BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33414_g1_i1 len=1166 path=[1:0-1165]

Length=1166
                                                                      Score     E

ref|XP_009614832.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    434   2e-148   
ref|XP_004243885.2|  PREDICTED: beta-1,3-galactosyltransferase pv...    432   2e-147   
ref|XP_009771013.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    431   3e-147   
emb|CDP01700.1|  unnamed protein product                                421   2e-143   
ref|XP_011096931.1|  PREDICTED: beta-1,3-galactosyltransferase sq...    411   2e-139   
ref|XP_011007415.1|  PREDICTED: probable beta-1,3-galactosyltrans...    408   4e-138   
ref|XP_002276299.1|  PREDICTED: beta-1,3-galactosyltransferase sqv-2    407   1e-137   Vitis vinifera
ref|XP_010104279.1|  putative beta-1,3-galactosyltransferase 16         402   4e-136   
ref|XP_011011530.1|  PREDICTED: probable beta-1,3-galactosyltrans...    404   1e-135   
ref|XP_007221054.1|  hypothetical protein PRUPE_ppa015950mg             399   8e-135   
gb|EYU38941.1|  hypothetical protein MIMGU_mgv1a021117mg                395   1e-133   
ref|XP_008232487.1|  PREDICTED: uncharacterized protein LOC103331619    391   9e-132   
emb|CBI24769.3|  unnamed protein product                                410   1e-130   
ref|XP_004308499.1|  PREDICTED: probable beta-1,3-galactosyltrans...    379   5e-127   
ref|XP_006855739.1|  hypothetical protein AMTR_s00044p00162820          335   2e-109   
ref|XP_006845629.1|  hypothetical protein AMTR_s00019p00218710          334   1e-108   
ref|XP_004146362.1|  PREDICTED: uncharacterized protein LOC101209952    327   9e-106   
ref|XP_007014197.1|  Galactosyltransferase family protein               323   2e-104   
ref|XP_004309947.1|  PREDICTED: uncharacterized protein LOC101312598    322   6e-104   
ref|XP_010099949.1|  hypothetical protein L484_005678                   322   8e-104   
ref|XP_002269659.1|  PREDICTED: uncharacterized protein LOC100246152    322   1e-103   Vitis vinifera
ref|XP_008453610.1|  PREDICTED: uncharacterized protein LOC103494272    321   1e-103   
emb|CAN80704.1|  hypothetical protein VITISV_017393                     320   2e-103   Vitis vinifera
ref|XP_009349882.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   3e-103   
ref|XP_010259842.1|  PREDICTED: uncharacterized protein LOC104599141    320   3e-103   
gb|EYU42439.1|  hypothetical protein MIMGU_mgv1a018717mg                319   7e-103   
ref|XP_008342564.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   9e-103   
ref|XP_004242922.2|  PREDICTED: probable beta-1,3-galactosyltrans...    319   1e-102   
ref|XP_011069907.1|  PREDICTED: uncharacterized protein LOC105155684    318   2e-102   
ref|XP_011043986.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-102   
ref|XP_008223705.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   5e-102   
ref|XP_006367544.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   7e-102   
ref|XP_002325062.1|  hypothetical protein POPTR_0018s10190g             316   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_007224899.1|  hypothetical protein PRUPE_ppa022137mg             316   1e-101   
gb|KDP36407.1|  hypothetical protein JCGZ_08676                         315   2e-101   
ref|XP_011007585.1|  PREDICTED: probable beta-1,3-galactosyltrans...    314   4e-101   
ref|XP_010452159.1|  PREDICTED: beta-1,3-galactosyltransferase sq...    313   2e-100   
ref|XP_009804119.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   2e-100   
ref|NP_200558.1|  Galactosyltransferase family protein                  312   2e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61378.1|  unknown                                                 312   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002269534.1|  PREDICTED: uncharacterized protein LOC100261534    311   7e-100   Vitis vinifera
ref|XP_010536916.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   2e-99    
ref|XP_002269569.1|  PREDICTED: uncharacterized protein LOC100256447    310   3e-99    Vitis vinifera
ref|XP_010046986.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   5e-99    
gb|KCW78719.1|  hypothetical protein EUGRSUZ_C00164                     309   6e-99    
ref|XP_009786266.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   7e-99    
emb|CDX88626.1|  BnaA03g10230D                                          308   7e-99    
ref|XP_010483271.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-98    
ref|XP_009132123.1|  PREDICTED: beta-1,3-galactosyltransferase 6        308   1e-98    
ref|XP_007227076.1|  hypothetical protein PRUPE_ppa025342mg             308   1e-98    
ref|XP_006401199.1|  hypothetical protein EUTSA_v10014129mg             308   2e-98    
ref|XP_010443436.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   2e-98    
ref|XP_006453391.1|  hypothetical protein CICLE_v10010309mg             307   2e-98    
ref|XP_009631232.1|  PREDICTED: lactosylceramide 1,3-N-acetyl-bet...    307   3e-98    
ref|XP_009631231.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   3e-98    
ref|XP_002866209.1|  transferase, transferring glycosyl groups          307   4e-98    
ref|XP_010688494.1|  PREDICTED: beta-1,3-galactosyltransferase 6        307   7e-98    
ref|XP_004308498.1|  PREDICTED: uncharacterized protein LOC101314610    303   7e-98    
emb|CDY11865.1|  BnaC03g12910D                                          305   2e-97    
ref|XP_006280773.1|  hypothetical protein CARUB_v10026744mg             305   2e-97    
ref|XP_010914138.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    304   4e-97    
gb|KFK27299.1|  hypothetical protein AALP_AA8G364400                    304   4e-97    
ref|XP_008811311.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    304   4e-97    
ref|XP_009120267.1|  PREDICTED: probable beta-1,3-galactosyltrans...    302   5e-97    
ref|XP_008223729.1|  PREDICTED: uncharacterized protein LOC103323513    302   4e-96    
gb|EYU42413.1|  hypothetical protein MIMGU_mgv1a025682mg                298   1e-95    
ref|XP_009390510.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    300   1e-95    
gb|AES92334.2|  galactosyltransferase family protein                    299   3e-95    
ref|XP_002309789.2|  hypothetical protein POPTR_0007s01740g             293   6e-95    Populus trichocarpa [western balsam poplar]
ref|XP_003610137.1|  hypothetical protein MTR_4g128310                  300   2e-94    
emb|CBI17823.3|  unnamed protein product                                295   2e-94    
gb|EPS73000.1|  hypothetical protein M569_01761                         293   8e-94    
ref|XP_003543746.2|  PREDICTED: uncharacterized protein LOC100777477    293   4e-93    
ref|XP_008811313.1|  PREDICTED: probable beta-1,3-galactosyltrans...    293   8e-93    
ref|XP_004507843.1|  PREDICTED: uncharacterized protein LOC101492465    293   8e-93    
gb|KHN22706.1|  hypothetical protein glysoja_027594                     291   2e-92    
ref|XP_010914140.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    292   2e-92    
gb|KHN17589.1|  hypothetical protein glysoja_005786                     291   4e-92    
ref|XP_010929245.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    291   5e-92    
ref|XP_010914303.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    290   8e-92    
ref|XP_008808354.1|  PREDICTED: uncharacterized protein LOC103720439    289   2e-91    
ref|NP_001048329.1|  Os02g0785000                                       288   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007154774.1|  hypothetical protein PHAVU_003G146700g             286   2e-90    
ref|XP_006649105.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    282   3e-88    
ref|XP_010914139.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    280   5e-88    
ref|XP_009417475.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    279   2e-87    
ref|XP_008808355.1|  PREDICTED: probable beta-1,3-galactosyltrans...    277   8e-87    
dbj|BAK04678.1|  predicted protein                                      278   2e-86    
ref|XP_008811307.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    272   1e-84    
ref|XP_010236914.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    271   3e-84    
ref|XP_009400103.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    271   3e-84    
emb|CBI17822.3|  unnamed protein product                                266   1e-82    
ref|NP_001136656.1|  hypothetical protein                               268   1e-82    Zea mays [maize]
ref|XP_004955248.1|  PREDICTED: uncharacterized protein LOC101786644    267   2e-82    
ref|XP_002452935.1|  hypothetical protein SORBIDRAFT_04g035240          266   7e-82    Sorghum bicolor [broomcorn]
gb|EMT10666.1|  hypothetical protein F775_11943                         265   3e-81    
ref|XP_009418889.1|  PREDICTED: uncharacterized protein LOC103998988    261   7e-81    
emb|CDY25905.1|  BnaC09g32770D                                          260   4e-80    
emb|CDP02967.1|  unnamed protein product                                259   8e-80    
ref|XP_009390509.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    257   6e-79    
ref|XP_003576561.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    256   2e-78    
ref|XP_001769179.1|  predicted protein                                  250   3e-77    
emb|CBI17824.3|  unnamed protein product                                249   3e-76    
ref|XP_009381783.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...    250   5e-76    
ref|XP_009380762.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    249   1e-75    
ref|XP_009401059.1|  PREDICTED: uncharacterized protein LOC103985157    243   1e-73    
ref|XP_009380761.1|  PREDICTED: probable beta-1,3-galactosyltrans...    244   1e-73    
ref|XP_001770084.1|  predicted protein                                  241   1e-73    
ref|XP_006655565.1|  PREDICTED: probable beta-1,3-galactosyltrans...    244   2e-73    
ref|XP_006661264.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    243   5e-73    
gb|EPS62703.1|  hypothetical protein M569_12085                         234   4e-71    
gb|EPS73893.1|  hypothetical protein M569_00860                         234   7e-71    
dbj|BAD19198.1|  hypothetical protein                                   235   2e-70    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09208.1|  hypothetical protein OsI_31483                          235   2e-70    Oryza sativa Indica Group [Indian rice]
ref|XP_004961308.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    235   8e-70    
dbj|BAD33555.1|  hypothetical protein                                   233   1e-69    Oryza sativa Japonica Group [Japonica rice]
gb|EMS64481.1|  hypothetical protein TRIUR3_12418                       231   1e-68    
ref|NP_001136849.1|  hypothetical protein                               230   3e-68    Zea mays [maize]
ref|XP_002440203.1|  hypothetical protein SORBIDRAFT_09g027700          231   3e-68    Sorghum bicolor [broomcorn]
dbj|BAD19304.1|  hypothetical protein                                   228   7e-68    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD19307.1|  hypothetical protein                                   227   2e-67    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70800.1|  hypothetical protein OsI_02252                          227   2e-67    Oryza sativa Indica Group [Indian rice]
ref|NP_001169756.1|  hypothetical protein                               228   3e-67    Zea mays [maize]
gb|EMS63972.1|  putative beta-1,3-galactosyltransferase 20              229   5e-67    
ref|XP_006649106.1|  PREDICTED: probable beta-1,3-galactosyltrans...    226   5e-67    
gb|EAY98941.1|  hypothetical protein OsI_20896                          228   6e-67    Oryza sativa Indica Group [Indian rice]
gb|EPS69158.1|  hypothetical protein M569_05610                         224   7e-67    
ref|NP_001056253.1|  Os05g0552200                                       225   5e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454671.1|  hypothetical protein SORBIDRAFT_04g035250          224   6e-66    Sorghum bicolor [broomcorn]
ref|XP_004956920.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    223   7e-66    
ref|XP_004956921.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...    221   6e-65    
dbj|BAJ95477.1|  predicted protein                                      221   1e-64    
ref|XP_003565858.1|  PREDICTED: uncharacterized protein LOC100838462    219   3e-64    
ref|XP_003565859.1|  PREDICTED: uncharacterized protein LOC100838773    219   4e-64    
dbj|BAJ92824.1|  predicted protein                                      218   1e-63    
ref|XP_003565857.1|  PREDICTED: uncharacterized protein LOC100838166    215   2e-62    
ref|XP_002438000.1|  hypothetical protein SORBIDRAFT_10g006180          213   1e-61    Sorghum bicolor [broomcorn]
gb|AAK73116.2|AF391808_26  unknown                                      210   2e-61    Zea mays [maize]
gb|ABF67954.1|  hypothetical protein                                    211   3e-61    Zea mays [maize]
gb|AFV13465.1|  hypothetical protein                                    212   4e-61    
ref|XP_003578152.1|  PREDICTED: beta-1,3-galactosyltransferase sq...    211   6e-61    
gb|EAZ44835.1|  hypothetical protein OsJ_29472                          210   6e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954153.1|  PREDICTED: probable beta-1,3-galactosyltrans...    210   7e-61    
gb|AEJ07952.1|  hypothetical protein                                    211   8e-61    
ref|XP_004964595.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...    211   8e-61    
gb|ABF67944.1|  hypothetical protein                                    211   1e-60    Zea mays [maize]
gb|AEJ07915.1|  hypothetical protein                                    210   1e-60    
ref|XP_003567945.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    211   1e-60    
gb|ABF67932.1|  hypothetical protein                                    210   1e-60    Zea mays [maize]
ref|XP_002462426.1|  hypothetical protein SORBIDRAFT_02g025420          210   1e-60    Sorghum bicolor [broomcorn]
ref|XP_006661263.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...    209   1e-60    
gb|AEJ07939.1|  hypothetical protein                                    210   2e-60    
ref|XP_006661262.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...    209   2e-60    
gb|ABF67924.1|  hypothetical protein                                    208   3e-60    Zea mays [maize]
gb|AAL59233.1|AF448416_13  hypothetical protein                         207   3e-60    Zea mays [maize]
ref|NP_001063242.1|  Os09g0432900                                       209   4e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659179.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...    209   6e-60    
ref|XP_006649108.1|  PREDICTED: uncharacterized protein LOC102701147    207   8e-60    
dbj|BAK06884.1|  predicted protein                                      208   8e-60    
ref|XP_010239137.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    207   9e-60    
gb|EEE57937.1|  hypothetical protein OsJ_08645                          205   3e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579292.1|  PREDICTED: uncharacterized protein LOC100821978    206   4e-59    
gb|EAY87784.1|  hypothetical protein OsI_09202                          204   6e-59    Oryza sativa Indica Group [Indian rice]
ref|XP_006649107.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    202   3e-58    
ref|NP_001132756.1|  hypothetical protein                               203   3e-58    Zea mays [maize]
gb|EPS67464.1|  hypothetical protein M569_07311                         198   4e-58    
ref|NP_001057035.1|  Os06g0192400                                       202   9e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417793.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    198   2e-57    
gb|ACG46990.1|  hypro1                                                  201   3e-57    Zea mays [maize]
tpg|DAA61597.1|  TPA: hypothetical protein ZEAMMB73_978397              200   3e-57    
gb|EAY99984.1|  hypothetical protein OsI_21988                          201   3e-57    Oryza sativa Indica Group [Indian rice]
ref|NP_001063243.1|  Os09g0433000                                       200   6e-57    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136904.1|  uncharacterized protein LOC100217061               200   7e-57    Zea mays [maize]
gb|ACN28027.1|  unknown                                                 200   1e-55    Zea mays [maize]
ref|XP_006660649.1|  PREDICTED: probable beta-1,3-galactosyltrans...    196   2e-55    
ref|XP_006381816.1|  hypothetical protein POPTR_0006s18480g             191   2e-55    
ref|XP_002462427.1|  hypothetical protein SORBIDRAFT_02g025430          192   1e-53    Sorghum bicolor [broomcorn]
ref|XP_003578153.1|  PREDICTED: beta-1,3-galactosyltransferase pv...    189   8e-53    
gb|EEE57934.1|  hypothetical protein OsJ_08641                          188   9e-53    Oryza sativa Japonica Group [Japonica rice]
gb|EPS62704.1|  transferase, transferring glycosyl groups               186   1e-52    
gb|EMT29615.1|  hypothetical protein F775_21430                         184   2e-52    
gb|AEJ07902.1|  hypothetical protein                                    184   2e-51    
gb|EPS72892.1|  hypothetical protein M569_01868                         182   7e-51    
gb|EAZ43247.1|  hypothetical protein OsJ_27846                          186   7e-50    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD33554.1|  hypothetical protein                                   175   2e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006845627.1|  hypothetical protein AMTR_s00019p00218500          167   1e-46    
ref|XP_006660339.1|  PREDICTED: uncharacterized protein LOC102715690    152   7e-40    
gb|EMS62183.1|  hypothetical protein TRIUR3_33292                       149   9e-40    
gb|EEE69763.1|  hypothetical protein OsJ_29471                          153   1e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002269612.1|  PREDICTED: uncharacterized protein LOC100251293    144   3e-37    Vitis vinifera
gb|EEC84624.1|  hypothetical protein OsI_31479                          148   1e-36    Oryza sativa Indica Group [Indian rice]
gb|EEC84626.1|  hypothetical protein OsI_31482                          143   6e-36    Oryza sativa Indica Group [Indian rice]
gb|EEE65247.1|  hypothetical protein OsJ_20421                          140   2e-35    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372840.1|  hypothetical protein POPTR_0017s05560g             134   2e-34    
ref|XP_006845628.1|  hypothetical protein AMTR_s00019p00218620          136   4e-34    
gb|EMT33316.1|  hypothetical protein F775_16326                         135   3e-33    
ref|XP_006677688.1|  hypothetical protein BATDEDRAFT_87048              134   2e-32    
gb|EMT29614.1|  hypothetical protein F775_04764                         124   2e-30    
gb|EMT00770.1|  hypothetical protein F775_19376                         112   1e-23    
gb|ESA14842.1|  hypothetical protein GLOINDRAFT_24522                   107   2e-23    
gb|EPS62729.1|  hypothetical protein M569_12060                         105   5e-23    
gb|EKC98421.1|  hypothetical protein A1Q2_07435                         105   3e-21    
gb|EMS63974.1|  hypothetical protein TRIUR3_16615                     97.8    4e-21    
gb|EPS67322.1|  hypothetical protein M569_07458                       97.8    6e-21    
ref|XP_009266168.1|  Beta-1,3-galactosyltransferase pvg3                101   1e-20    
gb|EMT19575.1|  hypothetical protein F775_17291                       96.3    1e-20    
ref|XP_006956220.1|  hypothetical protein WALSEDRAFT_56136              100   2e-20    
gb|EMS63973.1|  hypothetical protein TRIUR3_16614                     94.7    4e-20    
gb|EJT49460.1|  hypothetical protein A1Q1_01364                         102   4e-20    
gb|KEI37533.1|  glycosyltransferase family 31 protein                   101   8e-20    
dbj|GAA93412.1|  hypothetical protein E5Q_00053                         101   8e-20    
dbj|GAC93114.1|  glycosyltransferase                                  99.8    3e-19    
gb|KGB80144.1|  hypothetical protein CNBG_5982                        97.8    1e-18    
ref|XP_003196116.1|  hypothetical Protein CGB_I2100W                  97.4    1e-18    
gb|ESA07121.1|  hypothetical protein GLOINDRAFT_33292                 94.0    3e-18    
ref|XP_758231.1|  hypothetical protein UM02084.1                      95.1    9e-18    Ustilago maydis 521
gb|EGU12456.1|  hypothetical protein RTG_01490                        95.1    1e-17    
ref|XP_001731208.1|  hypothetical protein MGL_1391                    94.0    1e-17    Malassezia globosa CBS 7966
dbj|GAK65384.1|  family 31 glycosyltransferase                        94.7    1e-17    
gb|EPS59094.1|  hypothetical protein M569_15716                       86.3    2e-17    
gb|EMS25174.1|  glycosyltransferase family 31 protein                 94.4    2e-17    
ref|XP_570440.1|  hypothetical protein                                93.2    4e-17    Cryptococcus neoformans var. neoformans JEC21
ref|XP_007876289.1|  hypothetical protein PFL1_00605                  93.2    4e-17    
gb|EAZ07524.1|  hypothetical protein OsI_29780                        85.9    5e-17    Oryza sativa Indica Group [Indian rice]
gb|AFR94758.2|  hypothetical protein CNAG_01385                       92.8    6e-17    
gb|EJU02949.1|  hypothetical protein DACRYDRAFT_115252                90.1    1e-16    
emb|CCA73538.1|  related to glycosyltransferase family 31 protein...  91.7    1e-16    
ref|XP_003320350.1|  hypothetical protein PGTG_01262                  91.7    1e-16    
emb|CCF52386.1|  uncharacterized protein UHOR_03460                   91.3    2e-16    
gb|KDE02934.1|  hypothetical protein MVLG_06558                       91.3    2e-16    
gb|KDQ14510.1|  glycosyltransferase family 31 protein                 90.1    3e-16    
gb|KDN48861.1|  glycosyltransferase family 31 protein                 90.9    3e-16    
ref|XP_007005335.1|  hypothetical protein TREMEDRAFT_39553            89.0    8e-16    
ref|XP_007001966.1|  hypothetical protein TREMEDRAFT_67449            85.1    1e-14    
dbj|GAC72181.1|  galactosyltransferases                               85.5    2e-14    
ref|XP_002439014.1|  hypothetical protein SORBIDRAFT_10g029970        80.5    2e-14    Sorghum bicolor [broomcorn]
gb|ETS59647.1|  hypothetical protein PaG_06574                        84.3    4e-14    
gb|EJU02954.1|  hypothetical protein DACRYDRAFT_14925                 82.4    9e-14    
emb|CDI53158.1|  glycosyltransferase family 31 protein                82.4    1e-13    
gb|EUC67779.1|  glycosyltransferase family 31 protein                 81.6    2e-13    
gb|EUC67594.1|  glycosyltransferase family 31 protein, putative       81.6    2e-13    
gb|KEP54494.1|  putative glycosyltransferase family 31 protein        81.6    2e-13    
gb|EUC55697.1|  sugar porter (SP) family MFS transporter              78.6    2e-12    
gb|KEP54846.1|  sugar porter (SP) family MFS transporter              78.6    3e-12    
gb|EJT49571.1|  hypothetical protein A1Q1_01286                       77.0    5e-12    
ref|XP_007861573.1|  hypothetical protein GLOTRDRAFT_124407           77.8    5e-12    
ref|XP_007418137.1|  family 31 glycosyltransferase                    77.0    6e-12    
ref|XP_003319691.2|  hypothetical protein PGTG_01865                  77.0    6e-12    
gb|EKC98224.1|  hypothetical protein A1Q2_07478                       75.5    2e-11    
ref|XP_006960529.1|  hypothetical protein WALSEDRAFT_61473            75.1    2e-11    
ref|XP_007336662.1|  hypothetical protein AURDEDRAFT_78388            75.1    3e-11    
ref|XP_007403912.1|  family 31 glycosyltransferase                    74.7    4e-11    
gb|ELU44261.1|  glycosyltransferase family 31 protein                 73.2    1e-10    
gb|EJU04107.1|  hypothetical protein DACRYDRAFT_20743                 69.3    2e-10    
gb|KDN43635.1|  hypothetical protein RSAG8_06012                      70.9    5e-10    
ref|XP_007360242.1|  hypothetical protein DICSQDRAFT_151176           71.2    6e-10    
gb|EFX64867.1|  hypothetical protein DAPPUDRAFT_65862                 69.3    7e-10    
ref|XP_007854049.1|  glycosyltransferase family 31 protein            70.9    7e-10    
ref|NP_595999.1|  galactosylxylosylprotein 3-beta-galactosyltrans...  70.1    7e-10    Schizosaccharomyces pombe
gb|KDN43267.1|  hypothetical protein RSAG8_06234                      70.5    1e-09    
gb|EST04711.1|  galactosyltransferase                                 69.7    2e-09    
ref|XP_570254.1|  hypothetical protein                                68.9    2e-09    Cryptococcus neoformans var. neoformans JEC21
gb|KDN43266.1|  hypothetical protein RSAG8_06233                      68.2    3e-09    
ref|XP_003193611.1|  hypothetical protein CGB_D4210C                  68.6    3e-09    
ref|XP_007318286.1|  glycosyltransferase family 31 protein            66.2    2e-08    
gb|ETO25647.1|  hypothetical protein RFI_11488                        65.9    2e-08    
ref|XP_002171479.1|  galactosylxylosylprotein 3-beta- galactosylt...  64.7    4e-08    Schizosaccharomyces japonicus yFS275
gb|KGB74789.1|  hypothetical protein CNBG_0627                        64.7    4e-08    
gb|AFR95097.1|  hypothetical protein CNAG_01050                       64.7    5e-08    
ref|XP_005109120.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...  64.3    5e-08    
ref|XP_009268553.1|  hypothetical protein J056_000650                 63.9    1e-07    
gb|ELU39755.1|  Galactosyltransferase domain-containing protein       63.5    2e-07    
ref|XP_005758750.1|  hypothetical protein EMIHUDRAFT_219155           62.0    3e-07    
emb|CBQ72626.1|  conserved hypothetical protein                       61.2    1e-06    
ref|XP_006600394.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    5e-06    
ref|XP_003550571.2|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    5e-06    
ref|XP_006600393.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.9    5e-06    
gb|KHN03252.1|  Putative beta-1,3-galactosyltransferase 16            58.5    5e-06    
ref|XP_006600392.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    5e-06    
gb|ESS61958.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransferase   58.2    6e-06    
ref|XP_002274418.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.5    6e-06    
gb|ESS54878.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransferase   57.8    6e-06    
ref|XP_004508103.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    7e-06    
ref|XP_004508102.1|  PREDICTED: probable beta-1,3-galactosyltrans...  58.2    7e-06    
ref|XP_001622942.1|  predicted protein                                57.0    9e-06    
gb|ESS61959.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransferase   57.4    1e-05    
emb|CAN60055.1|  hypothetical protein VITISV_039050                   57.8    1e-05    
ref|XP_003489325.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...  56.6    1e-05    
ref|XP_008223439.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.4    1e-05    
ref|XP_007378693.1|  hypothetical protein PUNSTDRAFT_129444           57.0    2e-05    
ref|XP_005766637.1|  hypothetical protein EMIHUDRAFT_246386           57.0    2e-05    
ref|XP_008360226.1|  PREDICTED: probable beta-1,3-galactosyltrans...  57.0    2e-05    
gb|EKG07889.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfera...  53.9    2e-05    
gb|KFM73089.1|  Beta-1,3-galactosyltransferase 6                      55.8    3e-05    
ref|XP_005776210.1|  hypothetical protein EMIHUDRAFT_239094           55.5    3e-05    
ref|XP_009013160.1|  hypothetical protein HELRODRAFT_169080           55.1    4e-05    
ref|XP_006407946.1|  hypothetical protein EUTSA_v10020308mg           55.8    4e-05    
ref|XP_006297213.1|  hypothetical protein CARUB_v10013222mg           55.8    4e-05    
gb|KEH32374.1|  beta-1,3-galactosyltransferase-like protein           55.8    4e-05    
ref|XP_009372069.1|  PREDICTED: probable beta-1,3-galactosyltrans...  55.8    5e-05    
ref|XP_007224303.1|  hypothetical protein PRUPE_ppa019770mg           55.5    5e-05    
ref|NP_566284.1|  putative beta-1,3-galactosyltransferase 16          55.1    7e-05    
ref|XP_805064.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfe...  54.7    8e-05    
ref|XP_001376070.2|  PREDICTED: beta-1,3-galactosyltransferase 6      54.7    8e-05    
ref|XP_009124873.1|  PREDICTED: probable beta-1,3-galactosyltrans...  54.7    9e-05    
ref|XP_010276521.1|  PREDICTED: probable beta-1,3-galactosyltrans...  54.7    1e-04    
ref|XP_011011142.1|  PREDICTED: probable beta-1,3-galactosyltrans...  54.7    1e-04    
ref|XP_009314232.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltran...  53.9    1e-04    
gb|AAQ77230.1|  putative beta 1, 3 galactosyltransferase-like pro...  54.3    1e-04    
ref|XP_002884585.1|  galactosyltransferase family protein             54.3    1e-04    
ref|XP_004999736.1|  PREDICTED: beta-1,3-galactosyltransferase 6      53.5    1e-04    
gb|KDP29247.1|  hypothetical protein JCGZ_16636                       53.9    2e-04    
ref|XP_007426315.1|  PREDICTED: beta-1,3-galactosyltransferase 6      53.1    2e-04    
emb|CCC47723.1|  putative UDP-Gal or UDP-GlcNAc-dependent glycosy...  53.5    2e-04    
gb|KFM27800.1|  Beta-1,3-galactosyltransferase 15                     53.1    2e-04    
ref|XP_002316064.2|  hypothetical protein POPTR_0010s16140g           53.1    2e-04    
gb|EKF28055.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfera...  52.0    3e-04    
ref|XP_814599.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfe...  52.8    3e-04    
emb|CDY34952.1|  BnaA01g32830D                                        53.1    3e-04    
gb|EKF28836.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfera...  52.0    3e-04    
ref|XP_010464217.1|  PREDICTED: probable beta-1,3-galactosyltrans...  53.1    3e-04    
ref|NP_001078115.1|  putative beta-1,3-galactosyltransferase 16       53.1    3e-04    
ref|XP_008547614.1|  PREDICTED: beta-1,3-galactosyltransferase 6      52.4    3e-04    
ref|XP_808744.1|  hypothetical protein                                52.4    3e-04    
gb|EKG05936.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfera...  52.4    3e-04    
ref|XP_002190308.1|  PREDICTED: beta-1,3-galactosyltransferase 6      52.4    4e-04    
gb|EKF29193.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfera...  51.6    4e-04    
gb|KDO72582.1|  hypothetical protein CISIN_1g006694mg                 52.8    4e-04    
emb|CAJ84707.1|  beta-1,3-galactosyltransferase 6                     52.0    4e-04    
gb|AAF08572.1|AC011623_5  unknown protein                             52.4    5e-04    
emb|CAP36830.3|  Protein CBR-SQV-2                                    52.0    6e-04    
ref|XP_003245500.1|  PREDICTED: beta-1,3-galactosyltransferase 6-...  51.6    6e-04    
ref|XP_009708174.1|  PREDICTED: beta-1,3-galactosyltransferase 6      51.6    6e-04    
ref|XP_810678.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfe...  51.6    7e-04    
gb|KFP56195.1|  Beta-1,3-galactosyltransferase 6                      51.2    7e-04    
ref|XP_006482603.1|  PREDICTED: beta-1,3-galactosyltransferase 15...  52.0    7e-04    
ref|XP_811109.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfe...  51.2    8e-04    
emb|CCA74230.1|  hypothetical protein PIIN_08183                      51.6    8e-04    
gb|KFQ93784.1|  Beta-1,3-galactosyltransferase 6                      50.8    8e-04    
ref|XP_010486153.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    8e-04    
gb|EKF31033.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfera...  51.2    0.001    
gb|EKF29063.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransfera...  50.8    0.001    
ref|XP_011071350.1|  PREDICTED: probable beta-1,3-galactosyltrans...  51.6    0.001    
gb|ESS61429.1|  UDP-Gal or UDP-GlcNAc-dependent glycosyltransferase   51.2    0.001    



>ref|XP_009614832.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   434 bits (1117),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 194/243 (80%), Positives = 222/243 (91%), Gaps = 0/243 (0%)
 Frame = -1

Query  917  HARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEIL  738
            +A+F+LLIGIFT+P  +DRRHFLRL+YGIQSTS+AR+DVKFI CN++    R F+ALEI+
Sbjct  50   NAQFTLLIGIFTQPRNFDRRHFLRLVYGIQSTSIARIDVKFIFCNITNAEHRTFIALEII  109

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            RF DI++LNC+ENMNSGKTYTYFS+LP ILP+RYDYVMKADDDV+LRLAPLA SL+ LPR
Sbjct  110  RFNDIIVLNCSENMNSGKTYTYFSTLPQILPTRYDYVMKADDDVYLRLAPLATSLQPLPR  169

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
             DLYYGFVIPCPSMN FVHYMSGMGF+LSWDLVEWIGRS IPANNTYGPEDKLVGQWL++
Sbjct  170  VDLYYGFVIPCPSMNAFVHYMSGMGFILSWDLVEWIGRSNIPANNTYGPEDKLVGQWLNL  229

Query  377  GKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHS  198
            G KAKNRF+NKP MYDYPGTNGRCSHELIP+TIAVHRLKKWEQWV VL+FFNVT +L+ S
Sbjct  230  GNKAKNRFSNKPRMYDYPGTNGRCSHELIPDTIAVHRLKKWEQWVDVLRFFNVTKQLQPS  289

Query  197  KMY  189
             +Y
Sbjct  290  DLY  292



>ref|XP_004243885.2| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Solanum 
lycopersicum]
Length=296

 Score =   432 bits (1111),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 224/253 (89%), Gaps = 0/253 (0%)
 Frame = -1

Query  947  IAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEA  768
            I +   P   + +F+LL+GIFTRP  +DRRHFLRL+YGIQST +AR+DVKF+ CN++   
Sbjct  39   ILLQQAPQIVNTQFTLLLGIFTRPGNFDRRHFLRLVYGIQSTPIARIDVKFVFCNITNRE  98

Query  767  QRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAP  588
            +R FVALEI+RF DI++LNC ENMNSGKTYTYFS+LP ILP+RYDYVMKADDDV+LRL P
Sbjct  99   ERTFVALEIMRFNDIIVLNCRENMNSGKTYTYFSTLPQILPTRYDYVMKADDDVYLRLEP  158

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            LA+SL+ LPR DLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI RS IPANNTYGPE
Sbjct  159  LASSLQSLPRVDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIRRSNIPANNTYGPE  218

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            DKLVGQWL+MG KAKNRF+NKP MYDYPGTNG+CSHELIP+TIAVHRLKKWEQW++VL+F
Sbjct  219  DKLVGQWLNMGNKAKNRFSNKPKMYDYPGTNGKCSHELIPDTIAVHRLKKWEQWINVLRF  278

Query  227  FNVTTELEHSKMY  189
            FNVT +L+ S +Y
Sbjct  279  FNVTKQLQPSSLY  291



>ref|XP_009771013.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Nicotiana 
sylvestris]
Length=297

 Score =   431 bits (1109),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 196/256 (77%), Positives = 227/256 (89%), Gaps = 1/256 (0%)
 Frame = -1

Query  956  NDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLS  777
            N+ I +   P   +A+F+LLIGIFT+P+ +DRRHFLRL+YGIQST +AR+DVKFI CN++
Sbjct  38   NNTILLQQSP-QMNAQFTLLIGIFTQPKNFDRRHFLRLVYGIQSTPIARIDVKFIFCNIT  96

Query  776  GEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLR  597
                R F+ LEI+RF DI+ILNC+ENMNSGKTYTYFS+LP ILP+RYDYVMKADDDV+LR
Sbjct  97   NAEHRTFIVLEIMRFNDIIILNCSENMNSGKTYTYFSTLPRILPTRYDYVMKADDDVYLR  156

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTY  417
            LAPLA+SL+ LPR DLYYGFVIPCPSMN FVHYMSGMGF+LSWDLVEWIGRS IPANNTY
Sbjct  157  LAPLASSLQPLPRVDLYYGFVIPCPSMNAFVHYMSGMGFILSWDLVEWIGRSNIPANNTY  216

Query  416  GPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHV  237
            GPEDKLVGQWL++G KAKNRF+NKP MYDYPGTNGRCSHELIP+TIAVHRLKKWEQWV V
Sbjct  217  GPEDKLVGQWLNLGNKAKNRFSNKPRMYDYPGTNGRCSHELIPDTIAVHRLKKWEQWVDV  276

Query  236  LKFFNVTTELEHSKMY  189
            L+FFNVT +L+ S +Y
Sbjct  277  LRFFNVTKQLQPSDLY  292



>emb|CDP01700.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   421 bits (1083),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 194/257 (75%), Positives = 217/257 (84%), Gaps = 0/257 (0%)
 Frame = -1

Query  977  NSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVK  798
             SP  T    I I    +   +RFSLLIGI TRP+ Y+RRHFLRLIYGIQS+ +A++DVK
Sbjct  30   KSPSSTATKSIIILQDTSHLESRFSLLIGILTRPDNYERRHFLRLIYGIQSSPIAKIDVK  89

Query  797  FILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKA  618
            F+ C L+   QR +VALEI+RFRDI+ILNCTENMNSGKTY YFSSLP ILP  YDYVMKA
Sbjct  90   FVFCKLTKPEQRTYVALEIMRFRDIIILNCTENMNSGKTYAYFSSLPRILPQHYDYVMKA  149

Query  617  DDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR  438
            DDDVFLRL PLA SL+ LPR D+YYGFVIPCPSMNPFVHYMSGMGF+LSWDLV+WI  S 
Sbjct  150  DDDVFLRLVPLALSLQPLPRSDMYYGFVIPCPSMNPFVHYMSGMGFILSWDLVQWIAVSD  209

Query  437  IPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKK  258
            IPAN+T+GPEDKLVG+WLDMGKKA NRF+NKPAMYDYPGTN RCSH+LIP+TIAVHRLKK
Sbjct  210  IPANDTFGPEDKLVGKWLDMGKKATNRFSNKPAMYDYPGTNSRCSHDLIPDTIAVHRLKK  269

Query  257  WEQWVHVLKFFNVTTEL  207
            WEQW HVL FFNVT EL
Sbjct  270  WEQWFHVLSFFNVTEEL  286



>ref|XP_011096931.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2-like [Sesamum 
indicum]
Length=294

 Score =   411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 226/269 (84%), Gaps = 0/269 (0%)
 Frame = -1

Query  992  FSTNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA  813
            FS + NSP  TP  +  +    +      SLLIGI T+P++YD RHFLRL+YG QS+ +A
Sbjct  25   FSIHYNSPSSTPTSKNMLLQETSHPQPHLSLLIGILTQPDRYDIRHFLRLVYGTQSSPIA  84

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYD  633
            R+DVKF+LC L+ + QR  VALEI+RF DI+ILNC+ENMNSGKTYTYFSSLP IL + YD
Sbjct  85   RIDVKFVLCKLTKQEQRVLVALEIIRFNDIIILNCSENMNSGKTYTYFSSLPRILSAPYD  144

Query  632  YVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEW  453
            YVMKADDDVFLRL PLA SL+ LPR+DLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEW
Sbjct  145  YVMKADDDVFLRLKPLALSLQILPRKDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEW  204

Query  452  IGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAV  273
            I  S+IPAN+T+GPEDKLVG+WL+ G KAKNR ++KPAMYDYPGTNGRCSH+LIP+T+AV
Sbjct  205  ISTSQIPANSTFGPEDKLVGEWLNRGNKAKNRISDKPAMYDYPGTNGRCSHDLIPDTVAV  264

Query  272  HRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            HR+K+W+QW+ VL FFNVT +++ SK+Y+
Sbjct  265  HRVKRWDQWLRVLSFFNVTKDIKPSKLYN  293



>ref|XP_011007415.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Populus 
euphratica]
Length=296

 Score =   408 bits (1048),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 218/257 (85%), Gaps = 1/257 (0%)
 Frame = -1

Query  956  NDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLS  777
            N  I +   P  +  +FS+LIGI TRP+ YDRRHFLRL+YGIQ++S+A +DVKF+ CNL+
Sbjct  40   NHSITLTKTP-HTETKFSILIGILTRPDNYDRRHFLRLVYGIQASSIAEIDVKFVFCNLT  98

Query  776  GEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLR  597
               QR  +ALEILRF DI+IL+C ENMN+GKTY YFSSLP ILP  YDYVMKADDDVF+R
Sbjct  99   KPEQRVLIALEILRFNDIIILDCIENMNNGKTYAYFSSLPHILPRHYDYVMKADDDVFIR  158

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTY  417
            L PL+ SL+ LP +DLYYGFVIPC SMNPF  YMSGMGF+LSWDLVEWIG+S IP NNT 
Sbjct  159  LEPLSLSLQPLPWQDLYYGFVIPCNSMNPFADYMSGMGFLLSWDLVEWIGKSEIPENNTV  218

Query  416  GPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHV  237
            GPEDK+VG+WL MG KAKNRF+NKPAMYDYPGTNGRCSHELIPET+AVHRLK+W+QW++V
Sbjct  219  GPEDKMVGKWLKMGNKAKNRFSNKPAMYDYPGTNGRCSHELIPETVAVHRLKRWDQWLNV  278

Query  236  LKFFNVTTELEHSKMYH  186
            L+FFNVT +L +SK+YH
Sbjct  279  LEFFNVTKQLNNSKLYH  295



>ref|XP_002276299.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2 [Vitis vinifera]
Length=293

 Score =   407 bits (1045),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 187/243 (77%), Positives = 212/243 (87%), Gaps = 0/243 (0%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVA  750
            P+ +  +FSLLIGI TR +KYDRRHFLRL+YGIQS+ +A +DVKFI CNL+   QR  VA
Sbjct  43   PSSALPQFSLLIGILTRADKYDRRHFLRLVYGIQSSPVAHIDVKFIFCNLTKPEQRVLVA  102

Query  749  LEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLE  570
            LEILRF D++ILNC ENMNSGKTYTYFSSLP IL  +YDYVMKADDDVF+RLAPLA SL+
Sbjct  103  LEILRFEDVIILNCMENMNSGKTYTYFSSLPQILRRQYDYVMKADDDVFIRLAPLALSLQ  162

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQ  390
             LPR DLYYGFVIPC S NPFV YMSGMGFVLSWDLVEWIG S IP N+T+GPEDKLVG+
Sbjct  163  PLPRLDLYYGFVIPCASTNPFVEYMSGMGFVLSWDLVEWIGESDIPGNDTFGPEDKLVGK  222

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL+MG KAKNRF+NKPAMYDYPGTNGRCSHELIPET+AVHRLK+W+QW +VL FFNVT +
Sbjct  223  WLNMGNKAKNRFSNKPAMYDYPGTNGRCSHELIPETVAVHRLKRWDQWSNVLHFFNVTHQ  282

Query  209  LEH  201
            L+H
Sbjct  283  LKH  285



>ref|XP_010104279.1| putative beta-1,3-galactosyltransferase 16 [Morus notabilis]
 gb|EXB99564.1| putative beta-1,3-galactosyltransferase 16 [Morus notabilis]
Length=261

 Score =   402 bits (1032),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 183/245 (75%), Positives = 211/245 (86%), Gaps = 0/245 (0%)
 Frame = -1

Query  917  HARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEIL  738
            H +FSLLIGI TR + Y+RRHFLRLIYGIQS+ LA++DVKFI+CNL+   QR  VALEIL
Sbjct  17   HHKFSLLIGILTRADNYERRHFLRLIYGIQSSPLAKIDVKFIVCNLTKPEQRMLVALEIL  76

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            R+ DI++LNCTENMN GKTYTYFSSLP IL +RYDYVMK DDDVF+RL PLA+SLE LPR
Sbjct  77   RYDDIIVLNCTENMNEGKTYTYFSSLPNILKNRYDYVMKVDDDVFIRLEPLASSLEPLPR  136

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
             DLYYGFVIPC S NPFV YMSGMGF+LSWDLVEWI  S IP  + +GPED+LVG+WL M
Sbjct  137  LDLYYGFVIPCNSKNPFVEYMSGMGFLLSWDLVEWISESSIPKLDLFGPEDRLVGKWLRM  196

Query  377  GKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHS  198
            G KA+NRF+NKPAMYDYPGTNG+CSH+LIPETIAVHRLKKW+QW+HVL+FFNVT +L  S
Sbjct  197  GNKAQNRFSNKPAMYDYPGTNGKCSHDLIPETIAVHRLKKWDQWLHVLEFFNVTKQLNKS  256

Query  197  KMYHF  183
             +YH 
Sbjct  257  SLYHL  261



>ref|XP_011011530.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Populus 
euphratica]
Length=345

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 183/257 (71%), Positives = 217/257 (84%), Gaps = 1/257 (0%)
 Frame = -1

Query  956  NDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLS  777
            N  I +   P  +  +FS+LIGI T P+ YDRRHFLRL+YGIQ++S+A +DVKF+ CNL+
Sbjct  89   NHSITLTKTP-HTETKFSILIGILTCPDNYDRRHFLRLVYGIQASSIAEIDVKFVFCNLT  147

Query  776  GEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLR  597
               QR  +ALEILRF DI+IL+C ENMN+GKTY YFSSLP ILP  YDYVMKADDDVF+R
Sbjct  148  KPEQRVLIALEILRFNDIIILDCIENMNNGKTYAYFSSLPHILPRHYDYVMKADDDVFIR  207

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTY  417
            L PL+ SL+ LP +DLYYGFVIPC SMNPF  YMSGMGF+LSWDLVEWIG+S IP NNT 
Sbjct  208  LEPLSLSLQPLPWQDLYYGFVIPCNSMNPFADYMSGMGFLLSWDLVEWIGKSEIPENNTV  267

Query  416  GPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHV  237
            GPEDK+VG+WL MG KAKNRF+NKPAMYDYPGTNGRCSHELIPET+AVHRLK+W+QW++V
Sbjct  268  GPEDKMVGKWLKMGNKAKNRFSNKPAMYDYPGTNGRCSHELIPETVAVHRLKRWDQWLNV  327

Query  236  LKFFNVTTELEHSKMYH  186
            L+FFNVT +L +SK+YH
Sbjct  328  LEFFNVTKQLNNSKLYH  344



>ref|XP_007221054.1| hypothetical protein PRUPE_ppa015950mg [Prunus persica]
 gb|EMJ22253.1| hypothetical protein PRUPE_ppa015950mg [Prunus persica]
Length=281

 Score =   399 bits (1025),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 178/237 (75%), Positives = 209/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  917  HARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEIL  738
              +FSLLIGI TR + YDRRHFLRLIYGIQS+ +A++DVKFI CNL+   QR  ++LEIL
Sbjct  44   QTQFSLLIGILTRADNYDRRHFLRLIYGIQSSPIAKIDVKFIFCNLTKPEQRILISLEIL  103

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            RF DI+ILNCTENMN+GKTYTYFSSLPGILP +YDYVMKADDDVF+RL PLA SL+ LPR
Sbjct  104  RFNDIIILNCTENMNNGKTYTYFSSLPGILPRKYDYVMKADDDVFIRLKPLALSLKPLPR  163

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
             D+YYGFVIPC SMNPFV YMSGMGF+LSWDLVEWIG S IP    +GPEDK+VG+WL M
Sbjct  164  VDMYYGFVIPCASMNPFVEYMSGMGFLLSWDLVEWIGESDIPRKEMFGPEDKMVGKWLKM  223

Query  377  GKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            G+KA+NRF+NKPAMYDYPGTNG+CSHELIPET+AVHRLK+W++W+HVL+FFNVT ++
Sbjct  224  GRKARNRFSNKPAMYDYPGTNGKCSHELIPETVAVHRLKRWDRWLHVLEFFNVTKQV  280



>gb|EYU38941.1| hypothetical protein MIMGU_mgv1a021117mg [Erythranthe guttata]
Length=257

 Score =   395 bits (1015),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/251 (72%), Positives = 217/251 (86%), Gaps = 2/251 (1%)
 Frame = -1

Query  935  IVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--TSLARVDVKFILCNLSGEAQR  762
            +V   S+ +F+LLIGI T+P+KY+ RHFLRLIY  QS  +  A++D+KF+LCNL+   QR
Sbjct  5    LVGDSSNHQFTLLIGILTKPDKYELRHFLRLIYAAQSPPSPPAKIDIKFVLCNLTKPEQR  64

Query  761  AFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLA  582
             F++LEI RF DI+IL+C ENMN+GKTYTYFSSLP ILP++YDYVMKADDD+FLRL PLA
Sbjct  65   IFISLEIKRFDDIIILDCLENMNNGKTYTYFSSLPEILPAKYDYVMKADDDLFLRLKPLA  124

Query  581  ASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDK  402
            +SLE LPR+D+YYGFVIPC SMNPF HYMSGMGFVLSWDLVEWIG S IP NNT+GPEDK
Sbjct  125  SSLEALPRQDMYYGFVIPCNSMNPFKHYMSGMGFVLSWDLVEWIGESVIPVNNTFGPEDK  184

Query  401  LVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFN  222
            LVGQWLD GKKAKNRF+NKPAMYDYPGTNGRCSH+LIP+TI VHR+K+W+QW  VL FFN
Sbjct  185  LVGQWLDGGKKAKNRFSNKPAMYDYPGTNGRCSHDLIPDTIGVHRVKRWDQWFRVLDFFN  244

Query  221  VTTELEHSKMY  189
            VT +++ S++Y
Sbjct  245  VTKDIKPSRLY  255



>ref|XP_008232487.1| PREDICTED: uncharacterized protein LOC103331619 [Prunus mume]
Length=284

 Score =   391 bits (1005),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 206/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  917  HARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEIL  738
              +FSLLIGI TR + Y+ RHFLRLIYGIQS+ +A++DVKF+ CNL+   QR  ++LEIL
Sbjct  47   QTQFSLLIGILTRVDNYNHRHFLRLIYGIQSSPIAKIDVKFVFCNLTKPEQRILISLEIL  106

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            RF DI+ILNCTENMN+GKTYTYFSSLP +LP +YDYVMKADDDVF+RL PLA SL+ LPR
Sbjct  107  RFNDIIILNCTENMNNGKTYTYFSSLPHVLPHKYDYVMKADDDVFIRLEPLALSLKPLPR  166

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
             DLYYGFVIPC SMNPFV YMSGMGF+LSWDLVEWIG S IP    +GPEDK+VG+WL M
Sbjct  167  VDLYYGFVIPCASMNPFVEYMSGMGFLLSWDLVEWIGESDIPREEMFGPEDKMVGKWLKM  226

Query  377  GKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            G+KAKNRF+NKPAMYDYPGTNG+CSHELIPET+AVHRLK+W++W HVL+FFNVT ++
Sbjct  227  GRKAKNRFSNKPAMYDYPGTNGKCSHELIPETVAVHRLKRWDRWSHVLEFFNVTKQV  283



>emb|CBI24769.3| unnamed protein product [Vitis vinifera]
Length=969

 Score =   410 bits (1054),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/243 (77%), Positives = 212/243 (87%), Gaps = 0/243 (0%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVA  750
            P+ +  +FSLLIGI TR +KYDRRHFLRL+YGIQS+ +A +DVKFI CNL+   QR  VA
Sbjct  43   PSSALPQFSLLIGILTRADKYDRRHFLRLVYGIQSSPVAHIDVKFIFCNLTKPEQRVLVA  102

Query  749  LEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLE  570
            LEILRF D++ILNC ENMNSGKTYTYFSSLP IL  +YDYVMKADDDVF+RLAPLA SL+
Sbjct  103  LEILRFEDVIILNCMENMNSGKTYTYFSSLPQILRRQYDYVMKADDDVFIRLAPLALSLQ  162

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQ  390
             LPR DLYYGFVIPC S NPFV YMSGMGFVLSWDLVEWIG S IP N+T+GPEDKLVG+
Sbjct  163  PLPRLDLYYGFVIPCASTNPFVEYMSGMGFVLSWDLVEWIGESDIPGNDTFGPEDKLVGK  222

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL+MG KAKNRF+NKPAMYDYPGTNGRCSHELIPET+AVHRLK+W+QW +VL FFNVT +
Sbjct  223  WLNMGNKAKNRFSNKPAMYDYPGTNGRCSHELIPETVAVHRLKRWDQWSNVLHFFNVTHQ  282

Query  209  LEH  201
            L+H
Sbjct  283  LKH  285



>ref|XP_004308499.1| PREDICTED: probable beta-1,3-galactosyltransferase 16-like [Fragaria 
vesca subsp. vesca]
Length=287

 Score =   379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 202/239 (85%), Gaps = 0/239 (0%)
 Frame = -1

Query  920  SHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEI  741
            +  +FSL+IGI TR + YD RHFLRL+YG+QS+ LA + VKF+ C+L+   QRA +ALE+
Sbjct  48   NQTQFSLMIGILTRADNYDHRHFLRLVYGVQSSPLATIHVKFVFCSLTKPEQRALIALEM  107

Query  740  LRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLP  561
            LRF DI+ILNCTENMN+GKTYTYFSSLP +LP +YDY+MKADDDVF+R  PLA SL+ LP
Sbjct  108  LRFDDILILNCTENMNNGKTYTYFSSLPRLLPRKYDYIMKADDDVFIRFEPLALSLKALP  167

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYGFVIPC SM+PFV YMSGMGF+LSWDLV+WIG S IP     GPEDKLVG+W  
Sbjct  168  RVDLYYGFVIPCASMDPFVEYMSGMGFLLSWDLVKWIGSSEIPKETVVGPEDKLVGKWFK  227

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
            MG KAKNRF+NKPAMYDYPGTNGRCSHELIPET+AVHRLK+W+QW+ VL++FNVT  L+
Sbjct  228  MGNKAKNRFSNKPAMYDYPGTNGRCSHELIPETVAVHRLKRWDQWLRVLEYFNVTKGLK  286



>ref|XP_006855739.1| hypothetical protein AMTR_s00044p00162820 [Amborella trichopoda]
 gb|ERN17206.1| hypothetical protein AMTR_s00044p00162820 [Amborella trichopoda]
Length=296

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 191/256 (75%), Gaps = 6/256 (2%)
 Frame = -1

Query  938  NIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--ARVDVKFILCNLSGEAQ  765
             +VP  +  R  LLIGI TR    DRRH LRL Y +Q +    A +DV+F+LCNL+   Q
Sbjct  42   ELVPQPTELR--LLIGILTRFGTIDRRHLLRLAYSVQPSPTFPAVIDVRFVLCNLTSSDQ  99

Query  764  RAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILP--SRYDYVMKADDDVFLRLA  591
            R  V+LEILRF DI+ILNC+ENMNSGKTY+YFS LP I P   +YDYVMK DDD ++R+ 
Sbjct  100  RLLVSLEILRFNDIIILNCSENMNSGKTYSYFSQLPAIFPDTEKYDYVMKTDDDTYIRVL  159

Query  590  PLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGP  411
            PL +SL   PR DLYYGFV+PC SM+PF  YMSGMGFVLSWDLVEWI  S IP NNT GP
Sbjct  160  PLVSSLRARPRHDLYYGFVVPCMSMDPFKGYMSGMGFVLSWDLVEWIRESEIPKNNTMGP  219

Query  410  EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
            EDK+VG+WL +G K KNR+  KP MYDYPGTNGRCSH LI ET+AVHRLK+ + WV V +
Sbjct  220  EDKVVGEWLRLGSKGKNRWCEKPGMYDYPGTNGRCSHGLIEETVAVHRLKRMDMWVRVFE  279

Query  230  FFNVTTELEHSKMYHF  183
            +FNVT  ++ S+MYH 
Sbjct  280  YFNVTKGVKPSRMYHL  295



>ref|XP_006845629.1| hypothetical protein AMTR_s00019p00218710 [Amborella trichopoda]
 gb|ERN07304.1| hypothetical protein AMTR_s00019p00218710 [Amborella trichopoda]
Length=322

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/272 (61%), Positives = 193/272 (71%), Gaps = 3/272 (1%)
 Frame = -1

Query  989  STNSNSPLR-TPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA  813
            STNS    R T ND          S   F LLIGI T P  Y RR+ LRL+YG QST  A
Sbjct  50   STNSFCTCRPTANDSENFTEKSELSPPEFRLLIGILTLPGNYFRRYLLRLVYGTQSTGRA  109

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYD  633
            ++D+KF+ CN++ E  R  VALEI+R  DI+ILNCTENMN GKTYTYFSSLP ILP  YD
Sbjct  110  QIDIKFVFCNITNEDDRVIVALEIMRHDDIIILNCTENMNDGKTYTYFSSLPEILPEPYD  169

Query  632  YVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEW  453
            Y MKADDD++ RL  LA SLE LPR D+YYGFVIPC SM+PF  YMSGMGF+LSWDLVEW
Sbjct  170  YAMKADDDIYFRLDRLAKSLEPLPRFDMYYGFVIPCESMDPFFQYMSGMGFILSWDLVEW  229

Query  452  IGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETI  279
            + +S I  N+  GPED +VG WL  G KA+NRFNNKPAMYDY  P     CSHE IP+TI
Sbjct  230  VRKSSIARNHKDGPEDMVVGDWLREGNKARNRFNNKPAMYDYPIPVPIDTCSHEFIPDTI  289

Query  278  AVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            AVHRLK  ++WV  L++FN T  L+ SK+YH 
Sbjct  290  AVHRLKDNDKWVRTLRYFNATDGLKPSKLYHL  321



>ref|XP_004146362.1| PREDICTED: uncharacterized protein LOC101209952 [Cucumis sativus]
 ref|XP_004163727.1| PREDICTED: uncharacterized protein LOC101225780 [Cucumis sativus]
 gb|KGN65449.1| hypothetical protein Csa_1G423070 [Cucumis sativus]
Length=323

 Score =   327 bits (837),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 186/253 (74%), Gaps = 8/253 (3%)
 Frame = -1

Query  917  HARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEIL  738
            H    +LIGI T P++Y+RRHFLRLIYG QS S A++DVKF+ CNL+ E QR  VALEI+
Sbjct  68   HTDIRILIGILTLPDQYNRRHFLRLIYGTQSFSGAKIDVKFVFCNLTKEDQRILVALEIM  127

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLAPLA  582
            R+ DI+ILNC ENMN GKTYTYFSSLP I  +         Y YVMKADDD ++RL  L 
Sbjct  128  RYDDIIILNCKENMNKGKTYTYFSSLPEIFNNSDGGGSYPPYHYVMKADDDTYIRLNSLV  187

Query  581  ASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDK  402
             SL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWDL EWI  S IP  +  GPEDK
Sbjct  188  ESLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLISWDLAEWIRESEIPKKHLEGPEDK  247

Query  401  LVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFN  222
            + G W+  G++AKNRFN K +MY+YP     C+HEL PETIAVH LK  E+W+  LK+FN
Sbjct  248  VFGDWIREGRRAKNRFNAKWSMYNYPEPWTGCTHELWPETIAVHLLKNQEKWIRTLKYFN  307

Query  221  VTTELEHSKMYHF  183
            VT  L+ SK+YH 
Sbjct  308  VTANLKQSKLYHI  320



>ref|XP_007014197.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY31816.1| Galactosyltransferase family protein [Theobroma cacao]
Length=317

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 186/245 (76%), Gaps = 6/245 (2%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIGI T P++Y RRHFLRLIYG QS + A+VDV+F+ CNL+ E Q+  VALEI+R+ DI
Sbjct  71   ILIGILTLPDQYQRRHFLRLIYGTQSVAGAQVDVRFVFCNLTKEDQKVLVALEIMRYDDI  130

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLP  561
            +ILNC ENMN GKTYT+FSSLP I  S       Y YVMK DDD + RL  L  SL  LP
Sbjct  131  IILNCQENMNKGKTYTFFSSLPEIFNSSDRPYPPYHYVMKGDDDTYFRLENLVESLRPLP  190

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYG+VIPCPSM+P+VHYMSGMG+++SWD+ EWI  S IP N+  GPEDK+ G+W+ 
Sbjct  191  REDLYYGYVIPCPSMDPYVHYMSGMGYLVSWDIAEWIRESDIPRNHLEGPEDKVFGEWIR  250

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
             G +AKNRFN K +MY+YP    RC+HEL P+TIAVH LK  E+W+H LK+FNVT+ L+ 
Sbjct  251  DGHRAKNRFNAKWSMYNYPDPPTRCTHELWPDTIAVHLLKNQEKWIHTLKYFNVTSNLKP  310

Query  200  SKMYH  186
            SK+YH
Sbjct  311  SKLYH  315



>ref|XP_004309947.1| PREDICTED: uncharacterized protein LOC101312598 [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/273 (57%), Positives = 190/273 (70%), Gaps = 8/273 (3%)
 Frame = -1

Query  983  NSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVD  804
            NS S +   +    I      S     +L GI T P++Y RRHFLRLIYG Q+   A+VD
Sbjct  48   NSPSEIYKSSSSTLIETQKTSSEDEIRVLFGILTLPDQYQRRHFLRLIYGTQNPVGAKVD  107

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLP-------GILP  645
            VKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP       G+ P
Sbjct  108  VKFVFCNLTKEDQKVLVALEIMRYNDIIILNCQENMNKGKTYTYFSSLPEIFNNTDGVYP  167

Query  644  SRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWD  465
              Y YVMKADDD + RL  L  SL+ LPR DLYYG+VIPCPSM+P+VHYMSGMG+++SWD
Sbjct  168  P-YHYVMKADDDAYFRLQSLVDSLKPLPREDLYYGYVIPCPSMDPYVHYMSGMGYLISWD  226

Query  464  LVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPE  285
            +VEWI  S IP N   GPEDK+ G+W+  G +AKNRFN K  MY++P     C+HEL PE
Sbjct  227  IVEWIRDSDIPKNQLEGPEDKVFGEWIRNGHRAKNRFNAKWGMYNFPEPPTTCTHELWPE  286

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            TIAVH LK  E+W+  LK+FNVT  L+ SK+YH
Sbjct  287  TIAVHLLKTQEKWIRTLKYFNVTDNLKPSKLYH  319



>ref|XP_010099949.1| hypothetical protein L484_005678 [Morus notabilis]
 gb|EXB80932.1| hypothetical protein L484_005678 [Morus notabilis]
Length=329

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 195/276 (71%), Gaps = 13/276 (5%)
 Frame = -1

Query  992  FSTNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA  813
            F+TN  +   TP +        + S     +LIGI T P++Y +RHFLRLIYG Q+ + A
Sbjct  60   FNTNDTTSSLTPQNS-------SSSEDDIRILIGILTLPDQYQKRHFLRLIYGTQNPTGA  112

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGIL-----  648
            ++DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +L     
Sbjct  113  KIDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCKENMNKGKTYTYFSSLPELLNDTNA  172

Query  647  PSR-YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLS  471
            PS  Y YVMKADDD + RL  L  SL+ LPR DLYYG+VIPCPSM+PFV YMSGMG+++S
Sbjct  173  PSPPYHYVMKADDDTYFRLESLVQSLKPLPREDLYYGYVIPCPSMDPFVRYMSGMGYLVS  232

Query  470  WDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            WDLVEWI  S IP N   GPEDK+ G+WL +G KAKNRFN K +MY++P     C+HEL 
Sbjct  233  WDLVEWIRDSEIPRNKMEGPEDKVFGEWLRVGHKAKNRFNAKWSMYNFPEPKTGCTHELW  292

Query  290  PETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            P+TIAVH LK  E+W+  L +FN T  L+ SK+YH 
Sbjct  293  PDTIAVHLLKNQEKWIRTLNYFNHTQNLKPSKLYHI  328



>ref|XP_002269659.1| PREDICTED: uncharacterized protein LOC100246152 [Vitis vinifera]
Length=337

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/277 (58%), Positives = 199/277 (72%), Gaps = 14/277 (5%)
 Frame = -1

Query  992  FSTNSNSPLRTPNDEIAINIV--PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS  819
            FS NS+S     +D + +N    PAD   R  +LIGI T P++Y RR+FLR+IYG QS +
Sbjct  65   FSHNSSSS----DDFLTLNFTSDPADDDIR--ILIGILTLPDQYHRRNFLRMIYGTQSPA  118

Query  818  LARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR  639
             A+VDVKF+ CNL+ E Q+  VALEI+R+ DI+ILNCTENMN+GKTYTYFSSLP +L S 
Sbjct  119  GAKVDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCTENMNNGKTYTYFSSLPEMLNST  178

Query  638  ------YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFV  477
                  Y YVMKADDD +LRL  L  S+  LPR DLYYG+VIPCPSM+PFVHYMSGMG++
Sbjct  179  EGPSPPYHYVMKADDDTYLRLDNLVESMRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYL  238

Query  476  LSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHE  297
            +SWD+VEWI  S IP  +  GPEDK+ G W+  G++ KNR   K AMY+YP    RC+HE
Sbjct  239  VSWDIVEWIRVSEIPKKHMEGPEDKVFGDWIREGRRGKNRHTAKWAMYNYPEPPTRCTHE  298

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            L P TIAVH LK  E+W+  L +FNVT  L+ SK+YH
Sbjct  299  LWPNTIAVHLLKNQEKWIQTLNYFNVTQNLKPSKLYH  335



>ref|XP_008453610.1| PREDICTED: uncharacterized protein LOC103494272 [Cucumis melo]
Length=334

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 184/247 (74%), Gaps = 8/247 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIGI T P++Y+RRHFLRLIYG QS S A++DVKF+ CNL+ E Q+  VALEI+R+ DI
Sbjct  85   ILIGILTLPDQYNRRHFLRLIYGTQSFSGAKIDVKFVFCNLTKEDQKILVALEIMRYDDI  144

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLAPLAASLEG  567
            +ILNC ENMN GKTYTYFSSLP I  +         Y YVMKADDD ++RL  L  SL  
Sbjct  145  IILNCKENMNKGKTYTYFSSLPEIFNNSDDGGSYPPYHYVMKADDDTYIRLNSLVESLRP  204

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWDL EWI  S +P  +  GPEDK+ G W
Sbjct  205  LPREDLYYGYVIPCPSMDPFVHYMSGMGYLISWDLAEWIRESEVPKKHLEGPEDKVFGDW  264

Query  386  LDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            L  G++AKNRFN K +MY+YP     C+HEL PETIAVH LK  E+W+  L +FNVT  L
Sbjct  265  LREGRRAKNRFNAKWSMYNYPEPWTGCTHELWPETIAVHLLKNQEKWIRTLTYFNVTANL  324

Query  206  EHSKMYH  186
            + SK+YH
Sbjct  325  KESKLYH  331



>emb|CAN80704.1| hypothetical protein VITISV_017393 [Vitis vinifera]
Length=318

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 199/278 (72%), Gaps = 14/278 (5%)
 Frame = -1

Query  992  FSTNSNSPLRTPNDEIAINIV--PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS  819
            FS NS+S     +D + +N    PAD   R  +LIGI T P++Y RR+FLR+IYG QS +
Sbjct  46   FSHNSSSS----DDFLTLNYTSDPADDDIR--ILIGILTLPDQYHRRNFLRMIYGTQSPA  99

Query  818  LARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR  639
             A+VDVKF+ CNL+ E Q+  VALEI+R+ DI+ILNCTENMN+GKTYTYFSSLP +L S 
Sbjct  100  GAKVDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCTENMNNGKTYTYFSSLPEMLNST  159

Query  638  ------YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFV  477
                  Y YVMKADDD +LRL  L  S+  LPR DLYYG+VIPCPSM+PFVHYMSGMG++
Sbjct  160  EGPSPPYHYVMKADDDTYLRLDNLVESMRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYL  219

Query  476  LSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHE  297
            +SWD+VEWI  S IP  +  GPEDK+ G W+  G++ KNR   K AMY+YP    RC+HE
Sbjct  220  VSWDIVEWIRVSEIPKKHMEGPEDKVFGDWIREGRRGKNRHTAKWAMYNYPEPPTRCTHE  279

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            L P TIAVH LK  E+W+  L +FNVT  L+ SK+YH 
Sbjct  280  LWPNTIAVHLLKNQEKWIQTLNYFNVTQNLKPSKLYHI  317



>ref|XP_009349882.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Pyrus 
x bretschneideri]
Length=318

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 197/274 (72%), Gaps = 12/274 (4%)
 Frame = -1

Query  989  STNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLAR  810
            +TNS S   T N  +A N   + S     +L GI T P++Y RRHFLR+IYG Q+   A 
Sbjct  49   ATNSTS---TANVLLAQN---SSSDDEIRILFGILTLPDQYQRRHFLRMIYGTQTPVGAT  102

Query  809  VDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGIL-----P  645
            VDVKF+ CNL+ E Q+  VALEILR+ DI+ILNC ENMN GKTYTYFSSLP +      P
Sbjct  103  VDVKFVFCNLTKEDQKVLVALEILRYDDIIILNCKENMNKGKTYTYFSSLPEMFNDTKGP  162

Query  644  SR-YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSW  468
            +R Y YVMK DDD + RL  L  SL+ LPR+DLYYG+VIPCPSM+PFVHYMSGMG+++SW
Sbjct  163  NRPYHYVMKTDDDAYFRLQSLVDSLKPLPRQDLYYGYVIPCPSMDPFVHYMSGMGYLISW  222

Query  467  DLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIP  288
            D+VEWI  S IP N+  GPEDK+ G W+  G +AKNR+N K +MY++P    RC+HEL P
Sbjct  223  DIVEWIRESDIPKNHLEGPEDKIFGDWIREGHRAKNRYNAKWSMYNFPEPPTRCTHELWP  282

Query  287  ETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            +TIAVH LK  E+W+  LK+FNVT  L+ SK+YH
Sbjct  283  DTIAVHLLKNQEKWITTLKYFNVTDNLKPSKLYH  316



>ref|XP_010259842.1| PREDICTED: uncharacterized protein LOC104599141 [Nelumbo nucifera]
Length=324

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 194/276 (70%), Gaps = 9/276 (3%)
 Frame = -1

Query  995  MFSTNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL  816
            M   N+ SP    N  +  N   A +     +LIGI T P++Y RRHFLR++YG QS   
Sbjct  50   MSYQNTTSP---SNASLPENSTSAAALPELRVLIGIPTLPDQYHRRHFLRMVYGTQSPVG  106

Query  815  ARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-  639
            A+VD+KF+ CNL+ E Q   VALEI+R+ DI+ILNC ENMN+GKTYTYFSSLP +L S  
Sbjct  107  AQVDIKFVFCNLTKEDQTVLVALEIMRYDDIIILNCKENMNNGKTYTYFSSLPELLNSTD  166

Query  638  -----YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVL  474
                 Y YVMK DDD + RL  L  SL  LPR DLYYG+VIPCPSM+PF  YMSGMG+++
Sbjct  167  GPYPPYHYVMKGDDDTYFRLDNLVQSLRPLPREDLYYGYVIPCPSMDPFREYMSGMGYLV  226

Query  473  SWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHEL  294
            SWD+VEWI  S IP N T GPEDK+ G+WL  G +AKNR+N K +MYD+P     C+HEL
Sbjct  227  SWDIVEWISTSDIPKNRTEGPEDKVFGEWLRDGHRAKNRYNAKWSMYDFPQPPTGCTHEL  286

Query  293  IPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
             P+TIAVHRLK  E+W+  LK+FNVT +L+ SK+YH
Sbjct  287  WPDTIAVHRLKNQEKWIQTLKYFNVTDKLKPSKLYH  322



>gb|EYU42439.1| hypothetical protein MIMGU_mgv1a018717mg [Erythranthe guttata]
Length=324

 Score =   319 bits (818),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 197/274 (72%), Gaps = 12/274 (4%)
 Frame = -1

Query  983  NSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVD  804
            +S SPL  PN    I++ P  S +   +LIGI T P+ Y +RHFLR+IYG QS   ARVD
Sbjct  53   SSASPLIEPN---TISLPPPSS-SEIRILIGILTLPDHYHKRHFLRMIYGTQSPIGARVD  108

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----  639
            VKF+ CNL+ E Q+  VALEI+R+ DI+IL+C ENMN+GKTYTYFSSLP +  S      
Sbjct  109  VKFVFCNLTKEDQKVLVALEIMRYDDIIILDCRENMNNGKTYTYFSSLPEMFLSNESNSQ  168

Query  638  ---YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSW  468
               Y YV+K DDDV+ RL  L  SL  LPR+DLYYG+VIPCPSM+PFVHYMSGMG+++SW
Sbjct  169  YPPYHYVVKGDDDVYFRLQNLVDSLAPLPRQDLYYGYVIPCPSMDPFVHYMSGMGYLVSW  228

Query  467  DLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIP  288
            D+VEW+  S IP  +  GPEDK+ G WL  G++ KNR+N K AMY+YP    RC+HEL P
Sbjct  229  DIVEWLAESDIPKKHLEGPEDKIFGDWLREGRRGKNRYNAKWAMYNYPEPPTRCTHELWP  288

Query  287  ETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            +TIAVH LK  E+W+  L +FNVT +L+ SK+YH
Sbjct  289  DTIAVHLLKTQEKWIRTLNYFNVTRDLKPSKLYH  322



>ref|XP_008342564.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Malus 
domestica]
Length=318

 Score =   318 bits (816),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 194/272 (71%), Gaps = 9/272 (3%)
 Frame = -1

Query  974  SPLRTPNDEIAINIVPA---DSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVD  804
            S +  PN     N++ A    S     +L GI T P++Y RRHFLR+IYG Q+   A VD
Sbjct  45   SNINAPNSTSTANVLLAPNSSSDDEIRILFGILTLPDQYHRRHFLRMIYGTQTPVGASVD  104

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGIL-----PSR  639
            VKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +      P+R
Sbjct  105  VKFVFCNLTKEDQKVLVALEIMRYDDIIILNCKENMNKGKTYTYFSSLPEMFNDTKGPNR  164

Query  638  -YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDL  462
             Y YVMK DDD + RL  L  SL+ LPR+DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+
Sbjct  165  PYHYVMKTDDDAYFRLQSLVDSLKPLPRQDLYYGYVIPCPSMDPFVHYMSGMGYLISWDI  224

Query  461  VEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPET  282
            VEWI  S IP N+  GPEDK+ G W+  G +AKNR+N K +MY++P    RC+HEL P+T
Sbjct  225  VEWIRESDIPKNHLEGPEDKIFGDWIREGHRAKNRYNAKWSMYNFPEPPTRCTHELWPDT  284

Query  281  IAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            IAVH LK  E+W+  LK+FNVT  L+ SK+YH
Sbjct  285  IAVHLLKNQEKWITTLKYFNVTDNLKPSKLYH  316



>ref|XP_004242922.2| PREDICTED: probable beta-1,3-galactosyltransferase 20 [Solanum 
lycopersicum]
Length=348

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 196/277 (71%), Gaps = 21/277 (8%)
 Frame = -1

Query  995  MFSTNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL  816
             F  NS S L T NDEI I             LIGI T P++Y +RHFLRLIYG QS  +
Sbjct  84   FFDINS-STLSTSNDEIRI-------------LIGILTLPDQYQKRHFLRLIYGTQSPII  129

Query  815  --ARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPS  642
              A++DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +  +
Sbjct  130  VGAKIDVKFVFCNLTKEDQKVLVALEIMRYHDIIILNCQENMNKGKTYTYFSSLPEMFST  189

Query  641  R-----YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFV  477
                  Y YVMKADDD ++RL     SL  LPR DLYYG+VIPCPSM+PFVHYMSGMG++
Sbjct  190  SNYYPPYHYVMKADDDTYIRLENFVQSLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYL  249

Query  476  LSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHE  297
            +SWD+VEWI RS IP  +  GPEDK+ G+WL  G +A++R+N K +MY+YP    RC+HE
Sbjct  250  VSWDIVEWIKRSDIPKTHLEGPEDKVFGEWLRDGHRARHRYNAKWSMYNYPEPPTRCTHE  309

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            L P+TIAVH LK  ++W++ L +FNVT  L+ SK+YH
Sbjct  310  LWPDTIAVHLLKNQQKWINTLNYFNVTKGLQPSKLYH  346



>ref|XP_011069907.1| PREDICTED: uncharacterized protein LOC105155684 [Sesamum indicum]
Length=323

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 186/246 (76%), Gaps = 7/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +L+GI T P+ Y +RHFLRLIYG QST  AR+DVKF+ CNL+ E Q+  VALEI+R+ DI
Sbjct  76   ILLGILTLPDHYHKRHFLRLIYGTQSTVGARIDVKFVFCNLTKEDQKVLVALEIMRYDDI  135

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLRLAPLAASLEGL  564
            +ILNC ENMN GKTYTYFSSLP +L +        Y YVMK DDDV+ RL  LA SL  L
Sbjct  136  IILNCQENMNKGKTYTYFSSLPDMLLNDTNVPYPPYHYVMKGDDDVYFRLQSLADSLIPL  195

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR+DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+VEW+  S IP  +  GPEDK+ G+WL
Sbjct  196  PRQDLYYGYVIPCPSMDPFVHYMSGMGYLISWDIVEWLKDSDIPKKHLQGPEDKVFGEWL  255

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G + KNR+N K +MY+YP    RC+HEL P+TIAVH LK  E+W+  L +FNVT +L+
Sbjct  256  RDGHRGKNRYNAKWSMYNYPEPPTRCTHELWPDTIAVHLLKTQEKWIRTLNYFNVTKDLK  315

Query  203  HSKMYH  186
             SK+YH
Sbjct  316  PSKLYH  321



>ref|XP_011043986.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Populus 
euphratica]
Length=320

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 195/271 (72%), Gaps = 8/271 (3%)
 Frame = -1

Query  980  SNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDV  801
            S S   + N+ +A+N   +    R  +LIG+ T P++Y RRHFLRLIYG QS   A++DV
Sbjct  50   SQSSAPSSNNFLAVNSSTSSDDIR--ILIGVLTLPDQYQRRHFLRLIYGTQSPVGAQIDV  107

Query  800  KFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------  639
            KF+ CNL+ E Q+  VALEI+R+ DI+IL+C ENMN GKTYTYFSSLP +L         
Sbjct  108  KFVFCNLTKEDQKVLVALEIMRYDDIIILDCKENMNKGKTYTYFSSLPEMLNDTDRPYPP  167

Query  638  YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLV  459
            Y YVMK DDD + RL  L  SL+ LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+V
Sbjct  168  YHYVMKTDDDTYFRLDNLVGSLKPLPREDLYYGYVIPCPSMDPFVHYMSGMGYMISWDIV  227

Query  458  EWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETI  279
            EWI  S +P N+  GPEDK+ G W+  G +AKNR+N K +MY++P  + +C+HEL P T 
Sbjct  228  EWIRDSEVPKNHLEGPEDKVFGDWIREGHRAKNRYNAKWSMYNFPEPHTQCTHELWPNTT  287

Query  278  AVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            AVH LK  E+W+  LK+FNVT+ L+ SK+YH
Sbjct  288  AVHLLKNQEKWIQTLKYFNVTSNLKPSKLYH  318



>ref|XP_008223705.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Prunus 
mume]
Length=320

 Score =   317 bits (811),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 184/253 (73%), Gaps = 6/253 (2%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVAL  747
            + S     +L GI T P++Y RRHFLRLIYG Q+   A+VDVKF+ CNL+ E Q+  VAL
Sbjct  66   SSSDDEIRILFGILTLPDQYQRRHFLRLIYGTQTPVGAKVDVKFVFCNLTKEDQKVLVAL  125

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPL  585
            EI+R+ DI+IL+C ENMN GKTYTYFSSLP +          Y YVMK DDD + RL  L
Sbjct  126  EIMRYDDIIILDCQENMNKGKTYTYFSSLPEMFNDTEGPNPPYHYVMKTDDDAYFRLQSL  185

Query  584  AASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPED  405
              SL+ LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+VEWI  S IP N+  GPED
Sbjct  186  VDSLKPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLISWDIVEWIRESDIPKNHLEGPED  245

Query  404  KLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFF  225
            K+ G W+  G +AKNRFN K +MY++P    RC+HEL P+TIAVH LK  E+W+  LK+F
Sbjct  246  KIFGDWIRDGHRAKNRFNAKWSMYNFPEPPTRCTHELWPDTIAVHLLKNQEKWIRTLKYF  305

Query  224  NVTTELEHSKMYH  186
            NVT  L+ SK+YH
Sbjct  306  NVTDNLKPSKLYH  318



>ref|XP_006367544.1| PREDICTED: probable beta-1,3-galactosyltransferase 16-like [Solanum 
tuberosum]
Length=323

 Score =   317 bits (811),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 194/271 (72%), Gaps = 19/271 (7%)
 Frame = -1

Query  980  SNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL-ARVD  804
            ++S L T NDEI I             LIGI T P++Y +RHFLRLIYG QS  + A++D
Sbjct  61   NSSTLSTNNDEIRI-------------LIGILTLPDQYQKRHFLRLIYGTQSPIIGAKID  107

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----  639
            +KF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +   +     
Sbjct  108  IKFVFCNLTKEDQKVLVALEIMRYDDIIILNCQENMNKGKTYTYFSSLPEMFSDQLYYPP  167

Query  638  YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLV  459
            Y YVMK DDD ++RL     SL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+V
Sbjct  168  YHYVMKTDDDTYIRLENFVQSLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIV  227

Query  458  EWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETI  279
            EWI +S IP  +  GPEDK+ G+WL  G +A++R+N K +MY+YP    RC+HEL P+TI
Sbjct  228  EWIKQSDIPKTHLEGPEDKVFGEWLRDGHRARHRYNAKWSMYNYPEPPTRCTHELWPDTI  287

Query  278  AVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            AVH LK  E+W+H L +FNVT  L+ SK+YH
Sbjct  288  AVHLLKNQEKWIHTLNYFNVTRGLKPSKLYH  318



>ref|XP_002325062.1| hypothetical protein POPTR_0018s10190g [Populus trichocarpa]
 gb|EEF03627.1| hypothetical protein POPTR_0018s10190g [Populus trichocarpa]
Length=320

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 194/271 (72%), Gaps = 8/271 (3%)
 Frame = -1

Query  980  SNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDV  801
            S S   + N+ +A+N   +    R  +LIG+ T P++Y RRHFLRLIYG QS   A++DV
Sbjct  50   SQSSAPSSNNFLAMNSSTSSDDIR--ILIGVLTLPDQYQRRHFLRLIYGTQSPVGAQIDV  107

Query  800  KFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------  639
            KF+ CNL+ E Q+  VALEI+R+ DI+IL+C ENMN GKTYTYFSSLP +L         
Sbjct  108  KFVFCNLTKEDQKVLVALEIMRYDDIIILDCKENMNKGKTYTYFSSLPEMLNDTDKPYPP  167

Query  638  YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLV  459
            Y YVMK DDD + RL  L  SL+ LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+V
Sbjct  168  YHYVMKTDDDTYFRLDNLVESLKPLPREDLYYGYVIPCPSMDPFVHYMSGMGYMISWDIV  227

Query  458  EWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETI  279
            EWI  S +P N+  GPEDK+ G W+  G +AKNR+N K +MY++P    +C+HEL P T 
Sbjct  228  EWIRDSEVPKNHLEGPEDKVFGDWIREGHRAKNRYNAKWSMYNFPEPPTQCTHELWPNTT  287

Query  278  AVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            AVH LK  E+W+  LK+FNVT+ L+ SK+YH
Sbjct  288  AVHLLKNQEKWIQTLKYFNVTSNLKPSKLYH  318



>ref|XP_007224899.1| hypothetical protein PRUPE_ppa022137mg [Prunus persica]
 gb|EMJ26098.1| hypothetical protein PRUPE_ppa022137mg [Prunus persica]
Length=320

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 184/253 (73%), Gaps = 6/253 (2%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVAL  747
            + S     +L GI T P++Y RRHFLRLIYG Q+   A+VDVKF+ CNL+ E Q+  VAL
Sbjct  66   SSSDDEIRILFGILTLPDQYQRRHFLRLIYGTQTPVGAKVDVKFVFCNLTKEDQKVLVAL  125

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPL  585
            EI+R+ DI+IL+C ENMN GKTYTYFSSLP +          Y YVMK DDD + RL  L
Sbjct  126  EIMRYDDIIILDCQENMNKGKTYTYFSSLPEMFNDTEGPNPPYHYVMKTDDDAYFRLQSL  185

Query  584  AASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPED  405
              SL+ LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+VEWI  S IP N+  GPED
Sbjct  186  VDSLKPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLISWDIVEWIRESDIPKNHLEGPED  245

Query  404  KLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFF  225
            K+ G W+  G +AKNRFN K +MY++P    RC+HEL P+TIAVH LK  E+W+  LK+F
Sbjct  246  KIFGYWMRDGHRAKNRFNAKWSMYNFPEPPTRCTHELWPDTIAVHLLKNQEKWIRTLKYF  305

Query  224  NVTTELEHSKMYH  186
            NVT  L+ SK+YH
Sbjct  306  NVTDNLKPSKLYH  318



>gb|KDP36407.1| hypothetical protein JCGZ_08676 [Jatropha curcas]
Length=309

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 183/245 (75%), Gaps = 6/245 (2%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +L+GI T P++Y RRHFLR+IYG QS   A++D+KF+ CNL+ E Q+  VALEI+R+ DI
Sbjct  63   ILMGILTLPDQYQRRHFLRMIYGTQSPIGAKIDIKFVFCNLTKEDQKVLVALEIMRYDDI  122

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLP  561
            +ILNCTENMN GKTYTYFSSLP +L         Y YVMK DDDV+ RL  LA S++ LP
Sbjct  123  IILNCTENMNKGKTYTYFSSLPEMLNDTDRPYPPYHYVMKGDDDVYFRLEKLAESVKPLP  182

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYG+VIPC SM+PF HYM+GMG+++SWD+VEWI  S IP N+  GPEDK+ G W+ 
Sbjct  183  REDLYYGYVIPCSSMDPFKHYMAGMGYMVSWDIVEWIRVSEIPRNHLEGPEDKVFGDWIR  242

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
             G KAKNRFN K +MY+YP     CSHE  P+TIAVH LK  E+WV  LK+FNVT  L+ 
Sbjct  243  EGHKAKNRFNGKWSMYNYPEPPTGCSHEFWPDTIAVHALKNQEKWVKTLKYFNVTDNLKP  302

Query  200  SKMYH  186
            SK+YH
Sbjct  303  SKLYH  307



>ref|XP_011007585.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Populus 
euphratica]
Length=319

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 188/253 (74%), Gaps = 6/253 (2%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVAL  747
            + + +   +LIGI T P++Y RRHFLRLIYG QS   A+VDVKF+ CNL+ E Q+  VAL
Sbjct  65   SSTSSDIRILIGILTLPDQYHRRHFLRLIYGTQSPVGAQVDVKFVFCNLTKEDQKVLVAL  124

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPL  585
            EI+R+ DI+IL+C ENMN GKTYTYFSSLP IL         Y YVMK DDD + RL  L
Sbjct  125  EIMRYDDIIILDCKENMNKGKTYTYFSSLPEILNDTDTPYPPYHYVMKTDDDTYFRLDNL  184

Query  584  AASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPED  405
              SL+ LPR+DLYYG+VIPC SM+PFVHYMSGMG++++WD+VEWI  S IP ++  GPED
Sbjct  185  VESLKPLPRKDLYYGYVIPCSSMDPFVHYMSGMGYMITWDIVEWIRDSEIPKHHMEGPED  244

Query  404  KLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFF  225
            K+ G W+  G +AKNR+N K +MY++P    +C+HEL P+TIAVH LK  E+W+  LK+F
Sbjct  245  KVFGDWIREGHRAKNRYNAKWSMYNFPEPPTKCTHELWPDTIAVHLLKNQEKWIQTLKYF  304

Query  224  NVTTELEHSKMYH  186
            NVT+ L+ SK+YH
Sbjct  305  NVTSNLKPSKLYH  317



>ref|XP_010452159.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2-like [Camelina 
sativa]
Length=320

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 190/273 (70%), Gaps = 7/273 (3%)
 Frame = -1

Query  980  SNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVD  804
            SN P+   N  +   ++ + S     +LIGI T P++Y RRHFLR+IYG Q      +VD
Sbjct  47   SNVPMNNNNGSLETPLLSSSSDDEIRILIGILTLPDQYPRRHFLRMIYGTQVVPDGVKVD  106

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----  639
            VKF+ CNL+ E Q+  VALEI+RF DI+ILNC ENMN GKT+TYFSSLP +         
Sbjct  107  VKFVFCNLTKEDQKVLVALEIMRFDDIIILNCNENMNKGKTHTYFSSLPELFNETDAPNP  166

Query  638  -YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDL  462
             Y YVMKADDD ++RL  L ASL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+
Sbjct  167  PYHYVMKADDDTYIRLESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDI  226

Query  461  VEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPET  282
              W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    RC+HEL P+T
Sbjct  227  AVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELWPDT  286

Query  281  IAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            IAVH LK  E+W+  L +FNVT+ L+ SK+YH 
Sbjct  287  IAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYHI  319



>ref|XP_009804119.1| PREDICTED: probable beta-1,3-galactosyltransferase 20 [Nicotiana 
sylvestris]
Length=321

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 196/274 (72%), Gaps = 10/274 (4%)
 Frame = -1

Query  989  STNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL-A  813
            S+NS+S      + +++N     ++    +LIGI T P++Y +RHFLRLIYG Q   + A
Sbjct  50   SSNSSSA----TNFLSVNSSSLSTNNEIRILIGILTLPDQYQKRHFLRLIYGTQPPIMGA  105

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--  639
            +VD+KF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP I   +  
Sbjct  106  KVDIKFVFCNLTKEDQKVLVALEIMRYDDIIILNCQENMNKGKTYTYFSSLPEIFSDQPY  165

Query  638  ---YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSW  468
               Y YVMKADDD ++RL     SL  LPR DLYYG+VIPCPSMNPFVHYMSGMG+++SW
Sbjct  166  YPPYHYVMKADDDTYIRLENFVESLRTLPREDLYYGYVIPCPSMNPFVHYMSGMGYLVSW  225

Query  467  DLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIP  288
            D+ EWI  S IP N+  GPEDK+ G+WL  G + K+R+N K +MY++P    RC+HEL P
Sbjct  226  DIAEWIRDSNIPKNHLEGPEDKVFGEWLRDGHRGKHRYNAKWSMYNFPEPPTRCTHELWP  285

Query  287  ETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            +TIAVH LK  ++W+  L +FNVT +L+ SK+YH
Sbjct  286  DTIAVHLLKNQKKWIQTLTYFNVTRDLKPSKLYH  319



>ref|NP_200558.1| Galactosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAB08785.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96908.1| Galactosyltransferase family protein [Arabidopsis thaliana]
 gb|AHL38575.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=318

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/274 (55%), Positives = 192/274 (70%), Gaps = 10/274 (4%)
 Frame = -1

Query  980  SNSPLRTPNDEIAI-NIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARV  807
            SN P+   + E  + +  P D   R  +LIGI T P++Y RRHFLR+IYG Q+     +V
Sbjct  46   SNVPMNNGSSETPLLSSSPVDDEIR--ILIGILTLPDQYSRRHFLRMIYGTQNVPDGVKV  103

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR----  639
            DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP I        
Sbjct  104  DVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDIFNETDAQK  163

Query  638  --YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWD  465
              Y YVMKADDD ++RL  L ASL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD
Sbjct  164  PPYHYVMKADDDTYIRLESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWD  223

Query  464  LVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPE  285
            +  W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    RC+HEL P+
Sbjct  224  IAVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELWPD  283

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            TIAVH LK  E+W+  L +FNVT+ L+ SK+YH 
Sbjct  284  TIAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYHI  317



>gb|AAM61378.1| unknown [Arabidopsis thaliana]
Length=318

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/274 (55%), Positives = 192/274 (70%), Gaps = 10/274 (4%)
 Frame = -1

Query  980  SNSPLRTPNDEIAI-NIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARV  807
            SN P+   + E  + +  P D   R  +LIGI T P++Y RRHFLR+IYG Q+     +V
Sbjct  46   SNVPMNNGSSETPLLSSSPVDDEIR--ILIGILTLPDQYSRRHFLRMIYGTQNVPDGVKV  103

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR----  639
            DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP I        
Sbjct  104  DVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDIFNETDAQK  163

Query  638  --YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWD  465
              Y YVMKADDD ++RL  L ASL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD
Sbjct  164  PPYHYVMKADDDTYIRLESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWD  223

Query  464  LVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPE  285
            +  W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    RC+HEL P+
Sbjct  224  IAVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELWPD  283

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            TIAVH LK  E+W+  L +FNVT+ L+ SK+YH 
Sbjct  284  TIAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYHI  317



>ref|XP_002269534.1| PREDICTED: uncharacterized protein LOC100261534 [Vitis vinifera]
Length=323

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 189/268 (71%), Gaps = 19/268 (7%)
 Frame = -1

Query  971  PLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFI  792
            PL + +D+I I             LIGI T P++Y RRHFLR+IYG QS + A+VD+KF+
Sbjct  67   PLNSTSDDIRI-------------LIGILTLPDQYHRRHFLRMIYGTQSPAGAKVDIKFV  113

Query  791  LCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDY  630
             CNL+ E Q+  VALEI+R+ DI+ILNCTENMN GKTYTYFSSLP +L S       Y Y
Sbjct  114  FCNLTKEDQKVLVALEIMRYDDIIILNCTENMNQGKTYTYFSSLPEMLNSTEGPSPPYHY  173

Query  629  VMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI  450
            VMKADDD++LRL  L  SL  LPR DLYYG+VIPC SMNPF HYMSGMG+++SWD+VEW+
Sbjct  174  VMKADDDIYLRLDKLVESLRPLPREDLYYGYVIPCGSMNPFHHYMSGMGYLVSWDIVEWV  233

Query  449  GRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVH  270
              S I  N+  G ED++ G W+  GK+ KNR   K AMY+YP     C+HEL P+TI VH
Sbjct  234  SVSEISRNHLEGSEDRVFGDWMRWGKRGKNRHTVKWAMYNYPDRPTACTHELWPDTIGVH  293

Query  269  RLKKWEQWVHVLKFFNVTTELEHSKMYH  186
             LKK E+W+  LK+FNVT  L+ SK+YH
Sbjct  294  LLKKQEKWIETLKYFNVTQNLKPSKLYH  321



>ref|XP_010536916.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Tarenaya 
hassleriana]
Length=325

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 183/246 (74%), Gaps = 7/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +LIGI T P++Y RRHFLRL+YG Q+    A++DVKF+ CNL+ E Q+  VALEI+R+ D
Sbjct  78   ILIGILTLPDQYQRRHFLRLVYGTQTPPDGAKIDVKFVFCNLTKEDQKVLVALEIMRYDD  137

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGL  564
            IVILNC ENMN GKTYTYFSSLP +          Y YVMKADDD ++RL  L  SL  L
Sbjct  138  IVILNCPENMNKGKTYTYFSSLPDLFNDTDGPNPPYHYVMKADDDTYIRLESLVESLRRL  197

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+VEW+  S IP  +  GPEDK+ G W+
Sbjct  198  PRDDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIVEWLRDSDIPKKHIEGPEDKVFGDWI  257

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G++ KNRFN K +MY++P    RC+HEL P+TIAVH LK  E+W+  L FFNVT+ L+
Sbjct  258  REGRRGKNRFNAKWSMYNFPEPPTRCTHELWPDTIAVHLLKNQEKWIRTLNFFNVTSNLK  317

Query  203  HSKMYH  186
             SK+YH
Sbjct  318  PSKLYH  323



>ref|XP_002269569.1| PREDICTED: uncharacterized protein LOC100256447 [Vitis vinifera]
Length=323

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 178/245 (73%), Gaps = 6/245 (2%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            + IGI T P++Y RRHFLR++YG QS + A+VDVKF+ CNL+ E Q+  VALEI+R+ DI
Sbjct  77   IFIGILTLPDQYQRRHFLRIVYGTQSPAGAKVDVKFVFCNLTKEDQKVLVALEIMRYDDI  136

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLP  561
            +ILNCTENMN GKTY YFSSLP +L S       Y YVMKADDD +LRL  L  SL  LP
Sbjct  137  IILNCTENMNQGKTYAYFSSLPEMLNSTEGPSPPYHYVMKADDDTYLRLDNLVKSLRPLP  196

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYG V+PC SMNPFVH+MSGMG+++SWD+VEWI  S IP N+  GPED++   WL 
Sbjct  197  REDLYYGCVVPCRSMNPFVHFMSGMGYLVSWDIVEWIRVSEIPKNHMVGPEDRVFADWLR  256

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
             G + +NR   K  MYDYP     C+HEL P TIAVH LKK E+W+  LK+FNVT  L+ 
Sbjct  257  EGSRGRNRHMAKWEMYDYPEPRSVCTHELWPNTIAVHLLKKQEKWIETLKYFNVTQNLKP  316

Query  200  SKMYH  186
            SK+YH
Sbjct  317  SKLYH  321



>ref|XP_010046986.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Eucalyptus 
grandis]
Length=307

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 180/245 (73%), Gaps = 6/245 (2%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIGI T P+ Y +RHFLR+IYG QS + AR+DVKF+ CNL+ E Q   VALEI+R+ DI
Sbjct  61   ILIGILTLPDMYHKRHFLRMIYGSQSPAGARIDVKFVFCNLTKEDQHVLVALEIMRYNDI  120

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLP  561
            +I+NCTENMN+GKTY+YFSSLP +          Y YVMKADDD F RL  L ASL  LP
Sbjct  121  IIMNCTENMNNGKTYSYFSSLPEMFKGEGQPYPPYHYVMKADDDTFFRLEKLVASLRPLP  180

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYGFVIPC SM+PFVHYMSGMG+++SWDLVEWI  + I  N+T G ED + G WL 
Sbjct  181  REDLYYGFVIPCHSMDPFVHYMSGMGYMVSWDLVEWISETDIARNHTEGAEDLVFGSWLR  240

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
             G++AKNR+N K AMY+YP     C HE  P+TIAVH +K  E+W+  LK+FN T+ L+ 
Sbjct  241  DGRRAKNRYNAKWAMYNYPEPKDPCQHEFWPDTIAVHTVKTPEKWLRALKYFNFTSNLKP  300

Query  200  SKMYH  186
            SK+YH
Sbjct  301  SKLYH  305



>gb|KCW78719.1| hypothetical protein EUGRSUZ_C00164 [Eucalyptus grandis]
Length=319

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 180/245 (73%), Gaps = 6/245 (2%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIGI T P+ Y +RHFLR+IYG QS + AR+DVKF+ CNL+ E Q   VALEI+R+ DI
Sbjct  73   ILIGILTLPDMYHKRHFLRMIYGSQSPAGARIDVKFVFCNLTKEDQHVLVALEIMRYNDI  132

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLP  561
            +I+NCTENMN+GKTY+YFSSLP +          Y YVMKADDD F RL  L ASL  LP
Sbjct  133  IIMNCTENMNNGKTYSYFSSLPEMFKGEGQPYPPYHYVMKADDDTFFRLEKLVASLRPLP  192

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYGFVIPC SM+PFVHYMSGMG+++SWDLVEWI  + I  N+T G ED + G WL 
Sbjct  193  REDLYYGFVIPCHSMDPFVHYMSGMGYMVSWDLVEWISETDIARNHTEGAEDLVFGSWLR  252

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
             G++AKNR+N K AMY+YP     C HE  P+TIAVH +K  E+W+  LK+FN T+ L+ 
Sbjct  253  DGRRAKNRYNAKWAMYNYPEPKDPCQHEFWPDTIAVHTVKTPEKWLRALKYFNFTSNLKP  312

Query  200  SKMYH  186
            SK+YH
Sbjct  313  SKLYH  317



>ref|XP_009786266.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009786267.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009786268.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 isoform 
X3 [Nicotiana sylvestris]
Length=361

 Score =   310 bits (794),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 190/266 (71%), Gaps = 9/266 (3%)
 Frame = -1

Query  956  NDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL-ARVDVKFILCNL  780
             D +++N     ++    +LIGI T P++Y +RHFLRLIYG Q   + A+VD+KF+ CNL
Sbjct  94   TDFLSVNSSSLSTNNEIRILIGILTLPDQYQKRHFLRLIYGTQPPIMDAKVDIKFVFCNL  153

Query  779  SGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVM  624
            + E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +            Y YVM
Sbjct  154  TKEDQKVLVALEIMRYDDIIILNCQENMNKGKTYTYFSSLPDLFSVSDDQPYYPPYHYVM  213

Query  623  KADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGR  444
            KADDD ++RL     SL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+ EWI  
Sbjct  214  KADDDTYIRLESFVESLSPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIAEWIRE  273

Query  443  SRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRL  264
            S IP ++  GPEDK+ G+WL  G +A++R+N K +MY++P    RC+HEL P+TIAVH L
Sbjct  274  SDIPKSHLEGPEDKVFGEWLRDGHRARHRYNAKWSMYNFPEPPTRCTHELWPDTIAVHLL  333

Query  263  KKWEQWVHVLKFFNVTTELEHSKMYH  186
            K  E+W+  L +FNVT +L+ SK+YH
Sbjct  334  KNQEKWIQTLNYFNVTKDLKPSKLYH  359



>emb|CDX88626.1| BnaA03g10230D [Brassica napus]
Length=317

 Score =   308 bits (790),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 190/275 (69%), Gaps = 18/275 (7%)
 Frame = -1

Query  989  STNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA-  813
            S++  +PL + +DE  I I           LIGI T P++Y RRHFLR+IYG Q      
Sbjct  52   SSSLEAPLLSSSDEDEIRI-----------LIGILTLPDQYQRRHFLRMIYGTQDVPAGV  100

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--  639
            ++DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +      
Sbjct  101  KIDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDLFNETDT  160

Query  638  ----YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLS  471
                Y YVMKADDD ++R   L ASL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++S
Sbjct  161  PNPPYHYVMKADDDTYIRQESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVS  220

Query  470  WDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            WD+  W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    RC+HEL 
Sbjct  221  WDIAVWLKESEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELW  280

Query  290  PETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            P+TIAVH LK  E+W+  L +FNVT+ L+ SK+YH
Sbjct  281  PDTIAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYH  315



>ref|XP_010483271.1| PREDICTED: probable beta-1,3-galactosyltransferase 16 [Camelina 
sativa]
Length=318

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 180/246 (73%), Gaps = 7/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +LIGI T P++Y RRHFLR+IYG Q      +VDVKF+ CNL+ E Q+  VALEI+RF D
Sbjct  71   ILIGILTLPDQYPRRHFLRMIYGTQVVPDGVKVDVKFVFCNLTKEDQKVLVALEIMRFDD  130

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGL  564
            I+ILNC ENMN GKTYTYFSSLP +          Y YVMKADDD ++RL  L ASL  L
Sbjct  131  IIILNCNENMNKGKTYTYFSSLPELFNETDAPNPPYHYVMKADDDTYIRLESLVASLRPL  190

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+  W+  S IP  +  GPEDK+ G W+
Sbjct  191  PREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIAVWLKDSEIPKKHLEGPEDKVFGDWI  250

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G++ KNRFN K +MY++P    RC+HEL PETIAVH LK  E+W+  L +FNVT+ L+
Sbjct  251  REGRRGKNRFNAKWSMYNFPEPPTRCTHELWPETIAVHLLKNQEKWIRTLNYFNVTSNLK  310

Query  203  HSKMYH  186
             SK+YH
Sbjct  311  PSKLYH  316



>ref|XP_009132123.1| PREDICTED: beta-1,3-galactosyltransferase 6 [Brassica rapa]
Length=317

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 190/275 (69%), Gaps = 18/275 (7%)
 Frame = -1

Query  989  STNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA-  813
            S++  +PL + +DE  I I           LIGI T P++Y RRHFLR+IYG Q      
Sbjct  52   SSSLEAPLLSSSDEDEIRI-----------LIGILTLPDQYQRRHFLRMIYGTQDVPAGV  100

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--  639
            ++DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +      
Sbjct  101  KIDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDLFNETDA  160

Query  638  ----YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLS  471
                Y YVMKADDD ++R   L ASL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++S
Sbjct  161  PNPPYHYVMKADDDTYIRQESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVS  220

Query  470  WDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            WD+  W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    RC+HEL 
Sbjct  221  WDIAVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELW  280

Query  290  PETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            P+TIAVH LK  E+W+  L +FNVT+ L+ SK+YH
Sbjct  281  PDTIAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYH  315



>ref|XP_007227076.1| hypothetical protein PRUPE_ppa025342mg [Prunus persica]
 gb|EMJ28275.1| hypothetical protein PRUPE_ppa025342mg [Prunus persica]
Length=328

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 193/274 (70%), Gaps = 12/274 (4%)
 Frame = -1

Query  983  NSNSPLRTPN-DEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARV  807
            +SN+   +PN   +A+N   + S+    +L GI T P +Y RRHFLRLIYG Q+   A+V
Sbjct  57   SSNTSHSSPNITSLALN---SSSNDEIRVLFGILTLPGQYQRRHFLRLIYGTQTPVGAKV  113

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLP-------GIL  648
            DVKF++CNL+ E Q   VALEI+R+ DI+IL+C ENMN GKTYTYFSSLP       G+ 
Sbjct  114  DVKFVMCNLTKEEQEVLVALEIMRYDDIIILDCEENMNKGKTYTYFSSLPEMFNNTNGVY  173

Query  647  PSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSW  468
            P  Y YVMKADDD + RL  L  SL+ LPR DLYYG+VIPC SM PF HYMSGMG+++SW
Sbjct  174  PP-YHYVMKADDDAYFRLQNLVDSLKPLPREDLYYGYVIPCSSMEPFGHYMSGMGYLISW  232

Query  467  DLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIP  288
            D+VEWI  S IP ++  GPEDK  G W+  G +AKNRF+ K +MY++P    +C+HEL P
Sbjct  233  DIVEWIRESDIPKSHLEGPEDKTFGDWIKNGHRAKNRFHAKWSMYNFPEPPTKCTHELWP  292

Query  287  ETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
             TIAVH LK  E+W+  LK+FNVT  L+ SK+YH
Sbjct  293  HTIAVHLLKNQEKWIRTLKYFNVTDNLKPSKLYH  326



>ref|XP_006401199.1| hypothetical protein EUTSA_v10014129mg [Eutrema salsugineum]
 gb|ESQ42652.1| hypothetical protein EUTSA_v10014129mg [Eutrema salsugineum]
Length=320

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 181/246 (74%), Gaps = 7/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +LIGI T P++Y RRHFLRLIYG Q+     ++DVKF+ CNL+ E Q+  VALEI+R+ D
Sbjct  73   ILIGILTLPDQYPRRHFLRLIYGTQAIPDGVKIDVKFVFCNLTKEDQKVLVALEIMRYDD  132

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGL  564
            I+ILNC ENMN GKTYTYFSSLP +          Y YVMKADDD ++RL  L ASL  L
Sbjct  133  IIILNCNENMNKGKTYTYFSSLPDLFNETNSQNPPYHYVMKADDDTYIRLESLVASLRPL  192

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+  W+  S IP  +  GPEDK+ G W+
Sbjct  193  PREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIAVWLKDSEIPKKHLEGPEDKVFGDWI  252

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G++ KNRFN K +MY++P    RC+HEL P+TIAVH LK  E+W+  L FFNVT+ L+
Sbjct  253  REGRRGKNRFNAKWSMYNFPEPPTRCTHELWPDTIAVHLLKNQEKWIRTLNFFNVTSNLK  312

Query  203  HSKMYH  186
             SK+YH
Sbjct  313  PSKLYH  318



>ref|XP_010443436.1| PREDICTED: probable beta-1,3-galactosyltransferase 18 [Camelina 
sativa]
Length=318

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 181/246 (74%), Gaps = 7/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +LIGI T P++Y RRHFLR+IYG Q      +VDVKF+ CNL+ E Q+  VALEI+RF D
Sbjct  71   ILIGILTLPDQYPRRHFLRMIYGTQVVPDGVKVDVKFVFCNLTKEDQKVLVALEIMRFDD  130

Query  725  IVILNCTENMNSGKTYTYFSSLPGI------LPSRYDYVMKADDDVFLRLAPLAASLEGL  564
            I+ILNC ENMN GKTYTYFSSLP +      L   Y YVMKADDD ++RL  L ASL  L
Sbjct  131  IIILNCNENMNKGKTYTYFSSLPDLFNETDALNPPYHYVMKADDDTYIRLESLVASLRPL  190

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+  W+  S IP  +  GPEDK+ G W+
Sbjct  191  PREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIAVWLKDSEIPKKHLEGPEDKVFGDWI  250

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G++ KNRFN K +MY++P    RC+HEL P+TIAVH LK  E+W+  L +FNVT+ L+
Sbjct  251  REGRRGKNRFNAKWSMYNFPEPPTRCTHELWPDTIAVHLLKNQEKWIRTLNYFNVTSNLK  310

Query  203  HSKMYH  186
             SK+YH
Sbjct  311  PSKLYH  316



>ref|XP_006453391.1| hypothetical protein CICLE_v10010309mg [Citrus clementina]
 ref|XP_006474170.1| PREDICTED: uncharacterized protein LOC102630033 [Citrus sinensis]
 gb|ESR66631.1| hypothetical protein CICLE_v10010309mg [Citrus clementina]
 gb|KDO46517.1| hypothetical protein CISIN_1g020721mg [Citrus sinensis]
Length=322

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 193/273 (71%), Gaps = 7/273 (3%)
 Frame = -1

Query  983  NSNSPLRTPNDEIAINIVPADSHAR-FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARV  807
            NS+S L   +   A ++V  +S +    +LIGI T P++Y RRHFLR+IYG QS + A+V
Sbjct  48   NSSSHLSNDSFSNASHVVATNSSSEDIRILIGILTLPDQYHRRHFLRMIYGTQSPTGAQV  107

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR----  639
            DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP I  +     
Sbjct  108  DVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCKENMNKGKTYTYFSSLPEIFNTSDRPY  167

Query  638  --YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWD  465
              Y YVMK DDD ++RL  L  SL  LPR DLYYG+VIPC SM+PFV YMSGMG+++SWD
Sbjct  168  PPYHYVMKGDDDTYIRLENLVKSLVPLPREDLYYGYVIPCRSMDPFVDYMSGMGYLVSWD  227

Query  464  LVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPE  285
            + EWI  S IP N+  GPEDK+ G W+  G++AKNR+N K +MY++P     C+HEL  +
Sbjct  228  IAEWIRDSDIPKNHLEGPEDKVFGAWIREGRRAKNRYNAKWSMYNFPVPRTACTHELWAD  287

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            TIAVH LK  E+W+  L +FNVT  L+ SK+YH
Sbjct  288  TIAVHLLKNQEKWIETLTYFNVTANLKPSKLYH  320



>ref|XP_009631232.1| PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase-like 
[Nicotiana tomentosiformis]
Length=324

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 195/277 (70%), Gaps = 13/277 (5%)
 Frame = -1

Query  989  STNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS-TSLA  813
            S+NS+S      + +++N     ++    +LIGI T P++Y +RHFLRLIYG Q   + A
Sbjct  50   SSNSSSA----TNFLSVNSSSLSTNNEIRILIGILTLPDQYQKRHFLRLIYGTQPPITGA  105

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--  639
             VD+KF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +      
Sbjct  106  IVDIKFVFCNLTKEDQKVLVALEIMRYDDIIILNCQENMNKGKTYTYFSSLPDLFSVSDD  165

Query  638  ------YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFV  477
                  Y YVMKADDD ++RL     SL  LPR DLYYG+VIPCPSMNPFVHYMSGMG++
Sbjct  166  QPYYPPYHYVMKADDDTYIRLENFVESLRTLPREDLYYGYVIPCPSMNPFVHYMSGMGYL  225

Query  476  LSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHE  297
            +SWD+ EWI  S IP N+  GPEDK+ G+WL  G +A++R+N K +MY++P    RC+HE
Sbjct  226  VSWDIAEWIRDSNIPKNHLEGPEDKVFGEWLRDGHRARHRYNAKWSMYNFPEPPTRCTHE  285

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            L P+TIAVH LK  ++W+  L +FNVT +L+ SK+YH
Sbjct  286  LWPDTIAVHLLKNQKKWIQTLTYFNVTRDLKPSKLYH  322



>ref|XP_009631231.1| PREDICTED: probable beta-1,3-galactosyltransferase 20 [Nicotiana 
tomentosiformis]
Length=360

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 195/277 (70%), Gaps = 12/277 (4%)
 Frame = -1

Query  980  SNSPLR---TPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL-A  813
            S +P R   +  + +++N     ++    +LIGI T P++Y +RHFLRLIYG Q   + A
Sbjct  83   SQTPTRNSSSATNFLSVNSSSLSTNNEIRILIGILTLPDQYQKRHFLRLIYGTQPPIMGA  142

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--  639
            +VD+KF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP +      
Sbjct  143  KVDIKFVFCNLTKEDQKVLVALEIMRYDDIIILNCQENMNKGKTYTYFSSLPELFSVSDD  202

Query  638  ------YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFV  477
                  Y YVMKADDD ++RL     SL  LPR DLYYG+VIPCPSM+PFVHYMSGMG++
Sbjct  203  QPYYPPYHYVMKADDDTYIRLESFVESLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYL  262

Query  476  LSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHE  297
            +SWD+ EWI  S IP ++  GPEDK+ G+WL  G +A++R+N K +MY++P    RC+HE
Sbjct  263  VSWDIAEWIRDSDIPKSHLEGPEDKVFGEWLRDGHRARHRYNAKWSMYNFPEPPTRCTHE  322

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            L P+TIAVH LK  E+W+  L +FNVT +L+ SK+YH
Sbjct  323  LWPDTIAVHMLKNQEKWIQTLNYFNVTRDLKPSKLYH  359



>ref|XP_002866209.1| transferase, transferring glycosyl groups [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42468.1| transferase, transferring glycosyl groups [Arabidopsis lyrata 
subsp. lyrata]
Length=318

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 189/273 (69%), Gaps = 8/273 (3%)
 Frame = -1

Query  980  SNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVD  804
            SN P+   + E  + +  +       +LIGI T P++Y RRHFLR+IYG Q+     +VD
Sbjct  46   SNVPMNNGSSETPL-LSSSSVDDEIRILIGILTLPDQYPRRHFLRMIYGTQNVPDGVKVD  104

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----  639
            VKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSLP I         
Sbjct  105  VKFVFCNLTKEDQKVLVALEIMRYEDIIILNCNENMNKGKTYTYFSSLPDIFNETDAPNP  164

Query  638  -YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDL  462
             Y YVMKADDD ++RL  L ASL  L R DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+
Sbjct  165  PYHYVMKADDDTYIRLESLVASLRPLAREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDI  224

Query  461  VEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPET  282
              W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    RC+HEL P+T
Sbjct  225  AVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELWPDT  284

Query  281  IAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            IAVH LK  E+W+  L +FNVT+ L+ SK+YH 
Sbjct  285  IAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYHI  317



>ref|XP_010688494.1| PREDICTED: beta-1,3-galactosyltransferase 6 [Beta vulgaris subsp. 
vulgaris]
Length=343

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 180/245 (73%), Gaps = 6/245 (2%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +L+GI T P++Y +RHFLR+IYG QS   A++D+KF+ CNL+ E Q+  VALEI+R  DI
Sbjct  97   ILVGILTLPDQYHKRHFLRMIYGTQSPEGAKIDLKFVFCNLTKEDQKVLVALEIMRHDDI  156

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLP  561
            +IL+C ENMN GKTYTYFSSLP +  +       Y YV+KADDD + RL  L  SL  LP
Sbjct  157  IILDCKENMNKGKTYTYFSSLPKLFNNNDGPNPPYHYVLKADDDTYFRLENLVKSLRPLP  216

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYG+VIPCPSM+PF HYMSGMG+++SWDLVEWI  S IP ++  GPEDK+ G W+ 
Sbjct  217  REDLYYGYVIPCPSMDPFKHYMSGMGYLVSWDLVEWIAESDIPKSHLEGPEDKVFGDWIR  276

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
             G + KNRFN K +MY+YP     C+HEL P+TIAVH LK  E+WV  L++FNVT  L+ 
Sbjct  277  NGHRGKNRFNAKWSMYNYPDPPTGCTHELWPDTIAVHLLKTQEKWVKTLEYFNVTKNLKP  336

Query  200  SKMYH  186
            SK+YH
Sbjct  337  SKLYH  341



>ref|XP_004308498.1| PREDICTED: uncharacterized protein LOC101314610 [Fragaria vesca 
subsp. vesca]
Length=225

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 169/222 (76%), Gaps = 3/222 (1%)
 Frame = -1

Query  899  LIGIFTRPEKYDRRHFLRLIYGIQSTSLAR---VDVKFILCNLSGEAQRAFVALEILRFR  729
            +IGI TR + YDR HFL L+YG++     R     +KF+ C+L+   QRA +ALE+LRF 
Sbjct  1    MIGILTRTDNYDRCHFLPLVYGVRPVLSPRHHPRQLKFVFCSLTKPKQRALIALEMLRFD  60

Query  728  DIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            DI+ILNCTE MNSGKTYTYFS    +LP +YDY+M ADDDVF+R  PLA SL+ LPR DL
Sbjct  61   DILILNCTETMNSGKTYTYFSLPKLLLPRKYDYIMMADDDVFIRFEPLALSLKALPRVDL  120

Query  548  YYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKK  369
            YYGFVIPC SM+PFV YMSGMGF+LSWDLVEWI  S +P  N  GP+DKL+ +W  MG K
Sbjct  121  YYGFVIPCASMDPFVEYMSGMGFLLSWDLVEWIRSSEVPKENVVGPQDKLIEKWFKMGNK  180

Query  368  AKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWV  243
            A  + +NKPAMYDYPGTN RCSHELIPET+AVHRLK+ +  V
Sbjct  181  AMKKISNKPAMYDYPGTNERCSHELIPETVAVHRLKRLKDVV  222



>emb|CDY11865.1| BnaC03g12910D [Brassica napus]
Length=318

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 179/246 (73%), Gaps = 7/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLA-RVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +LIGI T P++Y RRHFLR+IYG Q      ++DVKF+ CNL+ E Q+  VALEI+R+ D
Sbjct  71   ILIGILTLPDQYPRRHFLRMIYGTQDVPAGVKIDVKFVFCNLTKEDQKVLVALEIMRYDD  130

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGL  564
            I+ILNC ENMN GKTYTYFSSLP +          Y YVMKADDD ++R   L ASL  L
Sbjct  131  IIILNCNENMNKGKTYTYFSSLPDLFNETDAPNPPYHYVMKADDDTYIRQESLVASLRPL  190

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+  W+  S IP  +  GPEDK+ G W+
Sbjct  191  PREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIAVWLKDSEIPKKHLEGPEDKVFGDWI  250

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G++ KNRFN K +MY++P    RC+HEL P+TIAVH LK  E+W+  L +FNVT+ L+
Sbjct  251  REGRRGKNRFNAKWSMYNFPEPPTRCTHELWPDTIAVHLLKNQEKWIRTLNYFNVTSNLK  310

Query  203  HSKMYH  186
             SK+YH
Sbjct  311  PSKLYH  316



>ref|XP_006280773.1| hypothetical protein CARUB_v10026744mg, partial [Capsella rubella]
 gb|EOA13671.1| hypothetical protein CARUB_v10026744mg, partial [Capsella rubella]
Length=337

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 188/273 (69%), Gaps = 14/273 (5%)
 Frame = -1

Query  983  NSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARV  807
            N+NS   TP       ++ +       +LIGI T P++Y RRHFLR+IYG Q      +V
Sbjct  70   NNNSSSETP-------LLSSSGGDEIRILIGILTLPDQYPRRHFLRMIYGTQVVPDGVKV  122

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR----  639
            DVKF+ CNL+ E Q+  VALEI+R+ DI+IL C ENMN GKTYTYFSSLP +        
Sbjct  123  DVKFVFCNLTKEDQKVLVALEIMRYDDIIILTCNENMNKGKTYTYFSSLPDLFNETDAPN  182

Query  638  --YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWD  465
              Y YVMKADDD ++RL  L ASL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++SWD
Sbjct  183  PPYHYVMKADDDTYIRLESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWD  242

Query  464  LVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPE  285
            +  W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    RC+HEL P+
Sbjct  243  IAVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTRCTHELWPD  302

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            TIAVH LK  E+W+  L +FNVT+ L+ SK+YH
Sbjct  303  TIAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYH  335



>ref|XP_010914138.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Elaeis guineensis]
Length=313

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 180/256 (70%), Gaps = 8/256 (3%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVA  750
            P      F LL+G+ TR + Y+RRH LRL+Y +Q+   A +D++F+ CNL+ E QR  +A
Sbjct  56   PVAVKPDFRLLMGVLTRADLYERRHLLRLVYSLQTNLSAHIDIRFVFCNLTKEDQRVLIA  115

Query  749  LEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAP  588
            LEI+R+ DI+ILNCTENMNSGKTYTYFSSLP +          YDYV+KADDD++ RL  
Sbjct  116  LEIMRYDDIIILNCTENMNSGKTYTYFSSLPNLFNGTNGDDRPYDYVLKADDDIYFRLPS  175

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            L  SL+ +PR D+YYGFVIPC SM+PF  YMSGMG++LSWDLV+WI  S +  N + G E
Sbjct  176  LIESLKKMPREDMYYGFVIPCGSMDPFHDYMSGMGYILSWDLVDWISTSEMVRNESVGVE  235

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVL  234
            D L G+WL  GK+ KNRFN KPAMYDY  P     CSH  +P+TIAVHRLK   +W   L
Sbjct  236  DLLTGKWLRDGKRGKNRFNTKPAMYDYPIPVPIDTCSHAFVPDTIAVHRLKDNLKWARTL  295

Query  233  KFFNVTTELEHSKMYH  186
            K+FNVT  L+ S+ YH
Sbjct  296  KYFNVTDGLKPSRFYH  311



>gb|KFK27299.1| hypothetical protein AALP_AA8G364400 [Arabis alpina]
Length=318

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 190/276 (69%), Gaps = 21/276 (8%)
 Frame = -1

Query  989  STNSNSPLRTP-NDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA  813
            S+ S +PL +  NDEI I             LIGI T P++Y RR+FLRLIYG Q     
Sbjct  54   SSLSETPLSSSVNDEIRI-------------LIGILTLPDQYSRRNFLRLIYGTQDVPAG  100

Query  812  -RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-  639
             ++DVKF+ CNL+ E Q+  VALEI+R+ DI+ILNC ENMN GKTYTYFSSL  I     
Sbjct  101  VKIDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLSDIFNETD  160

Query  638  -----YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVL  474
                 Y YVMKADDD ++RL  L ASL  LPR DLYYG+VIPCPSM+PFVHYMSGMG+++
Sbjct  161  SQIPPYHYVMKADDDTYIRLESLVASLRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLV  220

Query  473  SWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHEL  294
            SWD+  W+  S IP  +  GPEDK+ G W+  G++ KNRFN K +MY++P    +C+HEL
Sbjct  221  SWDIAVWLKDSEIPKKHLEGPEDKVFGDWIREGRRGKNRFNAKWSMYNFPEPPTKCTHEL  280

Query  293  IPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
             P+TIAVH LK  E+W+  L +FNVT+ L+ SK+YH
Sbjct  281  WPDTIAVHLLKNQEKWIRTLNYFNVTSNLKPSKLYH  316



>ref|XP_008811311.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Phoenix 
dactylifera]
Length=312

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 178/256 (70%), Gaps = 8/256 (3%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVA  750
            P      F LL+GI TR + Y+RRH LRL+Y +Q+   A +D++F+ CNL+ E QR  + 
Sbjct  55   PVTVKPDFRLLMGILTRADLYERRHLLRLVYSLQTNLTAHIDIRFVFCNLTKEDQRVLIP  114

Query  749  LEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAP  588
            LEI+R+ DI+ILNCTENMNSGKTYTY SSLP +          YDYV+KADDD++ RL  
Sbjct  115  LEIMRYDDIIILNCTENMNSGKTYTYLSSLPELFNGTNGDGRPYDYVLKADDDIYFRLPS  174

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            L  SL+ +PR DLYYGFVIPC SM+PF  YMSGMG++LSWDLVEWI  S +  N + G E
Sbjct  175  LIESLKKMPREDLYYGFVIPCGSMDPFHDYMSGMGYILSWDLVEWISTSEMVRNESSGVE  234

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVL  234
            D L G+WL  GK+ KNRFN KPAMYDY  P     CSH  +P+TIAVHRLK   +W   L
Sbjct  235  DFLTGKWLTDGKRGKNRFNTKPAMYDYPIPVPIDTCSHAFVPDTIAVHRLKDHLKWARTL  294

Query  233  KFFNVTTELEHSKMYH  186
            K+FNVT  L+ SK YH
Sbjct  295  KYFNVTDGLKPSKFYH  310



>ref|XP_009120267.1| PREDICTED: probable beta-1,3-galactosyltransferase 16, partial 
[Brassica rapa]
Length=278

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 183/247 (74%), Gaps = 7/247 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+GI T P++Y RRHFLR+IYG Q+  +  ++DVKF+ CNL+ E Q+  VALEI+R+ D
Sbjct  31   ILVGILTLPDQYPRRHFLRMIYGTQAIPNGVKIDVKFVFCNLTKEDQKVLVALEIMRYDD  90

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGL  564
            I+ILNC ENMN GKTYTYFSSLP +          Y Y+MKADDD+++RL  L ASL+ L
Sbjct  91   IIILNCNENMNKGKTYTYFSSLPDLFNETDSPNPPYHYIMKADDDIYIRLENLVASLKPL  150

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR DLYYG+VIPC SM+PFVHYMSGMG+++SWD+  W+  S IP  +  GPEDK+ G W+
Sbjct  151  PREDLYYGYVIPCQSMDPFVHYMSGMGYLVSWDIAVWLKDSEIPKKHLEGPEDKVFGDWM  210

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G++ KNRFN K +MY++P    +C+HEL P+TIAVH LK  E+W+  L +FNVT+ L+
Sbjct  211  KEGRRGKNRFNAKWSMYNFPEPPTKCTHELWPDTIAVHLLKNQEKWIRTLNYFNVTSNLK  270

Query  203  HSKMYHF  183
             SK+YH 
Sbjct  271  PSKLYHI  277



>ref|XP_008223729.1| PREDICTED: uncharacterized protein LOC103323513 [Prunus mume]
Length=328

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 191/274 (70%), Gaps = 12/274 (4%)
 Frame = -1

Query  983  NSNSPLRTPN-DEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARV  807
            +SN+   +PN   +A+N   + S+    +L GI T P +Y RRHFLRLIYG Q+   A+V
Sbjct  57   SSNTLHSSPNITSLALN---SSSNDEIRVLFGILTLPGQYQRRHFLRLIYGTQTPVGAKV  113

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLP-------GIL  648
            DVKF++CNL+ E Q   VALEI+R+ DI+IL+C ENMN GKT TYFSSLP       G+ 
Sbjct  114  DVKFVMCNLTKEDQEVLVALEIMRYDDIIILDCEENMNKGKTCTYFSSLPEMFNNTNGVY  173

Query  647  PSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSW  468
            P  Y YVMKADDD + RL  L  SL+ LPR DLYYG+VIPC SM PF HYMSGMG+++SW
Sbjct  174  PP-YHYVMKADDDAYFRLQNLVDSLKPLPREDLYYGYVIPCSSMEPFGHYMSGMGYLISW  232

Query  467  DLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIP  288
            D+VEWI  S IP N+  GPEDK  G W+  G +AKNRFN K +MY++P    + +HEL P
Sbjct  233  DIVEWIRESDIPRNHLEGPEDKTFGDWIKNGHRAKNRFNAKWSMYNFPEPPTKRTHELWP  292

Query  287  ETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
             TIAVH LK  E+W+  LK+FNVT  L+ SK+YH
Sbjct  293  HTIAVHLLKNQEKWIRTLKYFNVTDNLKPSKLYH  326



>gb|EYU42413.1| hypothetical protein MIMGU_mgv1a025682mg, partial [Erythranthe 
guttata]
Length=250

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 9/249 (4%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIGI T P+ Y +RHFLR+IYG QS + A VDVKF+ CNL+ E Q+  VALEI+R+ DI
Sbjct  1    ILIGILTLPDHYHKRHFLRMIYGTQSPTGAHVDVKFVFCNLTKEDQKVLVALEIMRYDDI  60

Query  722  VI-LNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLAPLAASLE  570
            +I L+C ENMN+GKTYTYFSSLP +  +         Y YV+K DDDV+ RL  L  SL 
Sbjct  61   IIILDCRENMNNGKTYTYFSSLPEMFINNESNSQYPPYHYVVKGDDDVYFRLQNLVDSLV  120

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQ  390
             LPR+DLYYG+VIPCPSM+ FVH MSGMG+++SWD+VEW+  S IP  +  GPEDK+ G 
Sbjct  121  PLPRQDLYYGYVIPCPSMDLFVHSMSGMGYLVSWDIVEWLMESDIPKKHLEGPEDKIFGD  180

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL  G++ KNR+N K AMY+YP    RC+HEL P+TIAVH LK  E+W+  L +FNVT +
Sbjct  181  WLREGRRGKNRYNAKWAMYNYPEPPTRCTHELWPDTIAVHLLKTQEKWIRTLNYFNVTRD  240

Query  209  LEHSKMYHF  183
            L+ SK+YH 
Sbjct  241  LKPSKLYHI  249



>ref|XP_009390510.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 176/256 (69%), Gaps = 8/256 (3%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVA  750
            P      F LLIG+ +R + Y+RRH LRL+Y +Q+   A VDV+F+ CNL+ E QR  +A
Sbjct  58   PVTVKPDFRLLIGVLSRADLYERRHLLRLVYSLQTNLTAHVDVRFVFCNLTKEDQRVLIA  117

Query  749  LEILRFRDIVILNCTENMNSGKTYTYFSSLPGIL------PSRYDYVMKADDDVFLRLAP  588
            LEI+R+ DI+IL+C ENMN GKTYTYFSS+P +          YD+V+KADDD++ RL  
Sbjct  118  LEIMRYNDIIILDCNENMNDGKTYTYFSSIPKLFNGADGDDQPYDFVLKADDDIYFRLPK  177

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            L  SL  +PR DLYYGFVIPC SM+PF  YMSGMG++LSWDLVEWI  S I  NNT G E
Sbjct  178  LIESLNKMPREDLYYGFVIPCDSMDPFNEYMSGMGYLLSWDLVEWISTSEIAKNNTVGAE  237

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVL  234
            D + G+WL  G K KNR+N K AMYD+  P     CSHE +P+TIAVHRLK   +W   L
Sbjct  238  DMMTGKWLREGNKGKNRYNTKYAMYDFPIPVPIDTCSHEFMPDTIAVHRLKDHLKWARTL  297

Query  233  KFFNVTTELEHSKMYH  186
            K+ NVT  L+ SK YH
Sbjct  298  KYLNVTDGLKPSKFYH  313



>gb|AES92334.2| galactosyltransferase family protein [Medicago truncatula]
Length=316

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 178/247 (72%), Gaps = 8/247 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIG+ T P++Y RRHFLRL+YG Q+   A++DVKF+ CN++ E Q+  +ALEI+R+ DI
Sbjct  68   ILIGVLTLPDQYLRRHFLRLVYGTQNPEGAKIDVKFVFCNITKEDQKTIIALEIMRYNDI  127

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLAPLAASLEG  567
            +ILNCTENMN GKT T+F+SLP I            Y YVMKADDD ++RL  L  SL+ 
Sbjct  128  IILNCTENMNKGKTSTFFTSLPEIFNETVNGPDYPPYHYVMKADDDTYVRLNSLVKSLKP  187

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            LP+ DLYYGFVIPC SM+PF HYMSGMGF++SWD+VEWI  S IP  +  GPEDK+ G W
Sbjct  188  LPKEDLYYGFVIPCGSMDPFKHYMSGMGFLVSWDIVEWIHGSDIPKKHVEGPEDKVFGDW  247

Query  386  LDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            +  G++  NRFN K +MY+YP     CSHEL+ +TIAVH LK  E+W+  L FFN T  L
Sbjct  248  MRWGRRGLNRFNAKWSMYNYPDPVSVCSHELVNDTIAVHLLKNQEKWIKTLNFFNHTGPL  307

Query  206  EHSKMYH  186
            + SKMYH
Sbjct  308  KESKMYH  314



>ref|XP_002309789.2| hypothetical protein POPTR_0007s01740g [Populus trichocarpa]
 gb|EEE90239.2| hypothetical protein POPTR_0007s01740g [Populus trichocarpa]
Length=172

 Score =   293 bits (750),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -1

Query  698  MNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPS  519
            MN+GKTY YFSSLP ILP  YDYVMKADDDVF+RL PL+ SL+ LP +DLYYGFVIPC S
Sbjct  1    MNNGKTYAYFSSLPHILPRHYDYVMKADDDVFIRLEPLSLSLKPLPWQDLYYGFVIPCNS  60

Query  518  MNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPA  339
            MNPF  YMSGMGF+LSWDLVEWIG+S IPAN+T GPEDK+VG+W  MG KAKNRF+NKPA
Sbjct  61   MNPFADYMSGMGFLLSWDLVEWIGKSEIPANDTVGPEDKMVGKWFKMGNKAKNRFSNKPA  120

Query  338  MYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            MYDYPGTNGRCSHEL+PET+AVHRLK+W+QW++VL+FFNVT +L +SK+YH
Sbjct  121  MYDYPGTNGRCSHELVPETVAVHRLKRWDQWLNVLEFFNVTKQLNNSKLYH  171



>ref|XP_003610137.1| hypothetical protein MTR_4g128310 [Medicago truncatula]
Length=397

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 178/247 (72%), Gaps = 8/247 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIG+ T P++Y RRHFLRL+YG Q+   A++DVKF+ CN++ E Q+  +ALEI+R+ DI
Sbjct  68   ILIGVLTLPDQYLRRHFLRLVYGTQNPEGAKIDVKFVFCNITKEDQKTIIALEIMRYNDI  127

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLAPLAASLEG  567
            +ILNCTENMN GKT T+F+SLP I            Y YVMKADDD ++RL  L  SL+ 
Sbjct  128  IILNCTENMNKGKTSTFFTSLPEIFNETVNGPDYPPYHYVMKADDDTYVRLNSLVKSLKP  187

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            LP+ DLYYGFVIPC SM+PF HYMSGMGF++SWD+VEWI  S IP  +  GPEDK+ G W
Sbjct  188  LPKEDLYYGFVIPCGSMDPFKHYMSGMGFLVSWDIVEWIHGSDIPKKHVEGPEDKVFGDW  247

Query  386  LDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            +  G++  NRFN K +MY+YP     CSHEL+ +TIAVH LK  E+W+  L FFN T  L
Sbjct  248  MRWGRRGLNRFNAKWSMYNYPDPVSVCSHELVNDTIAVHLLKNQEKWIKTLNFFNHTGPL  307

Query  206  EHSKMYH  186
            + SKMYH
Sbjct  308  KESKMYH  314



>emb|CBI17823.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 169/233 (73%), Gaps = 6/233 (3%)
 Frame = -1

Query  863  RRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGK  684
            RRHFLR++YG QS + A+VDVKF+ CNL+ E Q+  VALEI+R+ DI+ILNCTENMN GK
Sbjct  25   RRHFLRIVYGTQSPAGAKVDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCTENMNQGK  84

Query  683  TYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCP  522
            TY YFSSLP +L S       Y YVMKADDD +LRL  L  SL  LPR DLYYG V+PC 
Sbjct  85   TYAYFSSLPEMLNSTEGPSPPYHYVMKADDDTYLRLDNLVKSLRPLPREDLYYGCVVPCR  144

Query  521  SMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKP  342
            SMNPFVH+MSGMG+++SWD+VEWI  S IP N+  GPED++   WL  G + +NR   K 
Sbjct  145  SMNPFVHFMSGMGYLVSWDIVEWIRVSEIPKNHMVGPEDRVFADWLREGSRGRNRHMAKW  204

Query  341  AMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
             MYDYP     C+HEL P TIAVH LKK E+W+  LK+FNVT  L+ SK+YH 
Sbjct  205  EMYDYPEPRSVCTHELWPNTIAVHLLKKQEKWIETLKYFNVTQNLKPSKLYHI  257



>gb|EPS73000.1| hypothetical protein M569_01761, partial [Genlisea aurea]
Length=244

 Score =   293 bits (750),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 177/244 (73%), Gaps = 1/244 (0%)
 Frame = -1

Query  911  RFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRF  732
            +  +LIGI T P+++  R  LRL+YG QS    RVDV+F+LCN++ E  +  V LEI+R+
Sbjct  1    QMRVLIGILTLPDRFQERDLLRLVYGTQSPVGVRVDVRFVLCNVTDEDHKILVGLEIMRY  60

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRR  555
             DI+ILNC ENMN GKTYT+FSSLP I  S  YDYVMK+DDD + RL  L  SL+ LP+ 
Sbjct  61   ADIIILNCRENMNGGKTYTFFSSLPRIFGSDPYDYVMKSDDDTYFRLQNLVDSLKPLPKE  120

Query  554  DLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMG  375
            DLYYGFVIPC SMNPF +YMSGMG++++WD+VEWI  S IP     G EDK+ G+W+  G
Sbjct  121  DLYYGFVIPCNSMNPFKYYMSGMGYLITWDIVEWISVSDIPKKYLTGSEDKVFGKWISKG  180

Query  374  KKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSK  195
             + +NR++ K +MYD+P     CSHEL PET+ VH LK  ++WV  L++FNVT +L+ SK
Sbjct  181  HRGRNRYSAKWSMYDFPEPKTNCSHELWPETVGVHLLKNRDKWVRTLRYFNVTKDLKPSK  240

Query  194  MYHF  183
            +YHF
Sbjct  241  LYHF  244



>ref|XP_003543746.2| PREDICTED: uncharacterized protein LOC100777477 [Glycine max]
Length=307

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 184/270 (68%), Gaps = 16/270 (6%)
 Frame = -1

Query  959  PNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCN  783
            PN+ +  N    D      +LI + T P++Y RRHFLRL+YG Q+T   A+VDVKF+ CN
Sbjct  40   PNESLPTNSEDDD----LRILISVLTLPDQYQRRHFLRLVYGTQTTIEGAKVDVKFVFCN  95

Query  782  LSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLP----------GILP-SRY  636
            L+ E Q+  VALEI+R+ DI++LNCTENMN GKT T+F+SLP          GI+P   Y
Sbjct  96   LTKEDQKVLVALEIMRYNDIIVLNCTENMNKGKTSTFFTSLPEIFNNETTTSGIVPYPPY  155

Query  635  DYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVE  456
             YVMKADDD ++RL  L  SL  LPR DLYYGFVIPC SM+PF HYMSGMGFV+SWD+VE
Sbjct  156  HYVMKADDDTYVRLNSLVRSLRPLPREDLYYGFVIPCGSMDPFKHYMSGMGFVVSWDIVE  215

Query  455  WIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIA  276
            WI  S IP  +  GPEDK+ G W+   ++  NRFN K +MY+YP     CSH+L  +TIA
Sbjct  216  WIHGSDIPRKHVEGPEDKVFGDWMRWARRGNNRFNAKWSMYNYPDPPSVCSHDLWNDTIA  275

Query  275  VHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            VH LK  E+W+  L +FN T  L+ SK+YH
Sbjct  276  VHLLKNQEKWIRTLTYFNHTHALKPSKLYH  305



>ref|XP_008811313.1| PREDICTED: probable beta-1,3-galactosyltransferase 12 [Phoenix 
dactylifera]
Length=313

 Score =   293 bits (750),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 179/248 (72%), Gaps = 8/248 (3%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEILRF  732
            F L +GI T P+ Y+RRH LRL+Y +Q   + A VD++F+ CNL+ E QR  VALEILR+
Sbjct  65   FRLFMGILTHPDHYERRHLLRLVYSLQPKLATAHVDIRFVFCNLTKEDQRVLVALEILRY  124

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLE  570
             DI+ILNCTENMN GKTYTYFS+LP +  +       YDYVMKADDD++ RLA LA SL+
Sbjct  125  DDILILNCTENMNGGKTYTYFSTLPKLFDTTGDADRPYDYVMKADDDIYFRLARLAQSLK  184

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQ  390
             +PR+DLYYG  +PC  ++P+ HYMSGMG+VLSWDLVEWI  S I  ++T GPED     
Sbjct  185  KMPRQDLYYGCAVPCDRVDPYRHYMSGMGYVLSWDLVEWIATSEIARSHTVGPEDFTTWT  244

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL  G ++ ++F+ KPAMY+YP  +  C+H L+P+TIAVH+LK   +W   LK+F VT  
Sbjct  245  WLRDGNRSDDKFDTKPAMYNYPSGDP-CAHALVPDTIAVHQLKDNLKWARTLKYFKVTDG  303

Query  209  LEHSKMYH  186
            L+ SK+YH
Sbjct  304  LKPSKLYH  311



>ref|XP_004507843.1| PREDICTED: uncharacterized protein LOC101492465 [Cicer arietinum]
Length=312

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 174/247 (70%), Gaps = 8/247 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIGI T P++Y RRHFLRL+YG Q+   A++DVKF+ CNL+ E Q+  +ALEI+R+ DI
Sbjct  63   ILIGILTLPDQYLRRHFLRLVYGTQNPEGAKIDVKFVFCNLTKEEQKTTIALEIMRYNDI  122

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLAPLAASLEG  567
            +ILNCTENMN GKT T+F++LP I            Y YVMKADDD ++RL  L  SL+ 
Sbjct  123  IILNCTENMNKGKTSTFFTTLPSIFNETVKGPNYPPYHYVMKADDDTYVRLNSLVKSLKP  182

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            LP  DLYYGFVIPC SM+PF HYMSGMGF++SWD+VEWI  S IP  +  GPEDK+ G W
Sbjct  183  LPSEDLYYGFVIPCGSMDPFKHYMSGMGFLVSWDIVEWIHGSDIPKKHVEGPEDKVFGDW  242

Query  386  LDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            +  G++  NR+N K AMY+YP     CSH+L+ +TIAVH LK  E+WV  L FFN T  L
Sbjct  243  MRWGRRGLNRYNAKWAMYNYPDPPSVCSHDLVHDTIAVHLLKNQEKWVKTLNFFNHTAPL  302

Query  206  EHSKMYH  186
              S +Y 
Sbjct  303  MQSNLYQ  309



>gb|KHN22706.1| hypothetical protein glysoja_027594 [Glycine soja]
Length=307

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 179/260 (69%), Gaps = 12/260 (5%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFV  753
            P        +LI + T P++Y RRHFLRL+YG Q+T   A+VDVKF+ CNL+ E Q+  V
Sbjct  46   PNSEDDDLRILISVLTLPDQYQRRHFLRLVYGTQTTIEGAKVDVKFVFCNLTKEDQKVLV  105

Query  752  ALEILRFRDIVILNCTENMNSGKTYTYFSSLP----------GILP-SRYDYVMKADDDV  606
            ALEI+R+ DI++LNCTENMN GKT T+F+SLP          GI+P   Y YVMKADDD 
Sbjct  106  ALEIMRYNDIIVLNCTENMNKGKTSTFFTSLPEIFNNETTTSGIVPYPPYHYVMKADDDT  165

Query  605  FLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPAN  426
            ++R+  L  SL  LPR DLYYGFVIPC SM+PF HYMSGMGFV+SWD+VEWI  S IP  
Sbjct  166  YVRVNSLVRSLRPLPREDLYYGFVIPCGSMDPFKHYMSGMGFVVSWDIVEWIHGSDIPRK  225

Query  425  NTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQW  246
            +  GPEDK+ G W+   ++  NRFN K +MY+YP     CSH+L  +TIAVH LK  E+W
Sbjct  226  HVEGPEDKVFGDWMRWARRGNNRFNAKWSMYNYPDPPSVCSHDLWNDTIAVHLLKNQEKW  285

Query  245  VHVLKFFNVTTELEHSKMYH  186
            +  L +FN T  L+ SK+YH
Sbjct  286  IRTLTYFNHTHALKPSKLYH  305



>ref|XP_010914140.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Elaeis guineensis]
Length=314

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 182/258 (71%), Gaps = 9/258 (3%)
 Frame = -1

Query  932  VPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAF  756
            +P      F L +GI T P+ Y+RRH LRL+Y +Q + + A VD++F+ CNL+ E QR  
Sbjct  57   LPIAPKPDFRLFMGILTHPDHYERRHLLRLVYSLQPNLTTAHVDIRFVFCNLTKEDQRVL  116

Query  755  VALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLR  597
            VALEI+R+ DI+ILNCTENM++GKTY YFS+LP +  +        YDYVMKADDD++ R
Sbjct  117  VALEIMRYDDILILNCTENMDNGKTYAYFSTLPKLFNTTGDADRPPYDYVMKADDDIYFR  176

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTY  417
            L  LA SL+ +PR DLYYG  +PC  +NP+ HYMSGMG+VLSWDLV+WI  S I  N+T 
Sbjct  177  LGRLAQSLKKMPRHDLYYGCAVPCDRVNPYRHYMSGMGYVLSWDLVQWISTSEISRNHTV  236

Query  416  GPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHV  237
            GPED     WL  G +AK++F+ KPAMY+YP  +  C+H+L+P+TIAVH+LK   +W   
Sbjct  237  GPEDFTTWTWLRDGNRAKDKFDTKPAMYNYPSGDP-CAHDLVPDTIAVHQLKNNLKWART  295

Query  236  LKFFNVTTELEHSKMYHF  183
            LK+F VT  L+ SK+YH 
Sbjct  296  LKYFKVTDGLKPSKLYHI  313



>gb|KHN17589.1| hypothetical protein glysoja_005786 [Glycine soja]
Length=332

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 187/277 (68%), Gaps = 13/277 (5%)
 Frame = -1

Query  977  NSPLRTPNDEIAINIVPADSHAR-FSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVD  804
            NS LR     ++   +P +S      +LI + T P++Y RRHFLRL+YG Q+    A+VD
Sbjct  54   NSLLRFGRCALSNESLPTNSEDNDLRILISVLTLPDQYQRRHFLRLVYGTQTIIEGAKVD  113

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLP----------G  654
            VKF+ CNL+ + Q+  VALEI+++ DI+ILNCTENMN GKT T+FSSLP          G
Sbjct  114  VKFVFCNLTKQDQKVLVALEIMQYNDIMILNCTENMNKGKTSTFFSSLPEIFNKETTTSG  173

Query  653  ILP-SRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFV  477
            I+P   Y YVMKADDD ++R+  L  SL  LPR DLYYGFVIPC SM+PF HYMSGMGFV
Sbjct  174  IVPYPPYHYVMKADDDTYVRVNSLVRSLRPLPREDLYYGFVIPCGSMDPFKHYMSGMGFV  233

Query  476  LSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHE  297
            +SWD+VEWI  S IP  +  GPEDK+ G W+   ++  NRFN K +MY+YP     CSHE
Sbjct  234  VSWDIVEWIHGSDIPKKHVEGPEDKVFGDWMRWARRGNNRFNAKWSMYNYPDPPSVCSHE  293

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            L  +TIAVH LK  E+W+  L +FN T  L+ SK+YH
Sbjct  294  LWNDTIAVHLLKNQEKWIRTLTYFNHTDSLKPSKLYH  330



>ref|XP_010929245.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Elaeis guineensis]
Length=320

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 176/261 (67%), Gaps = 11/261 (4%)
 Frame = -1

Query  935  IVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRA  759
            I P      F LLIGI TR + Y+RRH LRL+Y +Q   + A +D++F+ CNL+ E QR 
Sbjct  58   IGPVTPKPDFRLLIGILTRADLYERRHLLRLVYSLQPRLATAHIDIRFVFCNLTKEDQRV  117

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVF  603
             VALEILR+ DI+ILNCTENM++GKTYTYFSSLP +            YDYVMK DDD +
Sbjct  118  IVALEILRYDDIIILNCTENMDNGKTYTYFSSLPELFNGTDAAGDDRPYDYVMKTDDDTY  177

Query  602  LRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANN  423
            L L  LA SL+   R D+YYGFV+PC SM+PF  YMSGMG++LSWDL+EWI  S +  N 
Sbjct  178  LILDNLAVSLKNKSREDMYYGFVLPCVSMDPFHDYMSGMGYILSWDLIEWISTSEMVRNR  237

Query  422  TYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGR--CSHELIPETIAVHRLKKWEQ  249
            T GPED+L  +WL  G KAKNR+  KPAMYD+P +  R  C HE +P TI VH++K    
Sbjct  238  TVGPEDRLTAEWLRDGNKAKNRYTAKPAMYDHPDSQPRSFCRHEFVPHTILVHKVKNNLN  297

Query  248  WVHVLKFFNVTTELEHSKMYH  186
            W   LK+FN T  L+ SK YH
Sbjct  298  WARTLKYFNATDGLKPSKFYH  318



>ref|XP_010914303.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Elaeis guineensis]
Length=315

 Score =   290 bits (743),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 184/276 (67%), Gaps = 12/276 (4%)
 Frame = -1

Query  983  NSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-LARV  807
            ++ +P R+P+ +    + P      F LLIGI T P+ Y+RRH LRL+Y +Q     A +
Sbjct  42   SACNPSRSPSADFTHAVTP---QPDFRLLIGILTLPDLYERRHLLRLVYSLQPKHPRAHI  98

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR----  639
            D++F+ CNL+ E QR  VALEI+R+ DI+ILNCTENMNSGKTYTYFS+LP +        
Sbjct  99   DIRFVFCNLTKEEQRVLVALEIMRYNDIIILNCTENMNSGKTYTYFSTLPKLCDGTHGHD  158

Query  638  --YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWD  465
              YDYVMKADDD +L L  LA SL    R D+YYG V+PC SM+PF  YMSGMG++LSWD
Sbjct  159  RPYDYVMKADDDSYLILDNLAESLRNKSRVDMYYGCVLPCDSMDPFHDYMSGMGYILSWD  218

Query  464  LVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGR--CSHELI  291
            LVEWI  S I   +T G ED +  +WL  G KAKNR+  KPAMYD+P T  R  C HE +
Sbjct  219  LVEWISTSEIARKHTVGVEDLVTAKWLRDGNKAKNRYTGKPAMYDHPDTQPRTSCQHEFV  278

Query  290  PETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            P+T+ VH++K   +W  +LK+FN T  L+ SK YH 
Sbjct  279  PDTVLVHKVKSNLKWATMLKYFNATHGLQPSKFYHL  314



>ref|XP_008808354.1| PREDICTED: uncharacterized protein LOC103720439 [Phoenix dactylifera]
Length=316

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 180/271 (66%), Gaps = 12/271 (4%)
 Frame = -1

Query  971  PLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKF  795
            P R+P+      I P      F LLIGI TR + Y+RRH LRL+Y +Q   + A +D++F
Sbjct  47   PSRSPSSNF---IDPVAPKPDFRLLIGILTRADLYERRHLLRLVYSLQPRRATAHIDIRF  103

Query  794  ILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YD  633
            + CNL+ E QR  VALEILR+ DI+ILNCTENM++GKTYTYF+SLP +          YD
Sbjct  104  VFCNLTKEDQRVLVALEILRYDDIIILNCTENMDNGKTYTYFASLPELFDGTNGDDRPYD  163

Query  632  YVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEW  453
            YVMK DDD +L L  LA SL    R D+YYGFV+PC SM+PF  YMSGMG++LSWDLVEW
Sbjct  164  YVMKTDDDAYLILDNLAESLMNKSREDMYYGFVLPCVSMDPFHDYMSGMGYILSWDLVEW  223

Query  452  IGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGR--CSHELIPETI  279
            I  S +  N T GPED+L  +WL  G KAKNR   KPAMYD+P +  R  C HE +P TI
Sbjct  224  ISTSEMVRNRTVGPEDRLTAEWLRDGNKAKNRCTAKPAMYDHPESEPRSFCRHEFVPHTI  283

Query  278  AVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
             VH++K    W  +L++FN T  L+ SK YH
Sbjct  284  LVHKVKNSLNWARMLEYFNATDGLKPSKFYH  314



>ref|NP_001048329.1| Os02g0785000 [Oryza sativa Japonica Group]
 dbj|BAD19302.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10243.1| Os02g0785000 [Oryza sativa Japonica Group]
 gb|EEC74131.1| hypothetical protein OsI_09200 [Oryza sativa Indica Group]
 gb|EEE57932.1| hypothetical protein OsJ_08639 [Oryza sativa Japonica Group]
Length=328

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 172/254 (68%), Gaps = 7/254 (3%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS---LARVDVKFILCNLSGEAQRA  759
            PA     F LLIG+ TR + Y+RRH LR++YG+Q  +    A VDV+F+ C L  + QR 
Sbjct  72   PASRKPDFRLLIGVLTRADNYERRHLLRMVYGLQLAAGDLTAHVDVRFVFCRLYKDDQRV  131

Query  758  FVALEILRFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPL  585
             V LEILR  DI++L+ C EN+N GKTY +FS+   +     YDYVMKADDD+FLRL  L
Sbjct  132  LVPLEILRHGDIIVLDECEENLNGGKTYAFFSAAARLYADDPYDYVMKADDDIFLRLPRL  191

Query  584  AASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPED  405
             ASL  +PR D YYG  IPC SM+PF  YMSGM + LSWD+VEW+  S +P N T GPED
Sbjct  192  LASLGAMPREDAYYGATIPCGSMDPFREYMSGMAYALSWDVVEWVATSDVPRNRTVGPED  251

Query  404  KLVGQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
            ++ GQWL +G + KNRFN KPAMYDY  P    +CSHE IP+TIAVHRLK   +W   LK
Sbjct  252  RMTGQWLRLGGRGKNRFNAKPAMYDYPLPAPVDKCSHEFIPDTIAVHRLKDNPRWAETLK  311

Query  230  FFNVTTELEHSKMY  189
            +FN T  LE SK Y
Sbjct  312  YFNFTKGLEPSKFY  325



>ref|XP_007154774.1| hypothetical protein PHAVU_003G146700g [Phaseolus vulgaris]
 gb|ESW26768.1| hypothetical protein PHAVU_003G146700g [Phaseolus vulgaris]
Length=310

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 182/275 (66%), Gaps = 21/275 (8%)
 Frame = -1

Query  986  TNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARV  807
            +N  +P R  ++++ I             LI + T P++Y RRHFLRL+YG Q+   A+V
Sbjct  47   SNETAPTRNESEDLRI-------------LISVLTLPDQYLRRHFLRLVYGTQTWEGAKV  93

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLP-------GIL  648
            +VKF+ CNL+ E Q+  VALEI+   DI+ILNCTENMN GKT T+F+SLP       G+ 
Sbjct  94   EVKFVFCNLTKEDQKVMVALEIMLHNDIIILNCTENMNKGKTSTFFTSLPEMFNDTSGVG  153

Query  647  P-SRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLS  471
            P   + YVMKADDD ++R+  L  SL  LPR DLYYGFVIPC SM+PF HYMSGMGFV+S
Sbjct  154  PYPPFHYVMKADDDTYVRINSLVRSLRPLPREDLYYGFVIPCGSMDPFKHYMSGMGFVVS  213

Query  470  WDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            WD+VEWI  S IP  +  GPEDK+ G W+   ++ KNRFN K +MY+YP     CSHEL 
Sbjct  214  WDIVEWIHGSDIPKKHVEGPEDKVFGDWMRWARRGKNRFNAKWSMYNYPDPPSVCSHELW  273

Query  290  PETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
             +TIAVH LK  E+W+  L FFN T  L  SK YH
Sbjct  274  NDTIAVHLLKNQEKWIRTLSFFNHTHSLNPSKFYH  308



>ref|XP_006649105.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Oryza brachyantha]
Length=345

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 172/257 (67%), Gaps = 10/257 (4%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS---LARVDVKFILCNLSGEAQRA  759
            PA     F LLIG+ TR + Y+RRH LR++YG+Q  +    A VDV+F+ C L  + QR 
Sbjct  86   PASRKPDFRLLIGVLTRADNYERRHLLRMVYGLQLAAGDLTAHVDVRFVFCRLYKDDQRV  145

Query  758  FVALEILRFRDIVILN-CTENMNSGKTYTYFSSLPGI-LPSRYDYVMKADDDVFLRLAPL  585
             V LEILR  D++IL+ C EN+N GKTYT+FS+   +     YDYVMKADDD+FLRL  L
Sbjct  146  LVPLEILRHGDVIILDECEENLNGGKTYTFFSAAARLDRDEPYDYVMKADDDIFLRLPRL  205

Query  584  AASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPED  405
              SL  +PR D YYG  IPC SM+PF  YMSGM + LSWDLVEW+  S +P N T GPED
Sbjct  206  LESLAAMPRDDAYYGATIPCDSMDPFREYMSGMAYALSWDLVEWVATSDVPRNRTVGPED  265

Query  404  KLVGQ---WLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVH  240
            ++ GQ   WL +G K KNRFN KPAMYDY  P    +CSHE +P+TIAVHRLK   +W  
Sbjct  266  RMTGQWLRWLRLGGKGKNRFNAKPAMYDYPLPAPVDKCSHEFVPDTIAVHRLKDNPRWAA  325

Query  239  VLKFFNVTTELEHSKMY  189
             L++FN T  LE SK Y
Sbjct  326  TLEYFNFTAGLEPSKFY  342



>ref|XP_010914139.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Elaeis guineensis]
Length=313

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 173/262 (66%), Gaps = 9/262 (3%)
 Frame = -1

Query  947  IAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEA  768
            +A  I P      F LLIGI T P++Y+RRH +RL Y +Q+   A VDV+F+ CN++GE 
Sbjct  51   VANFIDPVTRKPDFRLLIGILTLPDRYERRHLVRLAYSLQTNLTAHVDVRFVFCNITGEE  110

Query  767  QRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDV  606
             +  VALEI+R+ DI+ILNC ENM+SGKTYTYFSSLP I          YDYVMK DDD 
Sbjct  111  HQVLVALEIMRYDDIIILNCPENMDSGKTYTYFSSLPRIFNGTNGGDPPYDYVMKTDDDT  170

Query  605  FLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPAN  426
            + RL  LA SL   PR DLYYGF+ PC + N   HYMSGMG++LSWDLVEWI  S I  +
Sbjct  171  YFRLHNLAESLRNKPREDLYYGFLNPCNNPNAH-HYMSGMGYILSWDLVEWIATSEIVRS  229

Query  425  NTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWE  252
             T GPED + G WL  GK+ KNRF+  PAMYD   P       H  +P+TIAVH+LK  +
Sbjct  230  RTAGPEDSVTGAWLRDGKRGKNRFDMNPAMYDILDPNRVNCFRHAFVPDTIAVHKLKDQK  289

Query  251  QWVHVLKFFNVTTELEHSKMYH  186
            +W    K+FNVT  L+ SK+YH
Sbjct  290  KWATTFKYFNVTDGLKPSKLYH  311



>ref|XP_009417475.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Musa acuminata 
subsp. malaccensis]
Length=310

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 169/250 (68%), Gaps = 8/250 (3%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQS-TSLARVDVKFILCNLSGEAQRAFVALEILRF  732
            F LL+GI T P+ Y+RRH +R  Y +QS  S AR+DV+F+ CNL+ E QR  VA+EI+ +
Sbjct  61   FRLLVGILTLPDSYERRHLVRHAYALQSNVSDARIDVRFVFCNLTKEEQRVLVAMEIMIY  120

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPS------RYDYVMKADDDVFLRLAPLAASLE  570
             DI+ILNCTENM++GKTYTYFSSLP IL         YDYVMK DDD + RL  LA SL 
Sbjct  121  NDIIILNCTENMDNGKTYTYFSSLPKILEGINGIERPYDYVMKTDDDTYFRLQNLAESLR  180

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQ  390
             LPR D+YYGF+ PC        YMSGMG+VLSWDLVEWI  S +P ++  GPED + G 
Sbjct  181  RLPREDMYYGFLTPCHDRGAPNSYMSGMGYVLSWDLVEWIATSEMPRDHQVGPEDLVTGS  240

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCS-HELIPETIAVHRLKKWEQWVHVLKFFNVTT  213
            WL  G + KNRF+ K AMYDY      CS HE +P+TIAVH+LK   +W   LK+FN   
Sbjct  241  WLRAGGRGKNRFDMKLAMYDYMEEPRLCSRHEFVPDTIAVHKLKNNLRWATTLKYFNAAE  300

Query  212  ELEHSKMYHF  183
             L+ SK+YH 
Sbjct  301  GLKPSKLYHL  310



>ref|XP_008808355.1| PREDICTED: probable beta-1,3-galactosyltransferase 17 [Phoenix 
dactylifera]
Length=313

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 174/260 (67%), Gaps = 9/260 (3%)
 Frame = -1

Query  935  IVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRA  759
            I  A     F L IGI T P+ Y+RRH LRL+Y +Q   + A VD++F+ CNL+ + Q  
Sbjct  53   IESATPKPNFRLFIGILTLPDHYERRHLLRLVYSLQPKLTTAHVDIRFVFCNLTNDDQHV  112

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFL  600
             +ALEI+RF DI+IL+C E+M+ GKTY YFSSLP +L          YDYVMKADDD+++
Sbjct  113  LIALEIMRFDDILILDCAESMDDGKTYAYFSSLPKLLNGTNNGGGRPYDYVMKADDDIYI  172

Query  599  RLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNT  420
            RL  L  SL   PR D+YYG VI C   +P+  YMSGMG+VLSWDLVEWI  S +  N+T
Sbjct  173  RLQELVESLRNKPREDVYYGRVIQCYETDPYKGYMSGMGYVLSWDLVEWIATSEMVRNHT  232

Query  419  YGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYP-GTNGRCSHELIPETIAVHRLKKWEQWV  243
             GPED+++  WL  G++ KNRFN KPAMY+YP G    C HE +P+T+AVH+LK   +W 
Sbjct  233  VGPEDRVMAGWLKDGERGKNRFNEKPAMYNYPEGRLNPCMHEFMPDTVAVHQLKDNSRWA  292

Query  242  HVLKFFNVTTELEHSKMYHF  183
              LK+FNVT   + S ++H 
Sbjct  293  RTLKYFNVTHAFKPSTLHHI  312



>dbj|BAK04678.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 182/272 (67%), Gaps = 12/272 (4%)
 Frame = -1

Query  962  TPNDEIAINIVPADSHAR---FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVD  804
            T N   A++   A ++AR   F LLIGI TR + Y+RRH LR++YG+Q  +     A+VD
Sbjct  86   TANGSTALSSASAVAYARKPDFRLLIGILTRADVYERRHLLRMVYGLQLAADPALAAQVD  145

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILN-CTENMNSGKTYTYFSSLPGILP-SRYDY  630
            V+F+ C L  + QR  V LEIL   D+++L+ C EN+N GKT+T+F+++  +   + YDY
Sbjct  146  VRFVFCRLYKDDQRVLVPLEILAHGDVIVLDGCEENLNGGKTHTFFTAVAALYADAPYDY  205

Query  629  VMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI  450
            VMKADDD+ +RL  L ASL  +PR D+YYG  IPC SM+P   YMSGMG+ LSWDLV+W+
Sbjct  206  VMKADDDILIRLPALVASLGAMPREDMYYGATIPCNSMDPGRGYMSGMGYALSWDLVQWV  265

Query  449  -GRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETI  279
             G   +    T GPED++ G+WL +G K +NRFN KPAMYDY  P     CSHE +P+TI
Sbjct  266  AGAGEVTRGRTVGPEDRMTGEWLRVGGKGRNRFNAKPAMYDYPLPVPVDECSHEFVPDTI  325

Query  278  AVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            AVHRLK   +W H LK+FN T  L+ SK Y F
Sbjct  326  AVHRLKDNPRWAHALKYFNFTAGLKPSKFYKF  357



>ref|XP_008811307.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Phoenix 
dactylifera]
Length=315

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 171/263 (65%), Gaps = 9/263 (3%)
 Frame = -1

Query  947  IAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEA  768
            +A  + P      F LLIGI T P++Y+RR+ +RL Y +Q+   A VDV+F+ CN++ E 
Sbjct  51   VANFVDPVTRKPDFRLLIGILTLPDRYERRNLVRLAYSLQTNLTAHVDVRFVFCNITAEE  110

Query  767  QRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDD  609
             +  VALEI+++ DI+ILNC ENM+ GKTY YFSSLP IL          YDYVMK DDD
Sbjct  111  HQVLVALEIMQYDDIIILNCPENMDGGKTYAYFSSLPQILNGTNGGGDPPYDYVMKTDDD  170

Query  608  VFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPA  429
             + RL  LA SL   PR DLYYGF+ PC + +    YMSGMG+VLSWDLVEWI  S I  
Sbjct  171  TYFRLHNLAESLRSKPREDLYYGFLNPCNNPSLPRRYMSGMGYVLSWDLVEWIATSEIAR  230

Query  428  NNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNG-RC-SHELIPETIAVHRLKKW  255
            N T GPED + G WL  G + KNRF+  PAMYD    N   C  H  +P+TIAVH+LK  
Sbjct  231  NRTAGPEDSVTGAWLRDGNRGKNRFDMNPAMYDILDQNRVNCFRHAFVPDTIAVHKLKDQ  290

Query  254  EQWVHVLKFFNVTTELEHSKMYH  186
            ++W   LK+FNVT  L+ SK+YH
Sbjct  291  KKWATTLKYFNVTDHLKPSKLYH  313



>ref|XP_010236914.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Brachypodium 
distachyon]
Length=331

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 168/250 (67%), Gaps = 8/250 (3%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALEI  741
            F LLIG+ TR + Y+RRH LR++Y +Q  S     A+VDV+F+ C L  + QR  V LEI
Sbjct  80   FRLLIGVLTRADVYERRHLLRMVYNLQRLSSQALAAQVDVRFVFCRLYKDDQRVLVPLEI  139

Query  740  LRFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEG  567
            L   DI++L+ C EN+N GKTYTYFS++  +     YDYVMK DDD+F+RL  L ASL  
Sbjct  140  LLHGDIIVLDACEENLNEGKTYTYFSTVASLYADDPYDYVMKVDDDIFVRLPELLASLAK  199

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            +PR D YYG  IPC  M+P   YMSGMG+ LSWDLV+W+  S I  N+T GPED + GQW
Sbjct  200  MPREDAYYGATIPCEEMDPHNGYMSGMGYALSWDLVQWVATSDIAWNHTVGPEDMMTGQW  259

Query  386  LDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTT  213
            L  G K KNRFN KPAM+DY  P    +C HEL+P++IAVHRLK   +W  VL +FN T 
Sbjct  260  LREGGKGKNRFNAKPAMHDYLLPVPVDKCEHELMPDSIAVHRLKDNPRWAQVLGYFNFTA  319

Query  212  ELEHSKMYHF  183
             L+ SK Y+ 
Sbjct  320  ALKPSKFYNM  329



>ref|XP_009400103.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Musa acuminata 
subsp. malaccensis]
Length=333

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/257 (51%), Positives = 170/257 (66%), Gaps = 6/257 (2%)
 Frame = -1

Query  935  IVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRA  759
            + P      F LLIGI + P+ Y+RRH +R +Y +Q   + AR+DV+F+ CNL+ E QR 
Sbjct  76   VEPVTPEPDFRLLIGILSLPDSYERRHLVRDVYALQPGVANARIDVRFVFCNLTKEEQRV  135

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR---YDYVMKADDDVFLRLAP  588
             VA+EI+ + DI+IL+C ENM++GKTYTYFSSLP +L      YDYVMKADDD + RL  
Sbjct  136  LVAMEIMLYDDIIILDCAENMDNGKTYTYFSSLPKMLDGGGRPYDYVMKADDDTYFRLQL  195

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            LA SL  LPR D+YYG + PC +     HYMSGMG+VLSWDLVEWI  +  P N+  GPE
Sbjct  196  LAESLRKLPREDMYYGLITPCLNWRARDHYMSGMGYVLSWDLVEWIATAETPRNHQVGPE  255

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDY-PGTNGRC-SHELIPETIAVHRLKKWEQWVHVL  234
            DK++G WL   ++ KN  N +P MYDY  G    C  HEL+P+T+ VH LK   +W   L
Sbjct  256  DKVMGTWLREARRGKNEINMEPVMYDYLEGEPRTCYRHELVPDTVGVHMLKNNWRWATAL  315

Query  233  KFFNVTTELEHSKMYHF  183
            K+FN T  L+ S +YH 
Sbjct  316  KYFNATVGLKPSNLYHM  332



>emb|CBI17822.3| unnamed protein product [Vitis vinifera]
Length=293

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 176/278 (63%), Gaps = 38/278 (14%)
 Frame = -1

Query  992  FSTNSNSPLRTPNDEIAINIV--PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS  819
            FS NS+S     +D + +N    PAD   R  +LIGI T P++Y RR+FLR+IYG QS +
Sbjct  45   FSHNSSSS----DDFLTLNFTSDPADDDIR--ILIGILTLPDQYHRRNFLRMIYGTQSPA  98

Query  818  LARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR  639
             A+VDVKF+ CNL+ E Q+                          TYTYFSSLP +L S 
Sbjct  99   GAKVDVKFVFCNLTKEDQKVL------------------------TYTYFSSLPEMLNST  134

Query  638  ------YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFV  477
                  Y YVMKADDD +LRL  L  S+  LPR DLYYG+VIPCPSM+PFVHYMSGMG++
Sbjct  135  EGPSPPYHYVMKADDDTYLRLDNLVESMRPLPREDLYYGYVIPCPSMDPFVHYMSGMGYL  194

Query  476  LSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHE  297
            +SWD+VEWI  S IP  +  GPEDK+ G W+  G++ KNR   K AMY+YP    RC+HE
Sbjct  195  VSWDIVEWIRVSEIPKKHMEGPEDKVFGDWIREGRRGKNRHTAKWAMYNYPEPPTRCTHE  254

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            L P TIAVH LK  E+W+  L +FNVT  L+ SK+YH 
Sbjct  255  LWPNTIAVHLLKNQEKWIQTLNYFNVTQNLKPSKLYHI  292



>ref|NP_001136656.1| hypothetical protein [Zea mays]
 gb|ACF82345.1| unknown [Zea mays]
 gb|AFW64234.1| hypothetical protein ZEAMMB73_818479 [Zea mays]
Length=343

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 165/249 (66%), Gaps = 8/249 (3%)
 Frame = -1

Query  911  RFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALE  744
             F LLIG+ TR + Y+RRH LR++YG+Q  S     A VDV+F+ C L  + QR  V LE
Sbjct  92   EFRLLIGVLTRADLYERRHLLRMVYGLQLASPGGLAAHVDVRFVFCRLYKDDQRVLVPLE  151

Query  743  ILRFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLE  570
            IL   D+++L+ C EN+N GKTYT+ S++  +     YDYVMKADDD+FLRL  L  SL 
Sbjct  152  ILAHGDVIVLDGCEENLNGGKTYTFLSAVAALYADEPYDYVMKADDDIFLRLPQLVGSLG  211

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQ  390
            G+PR D+YYG  IPC SM+PF  YM+GM + LSWDLV+WI  S +  N++ G ED L G 
Sbjct  212  GMPREDMYYGATIPCDSMDPFREYMAGMAYALSWDLVQWIATSDVARNHSVGTEDMLTGL  271

Query  389  WLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVT  216
            WL +G K KNRFN KPA++DY  P    +C HE +P TI VHRLK   +W   LK+FN T
Sbjct  272  WLRIGGKGKNRFNAKPAIHDYLNPVPVDQCEHEFMPTTIGVHRLKSNPRWAEALKYFNFT  331

Query  215  TELEHSKMY  189
              L+ SK Y
Sbjct  332  AGLQPSKFY  340



>ref|XP_004955248.1| PREDICTED: uncharacterized protein LOC101786644 [Setaria italica]
Length=353

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 165/249 (66%), Gaps = 7/249 (3%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS---LARVDVKFILCNLSGEAQRAFVALEIL  738
            F LLIG+ TR + Y+RRH LR++YG+Q  S    A VDV+F+ C L  + QR  V LEIL
Sbjct  104  FRLLIGVLTRADLYERRHLLRMVYGLQLASGDLAAHVDVRFVFCRLYKDDQRVLVPLEIL  163

Query  737  RFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGL  564
               D+++L+ C EN+N GKTYT+ S++  +     YDYVMKADDD+  RL  L  SL  +
Sbjct  164  AHGDVIVLDGCEENLNGGKTYTFLSAVAELYADDPYDYVMKADDDILFRLPQLVESLGAM  223

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR D+YYG  IPC SM+PF  YM+GMG+ LSWDLVEWI  S +  N++ G ED L G+WL
Sbjct  224  PREDMYYGATIPCSSMDPFREYMAGMGYALSWDLVEWIATSDVARNHSVGTEDMLTGKWL  283

Query  383  DMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
             +G K KNRFN KPA++DY  P    +C HE +P TI VHRLK   +W   LK+FN T  
Sbjct  284  RIGGKGKNRFNAKPAIHDYRNPVPVDQCEHEFMPSTIGVHRLKSNPRWAEALKYFNFTAG  343

Query  209  LEHSKMYHF  183
            L+ SK Y F
Sbjct  344  LKSSKFYKF  352



>ref|XP_002452935.1| hypothetical protein SORBIDRAFT_04g035240 [Sorghum bicolor]
 gb|EES05911.1| hypothetical protein SORBIDRAFT_04g035240 [Sorghum bicolor]
Length=351

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 166/251 (66%), Gaps = 11/251 (4%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-------LARVDVKFILCNLSGEAQRAFVA  750
            F LLIG+ TR + Y+RRH LR++YG+Q  S        A VDV+F+ C L  + QR  V 
Sbjct  98   FRLLIGVLTRADLYERRHLLRMVYGLQLASPPEEEPLAAHVDVRFVFCRLYKDDQRVLVP  157

Query  749  LEILRFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAAS  576
            LEIL   D+++L+ C EN+N GKTYT+ S++  +     YDYVMKADDD+FLRL  L AS
Sbjct  158  LEILAHDDVIVLDGCEENLNGGKTYTFLSTVARLYADEPYDYVMKADDDIFLRLPQLVAS  217

Query  575  LEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLV  396
            L G+PR D+YYG  IPC SM+PF  YM+GM + LSWDLV+WI  S +  N++ G ED L 
Sbjct  218  LGGMPRDDMYYGATIPCDSMDPFRDYMAGMAYALSWDLVQWIATSDVARNHSVGTEDMLT  277

Query  395  GQWLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFN  222
            G WL +G K KNRFN KPA++DY  P    +C HE +P TI VHRLK   +W   LK+FN
Sbjct  278  GLWLRIGDKGKNRFNAKPAIHDYLNPVPVDQCEHEFMPSTIGVHRLKSNPRWAEALKYFN  337

Query  221  VTTELEHSKMY  189
             T  L+ SK Y
Sbjct  338  FTAGLKSSKFY  348



>gb|EMT10666.1| hypothetical protein F775_11943 [Aegilops tauschii]
Length=376

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 169/251 (67%), Gaps = 9/251 (4%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALEI  741
            F LLIGI TR + Y+RRH LR++YG+Q  +     A+VDV+F+ C L  + QR  + LEI
Sbjct  124  FRLLIGILTRADVYERRHLLRMVYGLQLAADPALAAQVDVRFVFCRLYKDDQRVLIPLEI  183

Query  740  LRFRDIVILN-CTENMNSGKTYTYFSSLPGILP-SRYDYVMKADDDVFLRLAPLAASLEG  567
            L   D+++L+ C EN+N GKT+ +  ++  +   + YDYVMKADDD+ +RL  L ASL  
Sbjct  184  LAHGDVIVLDGCEENLNGGKTHPFSPAVADLYADAPYDYVMKADDDILIRLPALVASLGA  243

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI-GRSRIPANNTYGPEDKLVGQ  390
            +PR D+YYG  IPC SM+P   YMSGMG+ LSWDLV+W+ G   +    T GPED++ G+
Sbjct  244  MPREDMYYGATIPCNSMDPGRGYMSGMGYALSWDLVQWVAGAGEVTRGRTVGPEDRMTGE  303

Query  389  WLDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVT  216
            WL +G K KNRFN KPAMYDY  P    +CSHE +P+TIAVHRLK   +W H L +FN T
Sbjct  304  WLRVGGKGKNRFNAKPAMYDYPLPVPVDQCSHEFVPDTIAVHRLKDNPRWAHALGYFNFT  363

Query  215  TELEHSKMYHF  183
              L+ SK Y F
Sbjct  364  AGLKPSKFYKF  374



>ref|XP_009418889.1| PREDICTED: uncharacterized protein LOC103998988 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 162/259 (63%), Gaps = 46/259 (18%)
 Frame = -1

Query  956  NDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLS  777
            N+ +     P  +   FSLLIGI TR + YDRRHFLR +YG Q++S+A + VKF+LC L+
Sbjct  32   NEGLVTASAPPAAKREFSLLIGILTRADLYDRRHFLRFVYGTQASSVATIHVKFVLCRLT  91

Query  776  GEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLR  597
               QR  +ALEILRF DI++LNCTENMN+GKTYTYFSSLP +LP                
Sbjct  92   KAEQRMLIALEILRFEDIIVLNCTENMNAGKTYTYFSSLPTVLPHH--------------  137

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTY  417
                        R DLYY   +PC S +P V YMSGM FVLSWDLV+WI  S IPA +T 
Sbjct  138  ------------RSDLYYCAAVPCSSRDPSVGYMSGMEFVLSWDLVQWIATSEIPARDT-  184

Query  416  GPEDKLVGQWLDMGKKAKNRFNNKP-AMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVH  240
                              NR   KP AMYDYPGTNGRCSHELIP T+ VHRLK+W++W+ 
Sbjct  185  ------------------NRVAEKPAAMYDYPGTNGRCSHELIPGTVVVHRLKRWDRWLP  226

Query  239  VLKFFNVTTELEHSKMYHF  183
            VL+FFNVT  L+ S++Y+ 
Sbjct  227  VLRFFNVTEGLKPSELYYI  245



>emb|CDY25905.1| BnaC09g32770D [Brassica napus]
Length=305

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 165/246 (67%), Gaps = 24/246 (10%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLA-RVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+GI T P++Y RRHFLR+IYG Q+     ++DVKF+ CNL+ E Q+  VALEI+R+ D
Sbjct  75   ILVGILTLPDQYPRRHFLRMIYGTQAIPNGIKIDVKFVFCNLTKEDQKVLVALEIMRYDD  134

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGL  564
            I+ILNC ENMN GKTYTYFSSLP +          Y Y+MKADDD+++RL  L ASL+ L
Sbjct  135  IIILNCNENMNKGKTYTYFSSLPDLFNETDSPNPPYHYIMKADDDIYIRLENLVASLKPL  194

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR DLYYG+VIP                  SWD+  W+  S IP  +  GPEDK+ G W+
Sbjct  195  PREDLYYGYVIP-----------------FSWDIAVWLKDSEIPKKHLEGPEDKVFGDWM  237

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G++ KNRFN K +MY++P    +C+HEL P+TIAVH LK  E+W+  L +FNVT+ L+
Sbjct  238  KEGRRGKNRFNAKWSMYNFPEPPTKCTHELWPDTIAVHLLKNQEKWIRTLNYFNVTSNLK  297

Query  203  HSKMYH  186
             SK+YH
Sbjct  298  PSKLYH  303



>emb|CDP02967.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 162/245 (66%), Gaps = 30/245 (12%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            +LIGI T P+ Y +RHFLRL+YGIQS   A+VDVKF+ CNL+ E Q+             
Sbjct  76   ILIGIPTLPDHYHKRHFLRLVYGIQSPQNAKVDVKFVFCNLTKEDQKVL-----------  124

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGLP  561
                         TYTYFSSLP +L +       Y YVMKADDD + RL  L  SL  LP
Sbjct  125  -------------TYTYFSSLPEMLNNTDGPFPPYHYVMKADDDSYFRLENLVESLRPLP  171

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R DLYYG+VIPCPSM+PFVHYMSGMG+++SWD+VEWI  S IP  +  GPEDK+ G+WL 
Sbjct  172  REDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIVEWIKESDIPLKHLEGPEDKVFGEWLR  231

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
             G +AKNR+N K +MY++P    RC+ EL P+TIAVH LK  E+W+  L +FNVT  L+ 
Sbjct  232  DGHRAKNRYNAKWSMYNFPEPPTRCTRELWPDTIAVHLLKTQEKWIRTLNYFNVTKNLKP  291

Query  200  SKMYH  186
            SK+YH
Sbjct  292  SKLYH  296



>ref|XP_009390509.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 169/267 (63%), Gaps = 9/267 (3%)
 Frame = -1

Query  959  PNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCN  783
            P   +A  I        F LL+GI + P+ Y+RRH +R +Y +QS  + A++DV+F+ CN
Sbjct  49   PPSSVATFIETVTPKPDFRLLMGILSLPDSYERRHLMRNVYALQSNITNAQIDVRFVFCN  108

Query  782  LSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMK  621
            L+ E QR  VA+EI+ + DI+IL+C ENM+ GKTY YFSSLP +L         YDYVMK
Sbjct  109  LTKEEQRVLVAMEIVLYDDIIILDCGENMDHGKTYAYFSSLPKMLEGSNGGDRPYDYVMK  168

Query  620  ADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRS  441
             DDD + RL  LA SL  +PR D+YYG + PC       +YM+GMG++LSWDLVEWI  S
Sbjct  169  VDDDTYFRLHNLAESLRKMPREDVYYGLINPCWIPQHKTNYMTGMGYLLSWDLVEWIATS  228

Query  440  RIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRC-SHELIPETIAVHRL  264
             +P  N  GPED   G W+  G + K +FN +PAMYDY      C  HE IP+TIAVH+L
Sbjct  229  ELPRKNQVGPEDFQTGLWMREGGRGK-KFNMEPAMYDYMEEPRTCHRHEFIPDTIAVHKL  287

Query  263  KKWEQWVHVLKFFNVTTELEHSKMYHF  183
            K   +W   L +FNVT  L+ SK+YH 
Sbjct  288  KSHLRWARTLNYFNVTAGLKPSKLYHI  314



>ref|XP_003576561.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Brachypodium 
distachyon]
Length=319

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 164/247 (66%), Gaps = 8/247 (3%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQS---TSLARVDVKFILCNLSGEAQRAFVALEIL  738
            F LLIG+ T P +Y+RRH LR +Y +Q    TS ARVDV+F  C L+   QR  V+LE +
Sbjct  71   FRLLIGVLTLPGRYERRHLLRTVYALQQPNLTSTARVDVRFFFCRLTSHEQRVLVSLEAM  130

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGIL-PSRYDYVMKADDDVFLRLAPLAASLEGLP  561
             + D+V L+C ENM++GKT++YFSS+P +   S YD+VMK DDD F RL  LA SL   P
Sbjct  131  LYGDVVELDCPENMDNGKTHSYFSSVPSLFGDSGYDFVMKTDDDTFFRLPQLAESLGRAP  190

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI--GRSRIPANNTYGPEDKLVGQW  387
            R DLYYG ++PC  +     YMSGMG+VLSWDLVEWI     +I  N T GPED+ +  W
Sbjct  191  REDLYYGCMVPCDYIRDRDVYMSGMGYVLSWDLVEWIVAAEDQI-GNRTDGPEDRTLSYW  249

Query  386  LDMGKKAKNRFNNKPAMYDYPGTNGR-CSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
                 KAKNR + KPAMYD+P  +G  C+HEL+P+TIAVHRLK   +W   LKFFN T  
Sbjct  250  FGAAGKAKNRVDVKPAMYDFPQEHGAPCAHELVPDTIAVHRLKDSWRWSTTLKFFNFTAG  309

Query  209  LEHSKMY  189
            L  SK Y
Sbjct  310  LPPSKFY  316



>ref|XP_001769179.1| predicted protein [Physcomitrella patens]
 gb|EDQ66051.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 161/229 (70%), Gaps = 1/229 (0%)
 Frame = -1

Query  911  RFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRF  732
            + S+L+G+FT   K +RR+ LRL Y +QS + A V ++F++     E ++  +ALE L  
Sbjct  1    KMSVLVGVFTMASKVERRNLLRLAYSVQSATDADVTIRFVIGRPRNEEEKLTIALESLTH  60

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRD  552
            +DI+IL+C ENMN GK++ YF ++   +  R+DYVMK DDD ++R+A LA SL+ LPR D
Sbjct  61   KDIIILDCEENMNHGKSFAYFFTVAA-MGVRFDYVMKVDDDAYVRVANLAKSLDPLPRDD  119

Query  551  LYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGK  372
            LYYG+VIPC + +P+  YM+GMG+++SWDLV+W+  S    NNT G EDKLVG WL    
Sbjct  120  LYYGYVIPCENKDPYAWYMAGMGYLISWDLVQWVHDSPTVRNNTNGTEDKLVGDWLKSAG  179

Query  371  KAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFF  225
            KAKNR + KP  YD+P   G+C+H+LIPETI +H++K   +W  VLKFF
Sbjct  180  KAKNRVSKKPFFYDHPEFGGKCAHDLIPETILIHQVKTPARWQQVLKFF  228



>emb|CBI17824.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 150/211 (71%), Gaps = 19/211 (9%)
 Frame = -1

Query  971  PLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFI  792
            PL + +D+I I             LIGI T P++Y RRHFLR+IYG QS + A+VD+KF+
Sbjct  57   PLNSTSDDIRI-------------LIGILTLPDQYHRRHFLRMIYGTQSPAGAKVDIKFV  103

Query  791  LCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDY  630
             CNL+ E Q+  VALEI+R+ DI+ILNCTENMN GKTYTYFSSLP +L S       Y Y
Sbjct  104  FCNLTKEDQKVLVALEIMRYDDIIILNCTENMNQGKTYTYFSSLPEMLNSTEGPSPPYHY  163

Query  629  VMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI  450
            VMKADDD++LRL  L  SL  LPR DLYYG+VIPC SMNPF HYMSGMG+++SWD+VEW+
Sbjct  164  VMKADDDIYLRLDKLVESLRPLPREDLYYGYVIPCGSMNPFHHYMSGMGYLVSWDIVEWV  223

Query  449  GRSRIPANNTYGPEDKLVGQWLDMGKKAKNR  357
              S I  N+  G ED++ G W+  GK+ KNR
Sbjct  224  SVSEISRNHLEGSEDRVFGDWMRWGKRGKNR  254



>ref|XP_009381783.1| PREDICTED: beta-1,3-galactosyltransferase 6-like [Musa acuminata 
subsp. malaccensis]
Length=332

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 165/255 (65%), Gaps = 12/255 (5%)
 Frame = -1

Query  911  RFSLLIGIFTRPEKYDRRHFLRLIYGIQS--TSLARVDVKFILCNLSGEAQRAFVALEIL  738
            +  +LIG+ T P+ Y RRH LR  Y +Q   T  AR+D++F+LC L+ E QR  VA+EIL
Sbjct  73   QLRILIGVLTVPDSYQRRHLLRDAYFLQPNLTVNARIDIRFVLCGLTTEEQRVLVAIEIL  132

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGIL------PSRYDYVMKADDDVFLRLAPLAAS  576
            R  DI+IL+C ENMN GKTYTYFS+LPG+        + YDYV+KADDD ++RL  LA +
Sbjct  133  RHGDIMILDCEENMNEGKTYTYFSNLPGVFNGSTGGETAYDYVLKADDDTYIRLDALAKT  192

Query  575  LEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGP---ED  405
            L+G+PR DLY G  IPC ++   + +M+GM + LSWDLVEWI RS IP N+   P   ED
Sbjct  193  LDGMPREDLYMGLFIPCKNITDRMGWMTGMAYALSWDLVEWIARSEIPRNHKTLPPHGED  252

Query  404  KLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRC-SHELIPETIAVHRLKKWEQWVHVLKF  228
             ++  WL      KNRF+  P MYDY      C SH+ IP+TIAVH+LK   +W   L +
Sbjct  253  VVLASWLRDASLGKNRFDMNPRMYDYYEEPTPCWSHDFIPDTIAVHKLKNDTKWAKTLDY  312

Query  227  FNVTTELEHSKMYHF  183
            FN+T  L  S +Y+ 
Sbjct  313  FNLTVGLRPSNLYNI  327



>ref|XP_009380762.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Musa acuminata 
subsp. malaccensis]
Length=327

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 169/260 (65%), Gaps = 12/260 (5%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSL-ARVDVKFILCNLSGEAQRAFV  753
            A       + +GI T+PE Y+RRH LR  Y +Q S S+ ARVDV+F+LCNL+ E QR  V
Sbjct  67   APPEPELRIFVGILTKPETYERRHLLRNAYALQPSVSINARVDVRFVLCNLTKEEQRVLV  126

Query  752  ALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLA  591
            ALEILR+ DIVIL+C EN+N GKT+TYFSS+P +          YDYV+KADDD ++R+ 
Sbjct  127  ALEILRYDDIVILDCAENLNDGKTFTYFSSMPKLFNGTGGGKPPYDYVLKADDDSYIRVD  186

Query  590  PLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANN-TYG  414
             LA +L+ +PR DLY GF IPC +++    +M+GM + LSWDLVEWI  S IP NN  + 
Sbjct  187  ALAQTLKEMPRDDLYMGFYIPCKNISDPDGWMTGMAYALSWDLVEWILESEIPRNNKVHH  246

Query  413  P--EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRC-SHELIPETIAVHRLKKWEQWV  243
            P  ED ++  WL  G + KNR +  P MYD    NG C S   IP+TI VHRLK   +W 
Sbjct  247  PLGEDVVLAYWLRDGNRGKNRVDVNPRMYDIYYDNGPCYSRPFIPDTIVVHRLKDNPRWA  306

Query  242  HVLKFFNVTTELEHSKMYHF  183
              L +FNVT  L+ SK+YH 
Sbjct  307  ATLAYFNVTQGLKPSKLYHI  326



>ref|XP_009401059.1| PREDICTED: uncharacterized protein LOC103985157 [Musa acuminata 
subsp. malaccensis]
Length=288

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 157/248 (63%), Gaps = 6/248 (2%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL---ARVDVKFILCNLSGEAQRAFVALEIL  738
              LL+G+FT P+ Y RR  +R  Y +Q  SL   A VDV+F+LCNL+ E QR  VA+EI+
Sbjct  40   LRLLLGVFTVPDAYARRSLVRHAYLLQRASLPADAAVDVRFVLCNLTKEEQRVLVAMEIM  99

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPS--RYDYVMKADDDVFLRLAPLAASLEGL  564
             + DI+IL+C EN+N GKTY Y SSLP +L +   YDYV+K DDD +  L  LA +L  L
Sbjct  100  LYDDIIILDCAENVNDGKTYDYLSSLPRVLGAGRAYDYVVKTDDDTYYLLDRLAETLRRL  159

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR D+Y G  +PC   +    +MSGMG++LSWDLVEWI  S +      GPED + G WL
Sbjct  160  PREDVYLGLRVPCWGKDEVSGFMSGMGYLLSWDLVEWIATSEVVRKKMKGPEDIMTGAWL  219

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            +   + +NRF+  P MYDYP     C  H   P+TIAVH+LK   +W   L++FNVT  L
Sbjct  220  NEAGRGRNRFDMNPRMYDYPEGPDTCFRHGFTPDTIAVHKLKDDLKWAKTLQYFNVTQGL  279

Query  206  EHSKMYHF  183
              SK++H 
Sbjct  280  RSSKLFHI  287



>ref|XP_009380761.1| PREDICTED: probable beta-1,3-galactosyltransferase 18 [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 164/269 (61%), Gaps = 12/269 (4%)
 Frame = -1

Query  971  PLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL---ARVDV  801
            PLR P    A+   P+       +L+G+ T P+ Y+RR  +R  Y +Q  SL   A VDV
Sbjct  54   PLRAPRFVGAV-ASPSPPSPDLRILLGVLTVPDAYERRSLVRRAYLLQQPSLIGKALVDV  112

Query  800  KFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----Y  636
            +F+LCNL+ E QR  VA+EI+ + DI+ILNCTEN+N GKTY YFSSLP  L        Y
Sbjct  113  RFVLCNLTKEEQRVLVAMEIMLYGDIMILNCTENVNDGKTYNYFSSLPRTLGGADDRRPY  172

Query  635  DYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVE  456
            DYV+K DDD + RL  LA +L  LPR DLY G  +PC        +MSGMG++LSWDLVE
Sbjct  173  DYVIKTDDDTYYRLGNLAETLRTLPREDLYLGLRVPCHRTEE--GFMSGMGYLLSWDLVE  230

Query  455  WIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRC-SHELIPETI  279
            WI  S +      GPED +VG W++   + +NR +  P MYDYP     C  H  IP+TI
Sbjct  231  WISTSELARRKMMGPEDIMVGVWMNEAGRGRNRIDTNPRMYDYPEGPDNCFRHAFIPDTI  290

Query  278  AVHRLKKWEQWVHVLKFFNVTTELEHSKM  192
            AVH+LK   +W   L++FNVT  LE S +
Sbjct  291  AVHKLKDNMKWAKTLQYFNVTHNLETSDL  319



>ref|XP_001770084.1| predicted protein [Physcomitrella patens]
 gb|EDQ65066.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 159/231 (69%), Gaps = 4/231 (2%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFR  729
            FS+ IG+F+   K +RR+ +RL YGIQ T++A V ++F++    GE +R  + LE L + 
Sbjct  1    FSIFIGVFSTASKVERRNIIRLAYGIQHTNIANVSIRFVIGTPKGEEERLQLGLESLHYG  60

Query  728  DIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            D++IL+  ENMN GKT+ YFS++  I+   +DYVMK DDD ++R+  LAASL   PR DL
Sbjct  61   DLLILDMEENMNKGKTWKYFSTV-AIMGVHFDYVMKVDDDSYVRIHNLAASLAEQPRVDL  119

Query  548  YYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYG-PEDKLVGQWLDMGK  372
            YYG+V+PC + N +++Y++GMG++LSWDLV+WI  S I      G  ED++ G WLD G 
Sbjct  120  YYGYVLPCENQNAYMNYIAGMGYILSWDLVQWIHESPIVRKRIGGYSEDRMTGDWLDAGN  179

Query  371  KAKNRFNNKPAMYDYPGTNG--RCSHELIPETIAVHRLKKWEQWVHVLKFF  225
            KA NR N KP  YD+P   G  RCSHEL PETI +H+LK    W+HVL++F
Sbjct  180  KALNRVNMKPMFYDHPAYKGRDRCSHELNPETILIHQLKSTALWLHVLRYF  230



>ref|XP_006655565.1| PREDICTED: probable beta-1,3-galactosyltransferase 16-like [Oryza 
brachyantha]
Length=346

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 165/256 (64%), Gaps = 12/256 (5%)
 Frame = -1

Query  914  ARFSLLIGIFTRPEKYDRRHFLRLIYGIQS---TSLA-RVDVKFILCNLSGEAQRAFVAL  747
            A   +L+GI T P KY+RR+ LR +Y +Q+    SLA  VDV+F+ CN++       VAL
Sbjct  91   ADVRVLVGIQTLPGKYERRNLLRTVYSLQAREQPSLAGSVDVRFVFCNVTSPVDAVLVAL  150

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLP----GILPSRYDYVMKADDDVFLRLAPLAA  579
            EI+R  DI++L+C ENM+ GKTYT+FS++     G    RYDYVMKADDD +LRL  L A
Sbjct  151  EIIRHGDIIVLDCAENMDGGKTYTFFSTVARAFNGTGAPRYDYVMKADDDTYLRLPALVA  210

Query  578  SLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPED  405
            SL G  R D YYG V+PC   N  PF  +MSGMG+ LSWDLV+W+  +     +  GPED
Sbjct  211  SLRGAAREDAYYGLVMPCDRDNFYPFPPFMSGMGYALSWDLVQWVATAEESRRDRVGPED  270

Query  404  KLVGQWLDMGKKAKNRFNNKPAMYDY-PGTNGRC-SHELIPETIAVHRLKKWEQWVHVLK  231
               G+WL++  +AKNR++N P MY+Y  G+   C  H+ IP+TIAVH LK   +W   L+
Sbjct  271  MWTGRWLNLAGRAKNRYDNAPRMYNYRGGSPPSCFRHDFIPDTIAVHMLKDAARWAETLR  330

Query  230  FFNVTTELEHSKMYHF  183
            +FNVT  L  S +YH 
Sbjct  331  YFNVTAALPPSPLYHL  346



>ref|XP_006661264.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Oryza brachyantha]
Length=342

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 161/242 (67%), Gaps = 6/242 (2%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA---RVDVKFILCNLSGEAQRAFVALEIL  738
            F LLIG+ T P +Y+RRH LR +Y +Q  ++A   RVDV+F+ C L     R  VALE +
Sbjct  87   FRLLIGVLTLPGRYERRHLLRTVYALQQPAVAPRARVDVRFVFCRLGSPEDRVLVALEAM  146

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLP  561
            R+ D+V L+C ENM++GKT  YFSS+P +   R YD+VMK+DDD F RL  LA SL   P
Sbjct  147  RYGDVVELDCPENMDNGKTNAYFSSVPPLFGDRAYDFVMKSDDDTFFRLPELAESLGRAP  206

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI-GRSRIPANNTYGPEDKLVGQWL  384
            R+DLYYG ++PC  +     YMSGMG+VLSWDLVEWI   +      T GPED+ +  WL
Sbjct  207  RQDLYYGCMVPCDYVRGSNEYMSGMGYVLSWDLVEWIVAAAPEIEGKTDGPEDRTLYSWL  266

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              G + KNR + KPAMY++PG +  CSHE IP+TIAVH+LK   +W   L++FN T  L+
Sbjct  267  RRGGRGKNRVDVKPAMYNFPGWHP-CSHEFIPDTIAVHQLKDNGRWARTLRYFNFTAGLK  325

Query  203  HS  198
             S
Sbjct  326  PS  327



>gb|EPS62703.1| hypothetical protein M569_12085, partial [Genlisea aurea]
Length=248

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 155/232 (67%), Gaps = 9/232 (4%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            + IGI T  ++Y+ R+ LRL YG QS+  A+VDV+F+LCNL+ + QR  V LEI+R+ DI
Sbjct  17   IFIGILTVADRYETRNLLRLAYGTQSSIGAQVDVRFMLCNLTTDDQRVLVLLEIIRYNDI  76

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR-----YDYVMKADDDVFLRLAPLAASLEGLPR  558
            +I++C ENM  GKTYTYFSSLP +L S      Y YV K DDD ++RL  L  SL  LPR
Sbjct  77   IIMDCRENMEDGKTYTYFSSLPRLLASYSTHPPYHYVAKVDDDTYVRLQNLVDSLNPLPR  136

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
             D+YYGF     +  P   +M+G  +++SWD+VEWI  S IP NN+ GPED + G+W+  
Sbjct  137  YDVYYGFR----ANRPEAPFMTGPCYLVSWDIVEWISISDIPRNNSKGPEDLIFGEWMRD  192

Query  377  GKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFN  222
            G + KN F+    +YDYPGT    S EL P T+A+HRLK  E+W+ VL +FN
Sbjct  193  GNRGKNYFDVAGKIYDYPGTKQHSSRELWPGTVAIHRLKTPERWIKVLNYFN  244



>gb|EPS73893.1| hypothetical protein M569_00860, partial [Genlisea aurea]
Length=253

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 156/245 (64%), Gaps = 7/245 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            L IG+ T P++++ R  LR+ YGIQS   A +DV+FI CNL+ E QR  +ALEI+ + DI
Sbjct  9    LFIGVMTIPDRHEIRGILRMAYGIQSPIGAHIDVRFIFCNLTNEEQRVLIALEIMTYDDI  68

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR-----YDYVMKADDDVFLRLAPLAASLEGLPR  558
            +ILNCTEN++ GKTYTYFSSLP +  S      Y YVMK DDD ++RL  L  SL  LPR
Sbjct  69   IILNCTENIHDGKTYTYFSSLPELFTSNSTYPPYHYVMKTDDDAYIRLQYLMDSLRPLPR  128

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
             D++YG+  P    +    +M G+ +++SWD+VEWI  S IP NN Y  ED + G WL +
Sbjct  129  DDMFYGYGFPFDRRDT-PDFMGGVIYIVSWDIVEWISTSDIPKNNIYATEDVIFGHWLFL  187

Query  377  GKKAKNRFNNKPAMYDYPGTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
            G+K KNR++ K  +YD P       SH L PET  VH+L    QW   L +FNVT  L+ 
Sbjct  188  GQKGKNRYDAKWTIYDIPDPAPTWYSHSLWPETAVVHQLNTRGQWAKALGYFNVTKGLKP  247

Query  200  SKMYH  186
            SK YH
Sbjct  248  SKFYH  252



>dbj|BAD19198.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD19308.1| hypothetical protein [Oryza sativa Japonica Group]
Length=313

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 158/252 (63%), Gaps = 12/252 (5%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRF  732
            F +  GI TRP+ Y+RR  LR+ Y +Q     A +DV+F++C+L  E     VA+EI+  
Sbjct  56   FRMFFGILTRPDFYERRALLRMAYALQPPPRRAAIDVRFVMCSLDKEEDAVLVAMEIITH  115

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPS----RYDYVMKADDDVFLRLAPLAASLEGL  564
             DI++LNCTENMN GKTY YFS+LP + P+    RYD+  K DDD + RL  LA +L   
Sbjct  116  GDILVLNCTENMNDGKTYDYFSALPRLFPAGAEPRYDFAGKIDDDTYYRLGALADTLRRK  175

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PRRD+Y+GF+ PC  ++P   YMSGMG+++SWD+ EWI  S        G ED + G+WL
Sbjct  176  PRRDMYHGFLNPC-HIDPAWQYMSGMGYIVSWDVAEWIAASPELRGREIGYEDDVFGRWL  234

Query  383  DMGKKAKNRFNNKPAMYDYP-----GTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFN  222
                K KNRF  +P MYDY      G +  C  HELI +T+AVH+LK   +W   L+FFN
Sbjct  235  RGAGKGKNRFGEEPRMYDYLDREMYGADVNCFRHELIADTVAVHKLKDRLKWARTLRFFN  294

Query  221  VTTELEHSKMYH  186
             T  L+ SKMYH
Sbjct  295  ATDGLKPSKMYH  306



>gb|EAZ09208.1| hypothetical protein OsI_31483 [Oryza sativa Indica Group]
Length=309

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 160/242 (66%), Gaps = 8/242 (3%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQS---TSLARVDVKFILCNLSGEAQRAFVALEIL  738
            F LLIG+ T P +Y+RRH LR++Y +Q     S ARVDV+F+ C +     R  V+LE +
Sbjct  63   FRLLIGVLTLPARYERRHLLRMVYALQQPAVASRARVDVRFVFCRVGSPEDRVLVSLEAM  122

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLP---GILPSRYDYVMKADDDVFLRLAPLAASLEG  567
             + D+V L+C ENM++GKT+ YFSS+P   G   + YD+VMKADDD F RL  LA SL  
Sbjct  123  AYGDVVELDCPENMDNGKTHAYFSSVPRLFGGGEAAYDFVMKADDDTFFRLPELAESLSR  182

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIP-ANNTYGPEDKLVGQ  390
             PRRDLYYG ++PC  +     YMSGMG++LSWDLVEWI  +       T GPED+ +  
Sbjct  183  APRRDLYYGCMVPCDYVRGSNEYMSGMGYLLSWDLVEWIVAAAAEIEGRTGGPEDRTLYS  242

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL  G + +NR + KPAMYD+PG +  CSHE IP+TIAVH+LK   +W   L++FN T  
Sbjct  243  WLRRGGRGRNRVDVKPAMYDFPGRH-PCSHEFIPDTIAVHQLKDNRRWARTLQYFNFTAA  301

Query  209  LE  204
            L+
Sbjct  302  LK  303



>ref|XP_004961308.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Setaria 
italica]
Length=361

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 160/256 (63%), Gaps = 16/256 (6%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQ---STSLA-RVDVKFILCNLSGEAQRAFVALEILR  735
            LLIGI T P KY+RRH LR +Y +Q     SLA RVDV+F+ CNL+      FVALEI+R
Sbjct  97   LLIGIQTLPAKYERRHLLRAVYSLQVREHPSLAGRVDVRFVFCNLTSPDDAVFVALEIMR  156

Query  734  FRDIVILNCTENMNSGKTYTYFSSLP-------GILPSRYDYVMKADDDVFLRLAPLAAS  576
            + DI++L+C ENM++GKTYT+FS++        G     YDYVMKADDD +LRL  LAAS
Sbjct  157  YGDIIVLDCAENMDNGKTYTFFSTVARAFDAGAGGRRPPYDYVMKADDDTYLRLPALAAS  216

Query  575  LEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDK  402
            L G  R D Y+G  +PC   N  PF  +MSGMG+ LSWDLV W+  S +      GPED 
Sbjct  217  LRGASREDAYFGLQMPCDRENFYPFPPFMSGMGYALSWDLVRWVSGSDLARREQDGPEDM  276

Query  401  LVGQWLDMGKKAKNRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKKWEQWVHVLKF  228
              G+W ++  +AKNR++  P MY+Y G +   C  H  +P+TIAVH LK   +W   L +
Sbjct  277  WTGRWFNLAGRAKNRYDAAPRMYNYKGASPDSCFRHGFVPDTIAVHMLKDDARWAETLAY  336

Query  227  FNVTTELEHS-KMYHF  183
            FN T  L  S  +YH 
Sbjct  337  FNATAGLPRSGHLYHL  352



>dbj|BAD33555.1| hypothetical protein [Oryza sativa Japonica Group]
Length=312

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 160/242 (66%), Gaps = 8/242 (3%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQS---TSLARVDVKFILCNLSGEAQRAFVALEIL  738
            F LLIG+ T P +Y+RRH LR++Y +Q     S ARVDV+F+ C +     R  V+LE +
Sbjct  66   FRLLIGVLTLPARYERRHLLRMVYALQQPAVASRARVDVRFVFCRVGSPEDRVLVSLEAM  125

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLP---GILPSRYDYVMKADDDVFLRLAPLAASLEG  567
             + D+V L+C ENM++GKT+ YFSS+P   G   + YD+VMKADDD F RL  LA SL  
Sbjct  126  AYGDVVELDCPENMDNGKTHAYFSSVPRLFGGGEAAYDFVMKADDDTFFRLPELAESLSR  185

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIP-ANNTYGPEDKLVGQ  390
             PRRDLYYG ++PC  +     YMSGMG++LSWDLVEWI  +       T GPED+ +  
Sbjct  186  APRRDLYYGCMVPCDYVRGSNEYMSGMGYLLSWDLVEWIVAAAAEIEGRTGGPEDRTLYS  245

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL  G + +NR + KPAMY++PG +  CSHE IP+TIAVH+LK   +W   L++FN T  
Sbjct  246  WLRRGGRGRNRVDVKPAMYNFPGRHP-CSHEFIPDTIAVHQLKDNRRWARTLQYFNFTAA  304

Query  209  LE  204
            L+
Sbjct  305  LK  306



>gb|EMS64481.1| hypothetical protein TRIUR3_12418 [Triticum urartu]
Length=336

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 157/250 (63%), Gaps = 31/250 (12%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALEI  741
            F LLIGI TR + Y+RRH LR++YG+Q  +     A+VDV+F+ C L  + QR  + LEI
Sbjct  108  FRLLIGILTRADVYERRHLLRMVYGLQLAADPALAAQVDVRFVFCRLYKDDQRVLIPLEI  167

Query  740  LRFRDIVILN-CTENMNSGKTYTYFSSLPGILP-SRYDYVMKADDDVFLRLAPLAASLEG  567
            L   D+++L+ C EN+N GKT+T+FS++  +   + YDYVMKADDD+ +RL  L ASL G
Sbjct  168  LAHGDVIVLDGCEENLNGGKTHTFFSAVAELYADAPYDYVMKADDDILIRLPALVASLGG  227

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            +  RD+YYG  IPC SM+P   YMSGMG+ LSWDLV+W+  +                  
Sbjct  228  V-ARDMYYGATIPCNSMDPGRGYMSGMGYALSWDLVQWVAGA------------------  268

Query  386  LDMGKKAKNRFNNKPAMYDY--PGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTT  213
                 + KNRFN KPAMYDY  P     CSHE +P+TIAVHRLK   +W H L +FN T 
Sbjct  269  ----GEGKNRFNAKPAMYDYPLPVPVDECSHEFVPDTIAVHRLKDNPRWAHALGYFNFTA  324

Query  212  ELEHSKMYHF  183
             L+ SK Y F
Sbjct  325  GLKPSKFYKF  334



>ref|NP_001136849.1| hypothetical protein [Zea mays]
 ref|XP_008681300.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF82755.1| unknown [Zea mays]
 gb|AFW73790.1| hypothetical protein ZEAMMB73_319438 [Zea mays]
Length=331

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 167/285 (59%), Gaps = 16/285 (6%)
 Frame = -1

Query  995  MFSTNSNSPLRTPNDEIAINIV------PADSHARFSLLIGIFTRPEKYDRRHFLRLIYG  834
            MF ++++S     N   A+  +      P D      LL+GI T P  Y+RR  LRL Y 
Sbjct  39   MFGSSTSSSCNYNNGASAVGRLAAGGSPPTDEAVDLRLLMGIVTTPSTYERRALLRLAYS  98

Query  833  IQSTSL-ARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLP  657
            +Q   + A VDV+F++C +  E  R  VALEI+   D+V+LNCTENMN GKTY YFS++P
Sbjct  99   LQPRPVRAVVDVRFVMCRIEREEDRILVALEIIAHGDVVVLNCTENMNDGKTYAYFSAVP  158

Query  656  GILPS---RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGM  486
            G+      RYDYV K DDD + R+A LA SL G  RRD Y G++ PC  + P   YMSGM
Sbjct  159  GLFAGDGERYDYVGKTDDDTYYRVAALAESLRGKARRDAYQGYLTPCHWL-PEKQYMSGM  217

Query  485  GFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDY----PGT  318
            G+V+SWD+ EWI  +    ++    ED   G WL  G + KN +N +P MYDY      T
Sbjct  218  GYVVSWDVAEWIAATPELRDDHNDWEDVNFGGWLRKGGRYKNVYNEEPRMYDYWDREMAT  277

Query  317  NGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            +  C  HE I +T+AVH+LK   +W   L FFN T  L+ SK+YH
Sbjct  278  DVNCFRHEHIADTVAVHKLKDRLKWARTLHFFNATQGLKPSKLYH  322



>ref|XP_002440203.1| hypothetical protein SORBIDRAFT_09g027700 [Sorghum bicolor]
 gb|EES18633.1| hypothetical protein SORBIDRAFT_09g027700 [Sorghum bicolor]
Length=374

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 159/260 (61%), Gaps = 20/260 (8%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST---SLAR-VDVKFILCNLSGEAQRAFVALEILR  735
            +LIGI T P K  RRH LR +Y +Q+    S+AR VDV+F+ CN++       VALE +R
Sbjct  108  VLIGIQTLPSKRARRHLLRDVYSLQAQEHPSVARGVDVRFVFCNVTSPDDAVLVALEAIR  167

Query  734  FRDIVILNCTENMNSGKTYTYFSSLPGILPS-----------RYDYVMKADDDVFLRLAP  588
            + DI++L+C ENM++GKTYT+FS++                  YDYVMKADDD +LRL  
Sbjct  168  YGDIMVLDCAENMDNGKTYTFFSTVARAFSGSDRRRRPRRRYEYDYVMKADDDTYLRLPA  227

Query  587  LAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYG  414
            L ASL G  R D YYG  +PC + N  PF  +MSGMG+ LSWDLV+W+  S +      G
Sbjct  228  LVASLRGAAREDAYYGLQMPCDTENFYPFPPFMSGMGYALSWDLVQWVASSDLARREQDG  287

Query  413  PEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKKWEQWVH  240
            PED   G+WL++  KAKNR++N P MY+Y G +   C  H  +P+TIAVH LK   +W  
Sbjct  288  PEDMWTGRWLNLAGKAKNRYDNAPRMYNYKGASPDSCFRHGFVPDTIAVHMLKDDARWAE  347

Query  239  VLKFFNVTTELEHS-KMYHF  183
             L +FN T  L  S  +YH 
Sbjct  348  TLAYFNATASLPRSGGLYHL  367



>dbj|BAD19304.1| hypothetical protein [Oryza sativa Japonica Group]
Length=307

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 158/246 (64%), Gaps = 8/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+G+ TR E Y+RR  LRL Y +Q + + A VDV+F +C+L+ E     V+LEI+   D
Sbjct  60   VLLGVVTRAEMYERRALLRLAYALQPAPARAVVDVRFFVCSLAREEDAVLVSLEIIAHGD  119

Query  725  IVILNCTENMNSGKTYTYFSSLPGILP-SRYDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            +V+LNCTENM+ GKT++YFSSLP +   + YDYV K DDD + RLA LA +L   PRRDL
Sbjct  120  VVVLNCTENMDDGKTHSYFSSLPALFADAPYDYVGKIDDDSYYRLASLADTLRDKPRRDL  179

Query  548  YYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKK  369
            Y+GF  PC + +P   +MSGMG+++SWD+  W+  +     +  GPED++ G+WL  G K
Sbjct  180  YHGFPAPCHA-DPRSQFMSGMGYIVSWDVAAWVAATEALRGDVKGPEDEVFGRWLRRGGK  238

Query  368  AKNRFNNKPAMYDYPGTNGR----C-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
              NR+  +  MYDY     R    C  H L+ +T+ VH+LK   +W   LKFFN T  L+
Sbjct  239  GSNRYGEETRMYDYLDGGMREGVNCFRHALVADTVVVHKLKDRLKWARTLKFFNATQGLK  298

Query  203  HSKMYH  186
             SK+YH
Sbjct  299  PSKLYH  304



>dbj|BAD19307.1| hypothetical protein [Oryza sativa Japonica Group]
Length=307

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 157/246 (64%), Gaps = 8/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+G+ TR +KY+RR  +RL Y +Q + + A V V+F++CNL+ E   A V LEI  + D
Sbjct  60   VLLGVLTRADKYERRALVRLAYALQPAPARAVVHVRFVVCNLTAEEDAALVGLEIAAYGD  119

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            I++L+CTENM++GKTYTYFS++P +     YDYV K DDD + RL  LA +L   PRRD 
Sbjct  120  IIVLDCTENMDNGKTYTYFSAVPRLFAGEPYDYVGKTDDDTYYRLGALADALRDKPRRDA  179

Query  548  YYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKK  369
            YYGF+ PC + +P   YMSGMG+V+SWD+  W+  +    N+  GPEDKL G+WL  G +
Sbjct  180  YYGFLTPCHA-DPRTQYMSGMGYVVSWDVAAWVAATPELQNDLKGPEDKLFGRWLRWGGR  238

Query  368  AKNRFNNKPAMYDYPGTNGR----C-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
             +N F  +P MYDY     R    C  H L  +T+AVH+LK   +W   L FFN T   +
Sbjct  239  GRNVFGAEPRMYDYLDGGMRHGPTCFRHLLQADTVAVHKLKDNLKWARTLNFFNATEGHK  298

Query  203  HSKMYH  186
             S ++H
Sbjct  299  ASPLFH  304



>gb|EEC70800.1| hypothetical protein OsI_02252 [Oryza sativa Indica Group]
 gb|EEE57935.1| hypothetical protein OsJ_08642 [Oryza sativa Japonica Group]
Length=305

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 157/246 (64%), Gaps = 8/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+G+ TR +KY+RR  +RL Y +Q + + A V V+F++CNL+ E   A V LEI  + D
Sbjct  58   VLLGVLTRADKYERRALVRLAYALQPAPARAVVHVRFVVCNLTAEEDAALVGLEIAAYGD  117

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            I++L+CTENM++GKTYTYFS++P +     YDYV K DDD + RL  LA +L   PRRD 
Sbjct  118  IIVLDCTENMDNGKTYTYFSAVPRLFAGEPYDYVGKTDDDTYYRLGALADALRDKPRRDA  177

Query  548  YYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKK  369
            YYGF+ PC + +P   YMSGMG+V+SWD+  W+  +    N+  GPEDKL G+WL  G +
Sbjct  178  YYGFLTPCHA-DPRTQYMSGMGYVVSWDVAAWVAATPELQNDLKGPEDKLFGRWLRWGGR  236

Query  368  AKNRFNNKPAMYDYPGTNGR----C-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
             +N F  +P MYDY     R    C  H L  +T+AVH+LK   +W   L FFN T   +
Sbjct  237  GRNVFGAEPRMYDYLDGGMRHGPTCFRHLLQADTVAVHKLKDNLKWARTLNFFNATEGHK  296

Query  203  HSKMYH  186
             S ++H
Sbjct  297  ASPLFH  302



>ref|NP_001169756.1| hypothetical protein [Zea mays]
 gb|ACN34815.1| unknown [Zea mays]
 gb|AFW79044.1| hypothetical protein ZEAMMB73_071372 [Zea mays]
Length=346

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 153/246 (62%), Gaps = 15/246 (6%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALEILR  735
            +LIGI T P K  RRH LR +Y +Q+         VDV+F+ CN++       VA+E LR
Sbjct  91   VLIGIQTLPSKRARRHLLRDVYSLQAREHPPVAGSVDVRFVFCNVTSPDDAVLVAVEALR  150

Query  734  FRDIVILNCTENMNSGKTYTYFSSLP------GILPSRYDYVMKADDDVFLRLAPLAASL  573
            + DI++L+C ENM++GKTYT+FS++       G  P RYDYVMKADDD +LRL  L  SL
Sbjct  151  YGDIIVLDCAENMDNGKTYTFFSTVARAFNGSGRRP-RYDYVMKADDDTYLRLPALVESL  209

Query  572  EGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKL  399
             G  R D YYG  +PC + N  PF  +MSGMG+ LSWDLV+W+  S +      GPED  
Sbjct  210  RGAAREDAYYGLQMPCDTENFYPFPPFMSGMGYALSWDLVQWVASSDLARREQNGPEDMW  269

Query  398  VGQWLDMGKKAKNRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKKWEQWVHVLKFF  225
             G+WL++  K KNR++N P MY+Y G +   C  H  +P+TIAVH LK   +W   L +F
Sbjct  270  TGRWLNLAGKGKNRYDNAPRMYNYKGASPDSCFRHGFVPDTIAVHMLKDDARWAETLAYF  329

Query  224  NVTTEL  207
            N T+ L
Sbjct  330  NATSGL  335



>gb|EMS63972.1| putative beta-1,3-galactosyltransferase 20 [Triticum urartu]
Length=399

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 144/212 (68%), Gaps = 4/212 (2%)
 Frame = -1

Query  815  ARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-  639
            ARV V+F  C +  E QR  VALE +R+ D+V L+C ENM++GKT++YFSS+P +  +  
Sbjct  186  ARVAVRFFFCRIESEEQRLLVALEAMRYGDVVELDCPENMDNGKTHSYFSSVPALFGAEA  245

Query  638  YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLV  459
            YD+VMKADDD F RL  LA SL   PR DLYYG ++PC  +  +  YMSGMG+V+SWDLV
Sbjct  246  YDFVMKADDDTFFRLPQLAESLGRAPREDLYYGCMVPCDYVRGWNEYMSGMGYVISWDLV  305

Query  458  EWI--GRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPE  285
            EWI     RI  N+T GPED+ +  W     KAKNR + KPAMYD+P     C+HEL+P+
Sbjct  306  EWIVAAADRI-RNHTAGPEDRTLYSWFSGAGKAKNRVDVKPAMYDFPQRGAPCAHELVPD  364

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKMY  189
            TIAVHRLK   +W   LK+FN T  L+ SK Y
Sbjct  365  TIAVHRLKNNFRWSTTLKYFNFTAGLQPSKFY  396



>ref|XP_006649106.1| PREDICTED: probable beta-1,3-galactosyltransferase 17-like [Oryza 
brachyantha]
Length=312

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 157/246 (64%), Gaps = 7/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+G+ TR E Y+RR  LRL Y +Q     A +DV+F +C+L+ E     V+LEI+   D
Sbjct  64   VLLGVVTRAEMYERRALLRLAYALQPPPERAVIDVRFFVCSLAREEDAVLVSLEIIAHGD  123

Query  725  IVILNCTENMNSGKTYTYFSSLPGI-LPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            +V+LNCTENM+ GKT++YFS++PG+ + + YDYV K DDD + RLA LA +L   PRRDL
Sbjct  124  VVVLNCTENMDDGKTHSYFSAVPGLFVDAPYDYVGKVDDDSYYRLAALADTLRDKPRRDL  183

Query  548  YYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKK  369
            Y+GF+ PC +      +MSGMG+++SWD+  W+  +     +  GPED++ G+WL  G K
Sbjct  184  YHGFLAPCHAGPGAPRFMSGMGYIVSWDVAAWVAATEALRRDVRGPEDEVFGRWLRSGGK  243

Query  368  AKNRFNNKPAMYDYPGTNGR----C-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
             +NR+  +  MYDY     R    C  H L+ +T+ VH+LK   +W   LKFFN T  L 
Sbjct  244  GRNRYGEETRMYDYLDGGMREGVNCFRHALVADTVVVHKLKDRLKWARTLKFFNATQGLR  303

Query  203  HSKMYH  186
             SK+YH
Sbjct  304  PSKLYH  309



>gb|EAY98941.1| hypothetical protein OsI_20896 [Oryza sativa Indica Group]
Length=357

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 158/259 (61%), Gaps = 22/259 (8%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST---SLA-RVDVKFILCNLSGEAQRAFVALEILR  735
            +LIGI T P KY+RR+ LR IY +Q+    SLA  VDV+F+ CN++       V+LE +R
Sbjct  99   VLIGIQTLPSKYERRNLLRTIYSLQAREQPSLAGSVDVRFVFCNVTSPVDAVLVSLEAIR  158

Query  734  FRDIVILNCTENMNSGKTYTYFSSLPGIL--------------PSRYDYVMKADDDVFLR  597
              DI++L+C ENM++GKTYT+FS++                  P RYDYVMKADDD +LR
Sbjct  159  HGDIIVLDCAENMDNGKTYTFFSTVARAFNSSDGEGSGSGSPAPPRYDYVMKADDDTYLR  218

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANN  423
            LA L  SL G  RRD YYG  +PC   N  PF  +MSGMG+ LSWDLV+W+  +     +
Sbjct  219  LAALVESLRGAARRDAYYGLQMPCDRENFYPFPPFMSGMGYALSWDLVQWVATAEESRRD  278

Query  422  TYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKKWEQ  249
              GPED   G+WL++  KAKNR++  P MY+Y G +   C   +  P+TIAVH LK   +
Sbjct  279  HVGPEDMWTGRWLNLAGKAKNRYDMSPRMYNYRGASPPSCFRRDFAPDTIAVHMLKDAAR  338

Query  248  WVHVLKFFNVTTELEHSKM  192
            W   L++FN T  L  S +
Sbjct  339  WAETLRYFNATAALRPSHL  357



>gb|EPS69158.1| hypothetical protein M569_05610, partial [Genlisea aurea]
Length=257

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 158/251 (63%), Gaps = 11/251 (4%)
 Frame = -1

Query  911  RFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL---ARVDVKFILCNLSGEAQRAFVALEI  741
            R  +LIGI   P+K+  RHFLR +Y ++S  +   AR D KF+ CN++ E  R  ++LEI
Sbjct  8    RIKILIGIMMTPDKFRHRHFLRQLYNVESGRIEDRARFDAKFVFCNITDEEHRLLISLEI  67

Query  740  LRFRDIVILNCTE---NMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLE  570
            + + D+++L+C E      +GKTY +FS LP + P  YDYVMK +DDV+ RL  LA SLE
Sbjct  68   MLYDDVIVLDCQEIVGGGGAGKTYAFFSGLPEMFPP-YDYVMKIEDDVYFRLQNLAKSLE  126

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYG--PEDKLV  396
             LP+ DLYYG  +PC ++     YMSG+G+++SWD+VEWI  + +P    Y    EDK  
Sbjct  127  TLPKSDLYYGRGVPCGALAD-DQYMSGVGYLVSWDIVEWISVADMPGKKNYTAEAEDKAF  185

Query  395  GQWLDMGKKAKNRFNNKPAMYDYPGTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNV  219
             +W+  G + KNR++    ++D PG+   C SHE+    + VH L +  +W+  L +FNV
Sbjct  186  AEWISDGDRGKNRYDVGYGIHDLPGSGSDCSSHEMWDGAVGVHGLDRENKWIDTLDYFNV  245

Query  218  TTELEHSKMYH  186
            T  LE++KMYH
Sbjct  246  TKGLENTKMYH  256



>ref|NP_001056253.1| Os05g0552200 [Oryza sativa Japonica Group]
 gb|AAT39276.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT85191.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18167.1| Os05g0552200 [Oryza sativa Japonica Group]
 gb|EEE64614.1| hypothetical protein OsJ_19466 [Oryza sativa Japonica Group]
Length=357

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 158/259 (61%), Gaps = 22/259 (8%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST---SLA-RVDVKFILCNLSGEAQRAFVALEILR  735
            +LIGI T P KY+RR+ LR IY +Q+    SLA  VDV+F+ CN++       V+LE +R
Sbjct  99   VLIGIQTLPSKYERRNLLRTIYSLQAREQPSLAGSVDVRFVFCNVTSPVDAVLVSLEAIR  158

Query  734  FRDIVILNCTENMNSGKTYTYFSSLPGIL--------------PSRYDYVMKADDDVFLR  597
              DI++L+C ENM++GKTYT+FS++                  P RYDYVMKADDD +LR
Sbjct  159  HGDIIVLDCAENMDNGKTYTFFSTVARAFNSSDGEGSGSGSPPPPRYDYVMKADDDTYLR  218

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANN  423
            LA L  SL G  RRD YYG  +PC   N  PF  +MSGMG+ LSWDLV+W+  +     +
Sbjct  219  LAALVESLRGAARRDAYYGLQMPCDRENFYPFPPFMSGMGYALSWDLVQWVATAEESRRD  278

Query  422  TYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKKWEQ  249
              GPED   G+WL++  KAKNR++  P MY+Y G +   C   +  P+TIAVH LK   +
Sbjct  279  HVGPEDMWTGRWLNLASKAKNRYDMSPRMYNYRGASPPSCFRRDFAPDTIAVHMLKDAAR  338

Query  248  WVHVLKFFNVTTELEHSKM  192
            W   L++FN T  L  S +
Sbjct  339  WAETLRYFNATAALRPSHL  357



>ref|XP_002454671.1| hypothetical protein SORBIDRAFT_04g035250 [Sorghum bicolor]
 gb|EES07647.1| hypothetical protein SORBIDRAFT_04g035250 [Sorghum bicolor]
Length=338

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 154/246 (63%), Gaps = 8/246 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSL-ARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            LL+GI T P  Y+RR  LRL Y +Q   + A VDV+F++C +  E  R  VALEI+   D
Sbjct  86   LLMGIVTIPSTYERRALLRLAYSLQPRPVRAVVDVRFVMCRIEREEDRILVALEIIAHGD  145

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLY  546
            +V+LNCTENMN GKTY YFS++P +   RYDYV K DDD + R+A LA SL G  RRD Y
Sbjct  146  VVVLNCTENMNDGKTYAYFSAVPELF-GRYDYVGKTDDDTYYRVAALAESLRGKARRDAY  204

Query  545  YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKA  366
             GF+ PC  + P   YMSGMG+V+SWD+VEWI  +    ++ +  ED   G WL  G + 
Sbjct  205  QGFLTPCHWL-PEKQYMSGMGYVVSWDVVEWIAATPELRDDHHDWEDVDFGGWLRKGGRY  263

Query  365  KNRFNNKPAMYDY----PGTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
            KN +N +P MYDY      T+  C  HE I + +AVH+LK   +W   L FFN T  L+ 
Sbjct  264  KNVYNEEPRMYDYWDREMATDINCFRHEHIADAVAVHKLKDRLKWARTLHFFNATQGLKP  323

Query  200  SKMYHF  183
            SK+YH 
Sbjct  324  SKLYHL  329



>ref|XP_004956920.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Setaria 
italica]
Length=312

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 162/256 (63%), Gaps = 18/256 (7%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS-TSLARVDVKFILCNLSGEAQRAFV  753
            P      FSLL+G+ T P + +RR  +R+ Y +Q   S ARVDV+F+ CN++     A +
Sbjct  64   PTQPEPEFSLLVGVLTMPSRRERRDIVRMAYALQPPASRARVDVRFVFCNVTDPVDAALL  123

Query  752  ALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAAS  576
            ALEI R  D+V+LNC ENMN GKTY Y SS+P +  SR YDYVMK DDD +LR+A LA  
Sbjct  124  ALEIRRHGDVVVLNCAENMNDGKTYAYLSSVPRLFASRPYDYVMKTDDDTYLRVAELADE  183

Query  575  LEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI-GRSRIPA-NNTYGPE  408
            L G PR D+Y  YG+ +    M PF+H   GMG+V+SWD+  W+ G   I A N+T GPE
Sbjct  184  LRGKPRDDVYLGYGYAMGGQPM-PFMH---GMGYVVSWDVASWVAGADEILARNDTLGPE  239

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYD--YPGTNGRCSHELIPETIAVHRLKKWEQWVHVL  234
            D +VG+WL++  + +NR++ KP MYD  +   N R      P+T+AVH LK   +W    
Sbjct  240  DLMVGKWLNLAGRGRNRYDLKPRMYDLNWDMDNFR------PDTVAVHMLKDNYRWAAAF  293

Query  233  KFFNVTTELEHSKMYH  186
            ++FNVT  +E S +YH
Sbjct  294  RYFNVTAGIEPSDLYH  309



>ref|XP_004956921.1| PREDICTED: beta-1,3-galactosyltransferase 6-like [Setaria italica]
Length=323

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 158/254 (62%), Gaps = 14/254 (6%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS-TSLARVDVKFILCNLSGEAQRAFV  753
            P      FSLL+G+ T P + +RR  +R+ Y +Q     ARVDV+F+ CN++     A V
Sbjct  76   PGAGTEEFSLLVGVLTMPSRRERRDIVRMAYALQPPAGAARVDVRFVFCNVTDPVDAALV  135

Query  752  ALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAAS  576
            A+E  R  DI++LNCTENMN GKT+ Y SS+P +  SR YDYVMK DDD +LR+A LA  
Sbjct  136  AVEARRHGDILVLNCTENMNDGKTHAYLSSVPRLFASRPYDYVMKTDDDTYLRVAALAEE  195

Query  575  LEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPE  408
            L G PR D+Y  +GF +    M PF+H   GMG+V+SWD+  W+  ++  +  N+T+GPE
Sbjct  196  LRGKPRGDVYLGHGFAVGDDPM-PFMH---GMGYVVSWDVARWVSDNQEILRHNDTHGPE  251

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D LVG+WL +G + KNR++ KP MYD             P+TIAVH LK   +W    ++
Sbjct  252  DLLVGKWLSIGGRGKNRYSLKPRMYDL----NWFMDNFRPDTIAVHMLKDNRRWAAAFRY  307

Query  227  FNVTTELEHSKMYH  186
            FNVT  +  S +YH
Sbjct  308  FNVTAGINPSDLYH  321



>dbj|BAJ95477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 161/265 (61%), Gaps = 9/265 (3%)
 Frame = -1

Query  950  EIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ---STSLA-RVDVKFILCN  783
            +  + +  AD  A   +LIGI T P KY+RRH LR +Y +Q     SLA  VDV+F+ CN
Sbjct  82   DATVPVKAADGQAGVRVLIGIQTMPGKYERRHLLRTVYALQLQEHPSLAGAVDVRFVFCN  141

Query  782  LSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILP-SRYDYVMKADDDV  606
            ++       VALEI+R+ D+++L+C ENM+ GKTY +F++     P   YDYVMKADDD 
Sbjct  142  VTSAVDAVLVALEIMRYGDVMVLDCAENMDGGKTYDFFAAAARAFPDGSYDYVMKADDDT  201

Query  605  FLRLAPLAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIP  432
            +LRL  LAA + G  R D Y G  +PC   N  PF  +MSGMG+ LSWDLV W+ RS + 
Sbjct  202  YLRLQALAAWMAGAARDDAYLGLQMPCDRENFYPFPPFMSGMGYALSWDLVRWVARSEVS  261

Query  431  ANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKK  258
              +  GPED   G+WL++  KAKNR++  P MY+Y G++   C      P+TIAVH LK 
Sbjct  262  RRDRVGPEDMWTGRWLNVAGKAKNRYDGAPRMYNYLGSSPANCFRRGFRPDTIAVHMLKD  321

Query  257  WEQWVHVLKFFNVTTELEHSKMYHF  183
              +W   L +FN T  L  S +YH 
Sbjct  322  AGRWAETLAYFNATAGLPPSGLYHL  346



>ref|XP_003565858.1| PREDICTED: uncharacterized protein LOC100838462 [Brachypodium 
distachyon]
Length=325

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 167/278 (60%), Gaps = 21/278 (8%)
 Frame = -1

Query  962  TPNDEIAINIVPADSHAR---FSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKF  795
            +  +  +  ++ AD++     F +L+G+ T P  Y+RR  LRL Y +Q   S A +DV+F
Sbjct  49   SARNHTSAQLIGADAYTAVVDFRVLLGVLTLPSSYERRALLRLAYKLQPPPSGAAIDVRF  108

Query  794  ILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR---YDYVM  624
            + CN++ E     VA+EI+ + DI++LNCTENMN GKTY +FS++P +   +   YDYV 
Sbjct  109  VFCNVTNEEDAVLVAMEIIVYDDILVLNCTENMNDGKTYDFFSAVPRLFADQVPSYDYVG  168

Query  623  KADDDVFLRLAPLAASLEGLPRRDLYYGFVIPC-----PSMNPFVHYMSGMGFVLSWDLV  459
            K DDD++ R+  LA +L G PR+D+Y+GF++PC     P  + F   M+G G+++SWD+ 
Sbjct  169  KVDDDIYYRVGHLADTLRGKPRQDMYHGFLLPCDVERKPGEDEF---MAGWGYIVSWDVA  225

Query  458  EWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPA-MYDY-----PGTNGRCSHE  297
             WI  +    ++  GPED    +WL  G K KN +   PA MYDY     P       H 
Sbjct  226  VWISETEELGDDVKGPEDMTFRRWLRRGGKGKNLYGEDPARMYDYLDYRWPDGLSCFRHA  285

Query  296  LIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
            L+P+TIAVH LK   +W   LKFFNVT  L+ SK+YH 
Sbjct  286  LVPDTIAVHYLKNRFRWARTLKFFNVTMGLKPSKLYHL  323



>ref|XP_003565859.1| PREDICTED: uncharacterized protein LOC100838773 [Brachypodium 
distachyon]
Length=314

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/281 (43%), Positives = 160/281 (57%), Gaps = 22/281 (8%)
 Frame = -1

Query  989  STNSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST-SLA  813
            +TNSN+P + P          AD   R  +L+G+ T P  Y+RR  LRL Y +Q   + A
Sbjct  42   NTNSNAPAQRPG--------AADVDLR--VLLGVLTLPSSYERRALLRLAYKLQPPPTGA  91

Query  812  RVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--  639
             VDV+F+ CN++ E     VA+EI+ + DI++LNCTENMN GKTY +FS++P +   +  
Sbjct  92   TVDVRFVFCNVAKEEDAVLVAMEIIAYDDILVLNCTENMNDGKTYDFFSAVPKLFADQVP  151

Query  638  -YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPC-PSMNPF-VHYMSGMGFVLSW  468
             YDYV K DDD++ R++PLA +L    RRD YYGF  PC P   P    +M G G+ +SW
Sbjct  152  SYDYVGKVDDDIYYRVSPLADALRSKARRDAYYGFEWPCEPETRPGDERFMVGWGYFVSW  211

Query  467  DLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPA-MYDYP----GTNGRC-  306
            D+  WI  +        G ED    +WL  G K KN +  KP+ MYDY     G    C 
Sbjct  212  DVAAWISETEELRGAAKGAEDMTFSRWLRRGGKGKNMYGEKPSRMYDYLNDGWGEKAACF  271

Query  305  SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
             H    +T+AVH+LK   QW   LKFFN T  L+ SKMYH 
Sbjct  272  RHNFTADTVAVHKLKDRRQWARALKFFNATQGLKPSKMYHL  312



>dbj|BAJ92824.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 163/264 (62%), Gaps = 19/264 (7%)
 Frame = -1

Query  947  IAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST--SLARVDVKFILCNLSG  774
            ++ +     +   F LL+G+ T P++Y+RR  +RL Y +Q    + A+VDV+F+ C +  
Sbjct  71   VSASATTTTAQPEFRLLVGVLTTPKRYERRDIVRLAYALQPPVPAYAQVDVRFVFCGVDD  130

Query  773  EAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILP-SRYDYVMKADDDVFLR  597
               R  VALE  R  DI++LNCTENMN GKT+ YFSS+P +   + YDYVMK DDD +LR
Sbjct  131  PVDRVLVALEAARHGDILVLNCTENMNDGKTHQYFSSVPRVFAHAPYDYVMKTDDDTYLR  190

Query  596  LAPLAASLEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPA  429
            +A +AA L   PR D+Y  YGF +    M     +M GMG+V+SWD+  W+  +   +  
Sbjct  191  VAAMAAELRPKPRDDVYLGYGFAVGDDPM----QFMHGMGYVVSWDVASWVSTNEEILRH  246

Query  428  NNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYD--YPGTNGRCSHELIPETIAVHRLKKW  255
            N+T+GPED L G+WL++G++ KNR++ KP MYD  +   N R      P+T+AVH +K  
Sbjct  247  NDTHGPEDLLFGKWLNIGRRGKNRYDLKPRMYDLNWNMDNFR------PDTVAVHMIKDN  300

Query  254  EQWVHVLKFFNVTTELEHSKMYHF  183
             +W   L++FNVT  +  S +YH 
Sbjct  301  RRWAAALRYFNVTAGIRPSNLYHL  324



>ref|XP_003565857.1| PREDICTED: uncharacterized protein LOC100838166 [Brachypodium 
distachyon]
Length=332

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 154/257 (60%), Gaps = 17/257 (7%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+G+ T P  Y+RR  LRL Y +Q   + A VDV+F+ CN++ E     VALEI+ + D
Sbjct  74   VLLGVLTVPSSYERRALLRLAYKLQPPPTGAVVDVRFVFCNVTKEEDAVLVALEIIAYDD  133

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR---YDYVMKADDDVFLRLAPLAASLEGLPRR  555
            I++LNCTENMN GKT+ +FS++P +   +   YDYV KADDD + R++ LA +L   PRR
Sbjct  134  ILVLNCTENMNDGKTFDFFSAVPKLFADKDPPYDYVGKADDDTYYRMSALADALRSKPRR  193

Query  554  --DLYYGFVIPC--PSMNPFVHYMSGMGFVLSWDLVEWIGR---SRIPANNTYGPEDKLV  396
              D+Y+GF+ PC   S NP   +M G G+V+SWD+  WI      R+  N T G ED   
Sbjct  194  RHDVYHGFLWPCDLESPNPEWQFMVGWGYVVSWDVAAWISSEPGERMSRNYTKGAEDMAF  253

Query  395  GQWLDMGKKAKNRFNNKPAMYDY-----PGTNGRC-SHELIPETIAVHRLKKWEQWVHVL  234
              WL +G K KN +     MYDY     P     C  HEL+P+T+AVHRLK    W   L
Sbjct  254  RHWLRLGGKGKNMYGEGKRMYDYLDGEKPDREKSCYRHELVPDTVAVHRLKSRLWWARTL  313

Query  233  KFFNVTTELEHSKMYHF  183
            +FFN T   + SKMYH 
Sbjct  314  RFFNSTEGFKPSKMYHL  330



>ref|XP_002438000.1| hypothetical protein SORBIDRAFT_10g006180 [Sorghum bicolor]
 gb|EER89367.1| hypothetical protein SORBIDRAFT_10g006180 [Sorghum bicolor]
Length=341

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 154/252 (61%), Gaps = 14/252 (6%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQ----STSLARVDVKFILCNLSGEAQ-RAFVALE  744
             S+L+G+ T P K+ RRH +R+ Y +Q    ++   RVDV+F+LC      + RAFVALE
Sbjct  94   MSVLVGVHTMPGKHSRRHLIRMAYVLQQQQQTSPALRVDVRFVLCARPMPPEHRAFVALE  153

Query  743  ILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----YDYVMKADDDVFLRLAPLAA  579
               + D+++L+C EN   GKTYTYF+SLP +L S      YDYVMK DDD FLRL  L  
Sbjct  154  ARAYGDVLVLDCAENAEDGKTYTYFASLPAMLGSGGGGPPYDYVMKVDDDTFLRLDALVD  213

Query  578  SLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKL  399
            +L   PR D+Y+G  +P  +   F  +M GMG++LSWDLVEWI  S +      G ED  
Sbjct  214  TLRSAPREDMYWGVGLPFQNRE-FPPFMLGMGYLLSWDLVEWIATSDMVRREAKGAEDLT  272

Query  398  VGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNV  219
             G+WL+MG KAKNR N  P MYDY       + + +  TI VH+LK+  +W H L+ FNV
Sbjct  273  TGKWLNMGNKAKNRVNIFPRMYDYKSAK---AEDFLENTIGVHQLKQDLRWAHTLEHFNV  329

Query  218  TTELEHSKMYHF  183
            T     SK+++F
Sbjct  330  TRLEPSSKLHNF  341



>gb|AAK73116.2|AF391808_26 unknown [Zea mays]
Length=261

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 150/252 (60%), Gaps = 18/252 (7%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  10   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  69

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLRLAP  588
            E   + D+++L+C EN   GKTYTYF+SLP +L S        YDYVMK DDD FL+L  
Sbjct  70   EARAYGDVLVLDCAENAEEGKTYTYFASLPTMLGSGSGGGGRPYDYVMKVDDDTFLQLDA  129

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            LA +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G E
Sbjct  130  LADTLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGVE  188

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+ 
Sbjct  189  DLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKGE---DFLENTIGVHQLKQDLRWAHTLEH  245

Query  227  FNVTTELEHSKM  192
            FNV T LE S M
Sbjct  246  FNV-TRLEPSNM  256



>gb|ABF67954.1| hypothetical protein [Zea mays]
 gb|AEJ07925.1| hypothetical protein [Zea mays subsp. mexicana]
Length=294

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 150/252 (60%), Gaps = 18/252 (7%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  43   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  102

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLRLAP  588
            E   + D+++L+C EN   GKTYTYF+SLP +L S        YDYVMK DDD FL+L  
Sbjct  103  EARAYGDVLVLDCAENAEEGKTYTYFASLPTMLGSGSGGGGRPYDYVMKVDDDTFLQLDA  162

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            LA +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G E
Sbjct  163  LAETLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGVE  221

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+ 
Sbjct  222  DLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKG---EDFLENTIGVHQLKQDLRWAHTLEH  278

Query  227  FNVTTELEHSKM  192
            FNV T LE S M
Sbjct  279  FNV-TRLEPSSM  289



>gb|AFV13465.1| hypothetical protein [Coix lacryma-jobi]
Length=350

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 154/260 (59%), Gaps = 16/260 (6%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL-----ARVDVKFILCNLSGEAQ-  765
            A +    S+L+G+ T P K+ RRH +R+ Y +Q         ARVDV+F+LC      + 
Sbjct  95   AAAEELMSVLVGVHTMPGKHSRRHLIRMAYALQQQQTPAPAPARVDVRFVLCARPMPPEH  154

Query  764  RAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVF  603
            RAFVALE   + D+++L+C EN   GKTYTYF+SLP +L S       YDYVMK DDD F
Sbjct  155  RAFVALEARVYGDVLVLDCAENAEDGKTYTYFASLPAMLGSGSGGRPPYDYVMKVDDDTF  214

Query  602  LRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANN  423
            L+L  L  +L   PR D+Y G  +P  +   F  +M GMG++LSWDLVEWI  S +    
Sbjct  215  LQLDALVETLRSAPREDMYCGSGLPFHNRE-FPPFMLGMGYLLSWDLVEWIATSDMVRRE  273

Query  422  TYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWV  243
              G ED   G+WL+MG KAKNR N  P MYDY       + + +  TI VH+LK+  +W 
Sbjct  274  AKGVEDLTTGKWLNMGHKAKNRVNIFPRMYDYKSAK---AEDFLENTIGVHQLKQDLRWA  330

Query  242  HVLKFFNVTTELEHSKMYHF  183
            H L+ FNVT     SK+++F
Sbjct  331  HTLEHFNVTRLEPSSKLHNF  350



>ref|XP_003578152.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2-like [Brachypodium 
distachyon]
Length=322

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/250 (44%), Positives = 158/250 (63%), Gaps = 16/250 (6%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQ--STSLARVDVKFILCNLSGEAQRAFVALEILR  735
            F LL+G+ T P +++RR  +RL Y +Q  + + A VDV+F+ C+++   +R  V+LE  R
Sbjct  80   FRLLVGVLTTPARHERRDIVRLAYALQPPAPAYAHVDVRFVFCDVADPTERVLVSLEAAR  139

Query  734  FRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPR  558
              D++ILNCTENMN GKT+ YFSS+P +  +  YDYVMK DDD +LR+A +A  L   PR
Sbjct  140  HGDVLILNCTENMNDGKTHEYFSSVPRLFAAAPYDYVMKTDDDTYLRVAAMAEELRPKPR  199

Query  557  RDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQ  390
            RD+Y  +GF +    M PF+H   GMG+V+SWD+  W+  +   +  N+T+GPED L G+
Sbjct  200  RDVYLGHGFAVGDDPM-PFMH---GMGYVVSWDVAAWVSDNEDILRHNDTHGPEDLLFGK  255

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL +G + KNR++ KP MYD             P+T+AVH LK   +W    ++FNVT E
Sbjct  256  WLGIGGRGKNRYSLKPRMYDL----NWYMDNFRPDTVAVHMLKDNRRWAAAFRYFNVTQE  311

Query  209  LEHSK-MYHF  183
            +  S  +YH 
Sbjct  312  VNSSSTLYHL  321



>gb|EAZ44835.1| hypothetical protein OsJ_29472 [Oryza sativa Japonica Group]
Length=313

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 153/243 (63%), Gaps = 9/243 (4%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQS---TSLARVDVKFILCNL-SGEAQRAFVALEI  741
            F LLIG+ T P +Y+RRH LR++Y +Q     S ARVDV+F+ C + S E +R  V    
Sbjct  66   FRLLIGVLTLPARYERRHLLRMVYALQQPAVASRARVDVRFVFCRVGSPEDRRPGVPGGD  125

Query  740  LRFRDIVILNCTENMNSGKTYTYFSSLP---GILPSRYDYVMKADDDVFLRLAPLAASLE  570
               R        ENM++GKT+ YFSS+P   G   + YD+VMKADDD F RL  LA SL 
Sbjct  126  GVRRRGGAPTAPENMDNGKTHAYFSSVPRLFGGGEAAYDFVMKADDDTFFRLPELAESLS  185

Query  569  GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIP-ANNTYGPEDKLVG  393
              PRRDLYYG ++PC  +     YMSGMG++LSWDLVEWI  +       T GPED+ + 
Sbjct  186  RAPRRDLYYGCMVPCDYVRGSNEYMSGMGYLLSWDLVEWIVAAAAEIEGRTGGPEDRTLY  245

Query  392  QWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTT  213
             WL  G + +NR + KPAMY++PG +  CSHE IP+TIAVH+LK   +W   L++FN T 
Sbjct  246  SWLRRGGRGRNRVDVKPAMYNFPGRHP-CSHEFIPDTIAVHQLKDNRRWARTLQYFNFTA  304

Query  212  ELE  204
             L+
Sbjct  305  ALK  307



>ref|XP_004954153.1| PREDICTED: probable beta-1,3-galactosyltransferase 17-like [Setaria 
italica]
Length=317

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 150/247 (61%), Gaps = 8/247 (3%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSL-ARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            + IGI T P  Y+RR  LRL Y +Q   + A VDV+F+LC +  E  R  V+LEI+   D
Sbjct  63   VFIGIVTVPGAYERRALLRLAYSLQPRPVRAVVDVRFVLCAVDKEEDRILVSLEIIAHGD  122

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            I++LNCTENMN GKTY YFS++P +  +  YDYV K DDD + RLA LA SL G  RRD 
Sbjct  123  ILVLNCTENMNDGKTYAYFSAVPRLFAAEPYDYVGKTDDDTYYRLASLADSLRGKARRDA  182

Query  548  YYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKK  369
            Y+G++ PC    P   YMSGMG+++SWD+  WI  +    ++    ED   G WL  G +
Sbjct  183  YHGYLTPC-HWRPEKQYMSGMGYIVSWDVAAWIAGTPELRDDHDDWEDVNFGGWLRKGGR  241

Query  368  AKNRFNNKPAMYDY----PGTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
             KN +N +P MYDY       +  C  HE + +T+AVH+LK   +W   L FFN T  L+
Sbjct  242  YKNVYNEEPRMYDYWDREMDADVNCFRHEHMADTVAVHKLKDRLKWARTLFFFNATQGLK  301

Query  203  HSKMYHF  183
             SKMY+ 
Sbjct  302  PSKMYNI  308



>gb|AEJ07952.1| hypothetical protein [Sorghum propinquum]
Length=348

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 155/261 (59%), Gaps = 23/261 (9%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQS---TSLA----------RVDVKFILCNLSGEA  768
             S+L+G+ T P K+ RRH +R+ Y +Q    TS A          RVDV+F+LC      
Sbjct  92   MSVLVGVHTMPGKHSRRHLIRMAYALQQQQQTSPALRAAAAAAAARVDVRFVLCARPMPP  151

Query  767  Q-RAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----YDYVMKADDDV  606
            + RAFVALE   + D+++L+C EN   GKTYTYF+SLP +L S      YDYVMK DDD 
Sbjct  152  EHRAFVALEARAYGDVLVLDCAENAEDGKTYTYFASLPAMLGSGGGRPPYDYVMKVDDDT  211

Query  605  FLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPAN  426
            FLRL  L  +L   PR D+Y+G  +P  +   F  +M GMG++LSWDLVEWI  S +   
Sbjct  212  FLRLDALVDTLRSAPREDMYWGVGLPFQNRE-FPPFMLGMGYLLSWDLVEWIATSDMVRR  270

Query  425  NTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQW  246
               G ED   G+WL+MG KAKNR N  P MYDY       + + +  TI VH+LK+  +W
Sbjct  271  EAKGAEDLTTGKWLNMGNKAKNRVNIFPRMYDYKSAK---AEDFLENTIGVHQLKQDLRW  327

Query  245  VHVLKFFNVTTELEHSKMYHF  183
             H L+ FNVT     SK+++F
Sbjct  328  AHTLEHFNVTRLEPSSKLHNF  348



>ref|XP_004964595.1| PREDICTED: beta-1,3-galactosyltransferase 6-like [Setaria italica]
Length=332

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 150/255 (59%), Gaps = 17/255 (7%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQST----SLARVDVKFILCNLSGEAQ-RAFVALE  744
             S+L+G+ T P K+ RRH +R+ Y +Q T    + ARVDV+F LC      + RAFVALE
Sbjct  82   LSVLVGVHTMPGKHSRRHLIRMAYALQQTPALRAAARVDVRFALCARPMPPEHRAFVALE  141

Query  743  ILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLAP  588
               + D+++L+C E+   GKTYTYF+SLP ++ S         YDYVMK DDD FLRL  
Sbjct  142  ARAYGDVLVLDCAESAEQGKTYTYFASLPAMIGSGGGAGDARPYDYVMKVDDDTFLRLDA  201

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            L  +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G E
Sbjct  202  LVETLRAAPREDMYGGVGLPFHDRE-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGVE  260

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D   G+WL+MG KAKNR N  P MYDY         + +  TI VH+LK+  +W H L+ 
Sbjct  261  DMTTGKWLNMGNKAKNRVNIFPRMYDYKSAK---DEDFLENTIGVHQLKQDLRWAHTLEH  317

Query  227  FNVTTELEHSKMYHF  183
            FN+T     SK++ F
Sbjct  318  FNLTRLEPSSKLHRF  332



>gb|ABF67944.1| hypothetical protein [Zea mays]
 gb|ACA21856.1| hypothetical protein [Zea mays]
Length=335

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 150/252 (60%), Gaps = 18/252 (7%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  84   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  143

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLRLAP  588
            E   + D+++L+C EN   GKTYTYF+SLP +L S        YDYVMK DDD FL+L  
Sbjct  144  EARAYGDVLVLDCAENAEEGKTYTYFASLPTMLGSGSGGGGRPYDYVMKVDDDTFLQLDA  203

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            LA +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G E
Sbjct  204  LADTLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGVE  262

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+ 
Sbjct  263  DLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKGE---DFLENTIGVHQLKQDLRWAHTLEH  319

Query  227  FNVTTELEHSKM  192
            FNV T LE S M
Sbjct  320  FNV-TRLEPSSM  330



>gb|AEJ07915.1| hypothetical protein [Zea mays]
Length=331

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 150/252 (60%), Gaps = 18/252 (7%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  80   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  139

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLRLAP  588
            E   + D+++L+C EN   GKTYTYF+S+P +L S        YDYVMK DDD FL+L  
Sbjct  140  EARAYGDVLVLDCAENAEEGKTYTYFASVPTMLGSGGGGGGRPYDYVMKVDDDTFLQLDA  199

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            LA +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G E
Sbjct  200  LAETLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGVE  258

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+ 
Sbjct  259  DLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKG---EDFLENTIGVHQLKQDLRWAHTLEH  315

Query  227  FNVTTELEHSKM  192
            FNV T LE S M
Sbjct  316  FNV-TRLEPSSM  326



>ref|XP_003567945.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Brachypodium 
distachyon]
Length=350

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 148/243 (61%), Gaps = 10/243 (4%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALEILR  735
            +LIGI T P KY+RR+ LR +Y +Q        A +D++F+LCN++       V+LE L 
Sbjct  96   VLIGIQTTPSKYERRNLLRTVYSLQIREHPHLAAAIDIRFVLCNVTSATDSTLVSLESLL  155

Query  734  FRDIVILNCTENMNSGKTYTYFSSLPGILPSRY--DYVMKADDDVFLRLAPLAASLEGLP  561
             RD+++L+C ENM+ GKTY +FS++    PS    DYVMKADDD +LRL  L A L    
Sbjct  156  NRDVLLLDCAENMDGGKTYDFFSAVARNPPSTPPPDYVMKADDDTYLRLPALLAWLSAAS  215

Query  560  RRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            R D Y G  +PC + N  PF  +MSGMG+ LSWDLV W+  S +   +  GPED   G+W
Sbjct  216  RADAYLGLQMPCDTENFYPFPPFMSGMGYALSWDLVSWVAESEVSRRDRVGPEDMWTGRW  275

Query  386  LDMGKKAKNRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKKWEQWVHVLKFFNVTT  213
            L++  KAKNR++  P MY+Y G +   C   +  P+TIAVH LK   +W   L +FN + 
Sbjct  276  LNVAGKAKNRYDGAPRMYNYRGASPASCFRRDFRPDTIAVHMLKDNGRWAETLAYFNASA  335

Query  212  ELE  204
             +E
Sbjct  336  VIE  338



>gb|ABF67932.1| hypothetical protein [Zea mays]
Length=335

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 150/252 (60%), Gaps = 18/252 (7%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  84   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  143

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLRLAP  588
            E   + D+++L+C EN   GKTYTYF+SLP +L S        YDYVMK DDD FL+L  
Sbjct  144  EARAYGDVLVLDCAENAEDGKTYTYFASLPTMLGSGSGGGGRPYDYVMKVDDDTFLQLDA  203

Query  587  LAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
            LA +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G E
Sbjct  204  LADTLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGVE  262

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+ 
Sbjct  263  DLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKGE---DFLENTIGVHQLKQDLRWAHTLEH  319

Query  227  FNVTTELEHSKM  192
            FNV T LE S M
Sbjct  320  FNV-TRLEPSSM  330



>ref|XP_002462426.1| hypothetical protein SORBIDRAFT_02g025420 [Sorghum bicolor]
 gb|EER98947.1| hypothetical protein SORBIDRAFT_02g025420 [Sorghum bicolor]
Length=335

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 158/259 (61%), Gaps = 18/259 (7%)
 Frame = -1

Query  935  IVPADSHAR-----FSLLIGIFTRPEKYDRRHFLRLIYGIQS--TSLARVDVKFILCNLS  777
            +V AD+ A       SLL+G+ T P + +RR  +R+ Y +Q   +  ARVDV+F+ CN++
Sbjct  83   VVAADADAETTTPELSLLVGVLTMPSRRERRDIVRMAYALQPPPSRPARVDVRFVFCNVT  142

Query  776  GEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPS-RYDYVMKADDDVFL  600
                 A VA+E  R  D+++L+CTENMN GKT+ Y SS+P +  S RYDYVMK DDD +L
Sbjct  143  DPVDAALVAVEARRHGDVLVLDCTENMNDGKTHAYLSSVPRLFASGRYDYVMKTDDDTYL  202

Query  599  RLAPLAASLEGLPRRDLYYGFVIPC-PSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPA  429
            R+A L   L   PR D+Y G+  P      PF+H   GMG+V+SWD+  W+  ++  +  
Sbjct  203  RVAALVEELRSKPRHDVYLGYGFPVGDDPMPFMH---GMGYVVSWDVARWVSANQDILRH  259

Query  428  NNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQ  249
            N+T+GPED LVG+WL++G + KNR++ KP MYD             P+TIAVH LK   +
Sbjct  260  NDTHGPEDLLVGKWLNIGGRGKNRYDLKPRMYDL----SWFMDNFRPDTIAVHMLKDNRR  315

Query  248  WVHVLKFFNVTTELEHSKM  192
            W    ++FNVT  +  S +
Sbjct  316  WAATFRYFNVTAGINLSHL  334



>ref|XP_006661263.1| PREDICTED: beta-1,3-galactosyltransferase 6-like [Oryza brachyantha]
Length=318

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 149/240 (62%), Gaps = 13/240 (5%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQS-TSLARVDVKFILCNLSGEAQRAFVALEILRF  732
            F LL+G+ T P +Y+RR  LRL Y +Q     ARVDV+F+LC+++  A    VA+E  R 
Sbjct  76   FRLLVGVMTTPRRYERRAILRLAYALQPPAEAARVDVRFVLCDVTDAADAVLVAMEAARH  135

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGIL-PSRYDYVMKADDDVFLRLAPLAASLEGLPRR  555
             DIV+L+C ENMN GKT+ Y +++  +  P+ YDYVMKADDD +LR+A LA  L   PR 
Sbjct  136  GDIVVLDCAENMNDGKTHAYLAAVSRLFAPAPYDYVMKADDDTYLRVAALADELRSQPRS  195

Query  554  DLYY--GFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQW  387
            DLY   G+ +      PF+H   GMG+V+SWD+  W+  +   +  N+T+G ED+LVG+W
Sbjct  196  DLYLGRGYAVGDDDPAPFMH---GMGYVVSWDVAAWLSANDEILRRNDTHGHEDRLVGKW  252

Query  386  LDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            L+ G + KNR+N KP MYD         H     TIAVHRLK   +W  VL+ FN T  +
Sbjct  253  LNAGGRGKNRYNLKPRMYDINWDMDEFRH----NTIAVHRLKDNHRWAAVLRHFNATAGI  308



>gb|AEJ07939.1| hypothetical protein [Zea diploperennis]
Length=336

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 150/253 (59%), Gaps = 19/253 (8%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + RAFVAL
Sbjct  84   MSVLVGVHTMPGKHSRRHLIRMAYALQQRTPALRAAARVDVRFVLCARPMPPEHRAFVAL  143

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLA  591
            E   + D+++L+C EN   GKTYTYF+SLP +L S         YDYVMK DDD FL+L 
Sbjct  144  EARAYGDVLVLDCAENAEEGKTYTYFASLPTMLGSGGGGGGGRPYDYVMKVDDDTFLQLD  203

Query  590  PLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGP  411
             L  +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G 
Sbjct  204  ALVDTLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGV  262

Query  410  EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
            ED   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+
Sbjct  263  EDLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKG---EDFLENTIGVHQLKQDLRWAHTLE  319

Query  230  FFNVTTELEHSKM  192
             FNV T LE S M
Sbjct  320  HFNV-TRLEPSSM  331



>ref|XP_006661262.1| PREDICTED: beta-1,3-galactosyltransferase 6-like [Oryza brachyantha]
Length=324

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/256 (42%), Positives = 157/256 (61%), Gaps = 20/256 (8%)
 Frame = -1

Query  920  SHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST---SLARVDVKFILCNLSGEAQRAFVA  750
            S     LL+G+ T P++Y+RR+ +RL Y +Q      +A+VDV+F+ C ++       VA
Sbjct  78   SRPELRLLVGVLTTPKRYERRNIVRLAYALQPAVPAGVAQVDVRFVFCAVADPVDAQLVA  137

Query  749  LEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASL  573
            LE +R  DI++LNCTENMN GKT+ Y SS+P +  +  YDYVMK DDD +LR+A L   L
Sbjct  138  LEAMRHGDILVLNCTENMNDGKTHEYLSSVPRLFAANPYDYVMKTDDDTYLRVAALVGEL  197

Query  572  EGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPED  405
               PR D+Y  YGF +    M     +M GMG+V+SWD+  W+  +   +  N+T+GPED
Sbjct  198  RSKPRDDVYLGYGFAVGDDPM----QFMHGMGYVVSWDVAAWVSTNEDILRHNDTHGPED  253

Query  404  KLVGQWLDMGKKAKNRFNNKPAMYD--YPGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
             LVG+WL++G++  NR++ +P MYD  +   N R      P+T+ VH LK   +W    +
Sbjct  254  LLVGKWLNIGRRGTNRYSLRPRMYDLNWDMDNFR------PDTVLVHMLKDNRRWAAAFR  307

Query  230  FFNVTTELEHSKMYHF  183
            +FNVT  L+ S +YH 
Sbjct  308  YFNVTAGLQPSVLYHL  323



>gb|ABF67924.1| hypothetical protein [Zea mays]
Length=296

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 149/253 (59%), Gaps = 19/253 (8%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  44   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  103

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLA  591
            E   + D+++L+C EN   GKTYTYF+SLP +L S         YDYVMK DDD FL+L 
Sbjct  104  EARAYGDVLVLDCAENAEEGKTYTYFASLPTMLGSGSGGGGGRPYDYVMKVDDDTFLQLD  163

Query  590  PLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGP  411
             L  +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G 
Sbjct  164  ALVDTLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGV  222

Query  410  EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
            ED   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+
Sbjct  223  EDLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKG---EDFLENTIGVHQLKQDLRWAHTLE  279

Query  230  FFNVTTELEHSKM  192
             FNV T LE S M
Sbjct  280  HFNV-TRLEPSSM  291



>gb|AAL59233.1|AF448416_13 hypothetical protein [Zea mays]
Length=286

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 149/253 (59%), Gaps = 19/253 (8%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  34   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  93

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLA  591
            E   + D+++L+C EN   GKTYTYF+SLP +L S         YDYVMK DDD FL+L 
Sbjct  94   EARAYGDVLVLDCAENAEEGKTYTYFASLPTMLGSGSGGGGGRPYDYVMKVDDDTFLQLD  153

Query  590  PLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGP  411
             L  +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G 
Sbjct  154  ALVDTLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGV  212

Query  410  EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
            ED   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+
Sbjct  213  EDLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKGE---DFLENTIGVHQLKQDLRWAHTLE  269

Query  230  FFNVTTELEHSKM  192
             FNV T LE S M
Sbjct  270  HFNV-TRLEPSSM  281



>ref|NP_001063242.1| Os09g0432900 [Oryza sativa Japonica Group]
 dbj|BAD33549.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD33933.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25156.1| Os09g0432900 [Oryza sativa Japonica Group]
 dbj|BAG87630.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97580.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 156/250 (62%), Gaps = 20/250 (8%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST---SLARVDVKFILCNLSGEAQRAFVALEILRF  732
            LL+G+ T P++Y+RR+ +RL Y +Q      +A+VDV+F+ C ++       V LE  R 
Sbjct  94   LLVGVLTTPKRYERRNIVRLAYALQPAVPPGVAQVDVRFVFCRVADPVDAQLVVLEAARH  153

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRR  555
             DI++LNCTENMN GKT+ Y SS+P +  S  YDYVMK DDD +LR+A L   L   PR 
Sbjct  154  GDILVLNCTENMNDGKTHEYLSSVPRMFASSPYDYVMKTDDDTYLRVAALVDELRHKPRD  213

Query  554  DLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQW  387
            D+Y  YGF +    M     +M GMG+V+SWD+  W+  +   +  N+T+GPED LVG+W
Sbjct  214  DVYLGYGFAVGDDPM----QFMHGMGYVVSWDVATWVSTNEDILRYNDTHGPEDLLVGKW  269

Query  386  LDMGKKAKNRFNNKPAMYD--YPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTT  213
            L++G++ KNR++ +P MYD  +   N R      P+T+ VH LK   +W    ++FNVT 
Sbjct  270  LNIGRRGKNRYSLRPRMYDLNWDMDNFR------PDTVLVHMLKDNRRWAAAFRYFNVTA  323

Query  212  ELEHSKMYHF  183
             L+ S +YHF
Sbjct  324  GLQPSNLYHF  333



>ref|XP_008659179.1| PREDICTED: beta-1,3-galactosyltransferase 6-like [Zea mays]
 gb|AAV64218.1| hypro1 [Zea mays]
 gb|ABF67912.1| hypothetical protein [Zea mays]
 gb|AFW85497.1| putative uncharacterized protein hypro1 [Zea mays]
Length=337

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 149/253 (59%), Gaps = 19/253 (8%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQ-RAFVAL  747
             S+L+G+ T P K+ RRH +R+ Y +Q  +      ARVDV+F+LC      + R FVAL
Sbjct  85   MSVLVGVHTMPGKHSRRHLIRMAYALQQQTPALRAAARVDVRFVLCARPMPPEHRVFVAL  144

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR--------YDYVMKADDDVFLRLA  591
            E   + D+++L+C EN   GKTYTYF+SLP +L S         YDYVMK DDD FL+L 
Sbjct  145  EARAYGDVLVLDCAENAEEGKTYTYFASLPTMLGSGSGGGGGRPYDYVMKVDDDTFLQLD  204

Query  590  PLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGP  411
             L  +L   PR D+Y G  +P      F  +M GMG++LSWDLVEWI  S +      G 
Sbjct  205  ALVDTLRSAPREDMYCGVGLPFHDRQ-FPPFMLGMGYLLSWDLVEWIATSDMVRREAMGV  263

Query  410  EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
            ED   G+WL+MG KAKNR N  P MYDY    G    + +  TI VH+LK+  +W H L+
Sbjct  264  EDLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKG---EDFLENTIGVHQLKQDLRWAHTLE  320

Query  230  FFNVTTELEHSKM  192
             FNV T LE S M
Sbjct  321  HFNV-TRLEPSSM  332



>ref|XP_006649108.1| PREDICTED: uncharacterized protein LOC102701147 [Oryza brachyantha]
Length=315

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 117/273 (43%), Positives = 157/273 (58%), Gaps = 9/273 (3%)
 Frame = -1

Query  983  NSNSPLRTPNDEIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARV  807
            +  SP+ T   E+      A+    F +  G+ TR + Y+RR  LR+ Y +Q     A +
Sbjct  38   SDGSPVATAASELTKTAAAAED-VDFRVFFGVVTRADFYERRALLRMAYALQPRPRRAVI  96

Query  806  DVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDY  630
            DV+F++C L  E     VALEI+   DI++LNCTENMN GKTY YFSSLP +     YDY
Sbjct  97   DVRFVMCRLDKEEDAVLVALEIITHGDILVLNCTENMNDGKTYEYFSSLPRLFAGEPYDY  156

Query  629  VMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI  450
              K DDD + RL  LA +L G  RRD+++GF+ PC  ++P   YMSGMG++ SW   EWI
Sbjct  157  AGKIDDDTYYRLEALADTLRGKARRDMWHGFLNPC-HVSPERQYMSGMGYIGSWGAAEWI  215

Query  449  GRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCS-----HELIPE  285
              S     +  G EDK  G+WL  G + KN +  +P MYDY             HEL+ +
Sbjct  216  AASPELREDHEGHEDKAFGRWLRRGGRGKNVYGEEPRMYDYLDREMYAEVTCYRHELMAD  275

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            T+AVH+LK   +W   L+FFN T  L+ SKMYH
Sbjct  276  TVAVHKLKDRLKWARTLRFFNATDALKPSKMYH  308



>dbj|BAK06884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 148/255 (58%), Gaps = 22/255 (9%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL----ARVDVKFILCNLSGEAQRA  759
            AD   + S+L+G+ T P+K+ RRH +R+ Y +Q T+     ARVDV+F LC      + A
Sbjct  70   ADDGGQLSILVGVHTMPKKHSRRHLIRMAYALQQTAALRGAARVDVRFALCARPMPPEHA  129

Query  758  -FVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR---------YDYVMKADDD  609
             FVALE   + D+++ NCTEN   GKTYTYF+ LP +L            YDYVMK DDD
Sbjct  130  AFVALERRAYGDVLLFNCTENAEDGKTYTYFADLPAMLGGAGGGSGEGRPYDYVMKVDDD  189

Query  608  VFLRLAPLAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRI  435
             +LRL  L  +L   PR D+YYG  +P       PF   M GMG+VLSWDLV WI  S +
Sbjct  190  TYLRLDALVETLRRAPREDMYYGVGLPFMDRESPPF---MLGMGYVLSWDLVRWIADSDM  246

Query  434  PANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKW  255
                  G ED  +G WL+ G KAKNR N  P MYDY G   +   + + +TI VH+LK+ 
Sbjct  247  VRRKAKGVEDVTMGNWLNEGGKAKNRVNIFPRMYDYKGAQAK---DFLEDTIGVHQLKED  303

Query  254  EQWVHVLKFFNVTTE  210
             +W H L  FN T++
Sbjct  304  IRWAHTLAHFNATSD  318



>ref|XP_010239137.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Brachypodium 
distachyon]
Length=316

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/271 (42%), Positives = 154/271 (57%), Gaps = 23/271 (8%)
 Frame = -1

Query  962  TPNDEIAINIVPADSH--ARFSLLIGIFTRPEKYDRRHFLRLIYGIQST---SLARVDVK  798
            T ND +A      D     +  +L+G+ T   K+ R+H +R+ Y +Q T   S ARVDV+
Sbjct  53   TTNDAVAPAAATTDDQDPEQLRILVGVHTVARKHARQHLIRMAYALQQTPGPSAARVDVR  112

Query  797  FILCNLSGEAQR-AFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR---YDY  630
            F+LC      +  AFVALE     D+++L+C EN   GKTY+YF++LP +L  R   YDY
Sbjct  113  FVLCARPMPPEHGAFVALEARAHGDMLLLDCAENAEDGKTYSYFAALPAMLGERERPYDY  172

Query  629  VMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVH-----YMSGMGFVLSWD  465
            VMK DDD +LRL  L  +L   PR D+YYG  +P      F+H     +M GMG+VLSWD
Sbjct  173  VMKVDDDTYLRLEALVETLRDAPREDMYYGVGLP------FMHRERPRFMLGMGYVLSWD  226

Query  464  LVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPE  285
            LV+WI  S +      G ED   G WL+MG KAKNR N  P MYDY       + + +  
Sbjct  227  LVQWIAASDMVKREAKGVEDVTTGNWLNMGNKAKNRVNIYPRMYDYKSAE---AEDFLEN  283

Query  284  TIAVHRLKKWEQWVHVLKFFNVTTELEHSKM  192
            T+ +H+LK+  +W H L+ FN T     SK+
Sbjct  284  TVGLHQLKEDLKWAHTLEHFNATRLEPSSKL  314



>gb|EEE57937.1| hypothetical protein OsJ_08645 [Oryza sativa Japonica Group]
Length=290

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 143/251 (57%), Gaps = 33/251 (13%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFR  729
            F +  GI TRP+ Y+RR  L                        GE     VA+EI+   
Sbjct  56   FRMFFGILTRPDFYERRALLP----------------------HGEEDAVLVAMEIITHG  93

Query  728  DIVILNCTENMNSGKTYTYFSSLPGILPS----RYDYVMKADDDVFLRLAPLAASLEGLP  561
            DI++LNCTENMN GKTY YFS+LP + P+    RYD+  K DDD + RL  LA +L   P
Sbjct  94   DILVLNCTENMNDGKTYDYFSALPRLFPAGAEPRYDFAGKIDDDTYYRLGALADTLRRKP  153

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            RRD+Y+GF+ PC  ++P   YMSGMG+++SWD+ EWI  S        G ED + G+WL 
Sbjct  154  RRDMYHGFLNPC-HIDPAWQYMSGMGYIVSWDVAEWIAASPELRGREIGYEDDVFGRWLR  212

Query  380  MGKKAKNRFNNKPAMYDYP-----GTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNV  219
               K KNRF  +P MYDY      G +  C  HELI +T+AVH+LK   +W   L+FFN 
Sbjct  213  GAGKGKNRFGEEPRMYDYLDREMYGADVNCFRHELIADTVAVHKLKDRLKWARTLRFFNA  272

Query  218  TTELEHSKMYH  186
            T  L+ SKMYH
Sbjct  273  TDGLKPSKMYH  283



>ref|XP_003579292.1| PREDICTED: uncharacterized protein LOC100821978 [Brachypodium 
distachyon]
Length=331

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 151/261 (58%), Gaps = 24/261 (9%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST-SLARVDVKFILCNLSGEAQRAFVALEILRFRD  726
            +L+G+ TRP  Y+RR  LRL Y +Q   + A +DV+F+LCN++ E     VALEI+   D
Sbjct  73   VLLGVLTRPCSYERRALLRLAYKLQPPPTRAVIDVRFVLCNITTEEDATLVALEIIAHDD  132

Query  725  IVILNCTENMNSGKTYTYFSSLPGILPS-----RYDYVMKADDDVFLRLAPLAASLEGLP  561
            I++LNCTENMN GKT  +FS++P +         YDYV KADDD + RLA LA +L G  
Sbjct  133  ILVLNCTENMNDGKTLEFFSAVPRLFGGADDEPAYDYVGKADDDTYYRLAALADTLRGKS  192

Query  560  RRDLYYGFVIPC-------PSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPAN---NTYGP  411
            RRD Y+GF+ PC       P++ PF   M G G+V+SWD+  WI  +        +  GP
Sbjct  193  RRDAYHGFLWPCGEEKEKDPAVEPF---MVGWGYVVSWDVAAWISSAAAEEELRRDAKGP  249

Query  410  EDKLVGQWLDMGKKAKNRFNNKPAMYDY-----PGTNGRCSHELIPETIAVHRLKKWEQW  246
            ED     WL    + KN +     MY+Y      G      H L+P+T+AVHRLK+   W
Sbjct  250  EDMTFAWWLRRAGRGKNVYGEGHRMYEYLDEAWMGGLSCYRHLLVPDTVAVHRLKERILW  309

Query  245  VHVLKFFNVTTELEHSKMYHF  183
               L+FFN TT L+ SKMYH 
Sbjct  310  ARTLRFFNATTGLKPSKMYHL  330



>gb|EAY87784.1| hypothetical protein OsI_09202 [Oryza sativa Indica Group]
Length=290

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 142/251 (57%), Gaps = 33/251 (13%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFR  729
            F +  GI  RP+ Y RR  LR+                      G      VALEI+   
Sbjct  56   FRMFFGILNRPDFYKRRALLRM----------------------GRRYAVLVALEIITHG  93

Query  728  DIVILNCTENMNSGKTYTYFSSLPGILPS----RYDYVMKADDDVFLRLAPLAASLEGLP  561
            DI++LNCTENMN GKTY YFS+LP + P+    RYD+  K DDD + RL  LA +L   P
Sbjct  94   DILVLNCTENMNDGKTYDYFSALPRLFPAGAEPRYDFAGKIDDDTYYRLGALADTLRRKP  153

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            RRD+Y+GF+ PC  ++P   YMSGMG+++SWD+ EWI  S        G ED + G+WL 
Sbjct  154  RRDMYHGFLNPC-HIDPAWQYMSGMGYIVSWDVAEWIAASPELRGREIGYEDDVFGRWLR  212

Query  380  MGKKAKNRFNNKPAMYDYP-----GTNGRC-SHELIPETIAVHRLKKWEQWVHVLKFFNV  219
               K KNRF  +P MYDY      G +  C  HELI +T+AVH+LK   +W   L+FFN 
Sbjct  213  GAGKGKNRFGEEPRMYDYLDREMYGADVNCFRHELIADTVAVHKLKDRLKWARTLRFFNA  272

Query  218  TTELEHSKMYH  186
            T  L+ SKMYH
Sbjct  273  TDGLKPSKMYH  283



>ref|XP_006649107.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Oryza brachyantha]
Length=270

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 130/202 (64%), Gaps = 7/202 (3%)
 Frame = -1

Query  803  VKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYV  627
            V+F++CNL+ E   A V LE   + DI++LNCTENM++GKTYTYFS++P +     YDYV
Sbjct  58   VRFVVCNLTKEEDAALVGLEAAAYGDIIVLNCTENMDNGKTYTYFSAVPRLFAGDPYDYV  117

Query  626  MKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIG  447
             KADDD + RL  LA +L   PRRD YYGF+ PC +  P V YMSGMG+V+SWD+  W+ 
Sbjct  118  GKADDDTYYRLGALADALRDKPRRDAYYGFLTPCHN-RPEVQYMSGMGYVVSWDVAAWVS  176

Query  446  RSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCS-----HELIPET  282
             +    N+  GPEDKL G+WL  G + +N F  +P MYDY     R       H L P+T
Sbjct  177  ATTELQNDLVGPEDKLFGRWLRWGGRGRNVFGAEPRMYDYLDGEMRQGPTCFRHLLQPDT  236

Query  281  IAVHRLKKWEQWVHVLKFFNVT  216
            +AVH+LK   +W   L+FFN T
Sbjct  237  VAVHKLKDNLKWARTLRFFNAT  258



>ref|NP_001132756.1| hypothetical protein [Zea mays]
 ref|XP_008650953.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81741.1| unknown [Zea mays]
 tpg|DAA61596.1| TPA: hypothetical protein ZEAMMB73_978397 [Zea mays]
Length=318

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 155/253 (61%), Gaps = 17/253 (7%)
 Frame = -1

Query  914  ARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEIL  738
            A FSLL+G+ T P + +RR  +R  Y +Q +   ARVDV+F+ C ++     A +A+E  
Sbjct  73   AEFSLLVGVLTVPGRRERRDIVRTAYALQPAAEGARVDVRFVFCRVTDPVDAALLAVEAR  132

Query  737  RFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGL  564
            R  D+++L+ C ENMN GKTY Y SS+P +  +  YDYVMKADDD +LR+A LA  L G 
Sbjct  133  RHGDVLVLDGCAENMNDGKTYAYLSSVPRLFAAEPYDYVMKADDDTYLRVAALAGELRGK  192

Query  563  PRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLV  396
            PR D+Y  YG+ +    M PF+H   GMG+V+SWD+  W+  +R  +  N+T GPED +V
Sbjct  193  PRHDVYLGYGYAMGGQPM-PFMH---GMGYVVSWDVAAWVAGAREILERNDTLGPEDLMV  248

Query  395  GQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVT  216
            G+WL++  + +NR++ KP MYD             P+T+AVH LK   +W    ++FNV 
Sbjct  249  GKWLNLAGRGRNRYDLKPRMYDLSWD----MDNFRPDTVAVHTLKTNRRWAAAFRYFNVV  304

Query  215  TE--LEHSKMYHF  183
            T      S++YH 
Sbjct  305  TAGITPSSELYHL  317



>gb|EPS67464.1| hypothetical protein M569_07311, partial [Genlisea aurea]
Length=178

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 125/179 (70%), Gaps = 6/179 (3%)
 Frame = -1

Query  728  DIVILNCTENMNSGKTYTYFSSLPGILPSR-----YDYVMKADDDVFLRLAPLAASLEGL  564
            DI+IL+C ENMN GKTYTYFSS+P ++ S      YD+VMK DDD + RL  L  SL+ L
Sbjct  1    DIIILDCKENMNDGKTYTYFSSVPRLMESSSRSPPYDFVMKVDDDTYFRLQYLVDSLKNL  60

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
             R++LYYG VIPC ++     YM+GMG++LS+DLV+WI  S IP +N  GPEDK++G+WL
Sbjct  61   TRQELYYGLVIPC-AITGIGKYMAGMGYLLSYDLVKWISVSDIPKHNLVGPEDKMLGKWL  119

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTEL  207
            + G   KN  N   AMYD+ G    C+H+L  ET+AVHRLK  E+W+  LK+FN T +L
Sbjct  120  EEGHHGKNWHNTLSAMYDFEGKPRTCTHKLWSETVAVHRLKSQERWITTLKYFNATLDL  178



>ref|NP_001057035.1| Os06g0192400 [Oryza sativa Japonica Group]
 dbj|BAD35263.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD35819.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18949.1| Os06g0192400 [Oryza sativa Japonica Group]
 dbj|BAG98530.1| unnamed protein product [Oryza sativa Japonica Group]
Length=330

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 149/257 (58%), Gaps = 24/257 (9%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL----ARVDVKFILCNLS-GEAQRAFVALE  744
             S+L+G+ T  +K+ RRH +R+ Y +Q T+     ARVDV+F LC     +  RAFVALE
Sbjct  74   ISILVGVHTMAKKHSRRHLVRMAYAVQQTAALRGAARVDVRFALCARPMPQEHRAFVALE  133

Query  743  ILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----------YDYVMKADDDVFLR  597
               + D+++++C E+ + GKTY YF+ LP +L S            YDYVMK DDD +LR
Sbjct  134  ARAYGDVMLIDCDESPDKGKTYDYFAGLPAMLSSGGGGGGGGEGRPYDYVMKVDDDTYLR  193

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANN  423
            L  LA +L   PR D+YYG  +P       PF   M GMG+VLSWDLVEWI  S +    
Sbjct  194  LDELAETLRRAPREDMYYGAGLPFLDKESPPF---MLGMGYVLSWDLVEWIAGSDMAKAL  250

Query  422  TYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWV  243
              G ED   G WL+MG KAKNR N  P MYD+ G       + + +TI VH+LK+  +W 
Sbjct  251  AIGAEDVTTGTWLNMGNKAKNRVNIFPRMYDFKGVK---PEDFLEDTIGVHQLKQDLRWA  307

Query  242  HVLKFFNVTTELEHSKM  192
              L+ FNVT     SKM
Sbjct  308  QTLEHFNVTCLDPSSKM  324



>ref|XP_009417793.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103998123 
[Musa acuminata subsp. malaccensis]
Length=224

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 122/177 (69%), Gaps = 4/177 (2%)
 Frame = -1

Query  965  RTPNDEIAINIV-PADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFIL  789
            R  +  +A++   P      F LL+G+ TR + Y+RRH LRL+Y +Q+   A VDV+F+L
Sbjct  45   RPSSSAVAVSFTEPVTVEPDFRLLLGVLTRADLYERRHLLRLVYSLQTNLTAHVDVRFVL  104

Query  788  CNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR---YDYVMKA  618
            CNL+ E QR  VA+EI+R+ DI+ILNCTENMN GKTY YF+SLP +        D+V+KA
Sbjct  105  CNLTKEEQRVLVAMEIMRYDDIIILNCTENMNEGKTYAYFASLPKLFDGDRPPXDFVVKA  164

Query  617  DDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIG  447
            DDD++ RL  L  SL+ +PR  LYYGFVIPC SM+PF  YM GM + L WDLVEWI 
Sbjct  165  DDDIYFRLPKLIESLKKMPREFLYYGFVIPCDSMDPFHEYMPGMRYQLLWDLVEWIS  221



>gb|ACG46990.1| hypro1 [Zea mays]
Length=331

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 153/258 (59%), Gaps = 12/258 (5%)
 Frame = -1

Query  950  EIAINIVPADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA-RVDVKFILCNLSG  774
            + A+   P       SLL+G+ T P + +RR  LR  Y +Q  + A RVDV+F+ C+++ 
Sbjct  80   KAAVAETPPPPRPELSLLVGVLTVPGRRERRDILRTAYALQPAAPASRVDVRFVFCSVTD  139

Query  773  EAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLR  597
              + A VA+E  R  D+++L+C ENMN GKT+ Y SS+P +  S  YDYVMK DDD +LR
Sbjct  140  PVEAALVAVEARRHGDVLVLDCAENMNDGKTHAYLSSVPRLFASAPYDYVMKTDDDTYLR  199

Query  596  LAPLAASLEGLPRRDLYYGFVIPC-PSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPAN  426
            +A L A L   PR D+Y G+  P      PF+H   GMG+V+SWD+  W+  +   +  N
Sbjct  200  VAALVAELRPRPRDDVYLGYGFPVGDDPMPFMH---GMGYVVSWDVARWVSANGDILRHN  256

Query  425  NTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQW  246
            +T+GPED LVG+WL++G + +NR++ KP MYD             P+TIAVH LK   +W
Sbjct  257  DTHGPEDLLVGKWLNIGGRGRNRYDLKPRMYDL----NWFMDNFRPDTIAVHMLKDNRRW  312

Query  245  VHVLKFFNVTTELEHSKM  192
                 +FNVT  +  + +
Sbjct  313  AATFTYFNVTARIHTNSL  330



>tpg|DAA61597.1| TPA: hypothetical protein ZEAMMB73_978397 [Zea mays]
Length=289

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 155/257 (60%), Gaps = 17/257 (7%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVA  750
            +D     SLL+G+ T P + +RR  +R  Y +Q +   ARVDV+F+ C ++     A +A
Sbjct  40   SDGLGILSLLVGVLTVPGRRERRDIVRTAYALQPAAEGARVDVRFVFCRVTDPVDAALLA  99

Query  749  LEILRFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAAS  576
            +E  R  D+++L+ C ENMN GKTY Y SS+P +  +  YDYVMKADDD +LR+A LA  
Sbjct  100  VEARRHGDVLVLDGCAENMNDGKTYAYLSSVPRLFAAEPYDYVMKADDDTYLRVAALAGE  159

Query  575  LEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPE  408
            L G PR D+Y  YG+ +    M PF+H   GMG+V+SWD+  W+  +R  +  N+T GPE
Sbjct  160  LRGKPRHDVYLGYGYAMGGQPM-PFMH---GMGYVVSWDVAAWVAGAREILERNDTLGPE  215

Query  407  DKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKF  228
            D +VG+WL++  + +NR++ KP MYD             P+T+AVH LK   +W    ++
Sbjct  216  DLMVGKWLNLAGRGRNRYDLKPRMYDLSWD----MDNFRPDTVAVHTLKTNRRWAAAFRY  271

Query  227  FNVTTE--LEHSKMYHF  183
            FNV T      S++YH 
Sbjct  272  FNVVTAGITPSSELYHL  288



>gb|EAY99984.1| hypothetical protein OsI_21988 [Oryza sativa Indica Group]
Length=330

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 149/257 (58%), Gaps = 24/257 (9%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL----ARVDVKFILCNLS-GEAQRAFVALE  744
             S+L+G+ T  +K+ RRH +R+ Y +Q T+     ARVDV+F LC     +  RAFVALE
Sbjct  74   ISILVGVHTMAKKHSRRHLVRMAYAVQQTAALRGAARVDVRFALCARPMPQEHRAFVALE  133

Query  743  ILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----------YDYVMKADDDVFLR  597
               + D+++++C E+ + GKTY YF+ LP +L S            YDYVMK DDD +LR
Sbjct  134  ARAYGDVMLIDCDESPDKGKTYDYFAGLPAMLSSGGGGGGGGEGRPYDYVMKVDDDTYLR  193

Query  596  LAPLAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANN  423
            L  LA +L   PR D+YYG  +P       PF   M GMG+VLSWDLVEWI  S +    
Sbjct  194  LDELAETLRRAPREDMYYGAGLPFLDKESPPF---MLGMGYVLSWDLVEWIAGSDMAKAL  250

Query  422  TYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWV  243
              G ED   G WL+MG KAKNR N  P MYD+ G       + + +TI VH+LK+  +W 
Sbjct  251  AIGAEDVTTGTWLNMGNKAKNRVNIFPRMYDFKGVK---PEDFLEDTIGVHQLKQDLRWA  307

Query  242  HVLKFFNVTTELEHSKM  192
              L+ FNVT     SKM
Sbjct  308  QTLEHFNVTWLDPSSKM  324



>ref|NP_001063243.1| Os09g0433000 [Oryza sativa Japonica Group]
 dbj|BAD33551.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD33935.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25157.1| Os09g0433000 [Oryza sativa Japonica Group]
 gb|EAZ09206.1| hypothetical protein OsI_31481 [Oryza sativa Indica Group]
 gb|EAZ44833.1| hypothetical protein OsJ_29470 [Oryza sativa Japonica Group]
 dbj|BAG91641.1| unnamed protein product [Oryza sativa Japonica Group]
Length=313

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 151/243 (62%), Gaps = 19/243 (8%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEILRF  732
             SLL+G+ T P++Y+RR  +RL Y +Q + + ARVDV+F+ C ++       VALE  R 
Sbjct  74   LSLLVGVLTMPKRYERRDIVRLAYALQPAAARARVDVRFVFCRVADPVDAQLVALEAARH  133

Query  731  RDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPR  558
             D+V+L  C ENMN GKT+ Y SS+P +  S  YDYVMK DDD +LR+A LA  L G PR
Sbjct  134  GDVVVLGGCEENMNHGKTHAYLSSVPRLFASSPYDYVMKTDDDTYLRVAALADELRGKPR  193

Query  557  RDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQ  390
             D+Y  YG+ +    M PF+H   GMG+V+SWD+  W+  +   +  N+T GPED +VG+
Sbjct  194  DDVYLGYGYAMGGQPM-PFMH---GMGYVVSWDVATWVSTAEEILARNDTEGPEDLMVGK  249

Query  389  WLDMGKKAKNRFNNKPAMYD--YPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVT  216
            WL++  + +NR++ KP MYD  +   N R      P+T+AVH LK   +W     +FNVT
Sbjct  250  WLNLAGRGRNRYDLKPRMYDLSWDMDNFR------PDTVAVHMLKDNRRWAAAFSYFNVT  303

Query  215  TEL  207
              +
Sbjct  304  AGI  306



>ref|NP_001136904.1| uncharacterized protein LOC100217061 [Zea mays]
 gb|ACF82856.1| unknown [Zea mays]
Length=328

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 149/244 (61%), Gaps = 12/244 (5%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-LARVDVKFILCNLSGEAQRAFVALEILRF  732
             SLL+G+ T P + +RR  LR  Y +Q  +  ARVDV+F+ C+++   + A VA+E  R 
Sbjct  91   LSLLVGVLTVPGRRERRDILRTAYALQPAAPAARVDVRFVFCSVTDPVEAALVAVEARRH  150

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRR  555
             D+++L+C ENMN GKT+ Y SS+P +  S  YDYVMK DDD +LR+A L A L   PR 
Sbjct  151  GDVLVLDCAENMNDGKTHAYLSSVPRLFASAPYDYVMKTDDDTYLRVAALVAELRPRPRD  210

Query  554  DLYYGFVIPC-PSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQWL  384
            D+Y G+  P      PF+H   GMG+V+SWD+  W+  +   +  N+T+GPED LVG+WL
Sbjct  211  DVYLGYGFPVGDDPMPFMH---GMGYVVSWDVARWVSANGDILRHNDTHGPEDLLVGKWL  267

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
            ++G + +NR++ KP MYD             P+TIAVH LK   +W     +FNVT  + 
Sbjct  268  NIGGRGRNRYDLKPRMYDL----NWFMDNFRPDTIAVHMLKDNRRWAATFTYFNVTAGIH  323

Query  203  HSKM  192
             + +
Sbjct  324  TNSL  327



>gb|ACN28027.1| unknown [Zea mays]
 tpg|DAA40121.1| TPA: hypro1 [Zea mays]
Length=435

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 149/244 (61%), Gaps = 12/244 (5%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTS-LARVDVKFILCNLSGEAQRAFVALEILRF  732
             SLL+G+ T P + +RR  LR  Y +Q  +  ARVDV+F+ C+++   + A VA+E  R 
Sbjct  198  LSLLVGVLTVPGRRERRDILRTAYALQPAAPAARVDVRFVFCSVTDPVEAALVAVEARRH  257

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRR  555
             D+++L+C ENMN GKT+ Y SS+P +  S  YDYVMK DDD +LR+A L A L   PR 
Sbjct  258  GDVLVLDCAENMNDGKTHAYLSSVPRLFASAPYDYVMKTDDDTYLRVAALVAELRPRPRD  317

Query  554  DLYYGFVIPC-PSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQWL  384
            D+Y G+  P      PF+H   GMG+V+SWD+  W+  +   +  N+T+GPED LVG+WL
Sbjct  318  DVYLGYGFPVGDDPMPFMH---GMGYVVSWDVARWVSANGDILRHNDTHGPEDLLVGKWL  374

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
            ++G + +NR++ KP MYD             P+TIAVH LK   +W     +FNVT  + 
Sbjct  375  NIGGRGRNRYDLKPRMYDL----NWFMDNFRPDTIAVHMLKDNRRWAATFTYFNVTAGIH  430

Query  203  HSKM  192
             + +
Sbjct  431  TNSL  434



>ref|XP_006660649.1| PREDICTED: probable beta-1,3-galactosyltransferase 17-like [Oryza 
brachyantha]
Length=312

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 146/242 (60%), Gaps = 16/242 (7%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEILRF  732
             SLL+G+ T P++Y+RR  +RL Y +Q + + ARVDV+F+ C +     R  VALE +R 
Sbjct  75   LSLLVGVLTTPKRYERRDIVRLAYTLQPAAARARVDVRFVFCRVEDPVDRQLVALEAMRH  134

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRR  555
             D+V L C ENMN GKT+ Y SS+P +  +  YDYVMK DDD +LR+A L   L   PR 
Sbjct  135  GDVVELACEENMNHGKTHAYLSSVPRLFAADPYDYVMKTDDDTYLRVAALVDELRRKPRD  194

Query  554  DLYYGFVIPCPSM-NPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQWL  384
            D+Y G          PF+H   GMG+V+SWD+  W+  +   +  N+T GPED +VG+WL
Sbjct  195  DVYLGHXXXXXGQPMPFMH---GMGYVVSWDVASWVSTAEEILARNDTEGPEDLMVGKWL  251

Query  383  DMGKKAKNRFNNKPAMYD--YPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            ++  + +NR++ KP MYD  +   N R      P+TIAVH LK   +W     +FNVT  
Sbjct  252  NLAGRGRNRYDLKPRMYDLSWDMDNFR------PDTIAVHTLKDNRRWAAAFSYFNVTAG  305

Query  209  LE  204
            ++
Sbjct  306  IK  307



>ref|XP_006381816.1| hypothetical protein POPTR_0006s18480g, partial [Populus trichocarpa]
 gb|ERP59613.1| hypothetical protein POPTR_0006s18480g, partial [Populus trichocarpa]
Length=158

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  632  YVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEW  453
            YVMKADDD++ RL  L  SL+ LPR+DLYYG+VI CP+M+PF+HYMSGMG+V+ WD+VEW
Sbjct  8    YVMKADDDIYFRLDNLVESLKPLPRKDLYYGYVISCPNMDPFLHYMSGMGYVIIWDIVEW  67

Query  452  IGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAV  273
            I  S+IP N+   P+DK+ G W+  G +AKNR+N K +MY++     +C+HEL P+TIAV
Sbjct  68   IRDSKIPKNHMERPKDKVFGDWIREGHRAKNRYNAKWSMYNFLEPPTKCTHELWPDTIAV  127

Query  272  HRLKKWEQWVHVLKFFNVTTELEHSKMYH  186
            H LK  E+W+H LK+FNVT+  + SK+YH
Sbjct  128  HLLKNQEKWIHTLKYFNVTSNFKPSKLYH  156



>ref|XP_002462427.1| hypothetical protein SORBIDRAFT_02g025430 [Sorghum bicolor]
 gb|EER98948.1| hypothetical protein SORBIDRAFT_02g025430 [Sorghum bicolor]
Length=325

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 158/260 (61%), Gaps = 29/260 (11%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQ--------STSLARVDVKFILCNLSGEAQRAFV  753
            FSLL+G+ T P + +RR  +R+ Y +Q          + ARVDV+F+ C ++     A V
Sbjct  74   FSLLVGVLTMPSRRERRDIVRMAYALQPAPAAEAEGVARARVDVRFVFCRVTDPVDAALV  133

Query  752  ALEILRFRDIVILN-CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAA  579
            A+E  R  DI++L+ C ENMN GKTY Y SS+P +  +  YDYVMK DDD +LR+A LA 
Sbjct  134  AVESQRHGDILVLDDCAENMNDGKTYAYLSSVPRLFAAEPYDYVMKTDDDTYLRVAALAG  193

Query  578  SLEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR----IPANNTY  417
             L G PR D+Y  YG+ +    M PF+H   GMG+V+SWD+  W+  +     +  N+T 
Sbjct  194  ELRGKPRDDVYLGYGYAMGGQPM-PFMH---GMGYVVSWDVAAWVAGAGADGILARNDTR  249

Query  416  GPEDKLVGQWLDMGKKAKNRFNNKPAMYD--YPGTNGRCSHELIPETIAVHRLKKWEQWV  243
            GPED +VG+WL++  + KNR++ KP MYD  +   N R      P+T+AVH LK  ++W 
Sbjct  250  GPEDLMVGKWLNLAGRGKNRYDLKPRMYDLNWDMDNFR------PDTVAVHMLKTNQRWA  303

Query  242  HVLKFFNVTTE-LEHSKMYH  186
               ++FNV T  +  S++YH
Sbjct  304  ATFRYFNVVTAGITPSELYH  323



>ref|XP_003578153.1| PREDICTED: beta-1,3-galactosyltransferase pvg3-like [Brachypodium 
distachyon]
Length=320

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 151/258 (59%), Gaps = 17/258 (7%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQST--SLARVDVKFILCNLSGEAQRAFV  753
            A+     SLL+GI T P+  +RR  +RL Y +Q    + ARVDV+F+ C ++   +   V
Sbjct  64   AEPEPELSLLVGILTMPKLRERRDIVRLAYALQPPVPAYARVDVRFVFCRVTDPTEATLV  123

Query  752  ALEILRFRDIVILN---CTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPL  585
            +LE ++  DI++L+     ENMN GKTY Y SS+  +  +  YDYVMK DDD +LR+A L
Sbjct  124  SLEEMQHGDIMVLDDSCAGENMNDGKTYAYISSVARLFAAAPYDYVMKTDDDTYLRVAAL  183

Query  584  AASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGP  411
               L G PR D Y G+     S +P + +M GMG+V+SWD+  W+  +   +  N+T GP
Sbjct  184  VGELRGKPRDDAYLGYGYNM-SGDPML-FMHGMGYVMSWDVATWVSTAAEILDRNDTLGP  241

Query  410  EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLK  231
            ED +VG+WL++  K KNR++ KP MYD             P+T+AVH LK   +W     
Sbjct  242  EDLMVGKWLNLAGKGKNRYDLKPRMYDL----NWGMDNFRPDTVAVHMLKDNRRWAAAFN  297

Query  230  FFNVTTELEH---SKMYH  186
            +FNVT  ++    SK+YH
Sbjct  298  YFNVTAGIKQSSSSKLYH  315



>gb|EEE57934.1| hypothetical protein OsJ_08641 [Oryza sativa Japonica Group]
Length=285

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 125/197 (63%), Gaps = 7/197 (4%)
 Frame = -1

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLA  582
             V+LEI+   D+V+LNCTENM+ GKT++YFSSLP +     YDYV K DDD + RLA LA
Sbjct  87   LVSLEIIAHGDVVVLNCTENMDDGKTHSYFSSLPALFADAPYDYVGKIDDDSYYRLASLA  146

Query  581  ASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDK  402
             +L   PRRDLY+GF  PC + +P   +MSGMG+++SWD+  W+  +     +  GPED+
Sbjct  147  DTLRDKPRRDLYHGFPAPCHA-DPRSQFMSGMGYIVSWDVAAWVAATEALRGDVKGPEDE  205

Query  401  LVGQWLDMGKKAKNRFNNKPAMYDYPGTNGR----C-SHELIPETIAVHRLKKWEQWVHV  237
            + G+WL  G K  NR+  +  MYDY     R    C  H L+ +T+ VH+LK   +W   
Sbjct  206  VFGRWLRRGGKGSNRYGEETRMYDYLDGGMREGVNCFRHALVADTVVVHKLKDRLKWART  265

Query  236  LKFFNVTTELEHSKMYH  186
            LKFFN T  L+ SK+YH
Sbjct  266  LKFFNATQGLKPSKLYH  282



>gb|EPS62704.1| transferase, transferring glycosyl groups, partial [Genlisea 
aurea]
Length=203

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 129/209 (62%), Gaps = 11/209 (5%)
 Frame = -1

Query  911  RFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRF  732
            +  +L+G+FT P++Y+ R FLRL+YG QS + A +DV+FI+C ++    +  V LEI+ +
Sbjct  1    QLKVLVGVFTTPDRYESRSFLRLVYGAQSPTGAIIDVRFIMCRMADAEHKITVGLEIMNY  60

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR-----YDYVMKADDDVFLRLAPLAASLEG  567
             D++IL+C ENMN GKTYTYFSSLP +  S      Y YV+KADDDV++RL PL  SL+ 
Sbjct  61   GDMIILDCRENMNDGKTYTYFSSLPRLFESNSTNPPYHYVVKADDDVYIRLQPLVESLQF  120

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
            + R D YYG    C +    V YM G  + +SWD+ EW+  S IP  N  GP+D L   W
Sbjct  121  VAREDAYYG----CNATQRGVEYMIGSLYAVSWDITEWLSISHIP--NFSGPQDILFATW  174

Query  386  LDMGKKAKNRFNNKPAMYDYPGTNGRCSH  300
            L  G   KNR++ +  +YD        +H
Sbjct  175  LRDGHVGKNRYDIEDKLYDIQVAGTHFAH  203



>gb|EMT29615.1| hypothetical protein F775_21430 [Aegilops tauschii]
Length=190

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 120/187 (64%), Gaps = 3/187 (2%)
 Frame = -1

Query  740  LRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGL  564
            ++  D+V L+C ENM++GKT+ Y SS+P +   R YD+VMK DDD    L  L  SL   
Sbjct  1    MQHGDVVELDCPENMDNGKTHAYLSSVPALFGDRAYDFVMKTDDDTSPPLPQLVESLNRA  60

Query  563  PRRDLYYGFVIPCPSMNPFVH-YMSGMGFVLSWDLVEWI-GRSRIPANNTYGPEDKLVGQ  390
            PR DLYYG ++PC  +    + YMSGMG+V+SWDLVEWI   +    N+T GPED+LV  
Sbjct  61   PREDLYYGCMVPCDVVRAQENEYMSGMGYVISWDLVEWIVAAADQIRNHTVGPEDRLVSS  120

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            W     K KNR + KPAMY +P     C+HEL+P+TIAVH+LK   +W   LK+FN T  
Sbjct  121  WFRGAGKGKNRVDTKPAMYGFPDRADHCAHELVPDTIAVHKLKNNGRWATTLKYFNFTAG  180

Query  209  LEHSKMY  189
            L+ SK Y
Sbjct  181  LQSSKFY  187



>gb|AEJ07902.1| hypothetical protein [Zea mays subsp. mexicana]
Length=253

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 130/219 (59%), Gaps = 14/219 (6%)
 Frame = -1

Query  821  SLARVDVKFILCNLSGEAQ-RAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILP  645
            + ARVDV+F+LC      + R FVALE   + D+++L+C EN   GKTYTYF+SLP +L 
Sbjct  35   AAARVDVRFVLCARPMPPEHRVFVALEARAYGDVLVLDCAENAEEGKTYTYFASLPTMLG  94

Query  644  SR--------YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSG  489
            S         YDYVMK DDD FL+L  L  +L   PR D+Y G  +P      F  +M G
Sbjct  95   SGGGGGGGRPYDYVMKVDDDTFLQLDALVDTLRSAPREDMYCGVGLPFHDRQ-FPPFMLG  153

Query  488  MGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGR  309
            MG++LSWDLVEWI  S +      G ED   G+WL+MG KAKNR N  P MYDY    G 
Sbjct  154  MGYLLSWDLVEWIATSDMVRREAMGVEDLTTGKWLNMGHKAKNRVNIFPRMYDYKSAKGE  213

Query  308  CSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKM  192
               + +  TI VH+LK+  +W H L+ FNV T LE S M
Sbjct  214  ---DFLENTIGVHQLKQDLRWAHTLEHFNV-TRLEPSSM  248



>gb|EPS72892.1| hypothetical protein M569_01868, partial [Genlisea aurea]
Length=240

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 145/244 (59%), Gaps = 13/244 (5%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQR-AFVA  750
            + S A   + IGI T  ++Y+ R+ LR +YG QS   A VDV++I+CN +G   +   V 
Sbjct  1    SSSDATMRIFIGILTTADRYEFRNLLRTVYGTQSPIGAHVDVRYIICNFTGNRHKLVMVG  60

Query  749  LEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-------YDYVMKADDDVFLRLA  591
            LE  ++ DI+IL+C ENM+ GKTY YFSSLP  L +        Y +V KADDD ++RL 
Sbjct  61   LERRKYNDIIILDCVENMDQGKTYDYFSSLPPRLLTSNSMIYPPYHFVAKADDDSYIRLQ  120

Query  590  PLAASLE-GLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYG  414
             LA +L   + + D+Y+G +    +++P + YM G  +++SWD+VEWI  S +P  N +G
Sbjct  121  SLAGALRRNVSKNDMYFGRM----NVSPELSYMVGPLYLVSWDIVEWISVSDVPKKNLFG  176

Query  413  PEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVL  234
             ED + G+WL  G +  N+++    ++D+P  +  C       T+ VH+LK  E+W+  L
Sbjct  177  SEDIVFGEWLRDGNRGNNKYDIGERLHDFPSPDTPCPLNFSQATMIVHQLKTRERWIETL  236

Query  233  KFFN  222
              F+
Sbjct  237  DHFH  240



>gb|EAZ43247.1| hypothetical protein OsJ_27846 [Oryza sativa Japonica Group]
Length=512

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 139/239 (58%), Gaps = 26/239 (11%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLAR---VDVKFILCNLSGEAQRAFVALEIL  738
            F LLIG+ T P +Y+RRH LR++Y +Q  ++A    VDV+F+ C +     R  V+LE +
Sbjct  66   FRLLIGVLTLPARYERRHLLRMVYALQQPAVASRAPVDVRFVFCRVGSPEDRVLVSLEAM  125

Query  737  RFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
                                     L G   + YD+VMKADDD F RL  LA SL   PR
Sbjct  126  AV---------------------PRLFGGGEAAYDFVMKADDDTFFRLPELAESLSRAPR  164

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIP-ANNTYGPEDKLVGQWLD  381
            RDLYYG ++PC  +     YMSGMG++LSWDLVEWI  +       T GPED+ +  WL 
Sbjct  165  RDLYYGCMVPCDYVRGSNEYMSGMGYLLSWDLVEWIVAAAAEIEGRTGGPEDRTLYSWLR  224

Query  380  MGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
             G + +NR + KPAMY++PG +  CSHE IP+TIAVH+LK   +W   L++FN T  L+
Sbjct  225  RGGRGRNRVDVKPAMYNFPGRHP-CSHEFIPDTIAVHQLKDNRRWARTLQYFNFTAALK  282


 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 130/213 (61%), Gaps = 17/213 (8%)
 Frame = -1

Query  821  SLARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPS  642
             +A+VDV+F+ C ++       V LE  R  DI++LNCTENMN GKT+ Y SS+P +  S
Sbjct  292  GVAQVDVRFVFCRVADPVDAQLVVLEAARHGDILVLNCTENMNDGKTHEYLSSVPRMFAS  351

Query  641  R-YDYVMKADDDVFLRLAPLAASLEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLS  471
              YDYVMK DDD +LR+A L   L   PR D+Y  YGF +    M     +M GMG+V+S
Sbjct  352  SPYDYVMKTDDDTYLRVAALVDELRHKPRDDVYLGYGFAVGDDPM----QFMHGMGYVVS  407

Query  470  WDLVEWIGRSR--IPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYD--YPGTNGRCS  303
            WD+  W+  +   +  N+T+GPED LVG+WL++G++ KNR++ +P MYD  +   N R  
Sbjct  408  WDVATWVSTNEDILRYNDTHGPEDLLVGKWLNIGRRGKNRYSLRPRMYDLNWDMDNFR--  465

Query  302  HELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
                P+T+ VH LK   +W    ++FNV   ++
Sbjct  466  ----PDTVLVHMLKDNRRWAAAFRYFNVNGGVQ  494



>dbj|BAD33554.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD33938.1| hypothetical protein [Oryza sativa Japonica Group]
Length=302

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 143/244 (59%), Gaps = 29/244 (12%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFR  729
            F LL+G+ T P +Y+RR  LRL Y +Q    A+VDV+F+LC+++  A    VA E  R  
Sbjct  74   FRLLVGVLTTPSRYERRGILRLAYALQPAPGAQVDVRFVLCDVTDAADAVLVAAEAARHG  133

Query  728  DIVILN--CTENMNSGKTYTYFSSLPGIL-PSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            DI++L+   TENMN GKT+ Y SS+P +  P  YDYVMKADDD +L              
Sbjct  134  DILVLDGCSTENMNDGKTHAYLSSVPRLFAPCPYDYVMKADDDTYL--------------  179

Query  557  RDLYY--GFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQ  390
            RD+Y   G+ +    M PF+H   GMG+V+SWD+  W+  +   +  + T G ED+LVG+
Sbjct  180  RDVYLGRGYAVGDDPM-PFMH---GMGYVVSWDVARWVSANEDIVRRSGTRGHEDRLVGR  235

Query  389  WLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTE  210
            WL+ G + +NR+N KP MYD          E  P TIAVHRLK   +W  V + FNVT  
Sbjct  236  WLNAGGRGRNRYNLKPRMYDINWD----MDEFRPNTIAVHRLKNNRRWAAVFRHFNVTVG  291

Query  209  LEHS  198
            ++ S
Sbjct  292  IKPS  295



>ref|XP_006845627.1| hypothetical protein AMTR_s00019p00218500 [Amborella trichopoda]
 gb|ERN07302.1| hypothetical protein AMTR_s00019p00218500 [Amborella trichopoda]
Length=141

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = -1

Query  599  RLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNT  420
            RL  LA SL+ LPR D YYG VIPC S +PF  YM GMG++LSWDLVEWIG S I  N+ 
Sbjct  3    RLDVLARSLDPLPRTDFYYGRVIPCKSTDPFFGYMGGMGYILSWDLVEWIGISNITRNHA  62

Query  419  YGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVH  240
             G EDKLV +W + G +AKNRF   P MYD PG    CSHE +P+TI VHRLK    W  
Sbjct  63   EGFEDKLVSEWFNEGNRAKNRFTATPRMYDVPGLT-TCSHEYMPDTIGVHRLKNKRTWAQ  121

Query  239  VLKFFNVTTELEHSKMYHF  183
            VL++FNVT  ++ SKMYH 
Sbjct  122  VLRYFNVTDGVKPSKMYHL  140



>ref|XP_006660339.1| PREDICTED: uncharacterized protein LOC102715690 [Oryza brachyantha]
Length=239

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 120/245 (49%), Gaps = 43/245 (18%)
 Frame = -1

Query  899  LIGIFTRPEKYDRRHFLRLIYGIQ-STSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
              GIFT    Y+RR  LR+ Y +Q     A +DV+F++C L  E     VALEI+   DI
Sbjct  24   FFGIFTCAHLYERRALLRMAYALQPRPRRAAIDVRFVMCRLDKEEDAVLVALEIITHNDI  83

Query  722  VILNCTENMNSGKTYTYFSSLPGILPS-RYDYVMKADDDVFLRLAPLAASLEGLPRRDLY  546
            ++LNCTENMN GKTY YFSSLP +  +  YDY  K DDD + RL  L  +L    RR   
Sbjct  84   LVLNCTENMNDGKTYEYFSSLPRLFAAGSYDYAGKIDDDTYYRLEALGDTL----RR---  136

Query  545  YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKA  366
                                         +WI  S     +  G ED+  G+WL  G++ 
Sbjct  137  -----------------------------KWIAASPELREDHAGSEDRAFGRWLWKGRRG  167

Query  365  KNRFNNKPAMYDYPGTNGRCS-----HELIPETIAVHRLKKWEQWVHVLKFFNVTTELEH  201
            KNR+  +P MYDY             HEL+ +T+AVH+LK   +W   L FFN T  L  
Sbjct  168  KNRYGEEPRMYDYLDREMYAEVTCYRHELMADTVAVHKLKDRLKWARTLAFFNSTDGLRP  227

Query  200  SKMYH  186
            S +Y 
Sbjct  228  SNLYQ  232



>gb|EMS62183.1| hypothetical protein TRIUR3_33292 [Triticum urartu]
Length=151

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -1

Query  626  MKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVH-YMSGMGFVLSWDLVEWI  450
            MK DDD FLRL  L  SL   PR DLYYG ++PC  +    + YMSGMG+V+SWDLVEWI
Sbjct  1    MKTDDDTFLRLPQLVESLNRAPREDLYYGCMVPCDVVRAQENEYMSGMGYVISWDLVEWI  60

Query  449  -GRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAV  273
               +    N+T GPED+LV  W     K KNR + KPAMY +P     C+HEL+ +TIAV
Sbjct  61   VAAAEQIRNHTVGPEDRLVSTWFRGAGKGKNRVDTKPAMYGFPDRADHCAHELVHDTIAV  120

Query  272  HRLKKWEQWVHVLKFFNVTTELEHSK  195
            H+LK   +W   LK+FN T  L+ SK
Sbjct  121  HKLKNNGRWATTLKYFNFTAGLQPSK  146



>gb|EEE69763.1| hypothetical protein OsJ_29471 [Oryza sativa Japonica Group]
Length=271

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 126/245 (51%), Gaps = 33/245 (13%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFR  729
            F LL+G+ T P +Y+RR  LRL Y +Q    A+VDV+F+LC+++  A    VA E  R  
Sbjct  45   FRLLVGVLTTPSRYERRGILRLAYALQPAPGAQVDVRFVLCDVTDAADAVLVAAEAARHG  104

Query  728  DIVILN--CTENMNSGKTYTYFSSLPGIL-PSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            DI++L+   TENMN GKT+ Y SS+P +  P  YDYVMKADDD +LR+A LA  L G PR
Sbjct  105  DILVLDGCSTENMNDGKTHAYLSSVPRLFAPCPYDYVMKADDDTYLRVAALADELRGKPR  164

Query  557  RDLYYGFVIP-----CPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVG  393
            R        P     C S   +     G              R+  P   T         
Sbjct  165  RTSTSAGATPSATTRCRSCTAWATSCPG------------TSRAGCPPTRT---------  203

Query  392  QWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTT  213
             WL+ G + +NR+N KP MYD          E  P TIAVHRLK   +W  V + FNVT 
Sbjct  204  SWLNAGGRGRNRYNLKPRMYDINWD----MDEFRPNTIAVHRLKNNRRWAAVFRHFNVTV  259

Query  212  ELEHS  198
             ++ S
Sbjct  260  GIKPS  264



>ref|XP_002269612.1| PREDICTED: uncharacterized protein LOC100251293 [Vitis vinifera]
Length=196

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            + IGI T P++Y RRHFLR+IYG QS + A+VDVKF+ CNL+ E Q+  VALEI+R+ DI
Sbjct  77   IFIGILTLPDQYQRRHFLRIIYGTQSPAGAKVDVKFVFCNLTKEDQKVLVALEIMRYDDI  136

Query  722  VILNCTENMNSGKTYTYFSSLPGILPSR------YDYVMKADDDVFLRLAPLAASLEGL  564
            +ILNCTENMN GKTY YFSS P +L S       Y YVMKADD+++LRL  L  SL  L
Sbjct  137  IILNCTENMNQGKTYKYFSSSPEMLNSTKGPSPPYHYVMKADDNMYLRLDNLVESLRPL  195



>gb|EEC84624.1| hypothetical protein OsI_31479 [Oryza sativa Indica Group]
Length=406

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 107/172 (62%), Gaps = 12/172 (7%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQST---SLARVDVKFILCNLSGEAQRAFVALEILRF  732
            LL+G+ T P++Y+RR+ +RL Y +Q      +A+VDV+F+ C ++       VALE  R 
Sbjct  95   LLVGVLTTPKRYERRNIVRLAYALQPAVPPGVAQVDVRFVFCRVADPVDAQLVALEAARH  154

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSR-YDYVMKADDDVFLRLAPLAASLEGLPRR  555
             DI++LNCTENMN GKT+ Y SS+P +  S  YDYVMK DDD +LR+A L   L   PR 
Sbjct  155  GDILVLNCTENMNDGKTHAYLSSVPRMFASSPYDYVMKTDDDTYLRVAALVDELRHKPRD  214

Query  554  DLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNTYGP  411
            D+Y  YGF +    M     +M GMG+V+SWD+  W+  +   +  N+T+ P
Sbjct  215  DVYLGYGFAVGDDPMQ----FMHGMGYVVSWDVATWVSTNEDILRYNDTHAP  262



>gb|EEC84626.1| hypothetical protein OsI_31482 [Oryza sativa Indica Group]
Length=264

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 122/240 (51%), Gaps = 30/240 (13%)
 Frame = -1

Query  908  FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFR  729
            F LL+G+ T P +Y+RR  LRL Y +Q    A+VDV+F+LC+++  A    VA E  R  
Sbjct  45   FRLLVGVLTTPSRYERRGILRLAYALQPAPGAQVDVRFVLCDVTDAADAVLVAAEAARHG  104

Query  728  DIVILN--CTENMNSGKTYTYFSSLPGIL-PSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            DI++L+   TENMN GKT+ Y SS+P +  P  YDYVMKADDD +LR+A LA  L G PR
Sbjct  105  DILVLDGCSTENMNDGKTHAYLSSVPRLFAPCPYDYVMKADDDTYLRVAALADELRGKPR  164

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
            R        P  +        S   +  S        R+  P   T G            
Sbjct  165  RTSTSAGATPSAT----TRCRSCTAWATS---CPGTSRAGCPPTRTSG------------  205

Query  377  GKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHS  198
                +NR+N KP MYD          E  P TIAVHRLK   +W  V + FNVT  ++ S
Sbjct  206  ----RNRYNLKPRMYDINWD----MDEFRPNTIAVHRLKNNRRWAAVFRHFNVTVGIKPS  257



>gb|EEE65247.1| hypothetical protein OsJ_20421 [Oryza sativa Japonica Group]
Length=224

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 115/228 (50%), Gaps = 46/228 (20%)
 Frame = -1

Query  773  EAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSR-----------YDYV  627
            +  RAFVALE   + D+++++C E+ + GKTY YF+ LP +L S            YDYV
Sbjct  3    QEHRAFVALEARAYGDVMLIDCDESPDKGKTYDYFAGLPAMLSSGGGGGGGGEGRPYDYV  62

Query  626  MKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMN--PFVHYMSGMGFVLSWDLVEW  453
            MK DDD +LRL  LA +L   PR D+YYG  +P       PF   M GMG+VLSW     
Sbjct  63   MKVDDDTYLRLDELAETLRRAPREDMYYGAGLPFLDKESPPF---MLGMGYVLSW-----  114

Query  452  IGRSRIPANNTYG---------------------PEDKLVGQWLDMGKKAKNRFNNKPAM  336
             G  R+     +G                      ED   G WL+MG KAKNR N  P M
Sbjct  115  -GSRRVDRRLRHGQSASHRRQLCACVRNRWRSLCAEDVTTGTWLNMGNKAKNRVNIFPRM  173

Query  335  YDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKM  192
            YD+ G       + + +TI VH+LK+  +W   L+ FNVT     SKM
Sbjct  174  YDFKGVK---PEDFLEDTIGVHQLKQDLRWAQTLEHFNVTCLDPSSKM  218



>ref|XP_006372840.1| hypothetical protein POPTR_0017s05560g [Populus trichocarpa]
 gb|ERP50637.1| hypothetical protein POPTR_0017s05560g [Populus trichocarpa]
Length=115

 Score =   134 bits (337),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 57/92 (62%), Positives = 74/92 (80%), Gaps = 4/92 (4%)
 Frame = -1

Query  527  CP----SMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN  360
            CP    S +PF  +MSGMGF+LSWDL  WIG+S IPAN+T+GPE+K+ G+WL  G KAK 
Sbjct  18   CPHLLISTSPFEDFMSGMGFLLSWDLAGWIGKSGIPANDTFGPEEKMAGKWLKTGNKAKY  77

Query  359  RFNNKPAMYDYPGTNGRCSHELIPETIAVHRL  264
            RF+++PAMYD+ GTNGRCSH+L+P T+A+H L
Sbjct  78   RFSDEPAMYDHLGTNGRCSHQLVPATLALHIL  109



>ref|XP_006845628.1| hypothetical protein AMTR_s00019p00218620 [Amborella trichopoda]
 gb|ERN07303.1| hypothetical protein AMTR_s00019p00218620 [Amborella trichopoda]
Length=202

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -1

Query  911  RFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRF  732
            +F +L+GI TRP  Y+ R+ LRL Y  Q+T++A +DVKF++CN++    R  VALEI++F
Sbjct  88   KFRMLMGILTRPGSYNGRNLLRLAYSTQTTNVAEIDVKFVICNVTDGNDRVIVALEIMKF  147

Query  731  RDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLR  597
             DI+IL C+ENM+ GKTYTYFSSLP +L   YDYVMK DDD++ R
Sbjct  148  NDIIILQCSENMDKGKTYTYFSSLPAMLSQPYDYVMKTDDDMYFR  192



>gb|EMT33316.1| hypothetical protein F775_16326 [Aegilops tauschii]
Length=255

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 117/247 (47%), Gaps = 59/247 (24%)
 Frame = -1

Query  926  ADSHAR----FSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL----ARVDVKFILCNLSGE  771
            AD  AR      +L+G+ T P+K+ RRH +R+ Y +Q T+     ARVDV+F LC     
Sbjct  48   ADDGARRPGQLRILVGVHTMPKKHSRRHLIRMAYALQQTAALRGAARVDVRFALCARPMP  107

Query  770  AQR-AFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRL  594
            A+  AFVALE   + D+++ NCTEN   GKTYTYF+ LP +L                  
Sbjct  108  AEHGAFVALERRAYGDVLLFNCTENAEDGKTYTYFADLPAML------------------  149

Query  593  APLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYG  414
                    G PR  ++                    G   +W    W G  R  + + +G
Sbjct  150  --------GAPRGRVW--------------------GCTTAWACRSWTG-CRRRSCSAWG  180

Query  413  PEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVL  234
             ED   G WL+ G KAKNR N  P MYDY     +   + + +TI VH+LK+  +W H L
Sbjct  181  VEDVTTGNWLNEGGKAKNRVNIFPRMYDYKSAQAK---DFLEDTIGVHQLKEDIRWAHTL  237

Query  233  KFFNVTT  213
              FN T+
Sbjct  238  AHFNATS  244



>ref|XP_006677688.1| hypothetical protein BATDEDRAFT_87048 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82270.1| hypothetical protein BATDEDRAFT_87048 [Batrachochytrium dendrobatidis 
JAM81]
Length=315

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 134/257 (52%), Gaps = 18/257 (7%)
 Frame = -1

Query  989  STNSNSPLRTPNDEIAIN----IVPADSHARFS---LLIGIFTRPEKYDRRHFLRLIYGI  831
            ST + +P +T N +I  +    ++ +D+ A  +   +L+GI T  EK  RR  +R  Y  
Sbjct  46   STLTQTPPQTLNFQITTDAHTALLSSDTAATSNSKLILVGILTSVEKLQRRTLIRDTYA-  104

Query  830  QSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPGI  651
                 A VD+ F+       +  A + LE +R+ DI++++C ENM+ GKT+ +F  +  +
Sbjct  105  -RLKPANVDLVFVFGRPKDSSYEALIRLESIRYGDIMVVDCKENMDDGKTFAFFKHVGSV  163

Query  650  L-PSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVL  474
              P +Y +VMKADDD ++ L  LA  +  +P+   Y+G  +          +M+GMG+ L
Sbjct  164  YPPEQYGFVMKADDDCWIGLDNLAKWVSTMPQTGTYFGRHVSGTG------FMAGMGYGL  217

Query  473  SWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRFNNKP-AMYDYPGTNGRCSHE  297
            S+DLV+WI     P+ +  G ED L+  WL    + K+   ++  A YD P      +H 
Sbjct  218  SFDLVQWIATDAYPSQHRIGQEDSLLASWLRHSNQLKHYIGDETKAFYDDPAHARGWAHP  277

Query  296  LIPETIAVHRLKKWEQW  246
                TI +HRLK  E W
Sbjct  278  YTANTILIHRLKN-EAW  293



>gb|EMT29614.1| hypothetical protein F775_04764 [Aegilops tauschii]
Length=120

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -1

Query  536  VIPCPSMNPFVHYMSGMGFVLSWDLVEWI-GRSRIPANNTYGPEDKLVGQWLDMGKKAKN  360
            ++PC  +  +  YMSGMG+V+SWDLVEWI   +    N+T GPED+ +  W     KAKN
Sbjct  1    MVPCDYVRGWNEYMSGMGYVISWDLVEWIVAAADQIRNHTVGPEDRTLYSWFSGAGKAKN  60

Query  359  RFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMY  189
            R + KPAMYD+P     C+HEL+P+TIAVHRLK   +W   LK+FN T  LE SK Y
Sbjct  61   RMDVKPAMYDFPQRGAPCAHELVPDTIAVHRLKNNFRWSTTLKYFNFTAGLEPSKFY  117



>gb|EMT00770.1| hypothetical protein F775_19376 [Aegilops tauschii]
Length=599

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 73/122 (60%), Gaps = 4/122 (3%)
 Frame = -1

Query  536  VIPCPSMN--PFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAK  363
             +PC   N  PF  +MSGMG+ LSWDLV W+ RS +   +  GPED   G+WL++  KAK
Sbjct  477  AMPCDRENFYPFPPFMSGMGYALSWDLVRWVARSEVSRRDRVGPEDMWTGRWLNVAGKAK  536

Query  362  NRFNNKPAMYDYPGTN-GRC-SHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMY  189
            NR++  P MY+Y G++   C      P+TIAVH LK   +WV  L +FN T  L  S +Y
Sbjct  537  NRYDGAPRMYNYLGSSPANCFRRGFRPDTIAVHMLKDAGRWVETLAYFNATAALPPSALY  596

Query  188  HF  183
            H 
Sbjct  597  HL  598



>gb|ESA14842.1| hypothetical protein GLOINDRAFT_24522 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX66871.1| hypothetical protein RirG_119640 [Rhizophagus irregularis DAOM 
197198w]
Length=263

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/235 (32%), Positives = 118/235 (50%), Gaps = 16/235 (7%)
 Frame = -1

Query  905  SLLIGIFTRPEKYDRRHFLRLIYGIQSTSLA--RVDVKFILC---NLSGEAQRAFVALEI  741
             + IGI+T  +K++ R+ +R +  IQ  +L   +VD KFIL      + E +   +++E 
Sbjct  24   QIFIGIWTVADKFEIRNLIRTLNIIQKMNLVGDKVDFKFILGIPPEFTPELESQ-LSIEN  82

Query  740  LRFRDIVILNCTENMNSGKTYTYFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLP  561
              + D+++LN  ENMN GK+Y Y+  +      +YDYV+K DDD F+    LA +L  LP
Sbjct  83   NTYGDLIMLNNIENMNHGKSYYYWKWVAEYSDMQYDYVIKTDDDAFVHFQNLALNLRPLP  142

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW-L  384
            R++LYYG       +     +M G    LS D V  I  S       YG ED+++G W L
Sbjct  143  RKNLYYG-------LENRDIFMYGELETLSVDQVYMIATSSFNQTEWYGHEDRMLGSWLL  195

Query  383  DMGKKAKNRFNNKPAMYDYPGTNGRCSHE--LIPETIAVHRLKKWEQWVHVLKFF  225
            +       R +    +++ P T  R S      P  I +HR+K+   W  V+  +
Sbjct  196  NHVNSTLIRISENCLIFNDPRTKNRFSRRPWASPNLIVIHRIKEISAWKSVIDLY  250



>gb|EPS62729.1| hypothetical protein M569_12060, partial [Genlisea aurea]
Length=206

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 96/194 (49%), Gaps = 23/194 (12%)
 Frame = -1

Query  860  RHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDIVI---LNCTENMNS  690
            R FLRL+YG QS   A +DV+FI+C ++    +      + R          + T ++ +
Sbjct  15   RSFLRLVYGAQSPIGAIIDVRFIMCRMADAEHKKSRNAGLTRKTQTGKKPRRDSTISLQA  74

Query  689  GKTYT-------------YFSSLPGILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDL  549
            G+  +             Y   L       Y YV+KADDDV++RL PL  SL+ + R D 
Sbjct  75   GRILSRYRIPGQTSPDTAYLQKLQIKTNPPYHYVVKADDDVYIRLQPLVESLQFVAREDA  134

Query  548  YYGFVIPC-PSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGK  372
            YYG    C  +    V YM+G  + +SWD+ EW+  S IP  N  GPED L   WL  G 
Sbjct  135  YYG----CNATTQRGVEYMTGSLYAVSWDITEWLSISHIP--NLSGPEDILFATWLRDGH  188

Query  371  KAKNRFNNKPAMYD  330
              KNR++ +  +YD
Sbjct  189  VGKNRYDIEDKLYD  202



>gb|EKC98421.1| hypothetical protein A1Q2_07435 [Trichosporon asahii var. asahii 
CBS 8904]
Length=952

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 125/251 (50%), Gaps = 34/251 (14%)
 Frame = -1

Query  923  DSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLAR----VDVKFILCNLSGE-AQRA  759
            DS    ++ +G+FT     DRR+ +R  YG    SL      V ++FI+   S E A+R 
Sbjct  597  DSIEPTTVFLGVFTVDHSVDRRNVIRETYGSHPKSLKPGSEGVRLRFIMGRPSPEWAER-  655

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFS--SLPGILPS---------------RYDY  630
             VA E  +  DIVIL+  ENMN+GKTY YFS  +    +P+               R  Y
Sbjct  656  -VAAENKKHGDIVILDIDENMNNGKTYHYFSWAAEHATVPAYEYPTVGQAIYKGEKRPAY  714

Query  629  VMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI  450
            V KADDD F+ L+ L   L   PR+  ++G+++     N +  +M+G  + +S DL E+I
Sbjct  715  VAKADDDAFIVLSELERHLRASPRKLTHWGYLV-----NNW--FMAGECYAVSLDLAEYI  767

Query  449  GRSRIPANNTYGPEDKLVGQWLDMGKKAK--NRFNNKPAMYDYPGTNGRCSHE-LIPETI  279
              S   A +  G EDK + QWL    + +     + K  +YD+P      SH  L P  +
Sbjct  768  STSPEVAQHVNGKEDKRMSQWLHAHPEREKITWVSEKTWIYDHPRAPTVYSHGFLFPSEV  827

Query  278  AVHRLKKWEQW  246
            A+ R +K E W
Sbjct  828  AMTRKRKAEGW  838



>gb|EMS63974.1| hypothetical protein TRIUR3_16615 [Triticum urartu]
Length=132

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 78/139 (56%), Gaps = 12/139 (9%)
 Frame = -1

Query  587  LAASLEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNT  420
            +A  L   PR D+Y  YGF +    M     +M GMG+V+SWD+  W+  +   +  N+T
Sbjct  1    MAEELRPKPRDDVYLGYGFAVGDDPM----QFMHGMGYVVSWDVATWVSANEEILRHNDT  56

Query  419  YGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVH  240
            +GPED L G+WL++G + KNR++ +P MYD             P+T+AVH +K   +W  
Sbjct  57   HGPEDLLFGKWLNIGHRGKNRYSLRPRMYDL----NWVMDNFRPDTVAVHMIKDNRRWAA  112

Query  239  VLKFFNVTTELEHSKMYHF  183
              ++FNVT  +  S +YH 
Sbjct  113  AFRYFNVTAGIRPSNLYHL  131



>gb|EPS67322.1| hypothetical protein M569_07458 [Genlisea aurea]
Length=144

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 76/145 (52%), Gaps = 9/145 (6%)
 Frame = -1

Query  608  VFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPA  429
             ++RL  L  SL+   R D YYG  +          +M+G  +++SWD+ EWI  + I  
Sbjct  5    TYIRLQHLVESLQYAAREDAYYGHKVKTSDQE----FMTGTFYLVSWDVAEWISTTDI--  58

Query  428  NNTYGP---EDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKK  258
            +  Y P   ED +   WL  G   KN+++ K  +YD P       HE    TI VH+LK 
Sbjct  59   DEKYHPIHLEDVVFSHWLHDGNLGKNQYDMKGKIYDIPRPGHHFPHEFWSGTIGVHKLKT  118

Query  257  WEQWVHVLKFFNVTTELEHSKMYHF  183
             E+W+  L +FNVT +L+ SK YH+
Sbjct  119  REKWIQTLDYFNVTKDLKPSKFYHY  143



>ref|XP_009266168.1| Beta-1,3-galactosyltransferase pvg3 [Wallemia ichthyophaga EXF-994]
 gb|EOR03951.1| Beta-1,3-galactosyltransferase pvg3 [Wallemia ichthyophaga EXF-994]
Length=385

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 116/240 (48%), Gaps = 28/240 (12%)
 Frame = -1

Query  929  PADSHARFSLLIGIFTRPE--KYDRRHFLR--LIYGIQSTSLARVDVKFILCNLSGEAQR  762
            P  S     L IGIF+ P+     RR  +R  L    ++   A ++ KF++     ++Q 
Sbjct  79   PCSSDNAPRLFIGIFSTPDPSATARRALIRSLLSQTFEAVGNAVLEYKFVVGTSEHDSQN  138

Query  761  AFVALEILRFRDIVILNCTENMNSGKTYTYFSSL-------PGILPSRYDYVMKADDDVF  603
              +A E    +DI+ L  +ENMNSGK+Y YF +L       P   P    +V K DDD  
Sbjct  139  NALAQEHSVHKDILTLPTSENMNSGKSYAYFRALLEMHKRDPAFTPQ---FVAKCDDDTL  195

Query  602  LRLAPLAASLEGLP-RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPAN  426
            L +  +  SL GL   +++Y+G        N F  Y  G+ ++LSW LV WIG S +   
Sbjct  196  LVVPAVLNSLSGLQCDQNVYWG--TSAGRSNHFPEYFRGLAYILSWPLVGWIGGSDVGTL  253

Query  425  NTYGPEDKLVGQWLDM-----GKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLK  261
            + +G ED   GQW+ M       ++  R +NK  M D+   +      +  +T+A+H LK
Sbjct  254  HQHGIEDARTGQWMQMLPYLSPSESVRRVDNKWNMGDWNQLS------ITQDTLALHWLK  307



>gb|EMT19575.1| hypothetical protein F775_17291 [Aegilops tauschii]
Length=132

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 77/139 (55%), Gaps = 12/139 (9%)
 Frame = -1

Query  587  LAASLEGLPRRDLY--YGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSR--IPANNT  420
            +A  L   PR DLY  YGF +    M     +M GMG+V+SWD+  W+  +   +  N  
Sbjct  1    MAEELRPRPRDDLYLGYGFAVGDDPM----QFMHGMGYVVSWDVATWVSTNDEILRHNAA  56

Query  419  YGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVH  240
            +GPED L G+WL++G++ KNR++ +P MYD             P+T+AVH +K   +W  
Sbjct  57   HGPEDLLCGKWLNIGRRGKNRYSLRPRMYDLNWN----MDNFRPDTVAVHMIKDNRRWAA  112

Query  239  VLKFFNVTTELEHSKMYHF  183
              ++FNVT  +  S +YH 
Sbjct  113  AFRYFNVTAGVRPSNLYHL  131



>ref|XP_006956220.1| hypothetical protein WALSEDRAFT_56136 [Wallemia sebi CBS 633.66]
 gb|EIM23543.1| hypothetical protein WALSEDRAFT_56136 [Wallemia sebi CBS 633.66]
Length=388

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 125/271 (46%), Gaps = 31/271 (11%)
 Frame = -1

Query  986  TNSNSPLRT--PNDEIAINIVPADSHARFS-----LLIGIFTRPEKYDRRHFLRLIYG--  834
            TN N P R+    D   ++  P  SH   +     L IGIF+ PEK DRR  +R +    
Sbjct  54   TNKNPPSRSFEEPDYGLLSSPPPSSHTCNTEQTPKLFIGIFSTPEKSDRRSLIRTLMSNY  113

Query  833  IQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPG  654
                  + +D  FI+   S   +   +  E  RF DI+ L+  ENM++GKT+ ++  L  
Sbjct  114  FDRIDKSILDYSFIVAQSSDNTENEEILKESERFADIMSLDIPENMDNGKTFHFYKHLHQ  173

Query  653  ILPS----RYDYVMKADDDVFLRLAPLAASLEGLP-RRDLYYGFVIPCPSMNPFVHYMSG  489
            +       +  +V K DDD  L +  L  SL+ L   +++Y+G          F  Y  G
Sbjct  174  LHAKNETFQPQFVTKCDDDTMLVIPALLNSLKELDCNQNIYWG--TSAGRSQHFPEYFRG  231

Query  488  MGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD-----MGKKAKNRFNNKPAMYDYP  324
            + ++LSW LV+WIG S I   +  G ED   GQW+        K++  R +N   M D+ 
Sbjct  232  LAYILSWPLVKWIGNSDISTLHQQGIEDARTGQWMQSLNYIYPKQSLKRVDNLWDMGDWN  291

Query  323  GTNGRCSHELIPETIAVH----RLKKWEQWV  243
                + S      T+A+H    RLK  E WV
Sbjct  292  QLALKES------TLALHWQHFRLKLPEWWV  316



>gb|EMS63973.1| hypothetical protein TRIUR3_16614 [Triticum urartu]
Length=112

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = -1

Query  500  YMSGMGFVLSWDLVEWIGRSR--IPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDY  327
            +M GMG+VLSWDL  W+  +   +  N+T GPED ++G+WL++  K +NR++ KP MYD 
Sbjct  8    FMHGMGYVLSWDLASWVSTAEEILARNDTLGPEDLMLGKWLNLAGKGRNRYDLKPRMYDL  67

Query  326  PGTNGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELEHSKMYHF  183
                      L P+++AVH LK   +W   L++FNVT  ++ S++YH 
Sbjct  68   SWD----MDNLRPDSVAVHMLKDNRRWATTLRYFNVTAGIKPSELYHL  111



>gb|EJT49460.1| hypothetical protein A1Q1_01364 [Trichosporon asahii var. asahii 
CBS 2479]
Length=952

 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 123/251 (49%), Gaps = 34/251 (14%)
 Frame = -1

Query  923  DSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLAR----VDVKFILCNLSGE-AQRA  759
            DS    ++ +G+FT     DRR+ +R  YG    SL      V ++FI+   S E A+R 
Sbjct  597  DSIEPTTVFLGVFTVDHSVDRRNVIRETYGSHPKSLKPGSEGVRLRFIMGRPSPEWAER-  655

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFS--SLPGILPS---------------RYDY  630
             VA E  +  DIVIL+  ENMN+GKTY YFS  +    +P+               R  Y
Sbjct  656  -VAAENKKHGDIVILDIDENMNNGKTYHYFSWAAEHATVPAYEYPTVGQAIYKGEKRPAY  714

Query  629  VMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWI  450
            V KADDD F+ L+ L   L   PR+  ++G+++     N +  +M+G  + +S DL E+I
Sbjct  715  VAKADDDAFIVLSELERHLRASPRKLTHWGYLV-----NNW--FMAGECYAVSLDLAEYI  767

Query  449  GRSRIPANNTYGPEDKLVGQWLDMGKKAK--NRFNNKPAMYDYPGTNGRCSHE-LIPETI  279
              S   A +  G EDK + QWL    + +     + K  +YD+P      SH  L P  +
Sbjct  768  STSPEVAQHVSGKEDKRMSQWLHAHPEREKITWVSEKTWIYDHPRAPTVYSHGFLFPSEV  827

Query  278  AVHRLKKWEQW  246
            A  R +  E W
Sbjct  828  ARTRKRYAEGW  838



>gb|KEI37533.1| glycosyltransferase family 31 protein [Mixia osmundae IAM 14324]
Length=1236

 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 77/261 (30%), Positives = 120/261 (46%), Gaps = 47/261 (18%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--------ARVDVKFILCNLSGE  771
            AD+    ++ +G+F+    Y+RRH +R  Y   S  L          + +KFIL      
Sbjct  555  ADALPPVNMFVGVFSVDAAYERRHLIRSTYARHSKPLDPKTGQPAQNIQLKFILGRPRKN  614

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF--SSLPGILPSRY-------------  636
              R   ALE+  + DIV+L+  ENMN GKTY +   ++    +P  Y             
Sbjct  615  HARRL-ALEMETYNDIVVLDIKENMNRGKTYAFMRWAAENATIPFNYVPQHGRTQSLQGG  673

Query  635  -------------DYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYM  495
                         DY++KADDD FL L+ L   +   PR   Y+G++I          +M
Sbjct  674  TITQPVSVGFRKADYIVKADDDSFLVLSELERHMRVSPREKSYWGYLINS-------GFM  726

Query  494  SGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAK--NRFNNKPAMYDYPG  321
            +G  + LS DLV++I       ++T GPEDK V +W+ +   A   N  + +  +YD+P 
Sbjct  727  AGEVYALSADLVQYIASDLTLLSHTIGPEDKKVAKWMRLHPNASSINWISERCYIYDHPK  786

Query  320  TNGRCSHE-LIPETIAVHRLK  261
             +   SH  L P+ +   RL+
Sbjct  787  ASTVYSHGFLFPDEVERIRLE  807



>dbj|GAA93412.1| hypothetical protein E5Q_00053 [Mixia osmundae IAM 14324]
Length=1398

 Score =   101 bits (252),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 77/261 (30%), Positives = 121/261 (46%), Gaps = 47/261 (18%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--------ARVDVKFILCNLSGE  771
            AD+    ++ +G+F+    Y+RRH +R  Y   S  L          + +KFIL      
Sbjct  717  ADALPPVNMFVGVFSVDAAYERRHLIRSTYARHSKPLDPKTGQPAQNIQLKFILGRPRKN  776

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTY--FSSLPGILPSRY-------------  636
              R   ALE+  + DIV+L+  ENMN GKTY +  +++    +P  Y             
Sbjct  777  HARRL-ALEMETYNDIVVLDIKENMNRGKTYAFMRWAAENATIPFNYVPQHGRTQSLQGG  835

Query  635  -------------DYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYM  495
                         DY++KADDD FL L+ L   +   PR   Y+G++I          +M
Sbjct  836  TITQPVSVGFRKADYIVKADDDSFLVLSELERHMRVSPREKSYWGYLI-------NSGFM  888

Query  494  SGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAK--NRFNNKPAMYDYPG  321
            +G  + LS DLV++I       ++T GPEDK V +W+ +   A   N  + +  +YD+P 
Sbjct  889  AGEVYALSADLVQYIASDLTLLSHTIGPEDKKVAKWMRLHPNASSINWISERCYIYDHPK  948

Query  320  TNGRCSHE-LIPETIAVHRLK  261
             +   SH  L P+ +   RL+
Sbjct  949  ASTVYSHGFLFPDEVERIRLE  969



>dbj|GAC93114.1| glycosyltransferase [Pseudozyma hubeiensis SY62]
Length=972

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 81/273 (30%), Positives = 121/273 (44%), Gaps = 72/273 (26%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--------ARVDVKFILCNLSGE  771
            AD+ A   + +G+F+    Y+RRH +R  Y      L        + V VKFI+    G+
Sbjct  359  ADALAPVDVFVGVFSIDSSYERRHLIRSTYATHELPLDPHTGMPTSNVQVKFII----GK  414

Query  770  AQRAF---VALEILRFRDIVILNCTENMNSGKTYTYF------SSLPGILP---------  645
             +RA    VALE+  F DIV+L+  ENMN GKT+ +F      +++P + P         
Sbjct  415  PRRAHARRVALELETFNDIVVLDMEENMNRGKTHAFFQWAAENATVPFLRPVDQKQQFGA  474

Query  644  --------------------------SRY-------DYVMKADDDVFLRLAPLAASLEGL  564
                                       RY       DYV+KADDD +LRL  L   L   
Sbjct  475  SLDELAQHGNGHGQTREVLGGSTEQAQRYQVLWKKADYVVKADDDAYLRLQELERHLRVA  534

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR+  Y+G++I     N F   M G  + LS DLV+++  S    ++  G EDK V QW+
Sbjct  535  PRQMTYWGYLI----RNWF---MGGECYALSSDLVQYVAHSESVLHHVNGKEDKKVAQWM  587

Query  383  DM--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
             +   +   +    +  +YD+P      SH  +
Sbjct  588  SLHPNRSDIHWVEERCWIYDHPKAGTAYSHGFL  620



>gb|KGB80144.1| hypothetical protein CNBG_5982 [Cryptococcus gattii R265]
Length=819

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/252 (30%), Positives = 116/252 (46%), Gaps = 55/252 (22%)
 Frame = -1

Query  905  SLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALEIL  738
            S+LIG+FT     +RRH +R  Y     S       V +KF++       ++A + LE+ 
Sbjct  387  SVLIGVFTTDAGLERRHMIRQSYASHWRSRREGTEGVRIKFVMGKPRKRYEKA-IQLEME  445

Query  737  RFRDIVILNCTENMNSGKTYTYFS------SLP---------------------GILPS-  642
             F DI++L+  ENMNSGKTY +FS      S+P                     GI  + 
Sbjct  446  AFNDILLLDMDENMNSGKTYAFFSWAAENASVPDWEYPSHPRSDSDHVSSGARHGIEAAQ  505

Query  641  -------------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVH  501
                         +  YV+KAD+D F+ L  L   L  +PR   Y+G+++          
Sbjct  506  GGKLHAPVWRGEKKPQYVVKADEDSFIMLGELERRLRVVPRTKTYWGYLVKN-------Q  558

Query  500  YMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRF--NNKPAMYDY  327
            +M+G  + LS+DLVE+I  S +    T G EDKLV +W+ M  + +      ++  +YD+
Sbjct  559  FMAGECYALSFDLVEYIAASPVLKTLTRGKEDKLVAKWIGMHPQREEIVWSTDRCWIYDH  618

Query  326  PGTNGRCSHELI  291
            P      SH  +
Sbjct  619  PKAGTVYSHGFL  630



>ref|XP_003196116.1| hypothetical Protein CGB_I2100W [Cryptococcus gattii WM276]
 gb|ADV24329.1| conserved hypothetical protein [Cryptococcus gattii WM276]
Length=820

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/252 (30%), Positives = 116/252 (46%), Gaps = 55/252 (22%)
 Frame = -1

Query  905  SLLIGIFTRPEKYDRRHFLRLIYGIQSTSLAR----VDVKFILCNLSGEAQRAFVALEIL  738
            S+LIG+FT     +RRH +R  Y     S       V +KF++       ++A + LE+ 
Sbjct  387  SMLIGVFTTDAGVERRHMIRQSYASHWRSRREGTEGVRIKFVMGKPRKRYEKA-IQLEME  445

Query  737  RFRDIVILNCTENMNSGKTYTYFS------SLP---------------------GILPS-  642
             F DI++L+  ENMNSGKTY +FS      S+P                     GI  + 
Sbjct  446  AFNDILLLDMDENMNSGKTYAFFSWAAENASVPDWEYPSHPRSDSDDFNSDARHGIEAAQ  505

Query  641  -------------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVH  501
                         +  YV+KAD+D F+ L  L   L  +PR   Y+G+++          
Sbjct  506  GGKLHAPVWRGEKKPQYVVKADEDSFIMLGELERRLRVVPRMRTYWGYLVKN-------Q  558

Query  500  YMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRF--NNKPAMYDY  327
            +M+G  + LS+DLVE+I  S +    T G EDKLV +W+ M  + +      ++  +YD+
Sbjct  559  FMAGECYALSFDLVEYIAASPVLKTLTRGKEDKLVAKWIGMHPQREEIVWSTDRCWIYDH  618

Query  326  PGTNGRCSHELI  291
            P      SH  +
Sbjct  619  PKAGTVYSHGFL  630



>gb|ESA07121.1| hypothetical protein GLOINDRAFT_33292 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX51644.1| hypothetical protein RirG_259920 [Rhizophagus irregularis DAOM 
197198w]
Length=318

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 113/236 (48%), Gaps = 17/236 (7%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLAR--VDVKFILCNLSGEAQRAFVAL--EILR  735
            + IGI++  +KY+ RH +R +   Q  +LA   VD KFIL   S       + L  E   
Sbjct  85   IFIGIWSVADKYEIRHLIRTLNLKQRRNLAGDIVDFKFILGIPSDNNPELKLKLKAENDT  144

Query  734  FRDIVILNCTENMNSGKTYTYFSSLPGIL-PSRYDYVMKADDDVFLRLAPLAASLEGLPR  558
            + D+V+L+  ENMN+GK Y Y+  +   L  +RYDYV K DDD+F+    LA +L  L R
Sbjct  145  YGDLVMLDMVENMNNGKGYYYWKWIAEQLDTTRYDYVSKVDDDLFIHFQNLALNLRPLTR  204

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
              LYYG      + +P   ++ G   VLS DL   I           GPED  +G +L+ 
Sbjct  205  GHLYYG------NKSPHSFFIRGTIEVLSVDLAHLIASFPFKKREWNGPEDVQLGAFLNK  258

Query  377  GKKAKNRFNNKPAMYDYPGTNGRCSHELI-----PETIAVHRLKKWEQWVHVLKFF  225
              K+ N       ++  P    +   ++      P +IA+H LK    W  V+  +
Sbjct  259  HAKSLNTIGENCLIFTDPRIR-KVRRKMWRPWASPNSIAIHWLKDIRAWKGVIDLY  313



>ref|XP_758231.1| hypothetical protein UM02084.1 [Ustilago maydis 521]
 gb|EAK83082.1| hypothetical protein UM02084.1 [Ustilago maydis 521]
Length=974

 Score = 95.1 bits (235),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 79/274 (29%), Positives = 120/274 (44%), Gaps = 71/274 (26%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--------ARVDVKFILCN-LSG  774
            AD+ A   + +G+F+    Y+RRH +R  Y      L        + V VKFI+    + 
Sbjct  360  ADALAPVDVFVGVFSVDSSYERRHLIRSTYATHELPLDPSTGRPTSHVQVKFIIGKPRNA  419

Query  773  EAQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLPGI-------------  651
             A+R  VALE+  F DIV+L+  ENMN GKT+ YF      +++P +             
Sbjct  420  HARR--VALEMETFNDIVVLDIDENMNRGKTHAYFQWAAENATVPFLRAVDQQTSQRPLG  477

Query  650  -------------------------LPSRY-------DYVMKADDDVFLRLAPLAASLEG  567
                                      P RY       DYV+KADDD ++ L  L   L  
Sbjct  478  AHLDEPRQRGNGHGQTREVLGGTADQPQRYQVLWKKADYVVKADDDAYIFLQELERHLRV  537

Query  566  LPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQW  387
             PR+  Y+G++I     N F   M G  + LS DLV+++  S    ++  G EDK V QW
Sbjct  538  APRQMTYWGYLI----RNWF---MGGECYALSSDLVQYVAHSANVLHHVKGKEDKKVAQW  590

Query  386  LDM--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            +++   +   +    +  +YD+P      SH  +
Sbjct  591  INLHPNRSGIHWVAERCWIYDHPKAGTAYSHGFL  624



>gb|EGU12456.1| hypothetical protein RTG_01490 [Rhodotorula glutinis ATCC 204091]
Length=1135

 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 104/213 (49%), Gaps = 40/213 (19%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            ADS    ++ +G+F+     +RR+ +RL Y   S        T+   V +KF+L     +
Sbjct  382  ADSLKPVNVFVGVFSVDAAAERRNAIRLSYAKHSKPIDPRTGTAAHNVQLKFVLGRPRAK  441

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYFS------------SLP----------  657
              +  +ALE+  F DIV+L+  ENMN GKT+ YFS            +LP          
Sbjct  442  WSKR-IALEMEMFNDIVVLDVEENMNKGKTFRYFSWAAENATVPVFYALPGEEGLVDGQR  500

Query  656  --GILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMG  483
              G+   + DYV+KADDD F+ L  L   L   PR + Y+G+++          +M+G  
Sbjct  501  QVGVGFRKADYVVKADDDSFIDLGELERHLRITPRENTYWGYLVRN-------RFMAGEV  553

Query  482  FVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            + LS DLV ++     P + T G ED+ V +W+
Sbjct  554  YALSSDLVSYLASYPRPKSWTIGKEDQRVAKWM  586



>ref|XP_001731208.1| hypothetical protein MGL_1391 [Malassezia globosa CBS 7966]
 gb|EDP43994.1| hypothetical protein MGL_1391 [Malassezia globosa CBS 7966]
Length=487

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 76/240 (32%), Positives = 111/240 (46%), Gaps = 48/240 (20%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIY--------GIQSTSLARVDVKFILCNLSGE-AQRAFVA  750
            LL+G+ T   K++RR  +R  Y              L  V VKFIL     E A+R  VA
Sbjct  41   LLVGVLTTDAKFERRSVIRDTYMRHTVPKHASSGRPLGNVQVKFILGRPRREYAER--VA  98

Query  749  LEILRFRDIVILNCTENMNSGKTYTYF------SSLPGILPSR-----------------  639
            +E+  + DIV+L+  E   S KTY +F      +++P ++P +                 
Sbjct  99   MEMELYNDIVVLDIKETQWSRKTYEFFRWAAENATVPVLVPGKPTTPSKNLVRIGQQAYE  158

Query  638  -----YDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVL  474
                  DYV+KADDD F+ L  L   L  LPR  L++G+ I          +M G  + L
Sbjct  159  VRWKLVDYVLKADDDAFIVLNELERRLRALPRHLLHWGYKIAD-------WFMGGELYAL  211

Query  473  SWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN--RFNNKPAMYDYPGTNGRCSH  300
            S+DLVE+I RS+  A      ED+ V QWL +  +A N    +    +YD+P      +H
Sbjct  212  SYDLVEFIARSQDIARWPSLKEDEQVAQWLRLHPQANNVTWASEHCWIYDHPRAKTPYAH  271



>dbj|GAK65384.1| family 31 glycosyltransferase [Pseudozyma antarctica]
Length=1136

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 118/277 (43%), Gaps = 73/277 (26%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            AD+ A   + +G+F+    Y+RRH +R  Y   +        T  + V VKFI+     +
Sbjct  515  ADALAPVDVFVGVFSIDSAYERRHLIRSTYATHTMPLDPHTGTPTSNVQVKFIIGKPR-Q  573

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF--------------------------  669
            A    VALE+  F DIV+L+  ENMN GKT+ +F                          
Sbjct  574  AHARRVALEMETFNDIVVLDMEENMNRGKTHAFFRWAAENATVPFLRAVEDGQNPASGLA  633

Query  668  --SSLPGILPSR---------------------------YDYVMKADDDVFLRLAPLAAS  576
              S L G L SR                            DYV+KADDD FL L  L   
Sbjct  634  QGSVLLGELESRGQGHGQTREVLGGSTEQMHRYQVLWKKADYVVKADDDAFLILEELERH  693

Query  575  LEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLV  396
            L   PR+  Y+G++I     N F   M G  + LS DLV+++ +S    +   G EDK V
Sbjct  694  LRVAPRQMTYWGYLI----RNWF---MGGECYALSNDLVQYVAKSENVLHYIKGKEDKKV  746

Query  395  GQWLDM--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
             QW+++   + + +  +    +YD+P      SH  +
Sbjct  747  AQWINLHPNRSSIHWVSEHCWIYDHPKAGTAYSHGFL  783



>gb|EPS59094.1| hypothetical protein M569_15716, partial [Genlisea aurea]
Length=74

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  437  IPANNTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLKK  258
            IP +N  GPED +VG+WL+ G   KNR N    MYD+      CSH+   ET+AVHRLK 
Sbjct  1    IPKHNLVGPEDMMVGKWLEEGHHGKNRHNTLSVMYDFEVEPAVCSHKFWSETVAVHRLKS  60

Query  257  WEQWVHVLKFFNVT  216
             E+WV  LK+FN T
Sbjct  61   QERWVTTLKYFNAT  74



>gb|EMS25174.1| glycosyltransferase family 31 protein [Rhodosporidium toruloides 
NP11]
 emb|CDR42929.1| RHTO0S07e05600g1_1 [Rhodosporidium toruloides]
Length=1140

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 104/213 (49%), Gaps = 40/213 (19%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            ADS    ++ +G+F+     +RR+ +RL Y   S        T+   V +KF+L     +
Sbjct  385  ADSLKPVNVFVGVFSVDAAAERRNAIRLSYAKHSKPIDPRTGTAAHNVQLKFVLGRPRAK  444

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYFS------------SLP----------  657
              +  +ALE+  F DIV+L+  ENMN GKT+ YFS            +LP          
Sbjct  445  WSKR-IALEMEMFNDIVVLDVEENMNKGKTFRYFSWAAENATVPVFYALPGQDGLVDGQR  503

Query  656  --GILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMG  483
              G+   + DYV+KADDD F+ L  L   +   PR + Y+G+++          +M+G  
Sbjct  504  QVGVGFRKADYVVKADDDSFIDLGELERHMRITPRENTYWGYLVRN-------RFMAGEV  556

Query  482  FVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            + LS DLV ++     P + T G ED+ V +W+
Sbjct  557  YALSSDLVSYLATYPRPKSWTIGKEDQRVAKWM  589



>ref|XP_570440.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_776090.1| hypothetical protein CNBD1380 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL21443.1| hypothetical protein CNBD1380 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW43133.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=813

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 121/260 (47%), Gaps = 54/260 (21%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLAR----VDVKFILCNLSGEAQRAFVALEILR  735
            +L+G+FT     +RRH +R  Y     S  +    V +KF++       ++A V LE+  
Sbjct  384  VLLGVFTTDAGLERRHMIRQSYASHWRSRRKGTEGVRIKFVMGRPRKRYEKA-VQLEMEA  442

Query  734  FRDIVILNCTENMNSGKTYTYFS------SLPG-ILPS----------------------  642
            F DI++L+  ENMN+GKT+ +FS      S+P    PS                      
Sbjct  443  FNDILLLDIDENMNNGKTHAFFSWAAENASVPDWEYPSHPRSDSDYANSGTAIEAAQGGN  502

Query  641  ----------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMS  492
                      +  YV+KAD+D F+ L  L   L  +PR   Y+G+++     N F   M+
Sbjct  503  LHAPVWRGEKKPQYVVKADEDSFIMLGELERRLRVVPRMKTYWGYLV----KNKF---MA  555

Query  491  GMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRF--NNKPAMYDYPGT  318
            G  + LS+DLVE+I  S      T G EDKLV +W+ M  + +      ++  +YD+P  
Sbjct  556  GECYALSFDLVEYIAASPALKTLTKGKEDKLVAKWIGMHPQKEEIVWSTDRCWIYDHPKA  615

Query  317  NGRCSHE-LIPETIAVHRLK  261
                SH  L P T+   R++
Sbjct  616  GTVYSHGFLYPSTVEQVRVE  635



>ref|XP_007876289.1| hypothetical protein PFL1_00605 [Pseudozyma flocculosa PF-1]
 gb|EPQ32409.1| hypothetical protein PFL1_00605 [Pseudozyma flocculosa PF-1]
Length=995

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 80/278 (29%), Positives = 119/278 (43%), Gaps = 74/278 (27%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            AD+ A   + +GIF+    Y+RRH +R  Y   +          L  + V+FI+     +
Sbjct  403  ADALAPVDVFVGIFSVDSSYERRHLIRSTYAAHTVPVDPQTGAPLGNIQVRFIIGRPR-K  461

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLPGILP------------  645
            A    VALE+  F D+VIL+  ENMN GKT+ +F      +++P + P            
Sbjct  462  AHARRVALEMEVFNDLVILDMEENMNRGKTHAFFKWAADNATVPFLRPVGGQQAQLWQSN  521

Query  644  -------------------------------SRY-------DYVMKADDDVFLRLAPLAA  579
                                            RY       DYV+KADDD F+ L  L  
Sbjct  522  VEQFGGGGSGGVGGGSFGQTHEVARGSGESEERYEVAWKKADYVVKADDDAFIVLEELER  581

Query  578  SLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKL  399
             L   PR+  Y+G++I     N F   M G  + LS DLV+++  S    + T G EDK 
Sbjct  582  HLRVSPRQMTYWGYLI----RNWF---MGGECYALSSDLVQYVATSENVLHYTKGKEDKK  634

Query  398  VGQWLDM--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            V QW+++   + A N  +    +YD+P      SH  +
Sbjct  635  VAQWINLHPNRAAINWVSEHCWIYDHPKAGTAYSHGFL  672



>gb|EAZ07524.1| hypothetical protein OsI_29780 [Oryza sativa Indica Group]
Length=101

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = -1

Query  488  MGFVLSWDLVEWIGRSRIPAN---NTYGPEDKLVGQWLDMGKKAKNRFNNKPAMYDYPGT  318
            MG++LSWDLVEWI     PA     T GPED+ +  WL  G + +NR + KPAMY++PG 
Sbjct  1    MGYLLSWDLVEWIVAP--PAEIEGRTGGPEDRTLYSWLRRGGRGRNRVDVKPAMYNFPGR  58

Query  317  NGRCSHELIPETIAVHRLKKWEQWVHVLKFFNVTTELE  204
            +  CSHE IP+TIAVH+LK   +W   L++FN T  L+
Sbjct  59   HP-CSHEFIPDTIAVHQLKDNRRWARTLQYFNFTAALK  95



>gb|AFR94758.2| hypothetical protein CNAG_01385 [Cryptococcus neoformans var. 
grubii H99]
Length=867

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 75/262 (29%), Positives = 122/262 (47%), Gaps = 56/262 (21%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVALEILR  735
            +LIG+FT     +RRH +R  Y     S       + +KF++       ++A + LE+  
Sbjct  436  VLIGVFTTDAGLERRHMIRQSYASHWRSRREGTEGMRIKFVMGRPRKRYEKA-IQLEMEA  494

Query  734  FRDIVILNCTENMNSGKTYTYFS------SLP----------------------------  657
            F DI++L+  ENMN+GKT+ +FS      ++P                            
Sbjct  495  FNDILLLDIDENMNNGKTHAFFSWAAENATVPDWEYPSHPRSDSNNANSGTGHGIEAAQG  554

Query  656  GILPS-------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHY  498
            G+L +       +  YV+KAD+D F+ L  L   L  +PR   Y+G+++          +
Sbjct  555  GMLQAPVWRGEKKPQYVVKADEDSFIMLGELERRLRVVPRMKTYWGYLVKN-------KF  607

Query  497  MSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKNRF--NNKPAMYDYP  324
            M+G  + LS+DLVE+IG S      T G EDKLV +W+ M  + +      ++  +YD+P
Sbjct  608  MAGECYALSFDLVEYIGASPGLKTLTRGKEDKLVAKWIGMHPQREEIVWSTDRCWIYDHP  667

Query  323  GTNGRCSHE-LIPETIAVHRLK  261
                  SH  L P T+   R++
Sbjct  668  KAGTVYSHGFLYPSTVEQVRVE  689



>gb|EJU02949.1| hypothetical protein DACRYDRAFT_115252 [Dacryopinax sp. DJM-731 
SS1]
Length=382

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/230 (29%), Positives = 111/230 (48%), Gaps = 15/230 (7%)
 Frame = -1

Query  923  DSHARFS--LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVA  750
            + +A F   L +G+FT   ++ +R  +R +  +QS    +V +KFIL      + ++   
Sbjct  125  EDNAEFGPMLFVGVFTIAAEHKQRAVIRALQTLQSPPSEQVVMKFILGRSPDASLQSMAE  184

Query  749  LEILRFRDIVILNCTENMNSGKTYTYF---SSLPGILPSRYDYVMKADDDVFLRLAPLAA  579
             E   + DIV L+  ENMN GKTY Y+   S LP  +  +  + +KAD D FL L  +  
Sbjct  185  TEAEMYGDIVFLDIQENMNEGKTYVYWKWVSKLP--VGQQPRFALKADSDTFLILPNVLH  242

Query  578  SLEGLP-RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDK  402
            SL  +P    +Y+G          +  Y  G+ + +SW L+ W+G++ +P   T G ED 
Sbjct  243  SLAPVPCSLPVYWGTSWGSCIETCYPLYCRGLSYGMSWPLISWLGQADLPQWATEGMEDA  302

Query  401  LVGQW---LDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVHRLK  261
              G W   L  G+++    +      D+ GT      ++    +A+H +K
Sbjct  303  RTGAWFGNLPQGEESLMLVDLYTHAGDWDGTTITYDTDI----VALHAMK  348



>emb|CCA73538.1| related to glycosyltransferase family 31 protein-Laccaria bicolor 
[Piriformospora indica DSM 11827]
Length=1007

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 114/261 (44%), Gaps = 65/261 (25%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTS-----LARVDVKFILCNLSGEAQRAFVALEIL  738
            + +G+F+     +RR F+R  +     S      +R  V+FIL     E +R  + LE  
Sbjct  560  VFLGVFSMDSGLERRMFVRTTFAAHERSRVDNGTSRTIVRFILGKPRPEWERR-IQLEAE  618

Query  737  RFRDIVILNCTENMNSGKTYTYFS-------------SLP-------GILPS--------  642
             + D+VIL   ENMN+GKT+ YFS              LP        I PS        
Sbjct  619  TYNDMVILPIAENMNNGKTHAYFSWAARHAWVPPPQTPLPFSYANQTKIPPSLAPHDPRP  678

Query  641  ---------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGF---VIPCPSMNPFVH-  501
                     R D+V+KADDD F+ LA L A L    R ++++G      P     P V  
Sbjct  679  LPNSPKEWVRPDFVLKADDDSFVMLAELEARL----RVEMHFGLNETRTPYYGTQPVVED  734

Query  500  ------------YMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN-  360
                        +M G  + LSW LV W+ +S      T G EDKLV +W+ +  +A N 
Sbjct  735  PLVYWGYLVKNKFMGGEMYALSWSLVSWVAQSEAVRGLTRGAEDKLVAKWMWLHPRAGNV  794

Query  359  RFNNKPA-MYDYPGTNGRCSH  300
            R+ ++   +YD+P      SH
Sbjct  795  RWKSEHCWIYDHPKAGTVYSH  815



>ref|XP_003320350.1| hypothetical protein PGTG_01262 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP75931.1| hypothetical protein PGTG_01262 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=996

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 114/257 (44%), Gaps = 56/257 (22%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--------ARVDVKFILCNLSGE  771
            ADS    ++ +G+F+    Y+RRH +R  Y   S  +          V +KFIL     +
Sbjct  190  ADSLDPVNVFVGVFSVDSAYERRHLIRSTYARHSRPIDPNTGQIAHNVQLKFILGRPRIQ  249

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLP----------------  657
              R  VALE+  + DIV+L+  ENMN GKTY +       +++P                
Sbjct  250  HVRR-VALEMETYNDIVVLDIQENMNRGKTYAFLNWASQNATIPVYFHPLHEPKPKTGVN  308

Query  656  ----------------GILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPC  525
                            G+   + D+++KADDD F+ L+ L   L   PR   Y+G++I  
Sbjct  309  GIGGVMSPDGMETINVGVGFKKADFIVKADDDSFIVLSELERHLRVAPRTMTYWGYLI--  366

Query  524  PSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAK--NRFN  351
               N F   M G  + LS DLV ++  S+   ++  G EDK V +W+ +   A   N   
Sbjct  367  --RNLF---MGGECYALSADLVRYVASSKKVLDHVTGAEDKKVAKWMRIHPNASQINWVT  421

Query  350  NKPAMYDYPGTNGRCSH  300
             +  +YD+P      +H
Sbjct  422  ERCWIYDHPKAGTTYAH  438



>emb|CCF52386.1| uncharacterized protein UHOR_03460 [Ustilago hordei]
Length=993

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/272 (27%), Positives = 116/272 (43%), Gaps = 68/272 (25%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            AD+ A   + +G+F+    Y+RRH +R  Y   +        T  + V VKFI+     +
Sbjct  380  ADALAPVDVFVGVFSIDSAYERRHLIRSTYATHTLPVDPNTGTPTSNVQVKFIIGKPR-Q  438

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLP----------------  657
            A    VALE+  F D+V+L+  ENMN GKT+ +F      +++P                
Sbjct  439  AHARRVALEMETFNDLVVLDMDENMNRGKTHAFFRWAAENATVPFLRAVEDDQQQAGSAS  498

Query  656  ----------------------------GILPSRYDYVMKADDDVFLRLAPLAASLEGLP  561
                                         +L  + DYV+KADDD +L L  L   L   P
Sbjct  499  LGQRGLHGNGHGQTREVLGGSSDQAQRYQVLWKKADYVVKADDDAYLVLKELERHLRVAP  558

Query  560  RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLD  381
            R+  Y+G++I          +M G  + LS DLV+++  S    +   G EDK V QW++
Sbjct  559  RQMTYWGYLIRN-------WFMGGECYALSNDLVQYVAHSENVLHYVKGKEDKKVAQWIN  611

Query  380  M--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            +   +   +  +    +YD+P      SH  +
Sbjct  612  LHPNRSDIHWVSEHCWIYDHPKAGTAYSHGFL  643



>gb|KDE02934.1| hypothetical protein MVLG_06558 [Microbotryum violaceum p1A1 
Lamole]
Length=1105

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 112/230 (49%), Gaps = 39/230 (17%)
 Frame = -1

Query  923  DSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--------ARVDVKFILCNLSGE-  771
            DS    S+ +GIF+     DRR+ +R      +  +          V VKFIL     + 
Sbjct  404  DSLKPVSVFVGIFSVSAAADRRNIIRQTSARLTKPIDPRTGGPSTDVQVKFILGRPPKKW  463

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLP-------------GIL  648
            A+R  +ALE+  + D+V+L+  ENMN GKT+ YF      +++P             G+ 
Sbjct  464  AKR--IALEMEMYNDVVVLDIDENMNRGKTWKYFEWAAENATVPVYYRTGKGSKTQIGVG  521

Query  647  PSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSW  468
              + DYV K+DDD F+ L+ L   L   PR   Y+G++I     N F   M+G  + +S 
Sbjct  522  FKKVDYVAKSDDDAFINLSELERHLRVSPREKTYWGYLI----RNLF---MAGELYAVSQ  574

Query  467  DLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAK--NRFNNKPAMYDYP  324
            DLV+++        +T+G ED+   +W+ M   A   N  + +  +YD+P
Sbjct  575  DLVQYVATYAPIRQHTFGAEDQRFAKWMRMHPNASTINWVSERVWIYDFP  624



>gb|KDQ14510.1| glycosyltransferase family 31 protein [Botryobasidium botryosum 
FD-172 SS1]
Length=527

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 111/250 (44%), Gaps = 46/250 (18%)
 Frame = -1

Query  923  DSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAF  756
            DS    SL + IF+    Y+RR  +R  Y     S      R  V+FI+     E +R  
Sbjct  140  DSIQPVSLFVAIFSMDSGYERRMMIRNSYASSPMSRIPGTERTVVRFIIGQPRKEWERR-  198

Query  755  VALEILRFRDIVILNCTENMNSGKTYTYF-------------------SSLPGILP----  645
            V +E+  + DIV+L   ENMN GKTY ++                    +L  I+P    
Sbjct  199  VGIEMDLYNDIVVLPIAENMNDGKTYHFYLWAYSHAFVPPPPNSSLSPGALETIVPLAPH  258

Query  644  ----------SRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYM  495
                       + DY++KAD+D F+ L  L A L    R   Y+GF++          +M
Sbjct  259  DPQGSRGVGWVKPDYIVKADEDSFIMLGELEARLRTTRREMTYWGFIVRKE------RFM  312

Query  494  SGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN--RFNNKPAMYDYPG  321
            +G  + LS+DLV +I  ++       G ED++   W+    +A+    ++ +  +YDYP 
Sbjct  313  AGESYALSFDLVRYIATTKRLRTMIKGAEDQMTALWMKSHPRAEEIRWWDERCWIYDYPK  372

Query  320  TNGRCSHELI  291
            +    SH L+
Sbjct  373  SGTIFSHGLL  382



>gb|KDN48861.1| glycosyltransferase family 31 protein [Tilletiaria anomala UBC 
951]
Length=1172

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 76/264 (29%), Positives = 116/264 (44%), Gaps = 60/264 (23%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSL--------ARVDVKFILCNLSGE  771
            AD  A   + +G+F+     +RR  +R  Y   +  L        A V VKFIL      
Sbjct  682  ADKLAPVDVFVGVFSMDANSERRSAIRHTYAAHTLPLSPHDGQPMANVQVKFILGRPRAR  741

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLPGIL--PSRY-------  636
               A VALE   + D+V+LN  ENMN GKT+ +F      +++P +L  P+         
Sbjct  742  YAHA-VALEQEMYNDVVLLNTDENMNHGKTFEFFRWASENATIPIVLGPPASPAWSSQSP  800

Query  635  ---------------------------DYVMKADDDVFLRLAPLAASLEGLPRRDLYYGF  537
                                       DYV+KAD+D F+ L+ L   L  +PR   Y+G+
Sbjct  801  SSSSSKEQVPENGGLEVGSRKVRWKMADYVVKADEDAFIVLSELERHLRIIPRTKTYWGY  860

Query  536  VIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN-  360
            +I          +M+G  + LS DLV+WI  S+  A+ + G EDK V + L    +A   
Sbjct  861  LI-------ADKFMAGECYALSQDLVQWISHSQRAASLSVGKEDKQVAKMLLQHPEAATI  913

Query  359  RFNNKPA-MYDYPGTNGRCSHELI  291
             + ++   +YD+P      SH  +
Sbjct  914  HYKSQHCWIYDHPKAGTAYSHGFL  937



>ref|XP_007005335.1| hypothetical protein TREMEDRAFT_39553 [Tremella mesenterica DSM 
1558]
 gb|EIW68641.1| hypothetical protein TREMEDRAFT_39553 [Tremella mesenterica DSM 
1558]
Length=532

 Score = 89.0 bits (219),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 116/262 (44%), Gaps = 57/262 (22%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGI----QSTSLARVDVKFILCNLSGEAQRAFVALEILR  735
            +L+G+FT      RRH +R  +      +S     V V+F++         A V LE+  
Sbjct  105  VLVGVFTTDAGTARRHMIRQSWASHWRSRSEGTEGVRVRFVMARPRPRYAHA-VQLEMEA  163

Query  734  FRDIVILNCTENMNSGKTYTYFS------SLPG---------------------------  654
            F DI+ L+  E MNSGKTY +FS      ++P                            
Sbjct  164  FNDIIFLDMPEKMNSGKTYAFFSWAAENATVPDWEYPTLSQKRIEGQVGTNGQDIPEGTE  223

Query  653  ILPS-------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYM  495
              PS       R DYV+KAD+D F+ L  L   L   PR   Y+G+++     N F   M
Sbjct  224  AAPSPIWRGERRPDYVIKADEDSFIMLGELERRLRAAPRSKAYWGYLV----KNLF---M  276

Query  494  SGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM--GKKAKNRFNNKPAMYDYPG  321
             G  + LS+DLV++I  S      TYG EDKLV +W+ M   ++       +  +YD+P 
Sbjct  277  GGECYGLSFDLVQYIASSPALRTLTYGKEDKLVSKWIRMHPAREEIVWVAERCWIYDHPK  336

Query  320  TNGRCSHE-LIPETIAVHRLKK  258
                 +H  L P  +A  R++K
Sbjct  337  APTVYAHGFLFPSEVA--RVRK  356



>ref|XP_007001966.1| hypothetical protein TREMEDRAFT_67449 [Tremella mesenterica DSM 
1558]
 gb|EIW73606.1| hypothetical protein TREMEDRAFT_67449 [Tremella mesenterica DSM 
1558]
Length=421

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 117/260 (45%), Gaps = 35/260 (13%)
 Frame = -1

Query  923  DSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCN------------L  780
            D      + +GIF+  +K +RR   R +  I       V +KFIL              +
Sbjct  124  DEERGVMVFLGIFSAVDKRERRDLYRKVI-IPDFPPELVTIKFILGTPAIPENPVGPEAI  182

Query  779  SGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFS------SLPGILPSRYDYVMKA  618
            +  A    V  E+    D+V+L+  +N++ GKT+ YF       S PG +  R  ++MKA
Sbjct  183  ARSAALLRVKQEMKDHNDMVMLDMIDNIDLGKTHEYFKWVAKTYSGPGRVKGRPRFIMKA  242

Query  617  DDDVFLRLAPLAASLEGLP-RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRS  441
            DDD  L +  + ++ + L   R++Y+G          F  Y  G+ + +SW LV WIG +
Sbjct  243  DDDTILVMPNVISAFKDLDCSRNIYWG--TSAGRSQYFHEYFRGLAYAMSWPLVSWIGNA  300

Query  440  RIPANNTYGPEDKLVGQW---LDMGKKAKNRFNNKPAMYDYPGTNGRCSHELIPETIAVH  270
             +P  +T   ED   GQW   LD      +R +    M D+         ++  ET+A+H
Sbjct  301  DMPPAHTIKIEDARTGQWLRHLDPVTDPIHRIDMGWTMGDW------NQLDVTAETVALH  354

Query  269  --RLKKW--EQWVHVLKFFN  222
              +L  W  EQ   +LK + 
Sbjct  355  WCKLDDWVKEQHARLLKIWE  374



>dbj|GAC72181.1| galactosyltransferases [Pseudozyma antarctica T-34]
Length=996

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/277 (28%), Positives = 118/277 (43%), Gaps = 73/277 (26%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            AD+ A   + +G+F+    Y+RRH +R  Y   +        T  + V VKFI+     +
Sbjct  375  ADALAPVDVFVGVFSIDSAYERRHLIRSTYATHTMPLDPHTGTPTSNVQVKFIIGKPR-Q  433

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLP-------GILPS----  642
            A    VALE+  F DIV+L+  ENMN GKT+ +F      +++P       G  P+    
Sbjct  434  AHARRVALEMETFNDIVVLDMEENMNRGKTHAFFRWAAENATVPFLRAVEDGQNPASGLA  493

Query  641  -------------------------------RYDYVMK-------ADDDVFLRLAPLAAS  576
                                           RY  + K       ADDD FL L  L   
Sbjct  494  QGSVLLSEPESRGQGHGQTREVLGGSTEQMHRYQVLWKKADYVVKADDDAFLILEELERH  553

Query  575  LEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLV  396
            L   PR+  Y+G++I     N F   M G  + LS DLV+++ +S    +   G EDK V
Sbjct  554  LRVAPRQMTYWGYLI----RNWF---MGGECYALSNDLVQYVAKSENVLHYIKGKEDKKV  606

Query  395  GQWLDM--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
             QW+++   + + +  +    +YD+P      SH  +
Sbjct  607  AQWINLHPNRSSIHWVSEHCWIYDHPKAGTAYSHGFL  643



>ref|XP_002439014.1| hypothetical protein SORBIDRAFT_10g029970 [Sorghum bicolor]
 gb|EER90381.1| hypothetical protein SORBIDRAFT_10g029970 [Sorghum bicolor]
Length=162

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 70/134 (52%), Gaps = 26/134 (19%)
 Frame = -1

Query  845  LIYGIQSTSL-------ARVDVKFILCNLSGEAQRAFVALEILRFRDIVILN-CTENMNS  690
            ++YG Q  S          VD++F  C              IL   D+++L+ C EN+N 
Sbjct  1    MVYGRQLASQEDPLATHVHVDIRFNWCRS-----------RILTHDDVIVLDGCEENLND  49

Query  689  GKTYTYFSSLPGI-LPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMN  513
            GKTY + S++  + +   YDYVM ADDD+FL L  L ASL G+PR D+YYG      SM+
Sbjct  50   GKTYRFLSTVARLYVDEPYDYVMNADDDIFLWLPQLVASLGGMPRDDMYYG------SMD  103

Query  512  PFVHYMSGMGFVLS  471
            P   YM G    LS
Sbjct  104  PLREYMDGRWIDLS  117



>gb|ETS59647.1| hypothetical protein PaG_06574 [Pseudozyma aphidis DSM 70725]
Length=996

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 77/277 (28%), Positives = 117/277 (42%), Gaps = 73/277 (26%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            AD+ A   + +G+F+    Y+RRH +R  Y   +        T  + V VKFI+      
Sbjct  375  ADALAPVDVFVGVFSIDSAYERRHLIRSTYATHTMPLDPHTGTPTSNVQVKFIIGKPRQT  434

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLP-------GILPS----  642
              R  VALE+  F DIV+L+  ENMN GKT+ +F      +++P       G  P+    
Sbjct  435  HARR-VALEMETFNDIVVLDMEENMNRGKTHAFFRWAAENATVPFLRAVEDGQNPASGLA  493

Query  641  -------------------------------RYDYVMK-------ADDDVFLRLAPLAAS  576
                                           RY  + K       ADDD FL L  L   
Sbjct  494  QGSVLLSEPESRGQGHGQTREVLGGSTEQMHRYQVLWKKADYVVKADDDAFLILEELERH  553

Query  575  LEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLV  396
            L   PR+  Y+G++I     N F   M G  + LS DLV+++ +S    +   G EDK V
Sbjct  554  LRVAPRQMTYWGYLI----RNWF---MGGECYALSNDLVQYVAKSENVLHYIKGKEDKKV  606

Query  395  GQWLDM--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
             QW+++   + + +  +    +YD+P      SH  +
Sbjct  607  AQWINLHPNRSSIHWVSEHCWIYDHPKAGTAYSHGFL  643



>gb|EJU02954.1| hypothetical protein DACRYDRAFT_14925 [Dacryopinax sp. DJM-731 
SS1]
Length=434

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 118/248 (48%), Gaps = 15/248 (6%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLI--YGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFR  729
            LLI +F+  + +++R  +R++   G+     ++V  +F++   + +     + LEI R+ 
Sbjct  168  LLIAVFSTAKGWEKRDLIRVLGRQGLGPAIASQVLFRFVVGRTNDKESEDRLQLEIQRYG  227

Query  728  DIVILNCTENMNSGKTYTYFSSLPGILPS--RYDYVMKADDDVFLRLAPLAASLEGLP-R  558
            DI+ L   ENM+ GKTY +   + G  P   R  + MK DDD FL L  L + +  L   
Sbjct  228  DILQLEFPENMDEGKTYQFLRWV-GERPESERPRFAMKTDDDTFLVLPNLLSVISSLDCS  286

Query  557  RDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDM  378
            +++Y+G        + +  YM GM + LSW L+ W+  + +  ++    ED   G W  +
Sbjct  287  QNIYFGTSWGACITDCYPFYMRGMAYGLSWPLIRWLTTASLSFDDYRSTEDARTGSWF-L  345

Query  377  GKKAKNRF---NNKPAMYDYPGTNGRCSHELIPETIAVHRLKKWEQWVHV-LKFFNVTTE  210
               A  +    + +  + D+ G     S  +   T+A+H +K    W  V L+  +   +
Sbjct  346  SLPATEKMYVVDLERRLGDWDG----ISIPVNSGTVALHAMKSNWLWAKVGLQLMDTWEK  401

Query  209  LEHSKMYH  186
             E   MY+
Sbjct  402  EEKEYMYN  409



>emb|CDI53158.1| glycosyltransferase family 31 protein [Melanopsichium pennsylvanicum 
4]
Length=969

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 73/273 (27%), Positives = 115/273 (42%), Gaps = 69/273 (25%)
 Frame = -1

Query  926  ADSHARFSLLIGIFTRPEKYDRRHFLRLIYGIQS--------TSLARVDVKFILCNLSGE  771
            AD+ A   + +G+F+    Y+RR  +R  Y   +        T  + V VKFI+     +
Sbjct  363  ADALAPVDVFVGVFSIDSAYERRQLIRSTYATHTMPVDPLSGTPSSNVQVKFIIGKPR-Q  421

Query  770  AQRAFVALEILRFRDIVILNCTENMNSGKTYTYF------SSLP----------------  657
            A    VALE+  F D+V+L+  ENMN GKT+ +F      +++P                
Sbjct  422  AHARRVALEMEMFNDVVVLDMEENMNRGKTHAFFRWAAENATVPFLRAFDDEQQQHLGST  481

Query  656  ----------------GILPSRYDYV-------------MKADDDVFLRLAPLAASLEGL  564
                             +L    D V             +KADDD ++ L  L   L   
Sbjct  482  QLSERGWHGNRHGQTREVLGGSADQVRRYEVLWKKADYVVKADDDAYIILEELERHLRVA  541

Query  563  PRRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
            PR+  Y+G++I     N F   M G  + LS DLV++I  S    +   G EDK V QW+
Sbjct  542  PRQMTYWGYLI----RNWF---MGGECYALSNDLVQYIAHSETVQHYVKGKEDKKVAQWI  594

Query  383  DM--GKKAKNRFNNKPAMYDYPGTNGRCSHELI  291
            ++   +   +  + +  +YD+P      SH  +
Sbjct  595  NLHPNRSDIHWVSERCWIYDHPKAGTAYSHGFL  627



>gb|EUC67779.1| glycosyltransferase family 31 protein, partial [Rhizoctonia solani 
AG-3 Rhs1AP]
Length=492

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 116/271 (43%), Gaps = 64/271 (24%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVD------------VKFILCNLSGEAQRA  759
            L IG+ +    + RR  +R  +     S + VD            V+FI+   S  A+R 
Sbjct  85   LFIGVMSTARGFQRRQLVRSTWASHPKSRSGVDGKSGREGTSRTVVRFIVGAPSPSAERK  144

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFS-------------------------SLPG  654
             + LE   + DIVI+   ENMN GKTY YFS                           P 
Sbjct  145  -LGLENELYGDIVIVPIRENMNEGKTYAYFSWAYEHALVPPPHHTSSNVNVTDTQTMFPR  203

Query  653  ILPS--------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVH-  501
              PS        + D+V+KADDD F+ LA L A L     R  +Y  +   P+ +P V+ 
Sbjct  204  HDPSSRTFSDWVKPDFVIKADDDSFVMLAELEARL-----RIEHYKALTEAPTWDPLVYW  258

Query  500  -------YMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN-RFNNK  345
                   +M G  + LSW L+ ++  S+     T G ED+ V +W+     A   R+ ++
Sbjct  259  GYLIKDYFMGGELYALSWPLISFVATSKAVKAMTIGYEDQQVAKWIGTHPHASRVRWASE  318

Query  344  PA-MYDYPGTNGRCSHE-LIPETIAVHRLKK  258
               +Y++P +    +H  L P    V R+KK
Sbjct  319  RCWIYNHPKSTNVYAHGFLFPS--EVQRVKK  347



>gb|EUC67594.1| glycosyltransferase family 31 protein, putative [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=534

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 116/271 (43%), Gaps = 64/271 (24%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVD------------VKFILCNLSGEAQRA  759
            L IG+ +    + RR  +R  +     S + VD            V+FI+   S  A+R 
Sbjct  127  LFIGVMSTARGFQRRQLVRSTWASHPKSRSGVDGKSGREGTSRTVVRFIVGAPSPSAERK  186

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFS-------------------------SLPG  654
             + LE   + DIVI+   ENMN GKTY YFS                           P 
Sbjct  187  -LGLENELYGDIVIVPIRENMNEGKTYAYFSWAYEHALVPPPHHTSSNVNVTDTQTMFPR  245

Query  653  ILPS--------RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVH-  501
              PS        + D+V+KADDD F+ LA L A L     R  +Y  +   P+ +P V+ 
Sbjct  246  HDPSSRTFSDWVKPDFVIKADDDSFVMLAELEARL-----RIEHYKALTEAPTWDPLVYW  300

Query  500  -------YMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN-RFNNK  345
                   +M G  + LSW L+ ++  S+     T G ED+ V +W+     A   R+ ++
Sbjct  301  GYLIKDYFMGGELYALSWPLISFVATSKAVKAMTIGYEDQQVAKWIGTHPHASRVRWASE  360

Query  344  PA-MYDYPGTNGRCSHE-LIPETIAVHRLKK  258
               +Y++P +    +H  L P    V R+KK
Sbjct  361  RCWIYNHPKSTNVYAHGFLFPS--EVQRVKK  389



>gb|KEP54494.1| putative glycosyltransferase family 31 protein [Rhizoctonia solani 
123E]
Length=534

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 117/271 (43%), Gaps = 64/271 (24%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVD------------VKFILCNLSGEAQRA  759
            L IG+ +    + RR  +R  +     S + VD            V+FI+   S  A+R 
Sbjct  127  LFIGVMSTARGFQRRQLVRSTWASHPKSRSGVDGKSGREGTSRTVVRFIVGAPSPSAERK  186

Query  758  FVALEILRFRDIVILNCTENMNSGKTYTYFS--SLPGILPSRY-----------------  636
             + LE   + DIVI+   ENMN GKTY YFS  +   ++P  +                 
Sbjct  187  -LGLENELYGDIVIVPIRENMNEGKTYAYFSWATKHALVPPPHHTSSNNNVTDTQAMFPR  245

Query  635  --------------DYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVH-  501
                          D+V+KADDD F+ LA L A L     R  +Y  +   P+ +P V+ 
Sbjct  246  HDPASRTFSDWVKPDFVIKADDDSFVMLAELEARL-----RIEHYKALTEAPTWDPLVYW  300

Query  500  -------YMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN-RFNNK  345
                   +M G  + LSW LV ++  S+     T G ED+ V +W+     A   R+ ++
Sbjct  301  GYLIKDYFMGGELYALSWPLVSFVAMSKAVKAMTIGYEDQQVAKWIGTHPHASRVRWASE  360

Query  344  PA-MYDYPGTNGRCSHE-LIPETIAVHRLKK  258
               +Y++P +    +H  L P    V R+KK
Sbjct  361  RCWIYNHPKSTNVYAHGFLFPS--EVQRVKK  389



>gb|EUC55697.1| sugar porter (SP) family MFS transporter [Rhizoctonia solani 
AG-3 Rhs1AP]
Length=993

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 100/232 (43%), Gaps = 43/232 (19%)
 Frame = -1

Query  914  ARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVAL  747
            A   + +G+ T    Y+RR  +R  Y     S      R  V+FI+   +G   ++ + +
Sbjct  625  APVGVFLGVLTIASGYERRMMIRESYAAHPASRIPGTERTIVRFIMGLPTGPDVQS-IQI  683

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSL--------PGILPS-----------------  642
            E   + DI++L   ENMN GK++ YF           P  LP                  
Sbjct  684  ENDIYNDIIVLPIKENMNDGKSFRYFEWAYHHALVPPPAGLPELNNRTVVLAPHDPTTTN  743

Query  641  ----RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVL  474
                + DYV+K DDD F+ L  + A L   PR   Y+G+V+          +M G  + L
Sbjct  744  RGWVQPDYVLKVDDDSFVMLGEIEARLRVTPRSLTYWGYVVKK-------KFMGGESYAL  796

Query  473  SWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN--RFNNKPAMYDYP  324
            S+DLV+++  S        G ED++  +W+    +A     +  +  +YD+P
Sbjct  797  SFDLVQYVATSTHVRAQIRGEEDQVTARWMKAHPRASEIVWWGERCWVYDHP  848



>gb|KEP54846.1| sugar porter (SP) family MFS transporter [Rhizoctonia solani 
123E]
Length=993

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 100/232 (43%), Gaps = 43/232 (19%)
 Frame = -1

Query  914  ARFSLLIGIFTRPEKYDRRHFLRLIYGIQSTS----LARVDVKFILCNLSGEAQRAFVAL  747
            A   + +G+ T    Y+RR  +R  Y     S      R  V+FI+   +G   ++ + +
Sbjct  625  APVGVFLGVLTIASGYERRMMIRESYAAHPASRIPGTERTIVRFIMGLPTGPDVQS-IQI  683

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSL--------PGILPS-----------------  642
            E   + DI++L   ENMN GK++ YF           P  LP                  
Sbjct  684  ENDIYNDIIVLPIKENMNDGKSFRYFEWAYHHALVPPPAGLPELNNRTVVLAPHDPTTTS  743

Query  641  ----RYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVL  474
                + DYV+K DDD F+ L  + A L   PR   Y+G+V+          +M G  + L
Sbjct  744  RGWVQPDYVLKVDDDSFVMLGEIEARLRVTPRSLTYWGYVVKK-------KFMGGESYAL  796

Query  473  SWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN--RFNNKPAMYDYP  324
            S+DLV+++  S        G ED++  +W+    +A     +  +  +YD+P
Sbjct  797  SFDLVQYVATSTHVRAQIRGEEDQVTARWMKAHPRASEIVWWGERCWVYDHP  848



>gb|EJT49571.1| hypothetical protein A1Q1_01286 [Trichosporon asahii var. asahii 
CBS 2479]
Length=411

 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 84/160 (53%), Gaps = 19/160 (12%)
 Frame = -1

Query  812  RVDVKFILCNLSG-----EAQRAFVALEILR-----FRDIVILNCTENMNSGKTYTYFSS  663
             V++KFIL +        ++ +    L+ L+      +D+VIL+  +N++ GKT+ YF  
Sbjct  139  EVEIKFILAHPPAVKYPLDSLKRLKILDGLKQEAEEHKDMVILDIDDNIDFGKTFEYFKW  198

Query  662  LP------GILPSRYDYVMKADDDVFLRLAPLAASLEGLP-RRDLYYGFVIPCPSMNPFV  504
            +       G +  R  +VMKADDD +L +  +  +L+ L  ++++Y+G      S   F 
Sbjct  199  VAQHYAGDGQVRGRPRFVMKADDDTYLVMPNVVRTLQSLNCKKNVYWG--TSAGSSGHFR  256

Query  503  HYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL  384
             Y  G+G+ LSW LV WIG + +P  +    ED   GQWL
Sbjct  257  QYFRGLGYGLSWPLVSWIGSADLPYAHKIKIEDARTGQWL  296



>ref|XP_007861573.1| hypothetical protein GLOTRDRAFT_124407 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ61395.1| hypothetical protein GLOTRDRAFT_124407 [Gloeophyllum trabeum 
ATCC 11539]
Length=764

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 118/308 (38%), Gaps = 98/308 (32%)
 Frame = -1

Query  923  DSHARFSLLIGIFTRPEKYDRRHFLR------------LIYGIQSTSLARVDVKFILCNL  780
            DS     + +G+F+    ++RR  +R             I G      +R  V+FIL   
Sbjct  262  DSLPPAGIFLGVFSLDSSFERRMLVRSTWASHPRSREGAIDGDGGNGTSRTIVRFILGQP  321

Query  779  SGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYF-----------------------  669
                +R  + LE+  + DIVIL   ENMNSGKT+ +F                       
Sbjct  322  KKSLERR-IRLEMETYNDIVILPIAENMNSGKTHAFFTWASNYAYVPPVYFETSTPPPEF  380

Query  668  -----SSLPGIL----------------PSRY---DYVMKADDDVFLRLAPLAASLE---  570
                 SS+P  +                P R+   D+++K DDD F+ LA L A L    
Sbjct  381  SYSNSSSVPPPVAKHDPSHARQDVLSRRPKRWVRPDFIVKTDDDSFVMLAELEARLRVEL  440

Query  569  --------------GLPRRDLYYGFVIPCPSM-----------NPFVH--------YMSG  489
                            PR +     V   PS            +P ++        +M+G
Sbjct  441  HAKSPPANATDTNPHSPRAETSTTAVSASPSQVVSAPDPASVNDPLIYWGYLVKRRFMAG  500

Query  488  MGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAKN-RFNNKPA-MYDYPGTN  315
              + LSW LV+WI R  +    T G EDK   +W+DM  +A   R+ ++   +YD+P   
Sbjct  501  ELYALSWSLVDWIARDPVIRTMTRGAEDKQTAKWMDMHPRADQVRWKDERCWIYDHPRAG  560

Query  314  GRCSHELI  291
               SH  +
Sbjct  561  TVYSHGFL  568



>ref|XP_007418137.1| family 31 glycosyltransferase [Melampsora larici-populina 98AG31]
 ref|XP_007418783.1| family 31 glycosyltransferase [Melampsora larici-populina 98AG31]
 gb|EGF97964.1| family 31 glycosyltransferase [Melampsora larici-populina 98AG31]
 gb|EGF98589.1| family 31 glycosyltransferase [Melampsora larici-populina 98AG31]
Length=502

 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 115/267 (43%), Gaps = 52/267 (19%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQ---------STSLARVDVKFILCNLSGEAQRAFVA  750
            L IGIFT P++Y +R+ +R +             +     +D+ FI      E     + 
Sbjct  224  LFIGIFTTPDRYSKRNLIRTLLKADLPPSSSSSSNHQAPIIDLVFISGKPKNEYWNYLIE  283

Query  749  LEILRF-RDIVILNCTE--NMNSGKTYTYFSSL------------------------PGI  651
             E  R+  D+++L   E  N++ GKTY +F  +                        P I
Sbjct  284  EENKRYGNDVIVLENLEKDNIDLGKTYEFFRWVSMGANGRWKMDRVLDREIGLENRDPRI  343

Query  650  LP-SRYDYVMKADDDVFLRLAPLAASLEGLP-RRDLYYGFVIPCPSMNP-FVHYMSGMGF  480
                R  +VMK+DDD FL +  L    + L    ++Y+G        NP F  Y  G+ +
Sbjct  344  KEIGRPQFVMKSDDDTFLVIPNLIKEFQNLDCGSNIYWG---TSQGSNPLFPAYFRGLAY  400

Query  479  VLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL-DMGKKAKN--RFNNKPAMYDYPGTNGR  309
             LSW LVEWIG S +   +  G ED  VG WL D+  +     R +    M D+      
Sbjct  401  ALSWPLVEWIGTSNMSYESQVGIEDARVGAWLSDLDDRVDRLMRIDLGWRMGDW------  454

Query  308  CSHELIPETIAVHRLKKWEQWVHVLKF  228
               E+  +T+A+H LK  E W  ++KF
Sbjct  455  NQLEIDSDTVALHWLKSIE-WFPMVKF  480



>ref|XP_003319691.2| hypothetical protein PGTG_01865 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP75272.2| hypothetical protein PGTG_01865 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=528

 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 112/273 (41%), Gaps = 64/273 (23%)
 Frame = -1

Query  902  LLIGIFTRPEKYDRRHFLRLIYGIQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDI  723
            L +GIFT P  +++R+ +R +        A +++KFI      E     +  E     D+
Sbjct  238  LFLGIFTTPSGFEKRNLIRTLVKADLPPNALIELKFISGEPKNENWMELIKAEQALHHDL  297

Query  722  VIL-NCTENMNSGKTYTYFS----------------------SLP---------------  657
            VI+ +  +N++ GKTY +F                       SLP               
Sbjct  298  VIIKDLEDNIDLGKTYQFFKWISQREKRRQDLHLHHQLPSTDSLPESERVRDQLGLNGWP  357

Query  656  --------------GILPSRYDYVMKADDDVFLRLAPLAASLEGLP-RRDLYYGFVIPCP  522
                           ++  +  +V+K+DDD FL +  L  + + L  +++ Y+G      
Sbjct  358  EHSLDSSIDDRDPRKVVYGKPKFVIKSDDDTFLVIPNLLKAFKDLDCQKNFYWGTSQGSS  417

Query  521  SMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPEDKLVGQWL-DMGKKAKN--RFN  351
             +  F  Y  G+G+ LSW LVEWIG S +   +  G ED  VG WL D+   A    R N
Sbjct  418  KL--FDPYFRGLGYGLSWPLVEWIGTSNMSLKSQVGIEDARVGAWLTDLDPVADPLVRIN  475

Query  350  NKPAMYDYPGTNGRCSHELIPETIAVHRLKKWE  252
                M D+         E+  E IA+H LK  E
Sbjct  476  EGWKMADWNQV------EIDKEVIALHWLKNTE  502



>gb|EKC98224.1| hypothetical protein A1Q2_07478 [Trichosporon asahii var. asahii 
CBS 8904]
Length=463

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 9/128 (7%)
 Frame = -1

Query  746  EILRFRDIVILNCTENMNSGKTYTYFSSLP------GILPSRYDYVMKADDDVFLRLAPL  585
            E    +D+VIL+  +N++ GKT+ +F  +       G +  R  +VMKADDD +L +  +
Sbjct  171  EAEEHKDMVILDIDDNIDFGKTFEFFKWVAQHYAGDGQVRGRPRFVMKADDDTYLVMPNV  230

Query  584  AASLEGLP-RRDLYYGFVIPCPSMNPFVHYMSGMGFVLSWDLVEWIGRSRIPANNTYGPE  408
              +L+ L  ++++Y+G      S   F  Y  G+G+ LSW LV WIG + +P  +    E
Sbjct  231  VRTLQSLNCKKNVYWG--TSAGSSGHFRQYFRGLGYGLSWPLVSWIGSADLPYAHKIKIE  288

Query  407  DKLVGQWL  384
            D   GQWL
Sbjct  289  DARTGQWL  296



>ref|XP_006960529.1| hypothetical protein WALSEDRAFT_61473 [Wallemia sebi CBS 633.66]
 gb|EIM19379.1| hypothetical protein WALSEDRAFT_61473 [Wallemia sebi CBS 633.66]
Length=511

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 87/183 (48%), Gaps = 21/183 (11%)
 Frame = -1

Query  833  IQSTSLARVDVKFILCNLSGEAQRAFVALEILRFRDIVILNCTENMNSGKTYTYFSSLPG  654
            IQ  +    DVK  L NL  E QR +        RD   +N   N +  +  + +    G
Sbjct  168  IQQPNEDGFDVK--LDNLRKEYQRGYQ-------RDHHDIN---NDDPSQHISNYVPGTG  215

Query  653  ILPSRYDYVMKADDDVFLRLAPLAASLEGLPRRDLYYGFVIPCPSMNPFVHYMSGMGFVL  474
            +   R D+V+KADDD F+ L  L   L  LP++ +Y+G++I          +M G  + L
Sbjct  216  VKYKRPDFVVKADDDSFIILGELERHLRILPKKLVYWGYLIKN-------RFMGGQAYAL  268

Query  473  SWDLVEWIGRSRIPANNTYGPEDKLVGQWLDMGKKAK--NRFNNKPAMYDYPGTNGRCSH  300
            S+DLVEWI  +     +  G ED L  +W+    KA   N  + +  +Y++P T+   SH
Sbjct  269  SFDLVEWIASNNFTRGHQIGAEDNLTARWMKHHPKANEINWVSERCWIYNHPRTHTVYSH  328

Query  299  ELI  291
              +
Sbjct  329  GFL  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2845066247358