length=892

 Score =   222 bits (565),  Expect = 9e-65, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RP L +   K T +E++G+NGELIV NPSKQ K+G R F+FN VYG  +TQA+VF+D
Sbjct  376  CRIRPLLKEHAGKNTTIEHIGENGELIVANPSKQGKDGHRLFRFNIVYGSDSTQAEVFSD  435

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEE WGVNYRALNDLF ISQ R +
Sbjct  436  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEEEWGVNYRALNDLFNISQRRST  495

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F YEV VQM EIYNEQ+
Sbjct  496  SFMYEVGVQMFEIYNEQL  513



>emb|CDX73023.1| BnaC06g34710D [Brassica napus]
Length=895

 Score =   222 bits (565),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VE+VG++GEL+V NP++Q K+G R F+FN+VY P+ATQA+VF+D
Sbjct  439  CRVRPFLPGQGTPNTVVEHVGEDGELVVTNPTRQGKDGLRQFRFNKVYSPNATQAEVFSD  498

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  499  IKPLVRSVLDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKG  558

Query  55   AFSYEVIVQMVEIYNEQV  2
              +Y+V VQMVEIYNEQV
Sbjct  559  NINYDVGVQMVEIYNEQV  576



>ref|XP_007209035.1| hypothetical protein PRUPE_ppa014950mg, partial [Prunus persica]
 gb|EMJ10234.1| hypothetical protein PRUPE_ppa014950mg, partial [Prunus persica]
Length=1084

 Score =   223 bits (567),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q++K+T VE+VG+NGEL+V + SK  KEG R FKFN+V+G  ATQA+V++D
Sbjct  613  CRIRPFLPGQREKRTSVEHVGENGELVVADRSKPGKEGHRLFKFNKVFGSDATQAEVYSD  672

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ +T+ENWGVNYRALNDLF ISQ R S
Sbjct  673  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNSSTKENWGVNYRALNDLFDISQRRKS  732

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  733  SITYEIGVQMVEIYNEQV  750



>ref|XP_009104788.1| PREDICTED: kinesin-4-like [Brassica rapa]
 ref|XP_009104789.1| PREDICTED: kinesin-4-like [Brassica rapa]
Length=1020

 Score =   222 bits (566),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VEYVG++GEL+V NP++  K+G R F+FN+VY P+ATQA+VF D
Sbjct  512  CRVRPFLPGQGAPNTVVEYVGEDGELVVTNPTRPRKDGLRKFRFNKVYSPAATQAEVFTD  571

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  572  IKPLVRSVLDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKG  631

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  632  NINYEVGVQMVEIYNEQV  649



>ref|XP_010660655.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
 ref|XP_010660660.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
 ref|XP_010660666.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
 ref|XP_010660672.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
Length=1100

 Score =   223 bits (567),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q +K T +EY+G+NGEL+++NP+KQ K+ RR FKFN+V+ P+ATQ +VF D
Sbjct  528  CRIRPFLPGQSEKYTTIEYIGENGELVIVNPAKQGKDSRRLFKFNKVFSPAATQEEVFLD  587

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPD +++ +WGVNYRALNDLF ISQ+R S
Sbjct  588  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDVSSKVDWGVNYRALNDLFHISQSRKS  647

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  648  SIMYEVGVQMVEIYNEQV  665



>ref|XP_007040243.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin ) domain, putative isoform 2 [Theobroma cacao]
 gb|EOY24744.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin ) domain, putative isoform 2 [Theobroma cacao]
Length=1044

 Score =   222 bits (566),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NPSKQ K+  R FKFN+V+ P+ATQ +VF D
Sbjct  458  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPSKQGKDTHRLFKFNKVFSPAATQEEVFLD  517

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+ +++E+WGVNYRALNDLF+ISQ+R S
Sbjct  518  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNVSSKEDWGVNYRALNDLFQISQSRKS  577

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  578  STIYEVGVQMVEIYNEQV  595



>ref|XP_004965598.1| PREDICTED: kinesin-4-like isoform X3 [Setaria italica]
Length=913

 Score =   221 bits (563),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  K T +EYVGD+GELI+ NP+++  EG +SFKFN+V GP+A+Q +VF D
Sbjct  325  CRIRPFLPGEDRKSTTIEYVGDDGELIIANPTRKGNEGSKSFKFNKVLGPTASQDEVFKD  384

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE+ WGVNYRALNDLF IS  RG 
Sbjct  385  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEKEWGVNYRALNDLFHISHNRGD  444

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE  VQM+EIYNEQ+
Sbjct  445  TIMYEFSVQMIEIYNEQI  462



>ref|XP_004965596.1| PREDICTED: kinesin-4-like isoform X1 [Setaria italica]
Length=1102

 Score =   223 bits (567),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  K T +EYVGD+GELI+ NP+++  EG +SFKFN+V GP+A+Q +VF D
Sbjct  543  CRIRPFLPGEDRKSTTIEYVGDDGELIIANPTRKGNEGSKSFKFNKVLGPTASQDEVFKD  602

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE+ WGVNYRALNDLF IS  RG 
Sbjct  603  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEKEWGVNYRALNDLFHISHNRGD  662

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE  VQM+EIYNEQ+
Sbjct  663  TIMYEFSVQMIEIYNEQI  680



>ref|XP_004965597.1| PREDICTED: kinesin-4-like isoform X2 [Setaria italica]
Length=934

 Score =   221 bits (563),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  K T +EYVGD+GELI+ NP+++  EG +SFKFN+V GP+A+Q +VF D
Sbjct  346  CRIRPFLPGEDRKSTTIEYVGDDGELIIANPTRKGNEGSKSFKFNKVLGPTASQDEVFKD  405

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE+ WGVNYRALNDLF IS  RG 
Sbjct  406  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEKEWGVNYRALNDLFHISHNRGD  465

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE  VQM+EIYNEQ+
Sbjct  466  TIMYEFSVQMIEIYNEQI  483



>ref|XP_006306421.1| hypothetical protein CARUB_v10012358mg, partial [Capsella rubella]
 gb|EOA39319.1| hypothetical protein CARUB_v10012358mg, partial [Capsella rubella]
Length=993

 Score =   221 bits (564),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q    T+VE++G++GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  493  CRVRPFLRGQGASNTVVEHIGEHGELVVLNPTKPGKDGHRKFRFNKVYSPASTQAEVFSD  552

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  553  IKPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  612

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  613  NIAYEVGVQMVEIYNEQV  630



>emb|CBI34668.3| unnamed protein product [Vitis vinifera]
Length=1071

 Score =   222 bits (565),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q +K T +EY+G+NGEL+++NP+KQ K+ RR FKFN+V+ P+ATQ +VF D
Sbjct  528  CRIRPFLPGQSEKYTTIEYIGENGELVIVNPAKQGKDSRRLFKFNKVFSPAATQEEVFLD  587

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPD +++ +WGVNYRALNDLF ISQ+R S
Sbjct  588  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDVSSKVDWGVNYRALNDLFHISQSRKS  647

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  648  SIMYEVGVQMVEIYNEQV  665



>ref|XP_010695142.1| PREDICTED: kinesin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695143.1| PREDICTED: kinesin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695144.1| PREDICTED: kinesin-1 [Beta vulgaris subsp. vulgaris]
Length=1052

 Score =   222 bits (565),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q +KQT +EY+G+NGEL+V NP K  K+ RR FKFN+V+ P+A+Q +VF D
Sbjct  492  CRIRPFLPGQNEKQTTIEYIGENGELVVFNPLKPGKDSRRLFKFNKVFAPTASQEEVFID  551

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGY+VCIFAYGQTGSGKTYTMTGPD A++E+WGVNYRAL+DLF+ISQ R S
Sbjct  552  TQPLIRSVLDGYDVCIFAYGQTGSGKTYTMTGPDMASKEDWGVNYRALHDLFQISQNRRS  611

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  612  SIMYEIGVQMVEIYNEQV  629



>ref|XP_007040244.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin ) domain, putative isoform 3 [Theobroma cacao]
 gb|EOY24745.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin ) domain, putative isoform 3 [Theobroma cacao]
Length=969

 Score =   221 bits (563),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NPSKQ K+  R FKFN+V+ P+ATQ +VF D
Sbjct  383  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPSKQGKDTHRLFKFNKVFSPAATQEEVFLD  442

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+ +++E+WGVNYRALNDLF+ISQ+R S
Sbjct  443  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNVSSKEDWGVNYRALNDLFQISQSRKS  502

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  503  STIYEVGVQMVEIYNEQV  520



>emb|CDX96493.1| BnaA07g31040D [Brassica napus]
Length=942

 Score =   221 bits (562),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VE+VG++GEL+V NP++  K+G R F+FN+VY P+ATQA+VF+D
Sbjct  489  CRVRPFLPGQGAPNTVVEHVGEDGELVVTNPTRPGKDGLRQFRFNKVYSPNATQAEVFSD  548

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  549  IKPLVRSVLDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKR  608

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  609  NINYEVGVQMVEIYNEQV  626



>ref|XP_010498229.1| PREDICTED: kinesin KP1-like isoform X2 [Camelina sativa]
Length=813

 Score =   220 bits (561),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q    T+VE++GD+GEL+V+NP+K  K+G R F+FN+VY  ++TQA+VF+D
Sbjct  290  CRVRPFLRGQGAANTVVEHIGDHGELVVLNPTKPGKDGLRKFRFNKVYSTASTQAEVFSD  349

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R +
Sbjct  350  IKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKN  409

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  410  NIAYEVGVQMVEIYNEQV  427



>ref|XP_009106042.1| PREDICTED: kinesin-4 [Brassica rapa]
Length=1021

 Score =   221 bits (564),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q    T+VE+VG++GEL+V NP++  K+G R F+FN+VY P+ATQA+VF+D
Sbjct  517  CRVRPFLPGQGAPNTVVEHVGEDGELVVTNPTRPGKDGLRQFRFNKVYSPNATQAEVFSD  576

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDG+NVCIFAYGQTGSGKTYTMTGPDGA+EE+WGVNYRALNDLF+ISQ+R  
Sbjct  577  IKPLVRSVLDGFNVCIFAYGQTGSGKTYTMTGPDGASEEDWGVNYRALNDLFKISQSRKR  636

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  637  NINYEVGVQMVEIYNEQV  654



>gb|KHG09229.1| Kinesin-4 -like protein [Gossypium arboreum]
Length=1045

 Score =   221 bits (564),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EYVG+NGEL+V NPSK  K+  R FKFN+V+ P+ATQ +VF D
Sbjct  458  CRIRPFLPGQSKKQTAIEYVGENGELVVSNPSKLGKDTHRLFKFNKVFSPAATQEEVFLD  517

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+ +++E+WGVNYRALNDLF+ISQ+R S
Sbjct  518  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNLSSKEDWGVNYRALNDLFQISQSRKS  577

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQ+
Sbjct  578  SIIYEVGVQMVEIYNEQI  595



>ref|XP_008393307.1| PREDICTED: kinesin KP1 isoform X1 [Malus domestica]
Length=966

 Score =   221 bits (562),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+K+T VE++G+NGEL+V + SK  KEG R FKFN+VYG  ATQA+V+AD
Sbjct  450  CRIRPFLPGQKEKKTSVEHIGENGELVVADRSKPGKEGHRLFKFNKVYGSDATQAEVYAD  509

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCI AYGQTGSGKTYTMTGP+ AT+ENWGVNYRALNDLF ISQ R  
Sbjct  510  TQPLIRSVLDGYNVCICAYGQTGSGKTYTMTGPNQATKENWGVNYRALNDLFDISQCRKG  569

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  570  SITYEIGVQMVEIYNEQV  587



>ref|XP_008393310.1| PREDICTED: kinesin-4 isoform X4 [Malus domestica]
Length=931

 Score =   220 bits (561),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+K+T VE++G+NGEL+V + SK  KEG R FKFN+VYG  ATQA+V+AD
Sbjct  450  CRIRPFLPGQKEKKTSVEHIGENGELVVADRSKPGKEGHRLFKFNKVYGSDATQAEVYAD  509

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCI AYGQTGSGKTYTMTGP+ AT+ENWGVNYRALNDLF ISQ R  
Sbjct  510  TQPLIRSVLDGYNVCICAYGQTGSGKTYTMTGPNQATKENWGVNYRALNDLFDISQCRKG  569

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  570  SITYEIGVQMVEIYNEQV  587



>ref|XP_006416608.1| hypothetical protein EUTSA_v10006662mg [Eutrema salsugineum]
 gb|ESQ34961.1| hypothetical protein EUTSA_v10006662mg [Eutrema salsugineum]
Length=1023

 Score =   221 bits (563),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q    T+VE++G++GEL+V+NP+K  K+G R F+FN+VY P++TQA+VF+D
Sbjct  508  CRVRPFLRGQGTSNTVVEHIGEHGELVVVNPTKPGKDGLRKFRFNKVYSPASTQAEVFSD  567

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PL++SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R S
Sbjct  568  IKPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKS  627

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  628  NITYEVGVQMVEIYNEQV  645



>ref|XP_008393308.1| PREDICTED: kinesin KP1 isoform X2 [Malus domestica]
Length=956

 Score =   220 bits (561),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+K+T VE++G+NGEL+V + SK  KEG R FKFN+VYG  ATQA+V+AD
Sbjct  440  CRIRPFLPGQKEKKTSVEHIGENGELVVADRSKPGKEGHRLFKFNKVYGSDATQAEVYAD  499

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCI AYGQTGSGKTYTMTGP+ AT+ENWGVNYRALNDLF ISQ R  
Sbjct  500  TQPLIRSVLDGYNVCICAYGQTGSGKTYTMTGPNQATKENWGVNYRALNDLFDISQCRKG  559

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  560  SITYEIGVQMVEIYNEQV  577



>ref|XP_008393309.1| PREDICTED: kinesin KP1 isoform X3 [Malus domestica]
Length=951

 Score =   220 bits (561),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+K+T VE++G+NGEL+V + SK  KEG R FKFN+VYG  ATQA+V+AD
Sbjct  435  CRIRPFLPGQKEKKTSVEHIGENGELVVADRSKPGKEGHRLFKFNKVYGSDATQAEVYAD  494

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCI AYGQTGSGKTYTMTGP+ AT+ENWGVNYRALNDLF ISQ R  
Sbjct  495  TQPLIRSVLDGYNVCICAYGQTGSGKTYTMTGPNQATKENWGVNYRALNDLFDISQCRKG  554

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  555  SITYEIGVQMVEIYNEQV  572



>ref|XP_010498228.1| PREDICTED: kinesin KP1-like isoform X1 [Camelina sativa]
Length=1008

 Score =   221 bits (562),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q    T+VE++GD+GEL+V+NP+K  K+G R F+FN+VY  ++TQA+VF+D
Sbjct  485  CRVRPFLRGQGAANTVVEHIGDHGELVVLNPTKPGKDGLRKFRFNKVYSTASTQAEVFSD  544

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPDGA+EE WGVNYRALNDLF+ISQ+R +
Sbjct  545  IKPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDGASEEEWGVNYRALNDLFKISQSRKN  604

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQMVEIYNEQV
Sbjct  605  NIAYEVGVQMVEIYNEQV  622



>ref|XP_010663596.1| PREDICTED: kinesin-4 isoform X1 [Vitis vinifera]
Length=1192

 Score =   221 bits (564),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  KQT +EY+G++GEL ++NPSKQ K+  R FKFN+VYGP+ATQA+VF+D
Sbjct  624  CRIRPFLRGQNGKQTTIEYIGEDGELGIVNPSKQGKDSHRLFKFNKVYGPAATQAEVFSD  683

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+ A++E WGVNYRAL+DLF I+Q+R S
Sbjct  684  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNAASKEEWGVNYRALSDLFEITQSRRS  743

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F YE+ VQMVEIYNEQV
Sbjct  744  SFMYEIGVQMVEIYNEQV  761



>ref|XP_010663597.1| PREDICTED: kinesin-4 isoform X2 [Vitis vinifera]
Length=1174

 Score =   221 bits (564),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  KQT +EY+G++GEL ++NPSKQ K+  R FKFN+VYGP+ATQA+VF+D
Sbjct  606  CRIRPFLRGQNGKQTTIEYIGEDGELGIVNPSKQGKDSHRLFKFNKVYGPAATQAEVFSD  665

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+ A++E WGVNYRAL+DLF I+Q+R S
Sbjct  666  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNAASKEEWGVNYRALSDLFEITQSRRS  725

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F YE+ VQMVEIYNEQV
Sbjct  726  SFMYEIGVQMVEIYNEQV  743



>emb|CDP12027.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   214 bits (546),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP K  K+  R FKFN+V+ P+ATQ +VF D
Sbjct  341  CRIRPFLPGQSQKQTTIEYIGENGELVVTNPLKPGKDSHRLFKFNKVFAPAATQEEVFLD  400

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  +  E+WGVNYRALNDLF+ISQ R S
Sbjct  401  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGVSAVEDWGVNYRALNDLFQISQRRKS  460

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  461  SITYEIGVQMVEIYNEQV  478



>gb|AFW71235.1| hypothetical protein ZEAMMB73_791260 [Zea mays]
Length=267

 Score =   207 bits (527),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF P + +K T VEY+G+NGEL++ NP+K+ KE  ++F FN+V+GP+ATQ  VF D
Sbjct  108  CRIRPFRPWEDEKSTSVEYIGENGELVLSNPTKKGKEAGKNFTFNKVFGPTATQDMVFND  167

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKT+TM GP+ ATE+ WGVNYRALNDLF IS  R  
Sbjct  168  IRPLIRSVLDGYNVCIFAYGQTGSGKTHTMMGPENATEKEWGVNYRALNDLFNISHDRRD  227

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQMVEIYNEQ+
Sbjct  228  TIKYELGVQMVEIYNEQI  245



>ref|XP_006654662.1| PREDICTED: kinesin-4-like [Oryza brachyantha]
Length=921

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  396  CRVRPFLPGQDKKSTTVDYIGENGELLISNPFKQGKDGHRMFKFNKVFSPFASQAEVFSD  455

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  456  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-STSKQDWGVNYRALNDLFDISLSRSN  514

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  515  AFSYEVGVQMVEIYNEQV  532



>ref|XP_008437282.1| PREDICTED: kinesin-4 isoform X2 [Cucumis melo]
Length=1095

 Score =   220 bits (560),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K T VEY+G+NGEL+++NP+KQ K+ RR FKFN+V+GP+ +Q  VF D
Sbjct  465  CRIRPFLPGQSKKLTTVEYIGENGELVIINPAKQGKDNRRLFKFNKVFGPTCSQEDVFLD  524

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD +    WGVNYRALNDLF ISQ+R  
Sbjct  525  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDVSLRTEWGVNYRALNDLFEISQSRKG  584

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYE+ VQMVEIYNEQV
Sbjct  585  SISYEIGVQMVEIYNEQV  602



>gb|EEC80804.1| hypothetical protein OsI_23351 [Oryza sativa Indica Group]
Length=1192

 Score =   220 bits (561),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +    T +EYVGDNGELI+ NP+K+ KEG + FKFN+V GPSA+Q +VF +
Sbjct  633  CRIRPFLPGEDQTSTTIEYVGDNGELILANPAKRGKEGHKLFKFNKVLGPSASQDEVFKE  692

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE++WGVNYRALNDLF IS++R  
Sbjct  693  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEKDWGVNYRALNDLFHISRSRRD  752

Query  55   AFSYEVIVQMVEIYNEQV  2
               Y+V VQM+EIYNEQ+
Sbjct  753  TVMYKVSVQMIEIYNEQI  770



>ref|XP_002509807.1| kinesin heavy chain, putative [Ricinus communis]
 gb|EEF51194.1| kinesin heavy chain, putative [Ricinus communis]
Length=1069

 Score =   219 bits (558),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+GP+ +Q +VF D
Sbjct  473  CRVRPFLPGQCKKQTTIEYIGENGELVVSNPCKQGKDSHRLFKFNKVFGPATSQEEVFLD  532

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+  +EE+WGVNYRAL+DLF+ISQTR S
Sbjct  533  TRPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNLLSEEDWGVNYRALHDLFQISQTRRS  592

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  593  SMRYEVGVQMVEIYNEQV  610



>ref|XP_009360158.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
Length=1088

 Score =   219 bits (558),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 101/138 (73%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+K+T VE++G+NGEL+V + SK  KE  R FKFN+VYG  ATQA+V+AD
Sbjct  589  CRIRPFLPGQKEKKTSVEHIGENGELVVADRSKPGKESHRLFKFNKVYGSDATQAEVYAD  648

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCI AYGQTGSGKTYTMTGP+ AT+ENWGVNYRALNDLF ISQ R  
Sbjct  649  TQPLIRSVLDGYNVCICAYGQTGSGKTYTMTGPNQATKENWGVNYRALNDLFDISQCRKG  708

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  709  SITYEIGVQMVEIYNEQV  726



>ref|XP_008437280.1| PREDICTED: kinesin-4 isoform X1 [Cucumis melo]
 ref|XP_008437281.1| PREDICTED: kinesin-4 isoform X1 [Cucumis melo]
Length=1119

 Score =   219 bits (559),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K T VEY+G+NGEL+++NP+KQ K+ RR FKFN+V+GP+ +Q  VF D
Sbjct  465  CRIRPFLPGQSKKLTTVEYIGENGELVIINPAKQGKDNRRLFKFNKVFGPTCSQEDVFLD  524

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD +    WGVNYRALNDLF ISQ+R  
Sbjct  525  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDVSLRTEWGVNYRALNDLFEISQSRKG  584

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYE+ VQMVEIYNEQV
Sbjct  585  SISYEIGVQMVEIYNEQV  602



>gb|EEE65873.1| hypothetical protein OsJ_21674 [Oryza sativa Japonica Group]
Length=1136

 Score =   219 bits (559),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +    T +EYVGDNGELI+ NP+K+ KEG + FKFN+V GPSA+Q +VF +
Sbjct  577  CRIRPFLPGEDQTSTTIEYVGDNGELILANPAKRGKEGHKLFKFNKVLGPSASQDEVFKE  636

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE++WGVNYRALNDLF IS++R  
Sbjct  637  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEKDWGVNYRALNDLFHISRSRRD  696

Query  55   AFSYEVIVQMVEIYNEQV  2
               Y+V VQM+EIYNEQ+
Sbjct  697  TVMYKVSVQMIEIYNEQI  714



>ref|XP_004171275.1| PREDICTED: kinesin-4-like, partial [Cucumis sativus]
Length=834

 Score =   218 bits (554),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K T VEY+G+NGEL+++NP+KQ K+ RR FKFN+V+GP+ +Q  VF D
Sbjct  180  CRIRPFLPGQSKKLTTVEYIGENGELVIINPAKQGKDNRRLFKFNKVFGPTCSQEDVFLD  239

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD +    WGVNYRALNDLF ISQ+R  
Sbjct  240  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDVSLRTEWGVNYRALNDLFEISQSRKG  299

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYE+ VQMVEIYNEQV
Sbjct  300  SISYEIGVQMVEIYNEQV  317



>ref|XP_010053254.1| PREDICTED: kinesin KP1 [Eucalyptus grandis]
 ref|XP_010053255.1| PREDICTED: kinesin KP1 [Eucalyptus grandis]
 ref|XP_010053256.1| PREDICTED: kinesin KP1 [Eucalyptus grandis]
 gb|KCW77514.1| hypothetical protein EUGRSUZ_D01842 [Eucalyptus grandis]
Length=925

 Score =   218 bits (554),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP+K  K+  R FKFN+V+GP+A+Q +VF D
Sbjct  354  CRIRPFLPGQNKKQTTIEYMGENGELVVANPTKHGKDSHRLFKFNKVFGPTASQEEVFLD  413

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDG++VCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF+I+Q+RG+
Sbjct  414  TQPLIRSVLDGFSVCIFAYGQTGSGKTYTMSGPSASSREDWGVNYRALNDLFQIAQSRGT  473

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  474  TVVYEVAVQMVEIYNEQV  491



>ref|XP_004143905.1| PREDICTED: kinesin-4-like [Cucumis sativus]
 gb|KGN50095.1| hypothetical protein Csa_5G153100 [Cucumis sativus]
Length=1119

 Score =   219 bits (558),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K T VEY+G+NGEL+++NP+KQ K+ RR FKFN+V+GP+ +Q  VF D
Sbjct  465  CRIRPFLPGQSKKLTTVEYIGENGELVIINPAKQGKDNRRLFKFNKVFGPTCSQEDVFLD  524

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD +    WGVNYRALNDLF ISQ+R  
Sbjct  525  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDVSLRTEWGVNYRALNDLFEISQSRKG  584

Query  55   AFSYEVIVQMVEIYNEQV  2
            + SYE+ VQMVEIYNEQV
Sbjct  585  SISYEIGVQMVEIYNEQV  602



>ref|XP_009408813.1| PREDICTED: kinesin KP1-like [Musa acuminata subsp. malaccensis]
Length=749

 Score =   216 bits (551),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RP+L  +  KQ+ + Y+G+NGELI+ NP+KQ K+G+R F FN+V+GP+ATQ +VF D
Sbjct  168  CRIRPYLSGENKKQSTIYYIGENGELILANPTKQGKDGQRVFNFNKVFGPTATQEEVFLD  227

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLIQS+LDGYNVCIFAYGQTGSGKTYTMTGPD ++E +WGVNYRALNDLF+ISQTR  
Sbjct  228  TRPLIQSILDGYNVCIFAYGQTGSGKTYTMTGPDSSSETDWGVNYRALNDLFQISQTRIE  287

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YEV VQMVE+YNEQV
Sbjct  288  TFIYEVGVQMVEVYNEQV  305



>ref|XP_006656158.1| PREDICTED: kinesin-4-like isoform X2 [Oryza brachyantha]
Length=834

 Score =   216 bits (551),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +    T +EY  DNGELI+ NP KQ KEG++ FKFN+V GPSA+Q +VF D
Sbjct  245  CRIRPFLPGEDQTSTTIEYGSDNGELILENPGKQGKEGKKLFKFNKVLGPSASQDEVFKD  304

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE +WGVNYRALNDLF IS +R  
Sbjct  305  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEMDWGVNYRALNDLFHISLSRRD  364

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQM+EIYNEQ+
Sbjct  365  TIMYEVSVQMIEIYNEQI  382



>ref|XP_006656157.1| PREDICTED: kinesin-4-like isoform X1 [Oryza brachyantha]
Length=972

 Score =   217 bits (552),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +    T +EY  DNGELI+ NP KQ KEG++ FKFN+V GPSA+Q +VF D
Sbjct  383  CRIRPFLPGEDQTSTTIEYGSDNGELILENPGKQGKEGKKLFKFNKVLGPSASQDEVFKD  442

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE +WGVNYRALNDLF IS +R  
Sbjct  443  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPENATEMDWGVNYRALNDLFHISLSRRD  502

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQM+EIYNEQ+
Sbjct  503  TIMYEVSVQMIEIYNEQI  520



>gb|EEC77443.1| hypothetical protein OsI_16245 [Oryza sativa Indica Group]
Length=1489

 Score =   219 bits (558),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRV+PFL  Q D+++ V+++G+NGE++++NP KQ KEGR+ F FN+++GP+A+Q++VFAD
Sbjct  388  CRVKPFLKMQTDQRSTVDHIGENGEIMIVNPQKQGKEGRKMFSFNKIFGPNASQSEVFAD  447

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SV+DGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYR+LNDLF ISQ R  
Sbjct  448  TQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPDITTEETWGVNYRSLNDLFAISQNRAD  507

Query  55   AFSYEVIVQMVEIYNEQV  2
              +Y+V VQM+EIYNEQV
Sbjct  508  TTTYDVKVQMIEIYNEQV  525



>gb|AFW85112.1| kinesin heavy chain [Zea mays]
Length=643

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K TI++Y+G+NGE+++ NP KQ K+  R FKFN+V+   A+QA+VF+D
Sbjct  164  CRVRPFLPGQDGKTTIIDYIGENGEILITNPFKQGKDVCRMFKFNKVFNTHASQAEVFSD  223

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS +R +
Sbjct  224  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSKEDWGVNYRALNDLFDISLSRRN  282

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  283  AFSYEVGVQMVEIYNEQV  300



>ref|XP_010915403.1| PREDICTED: kinesin-4-like [Elaeis guineensis]
Length=1084

 Score =   218 bits (554),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  K   + Y+G++GEL+++NPSK  K+G++ FKFN+VYGP+A+Q +VF D
Sbjct  507  CRIRPFLPGENRKSNTINYIGEDGELVLVNPSKPGKDGQKMFKFNKVYGPAASQEEVFLD  566

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPD  TEE WGVNYRALNDLF IS+TR  
Sbjct  567  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDSPTEEEWGVNYRALNDLFHISRTRRD  626

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YEV VQMVEIYNEQV
Sbjct  627  TFMYEVGVQMVEIYNEQV  644



>gb|AAT69670.1| putative kinesin [Oryza sativa Japonica Group]
Length=918

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGEL++ NP KQ K+G R FKFN+V+ P ++QA+VF+D
Sbjct  396  CRVRPFLPGQDKKSTTVDYIGENGELLISNPFKQGKDGHRMFKFNKVFSPFSSQAEVFSD  455

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  456  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-STSKQDWGVNYRALNDLFDISLSRRN  514

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  515  AFSYEVGVQMVEIYNEQV  532



>ref|NP_001044222.1| Os01g0744000 [Oryza sativa Japonica Group]
 dbj|BAD87516.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAD87915.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF06136.1| Os01g0744000 [Oryza sativa Japonica Group]
Length=971

 Score =   216 bits (551),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T ++Y+G+NGE+++ NPSKQ KEG R FKFN+V+G  ++QA+VF+D
Sbjct  477  CRVRPFLPGQDGKLTAIDYIGENGEILIANPSKQGKEGYRMFKFNKVFGTHSSQAEVFSD  536

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G + E+WGVNYRALNDLF IS +R +
Sbjct  537  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSREDWGVNYRALNDLFDISLSRKN  595

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  596  AFSYEVGVQMVEIYNEQV  613



>ref|XP_006644693.1| PREDICTED: kinesin-4-like [Oryza brachyantha]
Length=928

 Score =   216 bits (550),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T ++Y+G+NGE+++ NPSKQ KEG R FKFN+V+G  A+QA+VF+D
Sbjct  429  CRVRPFLPGQDGKLTAIDYIGENGEILISNPSKQGKEGYRMFKFNKVFGTHASQAEVFSD  488

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G + ++WGVNYRALNDLF IS +R +
Sbjct  489  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSRKDWGVNYRALNDLFDISLSRKN  547

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  548  AFSYEVGVQMVEIYNEQV  565



>gb|EEE61154.1| hypothetical protein OsJ_15116 [Oryza sativa Japonica Group]
Length=964

 Score =   216 bits (550),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRV+PFL  Q D+++ V+++G+NGE++++NP KQ KEGR+ F FN+++GP+A+Q++VFAD
Sbjct  388  CRVKPFLKMQTDQRSTVDHIGENGEIMIVNPQKQGKEGRKMFSFNKIFGPNASQSEVFAD  447

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SV+DGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYR+LNDLF ISQ R  
Sbjct  448  TQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPDITTEETWGVNYRSLNDLFAISQNRAD  507

Query  55   AFSYEVIVQMVEIYNEQV  2
              +Y+V VQM+EIYNEQV
Sbjct  508  TTTYDVKVQMIEIYNEQV  525



>ref|XP_004245601.1| PREDICTED: kinesin KP1 [Solanum lycopersicum]
 ref|XP_010325402.1| PREDICTED: kinesin KP1 [Solanum lycopersicum]
Length=921

 Score =   216 bits (549),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K T +EY+G+NGEL+V NPSK  K+  R FKFN+V+ P+ TQ +VF D
Sbjct  337  CRIRPFLPGQSQKLTTIEYIGENGELVVTNPSKLGKDSHRLFKFNKVFAPAVTQEEVFRD  396

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ ENWGVNYRALNDLF ISQ+R S
Sbjct  397  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSMSSVENWGVNYRALNDLFNISQSRKS  456

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YEV VQMVEIYNEQV
Sbjct  457  SIAYEVGVQMVEIYNEQV  474



>gb|KDO76229.1| hypothetical protein CISIN_1g001464mg [Citrus sinensis]
Length=1019

 Score =   216 bits (551),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+GP A+Q +VF D
Sbjct  500  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPLKQGKDNHRLFKFNKVFGPEASQEEVFLD  559

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF IS++R +
Sbjct  560  TRPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPCISSTEDWGVNYRALNDLFEISESRKN  619

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  620  SILYEVGVQMVEIYNEQV  637



>ref|XP_009364926.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364927.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364928.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364929.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364939.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364940.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364941.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364942.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364943.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
Length=1218

 Score =   218 bits (554),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  ++T +EY+G+NG+L++ NPSKQ K+ RR FKFN+V+GP+ATQA VF D
Sbjct  523  CRIRPFLRGQSQRETTIEYIGENGDLVIANPSKQGKDSRRLFKFNKVFGPAATQADVFLD  582

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ ++WG+NYRALNDLF+ISQ+R S
Sbjct  583  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSVSSTDDWGINYRALNDLFQISQSRKS  642

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YEV VQMVEIYNEQV
Sbjct  643  SIAYEVGVQMVEIYNEQV  660



>dbj|BAD26164.1| putative Carboxy-terminal kinesin 2 [Oryza sativa Japonica Group]
Length=862

 Score =   215 bits (548),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF P + DK + VEY+GDNGEL++ NP+KQ KEG ++F FN+V+GP  TQ  VF D
Sbjct  301  CRIRPFRPGEDDKSSSVEYIGDNGELVLSNPTKQGKEGGKNFTFNKVFGPITTQDAVFKD  360

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTM GP+ ATE+ WGVNYRALNDLF IS  R  
Sbjct  361  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMMGPEKATEKEWGVNYRALNDLFNISHDRRD  420

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YE+ VQM+EIYNEQ+
Sbjct  421  TITYELGVQMIEIYNEQI  438



>ref|XP_006653506.1| PREDICTED: kinesin-4-like [Oryza brachyantha]
Length=1059

 Score =   216 bits (551),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRV+PFL  Q D+++ V+++G+NGE+++MNP KQ KEGR+ F FN+++GP+A+Q++VFAD
Sbjct  374  CRVKPFLNMQTDQRSTVDHIGENGEIMIMNPQKQGKEGRKIFSFNKIFGPNASQSEVFAD  433

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SV+DG+NVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYR+LNDLF ISQ R  
Sbjct  434  TQPLIRSVMDGFNVCIFAYGQTGSGKTYTMSGPDTVTEETWGVNYRSLNDLFDISQNRAD  493

Query  55   AFSYEVIVQMVEIYNEQV  2
              +Y+V VQM+EIYNEQV
Sbjct  494  TTTYDVKVQMIEIYNEQV  511



>ref|XP_006343979.1| PREDICTED: kinesin-4-like [Solanum tuberosum]
Length=920

 Score =   215 bits (548),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K T +EY+G+NGEL+V NPSK  K+  R FKFN+V+ P+ TQ +VF D
Sbjct  337  CRIRPFLPGQSQKLTTIEYIGENGELVVTNPSKLGKDSHRLFKFNKVFAPAVTQEEVFRD  396

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ ENWGVNYRALNDLF ISQ+R S
Sbjct  397  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSMSSVENWGVNYRALNDLFNISQSRKS  456

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YEV VQMVEIYNEQV
Sbjct  457  SIAYEVGVQMVEIYNEQV  474



>emb|CAH67371.1| OSIGBa0128P10.5 [Oryza sativa Indica Group]
Length=979

 Score =   215 bits (548),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRV+PFL  Q D+++ V+++G+NGE++++NP KQ KEGR+ F FN+++GP+A+Q++VFAD
Sbjct  353  CRVKPFLKMQTDQRSTVDHIGENGEIMIVNPQKQGKEGRKMFSFNKIFGPNASQSEVFAD  412

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SV+DGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYR+LNDLF ISQ R  
Sbjct  413  TQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPDITTEETWGVNYRSLNDLFAISQNRAD  472

Query  55   AFSYEVIVQMVEIYNEQV  2
              +Y+V VQM+EIYNEQ+
Sbjct  473  TTTYDVKVQMIEIYNEQI  490



>ref|XP_009387623.1| PREDICTED: kinesin-4-like [Musa acuminata subsp. malaccensis]
Length=1026

 Score =   216 bits (549),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  K T ++Y+G++GEL+++NPSKQ K+G R FKFN+V+  +A+QA++F+D
Sbjct  474  CRIRPFLPGQNQKSTTIDYIGESGELLIVNPSKQGKDGHRMFKFNKVFDQAASQAEIFSD  533

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  A+ E+WGVNYRAL+DLF IS+ R +
Sbjct  534  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPISASVEDWGVNYRALSDLFEISENRRN  593

Query  55   AFSYEVIVQMVEIYNEQV  2
            ++ YEV VQMVEIYNEQV
Sbjct  594  SYFYEVGVQMVEIYNEQV  611



>ref|XP_004961465.1| PREDICTED: kinesin-4-like [Setaria italica]
Length=1005

 Score =   215 bits (548),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 99/138 (72%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T ++Y+G+NGE+++ NP KQ K+G R FKFN+V+ PSATQA+VF+D
Sbjct  490  CRVRPFLPGQDKKSTTIDYMGENGEMLISNPLKQGKDGHRMFKFNKVFSPSATQAEVFSD  549

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  550  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPS-TSKQDWGVNYRALNDLFDISLSRIN  608

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  609  AFSYEVGVQMVEIYNEQV  626



>gb|KDO76228.1| hypothetical protein CISIN_1g001464mg [Citrus sinensis]
Length=1055

 Score =   216 bits (549),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+GP A+Q +VF D
Sbjct  500  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPLKQGKDNHRLFKFNKVFGPEASQEEVFLD  559

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF IS++R +
Sbjct  560  TRPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPCISSTEDWGVNYRALNDLFEISESRKN  619

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  620  SILYEVGVQMVEIYNEQV  637



>ref|XP_011072725.1| PREDICTED: carboxy-terminal kinesin 2-like [Sesamum indicum]
 ref|XP_011072733.1| PREDICTED: carboxy-terminal kinesin 2-like [Sesamum indicum]
 ref|XP_011072742.1| PREDICTED: carboxy-terminal kinesin 2-like [Sesamum indicum]
Length=894

 Score =   214 bits (546),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT ++Y+G+NGEL+V+NP K  K+  R FKFN+V+GP++TQ +VF D
Sbjct  335  CRIRPFLPGQSRKQTTIQYIGENGELVVINPLKPGKDSHRLFKFNKVFGPASTQEEVFRD  394

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+  +  +WGVNYRALNDLF ISQ R S
Sbjct  395  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNATSIVDWGVNYRALNDLFNISQNRHS  454

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YEV VQMVEIYNEQV
Sbjct  455  SIAYEVGVQMVEIYNEQV  472



>ref|XP_004969922.1| PREDICTED: kinesin-4-like [Setaria italica]
Length=959

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGE+ + NP KQ K+G R FKFN+V+   A+QA+VF+D
Sbjct  479  CRVRPFLPGQDGKTTTVDYIGENGEIFITNPFKQGKDGCRMFKFNKVFNTRASQAEVFSD  538

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS +R +
Sbjct  539  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSKEDWGVNYRALNDLFEISLSRRN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  598  AFSYEVGVQMVEIYNEQV  615



>ref|XP_003569788.1| PREDICTED: kinesin-4-like isoform X2 [Brachypodium distachyon]
Length=990

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGE+++ NPSKQ K+G R FKFN+V+    +QA+VF+D
Sbjct  487  CRVRPFLPGQDGKSTAVDYIGENGEILISNPSKQGKDGYRMFKFNKVFSTHVSQAEVFSD  546

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS  R +
Sbjct  547  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSKEDWGVNYRALNDLFDISLKRRN  605

Query  55   AFSYEVIVQMVEIYNEQV  2
             FSYEV VQMVEIYNEQV
Sbjct  606  TFSYEVEVQMVEIYNEQV  623



>ref|XP_006439545.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
 gb|ESR52785.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
Length=1070

 Score =   216 bits (549),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+GP A+Q +VF D
Sbjct  500  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPLKQGKDNHRLFKFNKVFGPEASQEEVFLD  559

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF IS++R +
Sbjct  560  TRPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPCISSTEDWGVNYRALNDLFEISESRKN  619

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  620  SILYEVGVQMVEIYNEQV  637



>gb|KDO76227.1| hypothetical protein CISIN_1g001464mg [Citrus sinensis]
Length=1073

 Score =   216 bits (549),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+GP A+Q +VF D
Sbjct  500  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPLKQGKDNHRLFKFNKVFGPEASQEEVFLD  559

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF IS++R +
Sbjct  560  TRPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPCISSTEDWGVNYRALNDLFEISESRKN  619

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  620  SILYEVGVQMVEIYNEQV  637



>ref|XP_006439546.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
 gb|ESR52786.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
Length=1074

 Score =   216 bits (549),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+GP A+Q +VF D
Sbjct  500  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPLKQGKDNHRLFKFNKVFGPEASQEEVFLD  559

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF IS++R +
Sbjct  560  TRPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPCISSTEDWGVNYRALNDLFEISESRKN  619

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  620  SILYEVGVQMVEIYNEQV  637



>gb|KDP25433.1| hypothetical protein JCGZ_20589 [Jatropha curcas]
Length=1136

 Score =   216 bits (550),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q    T +EY+G+NGEL++ NP KQ KE  R FKFN+V+GP+A+Q +VF D
Sbjct  519  CRIRPFLPGQCKTLTTIEYIGENGELVISNPLKQGKESHRLFKFNKVFGPTASQEEVFLD  578

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD +++E+WGVNYRALNDLF+ISQ+R S
Sbjct  579  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLSSKEDWGVNYRALNDLFQISQSRKS  638

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  Y+V VQMVEIYNEQV
Sbjct  639  SIRYDVGVQMVEIYNEQV  656



>ref|XP_010232310.1| PREDICTED: kinesin-4-like isoform X1 [Brachypodium distachyon]
Length=1022

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGE+++ NPSKQ K+G R FKFN+V+    +QA+VF+D
Sbjct  487  CRVRPFLPGQDGKSTAVDYIGENGEILISNPSKQGKDGYRMFKFNKVFSTHVSQAEVFSD  546

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS  R +
Sbjct  547  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSKEDWGVNYRALNDLFDISLKRRN  605

Query  55   AFSYEVIVQMVEIYNEQV  2
             FSYEV VQMVEIYNEQV
Sbjct  606  TFSYEVEVQMVEIYNEQV  623



>emb|CAN65659.1| hypothetical protein VITISV_000953 [Vitis vinifera]
Length=1742

 Score =   217 bits (553),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q +K T +EY+G+NGEL+V+NP+KQ K+ RR FKFN+V+ P+ATQ  +  D
Sbjct  479  CRIRPFLPGQSEKYTTIEYIGENGELVVVNPAKQGKDSRRLFKFNKVFSPAATQGGIL-D  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGPD +++ +WGVNYRALNDLF ISQ+R S
Sbjct  538  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPDVSSKVDWGVNYRALNDLFHISQSRKS  597

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  598  SIMYEVGVQMVEIYNEQV  615



>ref|NP_001046361.1| Os02g0229600 [Oryza sativa Japonica Group]
 dbj|BAF08275.1| Os02g0229600 [Oryza sativa Japonica Group]
Length=997

 Score =   215 bits (547),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF P + DK + VEY+GDNGEL++ NP+KQ KEG ++F FN+V+GP  TQ  VF D
Sbjct  840  CRIRPFRPGEDDKSSSVEYIGDNGELVLSNPTKQGKEGGKNFTFNKVFGPITTQDAVFKD  899

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTM GP+ ATE+ WGVNYRALNDLF IS  R  
Sbjct  900  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMMGPEKATEKEWGVNYRALNDLFNISHDRRD  959

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YE+ VQM+EIYNEQ+
Sbjct  960  TITYELGVQMIEIYNEQI  977



>gb|EYU23471.1| hypothetical protein MIMGU_mgv1a000947mg [Erythranthe guttata]
Length=936

 Score =   214 bits (545),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  KQT +EY+G+NGEL+V+NPSK  K+  R FKFN+V+ P+ TQ  VF D
Sbjct  347  CRIRPFLSGQNGKQTTIEYIGENGELVVINPSKPGKDTHRLFKFNKVFDPAVTQEDVFRD  406

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ++  +WGVNYRALNDLF ISQ R S
Sbjct  407  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNSSSVVDWGVNYRALNDLFNISQKRNS  466

Query  55   AFSYEVIVQMVEIYNEQV  2
            +F+YE+ VQMVEIYNEQV
Sbjct  467  SFAYEISVQMVEIYNEQV  484



>ref|XP_006476565.1| PREDICTED: kinesin-4-like isoform X1 [Citrus sinensis]
 ref|XP_006476566.1| PREDICTED: kinesin-4-like isoform X2 [Citrus sinensis]
Length=1073

 Score =   215 bits (548),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+GP A+Q +VF D
Sbjct  500  CRIRPFLPGQSKKQTTIEYIGENGELVVSNPLKQGKDNHRLFKFNKVFGPEASQEEVFLD  559

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF IS++R +
Sbjct  560  TRPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPCISSTEDWGVNYRALNDLFEISESRKN  619

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  620  SILYEVGVQMVEIYNEQV  637



>ref|XP_011022686.1| PREDICTED: kinesin-4-like isoform X2 [Populus euphratica]
Length=1117

 Score =   215 bits (548),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  K+T VEY+G+NGEL++ NPSKQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  510  CRIRPFLLGQSKKRTTVEYIGENGELVISNPSKQGKDSNRLFKFNKVFGQAATQEEVFLD  569

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  570  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDITSQEDWGVNYRALHDLFQISQHRKS  629

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  630  SILYELGVQMVEIYNEQV  647



>ref|XP_011022688.1| PREDICTED: kinesin-4-like isoform X4 [Populus euphratica]
Length=1040

 Score =   215 bits (547),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  K+T VEY+G+NGEL++ NPSKQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  433  CRIRPFLLGQSKKRTTVEYIGENGELVISNPSKQGKDSNRLFKFNKVFGQAATQEEVFLD  492

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  493  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDITSQEDWGVNYRALHDLFQISQHRKS  552

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  553  SILYELGVQMVEIYNEQV  570



>ref|XP_011022687.1| PREDICTED: kinesin-4-like isoform X3 [Populus euphratica]
Length=1117

 Score =   215 bits (548),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  K+T VEY+G+NGEL++ NPSKQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  511  CRIRPFLLGQSKKRTTVEYIGENGELVISNPSKQGKDSNRLFKFNKVFGQAATQEEVFLD  570

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  571  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDITSQEDWGVNYRALHDLFQISQHRKS  630

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  631  SILYELGVQMVEIYNEQV  648



>ref|XP_009592482.1| PREDICTED: kinesin KP1-like [Nicotiana tomentosiformis]
 ref|XP_009592483.1| PREDICTED: kinesin KP1-like [Nicotiana tomentosiformis]
Length=932

 Score =   214 bits (544),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 96/137 (70%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  412  RVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFADI  233
            R+RPFLP Q  K T +EY+G+NGEL+V NPSKQ K+  R FKFN+V+ P+ATQ +VF D 
Sbjct  347  RIRPFLPGQSQKLTTIEYIGENGELVVTNPSKQGKDSHRLFKFNKVFAPAATQEEVFQDT  406

Query  232  QPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGSA  53
            QPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF ISQ+R S+
Sbjct  407  QPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPSMSSVEDWGVNYRALNDLFNISQSRKSS  466

Query  52   FSYEVIVQMVEIYNEQV  2
             +YE+ VQMVEIYNEQV
Sbjct  467  IAYEIGVQMVEIYNEQV  483



>ref|XP_011022683.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
 ref|XP_011022684.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
 ref|XP_011022685.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
Length=1118

 Score =   215 bits (548),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  K+T VEY+G+NGEL++ NPSKQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  511  CRIRPFLLGQSKKRTTVEYIGENGELVISNPSKQGKDSNRLFKFNKVFGQAATQEEVFLD  570

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  571  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDITSQEDWGVNYRALHDLFQISQHRKS  630

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  631  SILYELGVQMVEIYNEQV  648



>ref|XP_011022689.1| PREDICTED: kinesin-4-like isoform X5 [Populus euphratica]
Length=1166

 Score =   215 bits (548),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  K+T VEY+G+NGEL++ NPSKQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  511  CRIRPFLLGQSKKRTTVEYIGENGELVISNPSKQGKDSNRLFKFNKVFGQAATQEEVFLD  570

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD  ++E+WGVNYRAL+DLF+ISQ R S
Sbjct  571  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDITSQEDWGVNYRALHDLFQISQHRKS  630

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  631  SILYELGVQMVEIYNEQV  648



>ref|XP_004300795.1| PREDICTED: kinesin-4-like [Fragaria vesca subsp. vesca]
Length=1119

 Score =   215 bits (548),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQ+ +EYVG+NG+L++ NPSK  K+ R+ FKFN+V+GP+ATQ +VF D
Sbjct  526  CRIRPFLPGQSQKQSTIEYVGENGDLVIANPSKPRKDSRKLFKFNKVFGPAATQEEVFVD  585

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGY+VCIFAYGQTGSGKTYTM+GP  ++ E WGVNYRALNDLF+ISQ+R S
Sbjct  586  TQPLIRSVLDGYSVCIFAYGQTGSGKTYTMSGPSVSSTEEWGVNYRALNDLFQISQSRKS  645

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQMVEIYNEQV
Sbjct  646  SVEYEIGVQMVEIYNEQV  663



>dbj|BAJ97665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=974

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGE+++ NPSKQ K+G R FKFN+V+    +QA+VF+D
Sbjct  478  CRVRPFLPGQDGKSTAVDYIGENGEILISNPSKQGKDGYRMFKFNKVFNTHVSQAEVFSD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS  R +
Sbjct  538  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSKEDWGVNYRALNDLFDISLKRRN  596

Query  55   AFSYEVIVQMVEIYNEQV  2
             FSYEV VQMVEIYNEQV
Sbjct  597  TFSYEVEVQMVEIYNEQV  614



>ref|XP_011080953.1| PREDICTED: kinesin-4-like isoform X2 [Sesamum indicum]
Length=929

 Score =   214 bits (544),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  +QT ++Y+GDNGEL+V+NPSK  K+  R FKFN+++GP+ATQ  VF D
Sbjct  346  CRVRPFLSGQNGRQTTIQYIGDNGELVVINPSKSGKDSHRLFKFNKLFGPAATQEDVFRD  405

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+ ++  +WGVNYRALNDLF ISQ R S
Sbjct  406  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNASSVADWGVNYRALNDLFNISQKRHS  465

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  466  SIAYEIGVQMVEIYNEQV  483



>ref|XP_011080952.1| PREDICTED: kinesin-4-like isoform X1 [Sesamum indicum]
Length=932

 Score =   214 bits (544),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  +QT ++Y+GDNGEL+V+NPSK  K+  R FKFN+++GP+ATQ  VF D
Sbjct  346  CRVRPFLSGQNGRQTTIQYIGDNGELVVINPSKSGKDSHRLFKFNKLFGPAATQEDVFRD  405

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP+ ++  +WGVNYRALNDLF ISQ R S
Sbjct  406  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNASSVADWGVNYRALNDLFNISQKRHS  465

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  466  SIAYEIGVQMVEIYNEQV  483



>emb|CDM84045.1| unnamed protein product [Triticum aestivum]
Length=972

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGE+++ NPSKQ K+G R FKFN+++    +QA+VF+D
Sbjct  478  CRVRPFLPGQDGKSTAVDYIGENGEILISNPSKQGKDGYRMFKFNKIFNTHVSQAEVFSD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS  R +
Sbjct  538  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GKSKEDWGVNYRALNDLFDISLKRRN  596

Query  55   AFSYEVIVQMVEIYNEQV  2
             FSYEV VQMVEIYNEQV
Sbjct  597  TFSYEVEVQMVEIYNEQV  614



>ref|XP_008795115.1| PREDICTED: kinesin-4-like [Phoenix dactylifera]
Length=1061

 Score =   214 bits (546),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  K + ++Y+G++GEL+++NPSKQ K+G++ FKFN+VYGP+A+Q +VF D
Sbjct  502  CRIRPFLPGENRKSSTIDYIGEDGELVLVNPSKQGKDGQKMFKFNKVYGPAASQEEVFLD  561

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP   TEE  GVNYR LNDLF IS+TR  
Sbjct  562  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPHSPTEEERGVNYRILNDLFHISRTRRD  621

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YEV+VQM+EIYNEQV
Sbjct  622  TFMYEVVVQMIEIYNEQV  639



>ref|XP_006648475.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
[Oryza brachyantha]
Length=967

 Score =   214 bits (544),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF P + DK + VEY+GDNGEL++ NP+KQ KEG ++F FN+V+GP+ TQ  VF D
Sbjct  808  CRIRPFRPGEDDKSSSVEYIGDNGELVLSNPTKQGKEGGKNFTFNKVFGPTTTQDAVFKD  867

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKT+TM GP+ ATE+ WGVNYRALNDLF IS  R  
Sbjct  868  IQPLIRSVLDGYNVCIFAYGQTGSGKTHTMMGPEKATEKEWGVNYRALNDLFNISNDRRD  927

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YE+ VQMVEIYNEQ+
Sbjct  928  TITYELGVQMVEIYNEQI  945



>ref|XP_009391867.1| PREDICTED: kinesin KP1 [Musa acuminata subsp. malaccensis]
Length=936

 Score =   213 bits (543),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  KQ+ ++Y+G+NGEL+V+NPSK  K+G+R FKFN+V+G +ATQ QVF D
Sbjct  371  CRIRPFLPGENRKQSTIDYIGENGELLVVNPSKPGKDGQRMFKFNKVFGSTATQEQVFLD  430

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE+ WGVNYRALNDLF+IS +R  
Sbjct  431  TRPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPESATEKEWGVNYRALNDLFQISLSRRD  490

Query  55   AFSYEVIVQMVEIYNEQV  2
             + YEV VQMVEIYNEQV
Sbjct  491  TYLYEVGVQMVEIYNEQV  508



>gb|EEE56604.1| hypothetical protein OsJ_05972 [Oryza sativa Japonica Group]
Length=1438

 Score =   216 bits (549),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415   CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
             CR+RPF P + DK + VEY+GDNGEL++ NP+KQ KEG ++F FN+V+GP  TQ  VF D
Sbjct  928   CRIRPFRPGEDDKSSSVEYIGDNGELVLSNPTKQGKEGGKNFTFNKVFGPITTQDAVFKD  987

Query  235   IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             IQPLI+SVLDGYNVCIFAYGQTGSGKTYTM GP+ ATE+ WGVNYRALNDLF IS  R  
Sbjct  988   IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMMGPEKATEKEWGVNYRALNDLFNISHDRRD  1047

Query  55    AFSYEVIVQMVEIYNEQV  2
               +YE+ VQM+EIYNEQ+
Sbjct  1048  TITYELGVQMIEIYNEQI  1065



>gb|EEE64402.1| hypothetical protein OsJ_19246 [Oryza sativa Japonica Group]
Length=1016

 Score =   214 bits (544),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGEL++ NP KQ K+G R FKFN+V+ P ++QA+VF+D
Sbjct  486  CRVRPFLPGQDKKSTTVDYIGENGELLISNPFKQGKDGHRMFKFNKVFSPFSSQAEVFSD  545

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  546  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPS-TSKQDWGVNYRALNDLFDISLSRRN  604

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  605  AFSYEVGVQMVEIYNEQV  622



>gb|EEC80283.1| hypothetical protein OsI_22285 [Oryza sativa Indica Group]
Length=1016

 Score =   214 bits (544),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGEL++ NP KQ K+G R FKFN+V+ P ++QA+VF+D
Sbjct  486  CRVRPFLPGQDKKSTTVDYIGENGELLISNPFKQGKDGHRMFKFNKVFSPFSSQAEVFSD  545

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  546  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPS-TSKQDWGVNYRALNDLFDISLSRRN  604

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  605  AFSYEVGVQMVEIYNEQV  622



>ref|XP_004975905.1| PREDICTED: kinesin-4-like [Setaria italica]
Length=1024

 Score =   214 bits (544),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 89/138 (64%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRV+PF   Q D+++ V+++G+NGE+++ NP KQ K+GR+ F FN+++GP+A+Q++VFAD
Sbjct  382  CRVKPFPKSQSDQRSTVDHIGENGEIMIANPQKQGKDGRKVFTFNKIFGPNASQSEVFAD  441

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S++DG+NVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYR+LNDLF ISQTR  
Sbjct  442  TQPLIRSIMDGFNVCIFAYGQTGSGKTYTMSGPDVTTEETWGVNYRSLNDLFEISQTRAD  501

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +Y+V VQM+EIYNEQV
Sbjct  502  SITYDVKVQMIEIYNEQV  519



>ref|XP_008675058.1| PREDICTED: kinesin KP1-like [Zea mays]
 tpg|DAA57689.1| TPA: hypothetical protein ZEAMMB73_507843 [Zea mays]
Length=644

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T+++Y+G+NG++++ NP KQ K+  R FKFN+V+   A+Q +VF+D
Sbjct  164  CRVRPFLPGQDGKTTVIDYIGENGDILITNPFKQGKDACRMFKFNKVFNTRASQVEVFSD  223

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS +R +
Sbjct  224  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSKEDWGVNYRALNDLFYISLSRRN  282

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  283  AFSYEVGVQMVEIYNEQV  300



>ref|XP_006853662.1| hypothetical protein AMTR_s00056p00106770 [Amborella trichopoda]
 gb|ERN15129.1| hypothetical protein AMTR_s00056p00106770 [Amborella trichopoda]
Length=510

 Score =   208 bits (529),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 97/155 (63%), Positives = 121/155 (78%), Gaps = 17/155 (11%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q +KQT VEY+G+NGEL+++N SKQ ++G+R FKFN+V+GP+ATQ ++F D
Sbjct  336  CRVRPFLPGQVEKQTTVEYIGENGELLIVNRSKQGRDGQRMFKFNKVFGPTATQEEIFLD  395

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTM-----------------TGPDGATEENWGV  107
             +PL++SVLDGYNVCIFAYGQTGSGKT+TM                 TGPD ++EE+WGV
Sbjct  396  TRPLVRSVLDGYNVCIFAYGQTGSGKTFTMFYVLTKSPPKSSLLSYQTGPDMSSEEHWGV  455

Query  106  NYRALNDLFRISQTRGSAFSYEVIVQMVEIYNEQV  2
            NYRALNDLF IS++R   + YEV  QMVEIYNEQV
Sbjct  456  NYRALNDLFHISRSRKDTYGYEVGAQMVEIYNEQV  490



>ref|XP_008794166.1| PREDICTED: kinesin-4-like [Phoenix dactylifera]
Length=1077

 Score =   214 bits (544),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  +  K T ++Y+G++GEL+++NPSKQ K+GR+ FKFN+VY P+ATQ +VF D
Sbjct  505  CRIRPFLTGENQKSTTIDYIGEDGELVLVNPSKQGKDGRKMFKFNKVYDPAATQEEVFLD  564

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+  TE+ WGVNYRALNDLF IS++R  
Sbjct  565  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNSPTEKEWGVNYRALNDLFHISRSRRD  624

Query  55   AFSYEVIVQMVEIYNEQV  2
             F Y+V VQMVE+YNEQV
Sbjct  625  TFMYDVGVQMVEVYNEQV  642



>ref|NP_001056074.1| Os05g0521300 [Oryza sativa Japonica Group]
 dbj|BAF17988.1| Os05g0521300 [Oryza sativa Japonica Group]
Length=926

 Score =   212 bits (540),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K T V+Y+G+NGEL++ NP KQ K+G R FKFN+V+ P ++QA+VF+D
Sbjct  396  CRVRPFLPGQDKKSTTVDYIGENGELLISNPFKQGKDGHRMFKFNKVFSPFSSQAEVFSD  455

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  456  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPS-TSKQDWGVNYRALNDLFDISLSRRN  514

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  515  AFSYEVGVQMVEIYNEQV  532



>ref|XP_010533671.1| PREDICTED: kinesin-4 isoform X2 [Tarenaya hassleriana]
Length=1074

 Score =   213 bits (543),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP  Q K+  R FKFN+V+GP+ATQ +VF D
Sbjct  472  CRIRPFLPGQNKRQTTIEYIGENGELVVANPLNQGKDTHRLFKFNKVFGPTATQEEVFLD  531

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q R +
Sbjct  532  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFELTQNRQN  591

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  592  TVEYEVGVQMVEIYNEQV  609



>ref|XP_010533669.1| PREDICTED: kinesin-4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010533670.1| PREDICTED: kinesin-4 isoform X1 [Tarenaya hassleriana]
Length=1077

 Score =   213 bits (543),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP  Q K+  R FKFN+V+GP+ATQ +VF D
Sbjct  475  CRIRPFLPGQNKRQTTIEYIGENGELVVANPLNQGKDTHRLFKFNKVFGPTATQEEVFLD  534

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q R +
Sbjct  535  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFELTQNRQN  594

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  595  TVEYEVGVQMVEIYNEQV  612



>ref|XP_008668261.1| PREDICTED: uncharacterized protein LOC100381510 isoform X1 [Zea 
mays]
 tpg|DAA37392.1| TPA: hypothetical protein ZEAMMB73_988969 [Zea mays]
Length=1033

 Score =   213 bits (542),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 90/138 (65%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRV+PF   Q D+++ V+++G+NGE+++ NP KQ K+GR+ F FN+++GPS +Q++VFAD
Sbjct  384  CRVKPFPKAQSDQRSTVDHIGENGEILIANPQKQGKDGRKIFTFNKIFGPSTSQSEVFAD  443

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SV+DGYNVCIFAYGQTGSGKTYTM+GPD   EE WGVNYR+LNDLF ISQTR  
Sbjct  444  TQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPDVTAEETWGVNYRSLNDLFEISQTRAD  503

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +Y+V VQM+EIYNEQV
Sbjct  504  SITYDVKVQMIEIYNEQV  521



>ref|XP_009795668.1| PREDICTED: kinesin KP1 [Nicotiana sylvestris]
 ref|XP_009795669.1| PREDICTED: kinesin KP1 [Nicotiana sylvestris]
Length=932

 Score =   211 bits (538),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -2

Query  412  RVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFADI  233
            R+RPFLP Q  K T +EY+G+NGEL+V NPSKQ K+  R FKFN+V+ P+ATQ  VF D 
Sbjct  347  RIRPFLPGQSQKLTTIEYIGENGELVVTNPSKQGKDSHRLFKFNKVFAPAATQEDVFRDT  406

Query  232  QPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGSA  53
            QPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP  ++ E+WGVNYRALNDLF +SQ+R S+
Sbjct  407  QPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPSMSSVEDWGVNYRALNDLFNLSQSRKSS  466

Query  52   FSYEVIVQMVEIYNEQV  2
             +YE+ VQMVEIYNEQV
Sbjct  467  IAYEIGVQMVEIYNEQV  483



>emb|CDP13670.1| unnamed protein product [Coffea canephora]
Length=1145

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q D Q+ V+Y+GDNG+++++NP KQ KE RR F FN+V+G +ATQ Q++ D
Sbjct  441  CRVRPFLPGQSDGQSTVDYIGDNGDIMIVNPHKQGKEARRIFTFNKVFGTNATQQQIYMD  500

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTM+GPD   EE WGVNYRAL DLF IS+ R  
Sbjct  501  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLTAEETWGVNYRALRDLFHISKERME  560

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQM+EIYNEQV
Sbjct  561  FIEYEVGVQMIEIYNEQV  578



>ref|XP_007146665.1| hypothetical protein PHAVU_006G059300g [Phaseolus vulgaris]
 gb|ESW18659.1| hypothetical protein PHAVU_006G059300g [Phaseolus vulgaris]
Length=982

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+G+NG+++++NP K  K+ RR F FN+V+G + TQ Q++AD
Sbjct  286  CRVRPFLPGQSNGQSTVDYIGENGDMMIVNPLKHGKDSRRVFSFNKVFGTTVTQEQIYAD  345

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GPD  TE+ WGVNYRAL DLF IS+ R  
Sbjct  346  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLTTEDTWGVNYRALGDLFHISKERSD  405

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQM+EIYNEQV
Sbjct  406  SIKYEVFVQMIEIYNEQV  423



>ref|XP_004165900.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-4-like, partial [Cucumis 
sativus]
Length=762

 Score =   210 bits (535),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QKDK+  +EY+G+NGE+++ NP+K  KEG + FKFN+VY P++TQ +VF+D
Sbjct  244  CRIRPFLTGQKDKRMTIEYIGENGEVVIANPTKPGKEGHKLFKFNKVYSPASTQGEVFSD  303

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+GAT+ENWGVNYRALNDLF ISQ R  
Sbjct  304  IQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGATKENWGVNYRALNDLFEISQNRNG  363

Query  55   AFSYEV  38
            A SYEV
Sbjct  364  AISYEV  369



>ref|XP_003545084.1| PREDICTED: kinesin-4-like [Glycine max]
Length=1138

 Score =   213 bits (541),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+GDNG +++MNP KQ K+ RR F FN+V+  S TQ Q++AD
Sbjct  437  CRVRPFLPGQSNGQSTVDYIGDNGNIMIMNPHKQGKDARRVFSFNKVFATSTTQEQIYAD  496

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++S LDGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYRAL DLF IS+ R  
Sbjct  497  TQPLVRSALDGYNVCIFAYGQTGSGKTYTMSGPDLMTEETWGVNYRALRDLFHISKERAD  556

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQM+EIYNEQV
Sbjct  557  AIKYEVGVQMIEIYNEQV  574



>ref|XP_006405988.1| hypothetical protein EUTSA_v10027628mg [Eutrema salsugineum]
 gb|ESQ47441.1| hypothetical protein EUTSA_v10027628mg [Eutrema salsugineum]
Length=1065

 Score =   212 bits (539),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  472  CRIRPFLPGQNSRQTTIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQAATQEEVFLD  531

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++QTR +
Sbjct  532  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFHLTQTRQN  591

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  592  TVVYEVGVQMVEIYNEQV  609



>ref|XP_010473610.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=1072

 Score =   212 bits (539),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY+G+NGE++V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  478  CRIRPFLPGQNNRQTSIEYIGENGEMMVANPLKQGKDSHRLFKFNKVFGQAATQEEVFLD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  538  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  598  TVVYEVGVQMVEIYNEQV  615



>ref|XP_010473609.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=1073

 Score =   212 bits (539),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY+G+NGE++V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  478  CRIRPFLPGQNNRQTSIEYIGENGEMMVANPLKQGKDSHRLFKFNKVFGQAATQEEVFLD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  538  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  598  TVVYEVGVQMVEIYNEQV  615



>gb|EPS60229.1| hypothetical protein M569_14574, partial [Genlisea aurea]
Length=553

 Score =   207 bits (526),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  CRVRPFLP-KQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFA  239
            CR+RP L  +Q +KQT ++Y+G+NG+LIVMNPSK  K+G R FKFN+V+GPS  Q  V+ 
Sbjct  28   CRIRPLLSGQQSEKQTTIQYIGENGDLIVMNPSKPGKDGYRPFKFNKVFGPSVKQEDVYR  87

Query  238  DIQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRG  59
            D Q  I+SVLDGYNVCIFAYGQTGSGKTYTMTGP+GA+  +WGVNYRALNDLF+ SQ R 
Sbjct  88   DTQSFIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGASTLDWGVNYRALNDLFKCSQNRS  147

Query  58   SAFSYEVIVQMVEIYNEQV  2
             +  YE+ VQMVEIYNEQV
Sbjct  148  ISIDYEIKVQMVEIYNEQV  166



>gb|EPS68131.1| hypothetical protein M569_06641, partial [Genlisea aurea]
Length=466

 Score =   204 bits (520),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q +K T +EY+G+NGELIV NPSK  K  +R FKFN+V+ P++TQ +VF D
Sbjct  306  CRIRPFLPGQSEKLTTIEYIGENGELIVTNPSKLGKSSQRVFKFNKVFRPASTQEEVFQD  365

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGA-TEENWGVNYRALNDLFRISQTRG  59
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP G  +  +WGVNYRALNDLF I +TR 
Sbjct  366  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPGGGKSTGDWGVNYRALNDLFEILRTRY  425

Query  58   SAFSYEVIVQMVEIYNEQV  2
            ++ SY++ VQMVEIYNEQV
Sbjct  426  NSISYDIGVQMVEIYNEQV  444



>gb|KHN23820.1| Kinesin-4 [Glycine soja]
Length=1140

 Score =   212 bits (540),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+GDNG +++MNP KQ K+ RR F FN+V+  S TQ Q++AD
Sbjct  437  CRVRPFLPGQSNGQSTVDYIGDNGNIMIMNPHKQGKDARRVFSFNKVFATSTTQEQIYAD  496

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++S LDGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYRAL DLF IS+ R  
Sbjct  497  TQPLVRSALDGYNVCIFAYGQTGSGKTYTMSGPDLMTEETWGVNYRALRDLFHISKERAD  556

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQM+EIYNEQV
Sbjct  557  AIKYEVGVQMIEIYNEQV  574



>gb|EMS55440.1| Kinesin-4 [Triticum urartu]
Length=964

 Score =   211 bits (536),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  K +  E  GDNGELI+ NP+K  KEG + FKFN+V GP+ +Q +VF D
Sbjct  531  CRIRPFLPNEDHKSSTTEITGDNGELILANPTKIGKEGNKLFKFNKVLGPTTSQDEVFRD  590

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATEE  GVN+RALNDLF IS+ RG 
Sbjct  591  IQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPEDATEEELGVNFRALNDLFLISRNRGD  650

Query  55   AFSYEVIVQMVEIYNEQV  2
             F+YEV VQM+EIYNEQ+
Sbjct  651  TFNYEVSVQMIEIYNEQI  668



>ref|XP_004951394.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein 1-like [Setaria 
italica]
Length=1296

 Score =   213 bits (541),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF P + +K T VEY+G+NGEL++ NP+K+ KEG ++F FN+V+GP+ TQ  VF D
Sbjct  741  CRIRPFRPWEDEKSTSVEYIGENGELVLSNPTKKGKEGGKNFTFNKVFGPTTTQDMVFKD  800

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTM GP+ ATE+ WGVNYRALNDLF IS  R  
Sbjct  801  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMMGPENATEKEWGVNYRALNDLFNISHDRQD  860

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQMVEIYNEQ+
Sbjct  861  TIKYELGVQMVEIYNEQI  878



>ref|XP_010252852.1| PREDICTED: kinesin KP1 [Nelumbo nucifera]
Length=1114

 Score =   212 bits (539),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q D Q+ V+Y+ +NG ++++NP KQ K+ RR F FN+V+G +ATQ QVF D
Sbjct  436  CRVRPFLPGQSDGQSTVDYIDENGNIMIINPFKQGKDARRIFSFNKVFGANATQQQVFVD  495

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTM+GPD  T+E WGVNYRALNDLFRIS++R  
Sbjct  496  TQPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPDLTTQETWGVNYRALNDLFRISKSRMD  555

Query  55   AFSYEVIVQMVEIYNEQV  2
               Y V VQM+EIYNEQV
Sbjct  556  IIEYVVGVQMIEIYNEQV  573



>ref|XP_008656472.1| PREDICTED: kinesin-4 isoform X3 [Zea mays]
Length=787

 Score =   209 bits (533),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  491  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRMFKFNKVFTPFASQAEVFSD  550

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  551  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPT-TSKQDWGVNYRALNDLFDISLSRRN  609

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  610  AFSYEVGVQMVEIYNEQV  627



>ref|XP_002300575.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE85380.2| kinesin motor family protein [Populus trichocarpa]
Length=1057

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  +Q+ V+Y+G+NG ++++NP K  KE R+ F FN+V+G + TQ Q++ D
Sbjct  376  CRVRPFLPGQSSRQSAVDYIGENGNIMIVNPLKNGKEARKVFSFNKVFGSNVTQEQIYVD  435

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTM+GPD  +EE WGVNYRAL DLF+IS+TRG 
Sbjct  436  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLTSEETWGVNYRALRDLFQISKTRGD  495

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQM+EIYNEQV
Sbjct  496  VIKYEVGVQMIEIYNEQV  513



>ref|XP_008657237.1| PREDICTED: kinesin KP1 [Zea mays]
Length=964

 Score =   210 bits (535),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  K TI++Y+G+NGE+++ NP KQ K+  R FKFN+V+   A+QA+VF+D
Sbjct  485  CRVRPFLPGQDGKTTIIDYIGENGEILITNPFKQGKDVCRMFKFNKVFNTHASQAEVFSD  544

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP G ++E+WGVNYRALNDLF IS +R +
Sbjct  545  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGP-GTSKEDWGVNYRALNDLFDISLSRRN  603

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  604  AFSYEVGVQMVEIYNEQV  621



>ref|XP_009112752.1| PREDICTED: kinesin-4-like isoform X2 [Brassica rapa]
Length=1059

 Score =   211 bits (537),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  464  CRIRPFLPGQNSRQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQAATQEEVFLD  523

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF+++Q R +
Sbjct  524  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFQLTQIRRN  583

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQMVEIYNEQV
Sbjct  584  AVVYEVGVQMVEIYNEQV  601



>ref|XP_007142452.1| hypothetical protein PHAVU_008G281800g [Phaseolus vulgaris]
 ref|XP_007142453.1| hypothetical protein PHAVU_008G281800g [Phaseolus vulgaris]
 gb|ESW14446.1| hypothetical protein PHAVU_008G281800g [Phaseolus vulgaris]
 gb|ESW14447.1| hypothetical protein PHAVU_008G281800g [Phaseolus vulgaris]
Length=1134

 Score =   211 bits (538),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+G+NG +++MNP KQ K+ RR F FN+V+  SATQ Q++AD
Sbjct  436  CRVRPFLPGQPNGQSTVDYIGENGNIMIMNPLKQGKDARRVFSFNKVFATSATQEQIYAD  495

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++S LDGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYRAL DLF IS+ R  
Sbjct  496  TQPLVRSALDGYNVCIFAYGQTGSGKTYTMSGPDLMTEETWGVNYRALRDLFHISKERAD  555

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQM+EIYNEQV
Sbjct  556  AIKYEVGVQMIEIYNEQV  573



>gb|ADN33985.1| kinesin heavy chain [Cucumis melo subsp. melo]
Length=1214

 Score =   212 bits (539),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QKDK+  +EY+G+NGE+++ NP+K  KEG + FKFN+VY P++TQ +VF+D
Sbjct  699  CRIRPFLTGQKDKRMTIEYIGENGEVVIANPTKPGKEGHKLFKFNKVYSPASTQGEVFSD  758

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+GAT+ENWGVNYRALNDLF ISQ R  
Sbjct  759  IQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGATKENWGVNYRALNDLFEISQNRSG  818

Query  55   AFSYEV  38
            A SYEV
Sbjct  819  AISYEV  824



>ref|XP_009112751.1| PREDICTED: kinesin-4-like isoform X1 [Brassica rapa]
Length=1060

 Score =   211 bits (537),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  464  CRIRPFLPGQNSRQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQAATQEEVFLD  523

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF+++Q R +
Sbjct  524  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFQLTQIRRN  583

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQMVEIYNEQV
Sbjct  584  AVVYEVGVQMVEIYNEQV  601



>emb|CDY62807.1| BnaCnng41050D [Brassica napus]
Length=1067

 Score =   211 bits (536),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  465  CRIRPFLPGQNSRQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQAATQEEVFLD  524

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF+++Q R +
Sbjct  525  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFQLTQIRRN  584

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQMVEIYNEQV
Sbjct  585  AVVYEVGVQMVEIYNEQV  602



>emb|CDY45358.1| BnaA09g12430D [Brassica napus]
Length=1063

 Score =   211 bits (536),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  462  CRIRPFLPGQNSRQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQAATQEEVFLD  521

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF+++Q R +
Sbjct  522  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFQLTQIRRN  581

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQMVEIYNEQV
Sbjct  582  AVVYEVGVQMVEIYNEQV  599



>ref|XP_008647385.1| PREDICTED: uncharacterized protein LOC100193412 isoform X2 [Zea 
mays]
Length=1006

 Score =   210 bits (535),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  492  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRLFKFNKVFSPFASQAEVFSD  551

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  552  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPS-TSKQDWGVNYRALNDLFDISLSRRN  610

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  611  AFSYEVGVQMVEIYNEQV  628



>gb|KGN59396.1| hypothetical protein Csa_3G816090 [Cucumis sativus]
Length=1374

 Score =   212 bits (540),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QKDK+  +EY+G+NGE+++ NP+K  KEG + FKFN+VY P++TQ +VF+D
Sbjct  842  CRIRPFLTGQKDKRMTIEYIGENGEVVIANPTKPGKEGHKLFKFNKVYSPASTQGEVFSD  901

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+GAT+ENWGVNYRALNDLF ISQ R  
Sbjct  902  IQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGATKENWGVNYRALNDLFEISQNRNG  961

Query  55   AFSYEV  38
            A SYEV
Sbjct  962  AISYEV  967



>ref|XP_008647384.1| PREDICTED: uncharacterized protein LOC100193412 isoform X1 [Zea 
mays]
Length=1006

 Score =   210 bits (535),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  492  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRLFKFNKVFSPFASQAEVFSD  551

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  552  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPS-TSKQDWGVNYRALNDLFDISLSRRN  610

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  611  AFSYEVGVQMVEIYNEQV  628



>ref|XP_006300383.1| hypothetical protein CARUB_v10019703mg [Capsella rubella]
 gb|EOA33281.1| hypothetical protein CARUB_v10019703mg [Capsella rubella]
Length=1057

 Score =   210 bits (535),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY G+NGEL+V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  467  CRIRPFLPGQNNRQTTIEYTGENGELVVANPFKQGKDSHRLFKFNKVFGQAATQEEVFLD  526

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  527  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  586

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  587  TVMYEVGVQMVEIYNEQV  604



>gb|KHG17675.1| Kinesin-4 -like protein [Gossypium arboreum]
Length=622

 Score =   207 bits (526),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            C++R FLP Q  K + +E + +NG+L++ NPSK  K+G+RSFKFN+++GP ATQ +VFAD
Sbjct  198  CQIRLFLPGQTVKLSTIENISENGQLVIANPSKPGKDGQRSFKFNKIFGPDATQGEVFAD  257

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQP ++SV++GYNVCIFAYGQTGSGKTYTMTGP GATEE WGVNY  LN LF++SQ R S
Sbjct  258  IQPFVKSVVNGYNVCIFAYGQTGSGKTYTMTGPTGATEEEWGVNYLVLNHLFKVSQDRKS  317

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  318  NTVYEVAVQMVEIYNEQV  335



>gb|KHN43918.1| Kinesin-4 [Glycine soja]
Length=1136

 Score =   211 bits (536),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+G+NG +++MNP K+ K+ RR F FN+V+  SATQ Q++AD
Sbjct  437  CRVRPFLPGQSNGQSTVDYIGENGNIMIMNPLKEGKDARRVFSFNKVFATSATQEQIYAD  496

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++S LDGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYRAL DLF IS+ R  
Sbjct  497  TQPLVRSALDGYNVCIFAYGQTGSGKTYTMSGPDLMTEETWGVNYRALRDLFHISKERAD  556

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQM+EIYNEQV
Sbjct  557  AIKYEVGVQMIEIYNEQV  574



>gb|AET05326.2| kinesin motor catalytic domain protein [Medicago truncatula]
Length=1254

 Score =   211 bits (538),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  +K+KQ+IVE +G++ +L+V+NPSK+ K+  RSFKFN+++GP+ATQ  V+AD
Sbjct  520  CRIRPFLIDKKEKQSIVEDIGES-DLVVVNPSKEGKDVHRSFKFNKIFGPAATQGDVYAD  578

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQP ++SVLDGYNVCIFAYGQTGSGKTYTMTGP+GAT E  GVNYRALNDLFRIS +RGS
Sbjct  579  IQPFVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGATSEKLGVNYRALNDLFRISTSRGS  638

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQMVEIYNEQV
Sbjct  639  LIDYEIWVQMVEIYNEQV  656



>ref|XP_010431727.1| PREDICTED: kinesin-4-like [Camelina sativa]
Length=1015

 Score =   210 bits (534),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY+G+NGE++V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  478  CRIRPFLPGQNNRQTSIEYIGENGEMVVANPFKQGKDSHRLFKFNKVFGQAATQEEVFLD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  538  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  598  TVVYEVGVQMVEIYNEQV  615



>gb|AFW82518.1| hypothetical protein ZEAMMB73_648725 [Zea mays]
Length=686

 Score =   207 bits (528),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  326  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRMFKFNKVFTPFASQAEVFSD  385

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  386  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPT-TSKQDWGVNYRALNDLFDISLSRRN  444

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  445  AFSYEVGVQMVEIYNEQV  462



>ref|XP_003518562.1| PREDICTED: kinesin-4-like [Glycine max]
Length=1125

 Score =   211 bits (536),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+G+NG +++MNP K+ K+ RR F FN+V+  SATQ Q++AD
Sbjct  436  CRVRPFLPGQSNGQSTVDYIGENGNIMIMNPLKEGKDARRVFSFNKVFATSATQEQIYAD  495

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++S LDGYNVCIFAYGQTGSGKTYTM+GPD  TEE WGVNYRAL DLF IS+ R  
Sbjct  496  TQPLVRSALDGYNVCIFAYGQTGSGKTYTMSGPDLMTEETWGVNYRALRDLFHISKERAD  555

Query  55   AFSYEVIVQMVEIYNEQV  2
            A  YEV VQM+EIYNEQV
Sbjct  556  AVKYEVGVQMIEIYNEQV  573



>ref|XP_004136617.1| PREDICTED: uncharacterized protein LOC101213894 [Cucumis sativus]
Length=1217

 Score =   211 bits (537),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  QKDK+  +EY+G+NGE+++ NP+K  KEG + FKFN+VY P++TQ +VF+D
Sbjct  699  CRIRPFLTGQKDKRMTIEYIGENGEVVIANPTKPGKEGHKLFKFNKVYSPASTQGEVFSD  758

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKTYTMTGP+GAT+ENWGVNYRALNDLF ISQ R  
Sbjct  759  IQPLVRSVLDGYNVCIFAYGQTGSGKTYTMTGPNGATKENWGVNYRALNDLFEISQNRNG  818

Query  55   AFSYEV  38
            A SYEV
Sbjct  819  AISYEV  824



>ref|XP_010418391.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=1072

 Score =   210 bits (534),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY+G+NGE++V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  478  CRIRPFLPGQNNRQTSIEYIGENGEMVVANPFKQGKDSHRLFKFNKVFGQAATQEEVFLD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  538  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  598  TVVYEVGVQMVEIYNEQV  615



>ref|XP_010418390.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=1073

 Score =   210 bits (534),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY+G+NGE++V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  478  CRIRPFLPGQNNRQTSIEYIGENGEMVVANPFKQGKDSHRLFKFNKVFGQAATQEEVFLD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  538  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  598  TVVYEVGVQMVEIYNEQV  615



>ref|XP_010418392.1| PREDICTED: kinesin-4-like isoform X3 [Camelina sativa]
Length=1072

 Score =   210 bits (534),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY+G+NGE++V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  478  CRIRPFLPGQNNRQTSIEYIGENGEMVVANPFKQGKDSHRLFKFNKVFGQAATQEEVFLD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  538  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  598  TVVYEVGVQMVEIYNEQV  615



>ref|XP_010418393.1| PREDICTED: kinesin-4-like isoform X4 [Camelina sativa]
Length=1073

 Score =   210 bits (534),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q ++QT +EY+G+NGE++V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  478  CRIRPFLPGQNNRQTSIEYIGENGEMVVANPFKQGKDSHRLFKFNKVFGQAATQEEVFLD  537

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  538  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  597

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  598  TVVYEVGVQMVEIYNEQV  615



>ref|XP_002868605.1| hypothetical protein ARALYDRAFT_330390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44864.1| hypothetical protein ARALYDRAFT_330390 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   209 bits (533),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  KQT +EY G+NGEL+V NP KQ K+  R FKFN+V+GP++TQ +VF D
Sbjct  433  CRIRPFLQGQNKKQTSIEYTGENGELVVANPLKQGKDTYRLFKFNKVFGPASTQEEVFLD  492

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   +EE+WGVNYRALNDLF ++Q+R +
Sbjct  493  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSEEDWGVNYRALNDLFHLTQSRQN  552

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  553  SVIYEVDVQMVEIYNEQV  570



>emb|CDY34366.1| BnaA09g11080D [Brassica napus]
Length=1042

 Score =   209 bits (533),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q +KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G ++TQ +VF D
Sbjct  477  CRIRPFLPGQNNKQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQASTQEEVFLD  536

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF+++Q R +
Sbjct  537  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFQLTQIRKN  596

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  597  TVVYEVGVQMVEIYNEQV  614



>ref|XP_009392079.1| PREDICTED: kinesin KP1 [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   209 bits (533),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLPKQ D+++ VE++G+NG +++++ +KQ K+ R+ F FN+V+G + TQ+++F D
Sbjct  405  CRVRPFLPKQSDRRSTVEHIGENGNIVIVDHNKQGKDARKIFAFNKVFGENTTQSEIFFD  464

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVC+FAYGQTGSGKTYTM+GPD   EE WGVNYRALNDLF ISQ+R  
Sbjct  465  TQPLIRSVLDGYNVCVFAYGQTGSGKTYTMSGPDITAEETWGVNYRALNDLFEISQSRQG  524

Query  55   AFSYEVIVQMVEIYNEQV  2
              SYEV VQM+EIYNEQV
Sbjct  525  IISYEVSVQMIEIYNEQV  542



>ref|XP_004512859.1| PREDICTED: kinesin-4-like [Cicer arietinum]
Length=1013

 Score =   209 bits (532),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  +K+KQ+IVE +G+N +L+V NPS++ K+  RSFKFN+++GP+ATQ  V++D
Sbjct  515  CRIRPFLVGKKEKQSIVEDIGEN-DLVVANPSREGKDAIRSFKFNKIFGPAATQVDVYSD  573

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPL++SVLDGYNVCIFAYGQTGSGKT+TMTGP+GAT E  GVNYRALNDLF+IS +R S
Sbjct  574  IQPLVRSVLDGYNVCIFAYGQTGSGKTFTMTGPNGATNETLGVNYRALNDLFKISTSRAS  633

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQMVEIYNEQV
Sbjct  634  FIDYEIWVQMVEIYNEQV  651



>gb|AES70665.2| kinesin heavy chain [Medicago truncatula]
Length=1104

 Score =   210 bits (534),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+G+NG+++++NP KQ K+ RR F FN+V+G S TQ Q++AD
Sbjct  443  CRVRPFLPGQSNGQSTVDYIGENGDMMIVNPIKQGKDARRVFSFNKVFGTSVTQEQIYAD  502

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVC+FAYGQTGSGKTYTM+GPD + E+ WGVNYRAL DLF IS+ R  
Sbjct  503  TQPLIRSVLDGYNVCVFAYGQTGSGKTYTMSGPDLSAEDTWGVNYRALRDLFYISKERSD  562

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQM+EIYNEQV
Sbjct  563  SIIYEVFVQMIEIYNEQV  580



>ref|XP_006857693.1| hypothetical protein AMTR_s00061p00165490 [Amborella trichopoda]
 gb|ERN19160.1| hypothetical protein AMTR_s00061p00165490 [Amborella trichopoda]
Length=1139

 Score =   210 bits (534),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q D Q+ V+Y+G+NG ++++NP K  K+ RR F FN+V+G +A Q QVFAD
Sbjct  447  CRVRPFLPGQSDGQSTVDYIGENGNIMIVNPDKSGKDARRMFTFNKVFGTNAMQDQVFAD  506

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+   E+ WGVNYRAL DLF+IS+ R  
Sbjct  507  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPELMDEDTWGVNYRALRDLFQISKDRMD  566

Query  55   AFSYEVIVQMVEIYNEQV  2
              +YEV VQM+EIYNEQV
Sbjct  567  VITYEVSVQMIEIYNEQV  584



>gb|AES76706.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=854

 Score =   208 bits (529),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+KQTIVE +G++ +L+V NPSKQ KE  ++FKFN+++GPS+TQ +V+ D
Sbjct  482  CRIRPFLPGQKEKQTIVERIGES-DLVVANPSKQGKEALKTFKFNKIFGPSSTQVEVYND  540

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQ  I+SVLDGYNVCIFAYGQTGSGKTYTM+GP+GA+ EN GVNYRALNDLF IS +R S
Sbjct  541  IQAFIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNGASNENLGVNYRALNDLFNISSSRQS  600

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQ++EIYNEQV
Sbjct  601  SIVYEIGVQIIEIYNEQV  618



>ref|XP_003600414.1| Kinesin-4 [Medicago truncatula]
Length=1123

 Score =   209 bits (533),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q + Q+ V+Y+G+NG+++++NP KQ K+ RR F FN+V+G S TQ Q++AD
Sbjct  443  CRVRPFLPGQSNGQSTVDYIGENGDMMIVNPIKQGKDARRVFSFNKVFGTSVTQEQIYAD  502

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVC+FAYGQTGSGKTYTM+GPD + E+ WGVNYRAL DLF IS+ R  
Sbjct  503  TQPLIRSVLDGYNVCVFAYGQTGSGKTYTMSGPDLSAEDTWGVNYRALRDLFYISKERSD  562

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQM+EIYNEQV
Sbjct  563  SIIYEVFVQMIEIYNEQV  580



>ref|XP_008656471.1| PREDICTED: kinesin KP1 isoform X2 [Zea mays]
Length=799

 Score =   207 bits (528),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  283  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRMFKFNKVFTPFASQAEVFSD  342

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  343  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPT-TSKQDWGVNYRALNDLFDISLSRRN  401

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  402  AFSYEVGVQMVEIYNEQV  419



>ref|XP_010441293.1| PREDICTED: kinesin KP1-like [Camelina sativa]
Length=1000

 Score =   209 bits (531),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  KQT +EY G+NGEL+V NP KQ K+  R FKFN+V+GP++TQ +VF D
Sbjct  448  CRIRPFLQGQNKKQTSIEYTGENGELVVANPLKQGKDTHRLFKFNKVFGPASTQEEVFLD  507

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM GP  ++EE+WGVNYRALNDLF ++Q+R  
Sbjct  508  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMIGPSISSEEDWGVNYRALNDLFHLTQSRQE  567

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  568  SVIYEVGVQMVEIYNEQV  585



>ref|XP_008656473.1| PREDICTED: kinesin KP1 isoform X4 [Zea mays]
Length=718

 Score =   207 bits (526),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  202  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRMFKFNKVFTPFASQAEVFSD  261

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  262  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPT-TSKQDWGVNYRALNDLFDISLSRRN  320

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  321  AFSYEVGVQMVEIYNEQV  338



>ref|XP_008656470.1| PREDICTED: kinesin-4 isoform X1 [Zea mays]
Length=1007

 Score =   209 bits (531),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  491  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRMFKFNKVFTPFASQAEVFSD  550

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  551  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPT-TSKQDWGVNYRALNDLFDISLSRRN  609

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  610  AFSYEVGVQMVEIYNEQV  627



>ref|XP_008240320.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-2 [Prunus mume]
Length=1135

 Score =   209 bits (533),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q++K+T+VE+VG+NGEL+V + SK        FKFN+V+G  ATQA+V++D
Sbjct  628  CRIRPFLPGQREKRTLVEHVGENGELVVADRSKPXXX--XXFKFNKVFGSDATQAEVYSD  685

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ +T+ENWGVN+RALNDLF ISQ R S
Sbjct  686  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPNSSTKENWGVNFRALNDLFDISQCRKS  745

Query  55   AFSYEVIVQMVEIYNEQV  2
            + +YE+ VQMVEIYNEQV
Sbjct  746  SITYEIGVQMVEIYNEQV  763



>emb|CDY25511.1| BnaC09g11360D [Brassica napus]
Length=1042

 Score =   209 bits (531),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G +ATQ +VF D
Sbjct  477  CRIRPFLPGQNSRQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQAATQEEVFLD  536

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q R +
Sbjct  537  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFNLTQIRQN  596

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  597  TVVYEVGVQMVEIYNEQV  614



>ref|XP_009112934.1| PREDICTED: kinesin-4-like isoform X2 [Brassica rapa]
Length=1070

 Score =   209 bits (531),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G ++TQ +VF D
Sbjct  477  CRIRPFLPGQNSKQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQASTQEEVFLD  536

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF+++Q R +
Sbjct  537  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFQLTQIRQN  596

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  597  TVVYEVGVQMVEIYNEQV  614



>ref|XP_003620488.1| Kinesin [Medicago truncatula]
Length=723

 Score =   206 bits (525),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 119/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+KQTIVE +G++ +L+V NPSKQ KE  ++FKFN+++GPS+TQ +V+ D
Sbjct  494  CRIRPFLPGQKEKQTIVERIGES-DLVVANPSKQGKEALKTFKFNKIFGPSSTQVEVYND  552

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQ  I+SVLDGYNVCIFAYGQTGSGKTYTM+GP+GA+ EN GVNYRALNDLF IS +R S
Sbjct  553  IQAFIRSVLDGYNVCIFAYGQTGSGKTYTMSGPNGASNENLGVNYRALNDLFNISSSRQS  612

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YE+ VQ++EIYNEQV
Sbjct  613  SIVYEIGVQIIEIYNEQV  630



>ref|XP_009112933.1| PREDICTED: kinesin-4-like isoform X1 [Brassica rapa]
Length=1071

 Score =   209 bits (531),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  KQT +EY+G+NGEL+V NP KQ K+  R FKFN+V+G ++TQ +VF D
Sbjct  477  CRIRPFLPGQNSKQTSIEYIGENGELVVANPFKQGKDTHRLFKFNKVFGQASTQEEVFLD  536

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF+++Q R +
Sbjct  537  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFQLTQIRQN  596

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  597  TVVYEVGVQMVEIYNEQV  614



>ref|XP_006580580.1| PREDICTED: kinesin-4-like isoform X4 [Glycine max]
Length=1080

 Score =   209 bits (531),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q    T +E+VGD+GELIV NP KQ KE R+ FKFN+V+G + +Q ++F D
Sbjct  496  CRIRPFLPGQSQSHTTIEFVGDDGELIVGNPLKQGKENRKLFKFNKVFGQATSQGEIFKD  555

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  +++ +WGVNYRAL+DLF ISQ+R S
Sbjct  556  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGLSSKSDWGVNYRALHDLFHISQSRRS  615

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  616  SIVYEVGVQMVEIYNEQV  633



>ref|XP_006580577.1| PREDICTED: kinesin-4-like isoform X1 [Glycine max]
 ref|XP_006580578.1| PREDICTED: kinesin-4-like isoform X2 [Glycine max]
 ref|XP_006580579.1| PREDICTED: kinesin-4-like isoform X3 [Glycine max]
Length=1086

 Score =   209 bits (531),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q    T +E+VGD+GELIV NP KQ KE R+ FKFN+V+G + +Q ++F D
Sbjct  502  CRIRPFLPGQSQSHTTIEFVGDDGELIVGNPLKQGKENRKLFKFNKVFGQATSQGEIFKD  561

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  +++ +WGVNYRAL+DLF ISQ+R S
Sbjct  562  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGLSSKSDWGVNYRALHDLFHISQSRRS  621

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  622  SIVYEVGVQMVEIYNEQV  639



>gb|AFW82519.1| hypothetical protein ZEAMMB73_648725 [Zea mays]
Length=842

 Score =   207 bits (526),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  326  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRMFKFNKVFTPFASQAEVFSD  385

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  386  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPT-TSKQDWGVNYRALNDLFDISLSRRN  444

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  445  AFSYEVGVQMVEIYNEQV  462



>gb|AFW82517.1| kinesin heavy chain [Zea mays]
Length=842

 Score =   207 bits (526),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFL  Q  K T ++Y+G+NGEL++ NP KQ K+G R FKFN+V+ P A+QA+VF+D
Sbjct  326  CRVRPFLSGQDKKSTTIDYMGENGELLISNPFKQGKDGHRMFKFNKVFTPFASQAEVFSD  385

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDG+NVCIFAYGQTGSGKTYTM+GP   ++++WGVNYRALNDLF IS +R +
Sbjct  386  IQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPT-TSKQDWGVNYRALNDLFDISLSRRN  444

Query  55   AFSYEVIVQMVEIYNEQV  2
            AFSYEV VQMVEIYNEQV
Sbjct  445  AFSYEVGVQMVEIYNEQV  462



>gb|AAK91816.1|AF272753_1 kinesin heavy chain [Zea mays]
Length=407

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  EYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFADIQPLIQSVLDGYNVCIF  185
            +YVGDNG+LI+ NP++  KEG +SFKFN+V+GP+ +Q  VF DI+PLI+SVLDGYNVCIF
Sbjct  1    KYVGDNGDLIIANPTRHGKEGSKSFKFNKVFGPTTSQDDVFKDIEPLIRSVLDGYNVCIF  60

Query  184  AYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGSAFSYEVIVQMVEIYNEQ  5
            AYGQTGSGKTYTMTGP+ ATE  WGVNYRALNDLF IS  RG    YE+ VQM+EIYNEQ
Sbjct  61   AYGQTGSGKTYTMTGPENATENEWGVNYRALNDLFHISHNRGDTIMYEINVQMIEIYNEQ  120

Query  4    V  2
            +
Sbjct  121  I  121



>dbj|BAJ94982.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   205 bits (522),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP +  K +  E++GDNGEL++ +P+K  KEG + FKFN+V GP+ +Q +VF D
Sbjct  64   CRIRPFLPNEDHKSSTTEFIGDNGELVLADPTKNGKEGSKLFKFNKVLGPTISQDEVFKD  123

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQPLI+SVLDGYNVCIFAYGQTGSGKTYTMTGP+ ATE+  GVN+RALNDLF IS  R  
Sbjct  124  IQPLIRSVLDGYNVCIFAYGQTGSGKTYTMTGPEDATEQELGVNFRALNDLFFISCNRRD  183

Query  55   AFSYEVIVQMVEIYNEQV  2
             F YE+ VQM+EIYNEQ+
Sbjct  184  TFKYEISVQMIEIYNEQI  201



>ref|XP_006855341.1| hypothetical protein AMTR_s00057p00096030 [Amborella trichopoda]
 gb|ERN16808.1| hypothetical protein AMTR_s00057p00096030 [Amborella trichopoda]
Length=1075

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  + + V+Y+GD G L ++NP KQ K+ RRSF FN+V+GPS TQA+VFAD
Sbjct  445  CRVRPFLPGQASRSSTVDYIGD-GNLTILNPLKQGKDARRSFNFNKVFGPSTTQAEVFAD  503

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM GP   TE++ GVNYRAL+DLF IS+ R  
Sbjct  504  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMNGPKEITEQSRGVNYRALSDLFCISEQRRD  563

Query  55   AFSYEVIVQMVEIYNEQV  2
             FSYEV VQM+EIYNEQV
Sbjct  564  TFSYEVSVQMIEIYNEQV  581



>ref|XP_002886395.1| hypothetical protein ARALYDRAFT_474991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62654.1| hypothetical protein ARALYDRAFT_474991 [Arabidopsis lyrata subsp. 
lyrata]
Length=1065

 Score =   208 bits (530),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q  +QT +EY+G+NGEL+V NP KQ K+  R FKFN+V+  +ATQ +VF D
Sbjct  476  CRIRPFLPGQNSRQTTIEYIGENGELVVANPFKQGKDTHRLFKFNKVFDQAATQEEVFLD  535

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   ++E+WGVNYRALNDLF ++Q+R +
Sbjct  536  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSITSKEDWGVNYRALNDLFLLTQSRQN  595

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  596  SVMYEVGVQMVEIYNEQV  613



>ref|XP_006584721.1| PREDICTED: kinesin-4-like isoform X1 [Glycine max]
 ref|XP_006584722.1| PREDICTED: kinesin-4-like isoform X2 [Glycine max]
Length=1082

 Score =   208 bits (530),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q    T +E+VGD+GELIV NP KQ KE R+ FKFN+V+G + +Q ++F D
Sbjct  498  CRIRPFLPGQSQSHTTIEFVGDDGELIVGNPLKQGKENRKLFKFNKVFGQATSQEEIFKD  557

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  +++ +WGVNYRAL+DLF ISQ+R S
Sbjct  558  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGLSSKSDWGVNYRALHDLFHISQSRRS  617

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  618  SIVYEVGVQMVEIYNEQV  635



>ref|XP_008645618.1| PREDICTED: kinesin KP1-like [Zea mays]
Length=653

 Score =   205 bits (521),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 92/138 (67%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPF P + +K T VEY+G+NGEL++ NP+K+ KE  ++F FN+V+GP+ATQ  VF D
Sbjct  108  CRIRPFRPWEDEKSTSVEYIGENGELVLSNPTKKGKEAGKNFTFNKVFGPTATQDMVFND  167

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            I+PLI+SVLDGYNVCIFAYGQTGSGKT+TM GP+ ATE+ WGVNYRALNDLF IS  R  
Sbjct  168  IRPLIRSVLDGYNVCIFAYGQTGSGKTHTMMGPENATEKEWGVNYRALNDLFNISHDRRD  227

Query  55   AFSYEVIVQMVEIYNEQV  2
               YE+ VQMVEIYNEQ+
Sbjct  228  TIKYELGVQMVEIYNEQI  245



>ref|XP_010447313.1| PREDICTED: kinesin KP1 [Camelina sativa]
Length=997

 Score =   207 bits (527),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  KQT +EY G+NGEL+V NP KQ K+  R F FN+V+GP++TQ +VF D
Sbjct  448  CRIRPFLQGQNKKQTSIEYTGENGELVVANPLKQGKDTHRLFNFNKVFGPASTQEEVFLD  507

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             +PLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP  ++EE+WGVNYRALNDLF ++Q+R  
Sbjct  508  TRPLIRSILDGYNVCIFAYGQTGSGKTYTMSGPSISSEEDWGVNYRALNDLFHLTQSRQE  567

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  YEV VQMVEIYNEQV
Sbjct  568  SVIYEVGVQMVEIYNEQV  585



>ref|XP_011039821.1| PREDICTED: kinesin KP1-like isoform X2 [Populus euphratica]
Length=1068

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  +Q+ V+Y+G+NG ++++NP K  KE R+ F FN+V+G + TQ Q++ D
Sbjct  374  CRVRPFLPGQSSRQSAVDYIGENGNIMIVNPLKNGKEARKVFSFNKVFGSNVTQEQIYVD  433

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTM+GPD  +EE WGVNYRAL DLF+IS+TR  
Sbjct  434  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLTSEETWGVNYRALRDLFQISKTRRD  493

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQM+EIYNEQV
Sbjct  494  VIKYEVGVQMIEIYNEQV  511



>gb|KHN23642.1| Kinesin-4, partial [Glycine soja]
Length=1081

 Score =   207 bits (528),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP Q    T +E+VGD+GELIV NP KQ KE R+ FKFN+V+G + +Q ++F D
Sbjct  497  CRIRPFLPGQSQSHTTIEFVGDDGELIVGNPLKQGKENRKLFKFNKVFGQATSQGEIFKD  556

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+SVLDGYNVCIFAYGQTGSGKTYTM+GP  +++ +WGVNYRAL+DLF ISQ+R S
Sbjct  557  TQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPGLSSKSDWGVNYRALHDLFHISQSRRS  616

Query  55   AFSYEVIVQMVEIYNEQ  5
            +  YEV VQMVEIYNEQ
Sbjct  617  SIVYEVGVQMVEIYNEQ  633



>ref|XP_011039818.1| PREDICTED: kinesin KP1-like isoform X1 [Populus euphratica]
 ref|XP_011039819.1| PREDICTED: kinesin KP1-like isoform X1 [Populus euphratica]
 ref|XP_011039820.1| PREDICTED: kinesin KP1-like isoform X1 [Populus euphratica]
Length=1131

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CRVRPFLP Q  +Q+ V+Y+G+NG ++++NP K  KE R+ F FN+V+G + TQ Q++ D
Sbjct  437  CRVRPFLPGQSSRQSAVDYIGENGNIMIVNPLKNGKEARKVFSFNKVFGSNVTQEQIYVD  496

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPL++SVLDGYNVCIFAYGQTGSGKTYTM+GPD  +EE WGVNYRAL DLF+IS+TR  
Sbjct  497  TQPLVRSVLDGYNVCIFAYGQTGSGKTYTMSGPDLTSEETWGVNYRALRDLFQISKTRRD  556

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQM+EIYNEQV
Sbjct  557  VIKYEVGVQMIEIYNEQV  574



>emb|CDY46382.1| BnaC04g33010D [Brassica napus]
Length=916

 Score =   206 bits (524),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 94/138 (68%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFL  Q  K+T +EY G+NGEL+V NP KQ K+  R FKFN+V+GPS+TQ +VF D
Sbjct  450  CRIRPFLKGQNKKETSIEYTGENGELVVANPLKQGKDTHRFFKFNKVFGPSSTQEEVFLD  509

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
             QPLI+S+LDGYNVCIFAYGQTGSGKTYTM+GP   +EE+WGVNYRALNDLF ++Q+  +
Sbjct  510  TQPLIRSLLDGYNVCIFAYGQTGSGKTYTMSGPSINSEEHWGVNYRALNDLFHLTQSSQN  569

Query  55   AFSYEVIVQMVEIYNEQV  2
               YEV VQMVEIYNEQV
Sbjct  570  TVMYEVGVQMVEIYNEQV  587



>gb|KHN32041.1| Kinesin-4, partial [Glycine soja]
Length=786

 Score =   205 bits (522),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 93/138 (67%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -2

Query  415  CRVRPFLPKQKDKQTIVEYVGDNGELIVMNPSKQAKEGRRSFKFNRVYGPSATQAQVFAD  236
            CR+RPFLP QK+KQ+IVE++G+  +L+V NP+KQ KE  R+FKFN+V+GP++TQA+V+AD
Sbjct  417  CRLRPFLPGQKEKQSIVEHIGET-DLVVANPAKQGKEALRTFKFNKVFGPTSTQAEVYAD  475

Query  235  IQPLIQSVLDGYNVCIFAYGQTGSGKTYTMTGPDGATEENWGVNYRALNDLFRISQTRGS  56
            IQ  I+SVLDG+NVCIFAYGQTGSGKTYTM+GP+GAT E+ GVNYRALNDLF IS +R  
Sbjct  476  IQAFIRSVLDGFNVCIFAYGQTGSGKTYTMSGPNGATTESLGVNYRALNDLFSISTSRKG  535

Query  55   AFSYEVIVQMVEIYNEQV  2
            +  Y++ VQ++EIYNEQV
Sbjct  536  SIEYDIGVQIIEIYNEQV  553



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517347226690