BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33480_g1_i1 len=707 path=[685:0-706]

Length=707
                                                                      Score     E

emb|CDO99613.1|  unnamed protein product                              53.9    2e-06   
gb|KHN00117.1|  hypothetical protein glysoja_028645                   50.4    4e-05   
gb|KHN07308.1|  hypothetical protein glysoja_027398                   50.1    5e-05   
ref|XP_002521420.1|  conserved hypothetical protein                   48.9    1e-04   Ricinus communis
gb|KHN08574.1|  hypothetical protein glysoja_014339                   48.1    2e-04   
gb|KCW74651.1|  hypothetical protein EUGRSUZ_E03373                   47.8    3e-04   
gb|KEH31138.1|  hypothetical protein MTR_4g090545                     47.4    4e-04   
gb|KCW74649.1|  hypothetical protein EUGRSUZ_E03371                   48.1    4e-04   
ref|XP_002521422.1|  conserved hypothetical protein                   47.0    6e-04   Ricinus communis
ref|XP_007159265.1|  hypothetical protein PHAVU_002G223500g           47.0    7e-04   
emb|CBI18596.3|  unnamed protein product                              47.0    8e-04   



>emb|CDO99613.1| unnamed protein product [Coffea canephora]
Length=62

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = -1

Query  395  LPKRGQVKVAVVLGLAHSLSSIFSFGA  315
            +PKRGQVKVA+VLGLAHSLSSIFSFGA
Sbjct  26   IPKRGQVKVAIVLGLAHSLSSIFSFGA  52



>gb|KHN00117.1| hypothetical protein glysoja_028645 [Glycine soja]
Length=64

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = -1

Query  458  MAKARAEMSMTGKVQYRRR---QPLPKRGQVKVAVVLGLAHSLSSIFS  324
            MA ARA   M G   + RR   +P+PKRGQVKV +V+GLA+S+ SIFS
Sbjct  1    MAGARASGMMNGGRSFPRRFSGRPIPKRGQVKVGIVVGLANSVVSIFS  48



>gb|KHN07308.1| hypothetical protein glysoja_027398 [Glycine soja]
Length=64

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = -1

Query  458  MAKARAEMSMTGKVQYRRR---QPLPKRGQVKVAVVLGLAHSLSSIFS  324
            MA ARA   + G   + RR   +P+PKRGQVKV +V+GLA+S++SIFS
Sbjct  1    MAGARASGMINGGRSFPRRFSGRPIPKRGQVKVGIVVGLANSVASIFS  48



>ref|XP_002521420.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40910.1| conserved hypothetical protein [Ricinus communis]
Length=58

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 7/51 (14%)
 Frame = -1

Query  458  MAKARAEMSMTG-----KVQYRRRQPLPKRGQVKVAVVLGLAHSLSSIFSF  321
            MA A A  SM       ++QY R   +PKRGQVKVA+VLGLAHS +SIFSF
Sbjct  1    MAAAGAGRSMMNSRSFSQLQYGRL--IPKRGQVKVAIVLGLAHSFASIFSF  49



>gb|KHN08574.1| hypothetical protein glysoja_014339 [Glycine soja]
Length=59

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -1

Query  401  QPLPKRGQVKVAVVLGLAHSLSSIFS  324
            +P+PKRGQVKVA+VLGLAHSL++IFS
Sbjct  19   RPIPKRGQVKVAIVLGLAHSLAAIFS  44



>gb|KCW74651.1| hypothetical protein EUGRSUZ_E03373 [Eucalyptus grandis]
Length=73

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 7/49 (14%)
 Frame = -1

Query  458  MAKARA-EMS---MTGKVQYRRRQPLPKRGQVKVAVVLGLAHSLSSIFS  324
            MA +R+ EMS   ++G++  R   P+PKRGQVKV +V+GLAHS++SIFS
Sbjct  17   MAISRSGEMSGGGVSGRISSR---PIPKRGQVKVGIVVGLAHSVASIFS  62



>gb|KEH31138.1| hypothetical protein MTR_4g090545 [Medicago truncatula]
Length=60

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  416  QYRRRQPLPKRGQVKVAVVLGLAHSLSSIFSFG  318
            Q   R+P+PKRGQVKV +V+GLA+S++SIFS G
Sbjct  19   QRNSRRPIPKRGQVKVGIVVGLANSVASIFSRG  51



>gb|KCW74649.1| hypothetical protein EUGRSUZ_E03371, partial [Eucalyptus grandis]
Length=97

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = -1

Query  434  SMTGKVQYRRRQPLPKRGQVKVAVVLGLAHSLSSIFS  324
            S++G++  R   P+PKRGQVKV +V+GLAHS++SIFS
Sbjct  53   SVSGRISSR---PIPKRGQVKVGIVVGLAHSVASIFS  86



>ref|XP_002521422.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40912.1| conserved hypothetical protein [Ricinus communis]
Length=62

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 3/43 (7%)
 Frame = -1

Query  443  AEMSMTGKVQYRRR---QPLPKRGQVKVAVVLGLAHSLSSIFS  324
            A M M    +  RR   +P+PKRGQVKV +V+GLAHS++SIFS
Sbjct  4    ARMGMMSDRKVSRRLSGRPIPKRGQVKVGIVVGLAHSVASIFS  46



>ref|XP_007159265.1| hypothetical protein PHAVU_002G223500g [Phaseolus vulgaris]
 gb|ESW31259.1| hypothetical protein PHAVU_002G223500g [Phaseolus vulgaris]
Length=62

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -1

Query  458  MAKARAEMSMTGKVQYRR--RQPLPKRGQVKVAVVLGLAHSLSSIFS  324
            MA +RA   + G+   RR   +P PKRGQVKV +VLGLA+S++SIFS
Sbjct  1    MAGSRASSMINGRSIPRRFSGRPSPKRGQVKVGIVLGLANSVASIFS  47



>emb|CBI18596.3| unnamed protein product [Vitis vinifera]
Length=76

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -1

Query  458  MAKARAEMSMTGKVQYRRR-QPLPKRGQVKVAVVLGLAHSLSSIFS  324
            +  AR  +   G+   R   +PLPKRGQVKV +V+G+AHS +SIFS
Sbjct  17   VTNARKGIGNGGRFSKRHSGRPLPKRGQVKVGIVVGIAHSFASIFS  62



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1156001164318