BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33300_g1_i1 len=505 path=[1:0-504]

Length=505
                                                                      Score     E

gb|AAK71505.2|  soluble acid invertase Ib2FRUCT3                        316   4e-101   Ipomoea batatas [batate]
ref|NP_001234618.1|  acid beta-fructofuranosidase precursor             306   1e-98    
gb|ABX55832.1|  soluble acid invertase                                  308   2e-98    Cucumis melo [Oriental melon]
prf||1905419A  invertase                                                308   2e-98 
sp|P29000.1|INVA_SOLLC  RecName: Full=Acid beta-fructofuranosidas...    308   3e-98    Solanum lycopersicum
gb|ADE44160.1|  acid invertase                                          308   3e-98    
ref|NP_001274993.1|  beta-fructosidase                                  308   5e-98    
gb|AEV46296.1|  vacuolar invertase                                      307   6e-98    
gb|ADM47340.1|  vacuolar invertase                                      306   2e-97    
gb|AEV46294.1|  vacuolar invertase                                      306   2e-97    
gb|AAA50305.1|  beta-fructosidase                                       306   2e-97    Solanum tuberosum [potatoes]
gb|ACC93584.1|  beta-fructofuranosidase                                 306   2e-97    Solanum tuberosum [potatoes]
gb|ABF18956.1|  acid invertase                                          306   2e-97    Solanum tuberosum [potatoes]
gb|ACC93585.1|  beta-fructofuranosidase                                 306   2e-97    Solanum tuberosum [potatoes]
gb|AEV46287.1|  vacuolar invertase                                      305   3e-97    
gb|AEV46289.1|  vacuolar invertase                                      305   3e-97    
ref|NP_001234843.1|  acid invertase                                     305   6e-97    
gb|AAQ17074.1|  acid invertase                                          303   3e-96    Solanum tuberosum [potatoes]
gb|AAL75450.1|AF465613_1  minor allergen beta-fructofuranosidase ...    303   4e-96    Solanum lycopersicum
emb|CAA49831.1|  beta-fructofuranosidase                                303   4e-96    Solanum tuberosum [potatoes]
ref|XP_009794076.1|  PREDICTED: acid beta-fructofuranosidase AIV-18     301   1e-95    
dbj|BAM74659.1|  acid invertase                                         286   2e-95    
ref|XP_009619840.1|  PREDICTED: acid beta-fructofuranosidase AIV-...    298   3e-94    
sp|P93761.1|INV1_CAPAN  RecName: Full=Acid beta-fructofuranosidas...    298   3e-94    Capsicum annuum
gb|AAK71504.1|  soluble acid invertase FRUCT2                           295   9e-93    Ipomoea batatas [batate]
gb|KDO65460.1|  hypothetical protein CISIN_1g006523mg                   287   2e-91    
gb|KDO65465.1|  hypothetical protein CISIN_1g006523mg                   285   3e-91    
gb|KDO65463.1|  hypothetical protein CISIN_1g006523mg                   287   6e-91    
gb|KDO65464.1|  hypothetical protein CISIN_1g006523mg                   285   7e-91    
gb|KDO65462.1|  hypothetical protein CISIN_1g006523mg                   287   9e-91    
emb|CDP05324.1|  unnamed protein product                                286   1e-90    
gb|AFU35318.1|  soluble acid beta-fructofuranosidase                    276   1e-90    
gb|ABI17894.1|  vacuolar invertase                                      286   2e-90    Coffea canephora [robusta coffee]
gb|KDO65459.1|  hypothetical protein CISIN_1g006523mg                   288   3e-90    
ref|XP_010259021.1|  PREDICTED: beta-fructofuranosidase, soluble ...    286   3e-90    
gb|AAL27709.3|AF433643_1  vacuolar invertase                            286   3e-90    Citrus sinensis [apfelsine]
ref|XP_007038396.1|  Glycosyl hydrolases family 32 protein isoform 2    281   4e-90    
dbj|BAB82420.1|  acid invertase                                         272   5e-90    Citrus unshiu [satsuma mandarin]
gb|AFH77956.1|  vacuolar invertase                                      286   6e-90    
ref|XP_010259020.1|  PREDICTED: beta-fructofuranosidase, soluble ...    287   7e-90    
ref|XP_009775767.1|  PREDICTED: acid beta-fructofuranosidase-like       286   7e-90    
ref|XP_006421676.1|  hypothetical protein CICLE_v10004465mg             287   7e-90    
ref|NP_001275874.1|  beta-fructofuranosidase, soluble isoenzyme I...    286   8e-90    
ref|XP_009630517.1|  PREDICTED: acid beta-fructofuranosidase-like       286   1e-89    
emb|CAA53098.1|  beta-fructofuranosidase                                286   1e-89    Daucus carota [carrots]
gb|AAD01606.1|  beta-fructofuranosidase                                 286   1e-89    Ipomoea batatas [batate]
ref|XP_010536536.1|  PREDICTED: acid beta-fructofuranosidase-like       286   2e-89    
emb|CAA53099.1|  beta-fructofuranosidase                                286   2e-89    Daucus carota [carrots]
ref|XP_007210314.1|  hypothetical protein PRUPE_ppa002334mg             285   6e-89    
ref|XP_008238615.1|  PREDICTED: acid beta-fructofuranosidase-like       285   8e-89    
ref|XP_007038395.1|  Glycosyl hydrolases family 32 protein isoform 1    284   9e-89    
ref|XP_004298661.1|  PREDICTED: acid beta-fructofuranosidase-like       285   1e-88    
gb|KDP25630.1|  hypothetical protein JCGZ_20786                         284   1e-88    
gb|AEY79730.1|  vacuolar invertase isoform 2                            283   1e-88    
ref|XP_008234397.1|  PREDICTED: beta-fructofuranosidase, soluble ...    283   1e-88    
ref|XP_002510944.1|  Beta-fructofuranosidase, soluble isoenzyme I...    283   2e-88    Ricinus communis
ref|XP_007218855.1|  hypothetical protein PRUPE_ppa002732mg             279   2e-88    
gb|AFR11328.1|  acid invertase                                          270   3e-88    
dbj|BAD91193.1|  soluble acid invertase                                 268   3e-88    Pyrus communis
sp|P80065.2|INVB_DAUCA  RecName: Full=Beta-fructofuranosidase, so...    283   3e-88    Daucus carota [carrots]
ref|XP_011101120.1|  PREDICTED: beta-fructofuranosidase, soluble ...    282   4e-88    
dbj|BAD91192.1|  soluble acid invertase                                 268   4e-88    Pyrus communis
dbj|BAP47496.1|  invertase                                              282   5e-88    
ref|XP_010264216.1|  PREDICTED: beta-fructofuranosidase, soluble ...    282   6e-88    
dbj|BAM74662.1|  acid invertase                                         266   7e-88    
ref|XP_003635662.2|  PREDICTED: acid beta-fructofuranosidase-like       270   8e-88    
gb|AAD10239.1|  invertase                                               280   3e-87    Oryza sativa [red rice]
ref|XP_010106222.1|  hypothetical protein L484_003380                   280   3e-87    
ref|XP_011070162.1|  PREDICTED: beta-fructofuranosidase, soluble ...    280   3e-87    
dbj|BAD91194.1|  soluble acid invertase                                 266   3e-87    Pyrus communis
ref|XP_007218853.1|  hypothetical protein PRUPE_ppa002732mg             279   4e-87    
gb|AFO84092.1|  vacuolar invertase                                      278   6e-87    
gb|ACT21538.1|  acid invertase                                          276   1e-86    Vigna radiata [mung bean]
gb|KHG09862.1|  Beta-fructofuranosidase, soluble isoenzyme I            275   1e-86    
gb|AFU25743.1|  truncated soluble acid invertase 1                      272   1e-86    
ref|XP_006355490.1|  PREDICTED: acid beta-fructofuranosidase-like       278   2e-86    
gb|AHK05786.1|  vacuolar invertase                                      277   3e-86    
gb|KDP22418.1|  hypothetical protein JCGZ_26249                         276   3e-86    
ref|XP_009370474.1|  PREDICTED: beta-fructofuranosidase, soluble ...    277   4e-86    
gb|AFU25742.1|  soluble acid invertase 2                                276   4e-86    
sp|P29001.1|INVA_VIGRR  RecName: Full=Acid beta-fructofuranosidas...    277   4e-86    Vigna radiata var. radiata [golden gram]
emb|CDP09916.1|  unnamed protein product                                278   4e-86    
gb|AFU56882.1|  vacuolar invertase                                      276   5e-86    
gb|AFV59227.2|  vacuolar invertase NvINV                                276   6e-86    
gb|KHN42772.1|  Beta-fructofuranosidase, soluble isoenzyme I            273   6e-86    
ref|XP_009374489.1|  PREDICTED: beta-fructofuranosidase, soluble ...    276   7e-86    
ref|XP_008373808.1|  PREDICTED: acid beta-fructofuranosidase            277   8e-86    
ref|XP_011101190.1|  PREDICTED: beta-fructofuranosidase, soluble ...    275   8e-86    
gb|KHN04338.1|  Acid beta-fructofuranosidase                            274   8e-86    
gb|AFV59228.1|  vacuolar invertase CvINV                                276   9e-86    
gb|AFH77957.1|  vacuolar invertase                                      276   1e-85    
ref|XP_008376436.1|  PREDICTED: beta-fructofuranosidase, soluble ...    275   1e-85    
ref|XP_009343902.1|  PREDICTED: acid beta-fructofuranosidase-like       276   1e-85    
dbj|BAF35859.1|  soluble acid invertase                                 276   2e-85    Pyrus pyrifolia var. culta [Asian pear]
gb|AAB47172.1|  vacuolar invertase 2, GIN2                              275   2e-85    
gb|ACQ82802.1|  vacuolar invertase                                      275   2e-85    Gossypium hirsutum [American cotton]
gb|KHN09790.1|  Acid beta-fructofuranosidase                            274   2e-85    
ref|XP_011033927.1|  PREDICTED: acid beta-fructofuranosidase            275   2e-85    
ref|XP_009350311.1|  PREDICTED: acid beta-fructofuranosidase-like       275   3e-85    
ref|NP_001284469.1|  acid beta-fructofuranosidase-like                  274   3e-85    
ref|XP_002272809.3|  PREDICTED: acid beta-fructofuranosidase-like       275   3e-85    Vitis vinifera
ref|XP_003549902.1|  PREDICTED: acid beta-fructofuranosidase-like...    274   4e-85    
ref|XP_003526374.1|  PREDICTED: beta-fructofuranosidase, soluble ...    274   4e-85    
gb|ADF27779.1|  soluble acid invertase 1                                275   4e-85    
ref|XP_003525803.1|  PREDICTED: acid beta-fructofuranosidase-like       274   4e-85    
gb|KHG24404.1|  Beta-fructofuranosidase, soluble isoenzyme I            264   5e-85    
ref|XP_010476187.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    274   7e-85    
dbj|BAF35858.1|  Soluble acid invertase                                 273   8e-85    Pyrus pyrifolia var. culta [Asian pear]
gb|AAL27629.1|AF434728_1  vacuolar invertase                            258   9e-85    Citrus aurantium [bitter orange]
dbj|BAG30919.1|  soluble acid invertase                                 273   9e-85    Pyrus pyrifolia [sha li]
ref|XP_010493951.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    274   1e-84    
gb|AFD62256.1|  acid invertase                                          273   1e-84    
ref|XP_002303519.1|  vacuolar invertase family protein                  273   1e-84    Populus trichocarpa [western balsam poplar]
ref|XP_009340588.1|  PREDICTED: beta-fructofuranosidase, soluble ...    273   1e-84    
emb|CAA47636.1|  soluble beta-fructosidase                              273   1e-84    Daucus carota [carrots]
ref|XP_002321831.2|  hypothetical protein POPTR_0015s14790g             273   1e-84    Populus trichocarpa [western balsam poplar]
ref|XP_010458650.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    273   2e-84    
gb|KHN11662.1|  Beta-fructofuranosidase, soluble isoenzyme I            270   2e-84    
gb|KDO48371.1|  hypothetical protein CISIN_1g0052792mg                  270   2e-84    
gb|AFR69121.1|  vacuolar invertase                                      272   3e-84    
emb|CAD19321.1|  acid vacuolar invertase                                273   3e-84    Beta vulgaris [beet]
ref|XP_011010942.1|  PREDICTED: beta-fructofuranosidase, soluble ...    269   3e-84    
ref|XP_007155629.1|  hypothetical protein PHAVU_003G217900g             272   3e-84    
sp|O24509.1|INVA_PHAVU  RecName: Full=Acid beta-fructofuranosidas...    272   3e-84    Phaseolus vulgaris [French bean]
gb|AAC99434.1|  beta-fructofuranosidase                                 257   3e-84    Hamamelis virginiana [American witch-hazel]
gb|AFP23357.1|  soluble acid invertase                                  271   4e-84    
gb|EYU24750.1|  hypothetical protein MIMGU_mgv1a0026273mg               265   5e-84    
ref|XP_003598216.1|  Acid beta-fructofuranosidase                       268   6e-84    
gb|AFD62255.1|  acid invertase                                          271   7e-84    
emb|CAA57392.1|  beta-fructofuranosidase                                259   7e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676175.1|  PREDICTED: acid beta-fructofuranosidase-like...    271   7e-84    
ref|XP_011081205.1|  PREDICTED: beta-fructofuranosidase, soluble ...    271   8e-84    
ref|XP_003533514.1|  PREDICTED: beta-fructofuranosidase, soluble ...    270   8e-84    
gb|ACZ05614.1|  vacuolar invertase 2                                    270   8e-84    
gb|ADP08983.1|  vacuolar invertase 1                                    271   9e-84    
ref|NP_001275813.1|  acid beta-fructofuranosidase-like                  271   1e-83    
gb|AGU12782.1|  vacuolar invertase 2a                                   270   1e-83    
gb|AFS17280.1|  acid vacuolar invertase                                 271   1e-83    
gb|KHN42709.1|  Acid beta-fructofuranosidase                            271   1e-83    
ref|NP_001284386.1|  acid beta-fructofuranosidase-like                  271   1e-83    
dbj|BAB82419.1|  acid invertase                                         271   1e-83    Citrus unshiu [satsuma mandarin]
ref|XP_011000150.1|  PREDICTED: beta-fructofuranosidase, soluble ...    270   1e-83    
ref|XP_010676174.1|  PREDICTED: acid beta-fructofuranosidase-like...    271   2e-83    
emb|CBI24585.3|  unnamed protein product                                267   2e-83    
ref|XP_010093687.1|  Acid beta-fructofuranosidase                       270   2e-83    
ref|XP_004499664.1|  PREDICTED: beta-fructofuranosidase, soluble ...    269   3e-83    
gb|KEH31660.1|  soluble acid invertase FRUCT2                           266   3e-83    
gb|AES68467.2|  soluble acid invertase FRUCT2                           269   3e-83    
ref|XP_004143623.1|  PREDICTED: beta-fructofuranosidase, soluble ...    269   3e-83    
ref|XP_007157332.1|  hypothetical protein PHAVU_002G061200g             269   4e-83    
ref|XP_007039920.1|  Glycosyl hydrolases family 32 protein              271   5e-83    
ref|XP_004147588.1|  PREDICTED: acid beta-fructofuranosidase-like       269   6e-83    
ref|XP_006417255.1|  hypothetical protein EUTSA_v10007016mg             269   6e-83    
ref|XP_006573732.1|  PREDICTED: acid beta-fructofuranosidase-like       269   7e-83    
gb|KHN32440.1|  Beta-fructofuranosidase, soluble isoenzyme I            266   8e-83    
ref|XP_007148711.1|  hypothetical protein PHAVU_005G008200g             268   9e-83    
ref|XP_006878590.1|  hypothetical protein AMTR_s00011p00252750          268   9e-83    
gb|EYU30506.1|  hypothetical protein MIMGU_mgv1a0199921mg               266   1e-82    
ref|XP_002265534.1|  PREDICTED: beta-fructofuranosidase, soluble ...    268   1e-82    Vitis vinifera
ref|XP_003540575.1|  PREDICTED: beta-fructofuranosidase, soluble ...    267   1e-82    
gb|AAB68823.1|  acid invertase                                          256   2e-82    Citrus unshiu [satsuma mandarin]
emb|CAA77268.1|  Inv*Dc4' protein                                       265   2e-82    Daucus carota [carrots]
ref|XP_003538727.1|  PREDICTED: acid beta-fructofuranosidase-like       266   2e-82    
emb|CAD12104.1|  beta-fructofuranosidase                                267   2e-82    Cichorium intybus [radicchio]
sp|Q43857.1|INVA_VICFA  RecName: Full=Acid beta-fructofuranosidas...    267   2e-82    Vicia faba [broad bean]
gb|AAB47171.1|  vacuolar invertase 1, GIN1                              266   3e-82    
ref|XP_006391837.1|  hypothetical protein EUTSA_v10023331mg             267   3e-82    
gb|KHN34956.1|  Acid beta-fructofuranosidase                            267   3e-82    
ref|XP_011076337.1|  PREDICTED: beta-fructofuranosidase, soluble ...    266   4e-82    
ref|XP_009148607.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    266   5e-82    
emb|CDX98080.1|  BnaA06g08310D                                          266   5e-82    
ref|XP_002889923.1|  beta-fructosidase                                  266   5e-82    
ref|XP_003608758.1|  Acid beta-fructofuranosidase                       266   5e-82    
ref|XP_004171067.1|  PREDICTED: LOW QUALITY PROTEIN: acid beta-fr...    267   6e-82    
gb|AES90955.2|  soluble acid invertase FRUCT2                           266   6e-82    
gb|ADF27780.1|  soluble acid invertase 2                                263   6e-82    
gb|AEM00023.1|  vacuolar acid invertase                                 262   8e-82    
ref|XP_010533769.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    266   9e-82    
gb|AGW23637.1|  soluble acid invertase                                  265   1e-81    
gb|AAV70979.1|  vacuolar invertase                                      253   1e-81    Mesembryanthemum crystallinum
gb|ADI70685.1|  vacuolar invertase INV2                                 252   2e-81    
gb|AAD43622.1|AC005698_21  T3P18.21                                     265   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAF19535.1|AC007190_3  F23N19.3                                      266   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAM52062.1|  vacuolar acid invertase PsI-1                           265   2e-81    Pisum sativum [garden pea]
emb|CDY46906.1|  BnaA09g12880D                                          265   2e-81    
ref|XP_009113064.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    265   2e-81    
ref|NP_564798.1|  acid beta-fructofuranosidase 3                        265   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAK62665.1|  At1g62660/F23N19_3                                      265   2e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CAA64781.1|  beta-fructosidase                                      264   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|EPS61897.1|  soluble acid invertase 1                                262   3e-81    
ref|XP_004515737.1|  PREDICTED: acid beta-fructofuranosidase-like       264   3e-81    
gb|KFK40589.1|  hypothetical protein AALP_AA2G015400                    264   3e-81    
ref|XP_010259194.1|  PREDICTED: beta-fructofuranosidase, soluble ...    261   3e-81    
emb|CAE01318.1|  acid vacuolar invertase                                249   3e-81    Coffea arabica [arabica coffee]
gb|AAL27710.3|AF433644_1  vacuolar invertase                            252   3e-81    Malus domestica [apple tree]
ref|XP_002888009.1|  predicted protein                                  264   3e-81    
emb|CAA61624.1|  beta-fructofuranosidase                                261   4e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300839.1|  hypothetical protein CARUB_v10019930mg             263   6e-81    
ref|XP_002532576.1|  Acid beta-fructofuranosidase precursor, puta...    263   7e-81    Ricinus communis
emb|CDY30056.1|  BnaC05g09640D                                          263   7e-81    
emb|CDY31826.1|  BnaC09g13230D                                          263   7e-81    
emb|CDY39805.1|  BnaA09g10570D                                          262   8e-81    
gb|AAG36942.1|AF274298_1  acid invertase                                263   8e-81    Brassica oleracea
gb|AEY79729.1|  vacuolar invertase isoform 1                            261   8e-81    
ref|XP_009118103.1|  PREDICTED: acid beta-fructofuranosidase 4, v...    263   8e-81    
emb|CDY26548.1|  BnaA09g47290D                                          263   1e-80    
emb|CDY39804.1|  BnaA09g10560D                                          262   1e-80    
ref|XP_009112697.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    263   1e-80    
ref|XP_010430328.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    262   1e-80    
ref|NP_563901.1|  acid beta-fructofuranosidase 4                        263   1e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDY15984.1|  BnaC08g41390D                                          263   2e-80    
emb|CAA66330.1|  beta-fructosidase                                      263   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511663.1|  PREDICTED: acid beta-fructofuranosidase-like       262   2e-80    
ref|XP_010259193.1|  PREDICTED: beta-fructofuranosidase, soluble ...    263   2e-80    
emb|CDY03265.1|  BnaC09g10830D                                          261   2e-80    
gb|AAG36943.1|AF274299_1  acid invertase                                262   3e-80    Brassica oleracea
emb|CAA72109.1|  vacuolar invertase                                     248   3e-80    Allium cepa
ref|XP_004307806.1|  PREDICTED: beta-fructofuranosidase, soluble ...    258   3e-80    
emb|CDY03264.1|  BnaC09g10840D                                          260   4e-80    
ref|XP_010473488.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    261   4e-80    
ref|XP_010418267.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    261   4e-80    
emb|CAC81826.1|  beta-fructofuranosidase                                251   4e-80    Beta vulgaris [beet]
dbj|BAM74660.1|  acid invertase                                         246   5e-80    
ref|XP_010672026.1|  PREDICTED: beta-fructofuranosidase, soluble ...    260   9e-80    
ref|XP_010062212.1|  PREDICTED: beta-fructofuranosidase, soluble ...    260   1e-79    
ref|XP_002303584.2|  hypothetical protein POPTR_0003s12640g             258   3e-79    Populus trichocarpa [western balsam poplar]
ref|XP_004307805.1|  PREDICTED: beta-fructofuranosidase, soluble ...    258   4e-79    
ref|XP_011022761.1|  PREDICTED: acid beta-fructofuranosidase-like       258   5e-79    
ref|XP_010906620.1|  PREDICTED: beta-fructofuranosidase 1-like          258   5e-79    
gb|AEB66649.1|  vacuole invertase                                       256   6e-79    
gb|AEB66648.1|  vacuole invertase                                       256   6e-79    
ref|XP_010053435.1|  PREDICTED: acid beta-fructofuranosidase-like       257   2e-78    
gb|EYU24965.1|  hypothetical protein MIMGU_mgv1a004782mg                253   2e-78    
ref|XP_010419461.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    248   3e-78    
ref|XP_010430330.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    256   5e-78    
ref|NP_001234069.1|  invertase                                          255   7e-78    
ref|XP_010941127.1|  PREDICTED: beta-fructofuranosidase 1-like          255   1e-77    
ref|XP_006300852.1|  hypothetical protein CARUB_v10019944mg             254   2e-77    
ref|XP_009384549.1|  PREDICTED: beta-fructofuranosidase 1-like          254   3e-77    
gb|AEX15265.1|  vacuolar invertase                                      253   3e-77    
ref|XP_010473489.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    253   5e-77    
gb|AAF87245.1|AF276703_1  vacuolar acid invertase                       253   5e-77    Oryza sativa [red rice]
emb|CAA06839.1|  invertase                                              254   6e-77    Allium cepa
ref|XP_008794813.1|  PREDICTED: beta-fructofuranosidase 1-like          253   6e-77    
ref|NP_001053422.1|  Os04g0535600                                       253   7e-77    Oryza sativa Japonica Group [Japonica rice]
emb|CAH67112.1|  H0502G05.3                                             253   8e-77    Oryza sativa [red rice]
emb|CAD41525.3|  OSJNBb0020O11.6                                        253   8e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009401797.1|  PREDICTED: beta-fructofuranosidase 1-like          253   1e-76    
gb|EEC77707.1|  hypothetical protein OsI_16783                          253   1e-76    Oryza sativa Indica Group [Indian rice]
ref|XP_007131343.1|  hypothetical protein PHAVU_011G005900g             251   1e-76    
gb|AAM77272.1|AF519809_1  acid invertase                                251   2e-76    Lagenaria siceraria [bottle gourd]
emb|CAA72110.1|  vacuolar invertase                                     237   3e-76    Allium cepa
gb|EMS61371.1|  Acid beta-fructofuranosidase                            250   4e-76    
ref|XP_003580229.1|  PREDICTED: beta-fructofuranosidase 1-like          251   5e-76    
ref|XP_008645147.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    251   6e-76    
gb|EMT14935.1|  Beta-fructofuranosidase 1                               246   1e-75    
ref|XP_008778382.1|  PREDICTED: beta-fructofuranosidase 1-like          247   1e-75    
gb|AAS88729.1|  vacuolar invertase1                                     248   5e-75    Triticum monococcum [einkorn wheat]
gb|AFB83198.1|  sucrose:sucrose 1-fructosyl transferase                 247   7e-75    
gb|AAB58909.1|  sucrose:sucrose 1-fructosyl transferase                 247   1e-74    Cichorium intybus [radicchio]
gb|AFN66440.1|  soluble acid invertase                                  244   2e-74    
ref|XP_008787011.1|  PREDICTED: beta-fructofuranosidase 1               246   2e-74    
gb|AFN66439.1|  soluble acid invertase                                  243   4e-74    
ref|XP_004976364.1|  PREDICTED: beta-fructofuranosidase 1-like          246   4e-74    
ref|XP_010546426.1|  PREDICTED: acid beta-fructofuranosidase 3, v...    246   4e-74    
dbj|BAJ95733.1|  predicted protein                                      243   5e-74    
gb|ABX90019.1|  sucrose:sucrose 1-fructosyltransferase                  245   6e-74    Lactuca sativa [cultivated lettuce]
emb|CAD58681.1|  putative soluble acid invertase                        245   6e-74    Lolium temulentum
ref|XP_010919479.1|  PREDICTED: beta-fructofuranosidase 1 isoform X2    244   9e-74    
ref|XP_010919478.1|  PREDICTED: beta-fructofuranosidase 1 isoform X1    244   9e-74    
gb|ACJ04701.1|  invertase 1                                             245   9e-74    Cucumis melo [Oriental melon]
gb|ACY78465.1|  soluble acid invertase                                  242   9e-74    Sorghum bicolor [broomcorn]
gb|ACY78467.1|  soluble acid invertase                                  242   9e-74    Sorghum bicolor [broomcorn]
gb|ACY78464.1|  soluble acid invertase                                  242   9e-74    Sorghum bicolor [broomcorn]
ref|XP_006646767.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    244   1e-73    
ref|XP_004951208.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose:sucr...    244   2e-73    
emb|CAA70855.1|  sucrose sucrose 1-fructosyltransferase                 243   3e-73    Cynara cardunculus var. scolymus [artichoke]
gb|AFH57543.1|  soluble acid invertase                                  243   4e-73    
gb|AGO03820.1|  soluble acid invertase                                  243   4e-73    
gb|AGO03823.1|  soluble acid invertase                                  243   4e-73    
gb|AAK72492.2|  soluble acid invertase bfruct2                          243   4e-73    
gb|AFV94475.1|  soluble acid invertase 12                               243   6e-73    
gb|AAL92880.1|  fructosyltransferase                                    242   8e-73    
gb|AFV94473.1|  soluble acid invertase 10                               243   8e-73    
gb|AFV94468.1|  soluble acid invertase 4                                243   8e-73    
gb|AFV94467.1|  soluble acid invertase 5                                243   9e-73    
gb|AAP59436.1|  soluble acid invertase                                  241   1e-72    
dbj|BAJ93214.1|  predicted protein                                      242   1e-72    
gb|AFV94471.1|  soluble acid invertase 8                                243   1e-72    
gb|EMT19916.1|  Beta-fructofuranosidase 1                               241   1e-72    
ref|XP_010228144.1|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    237   3e-72    
gb|AFV94474.1|  soluble acid invertase 11                               241   4e-72    
ref|XP_008796841.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    240   4e-72    
dbj|BAJ87063.1|  predicted protein                                      240   4e-72    
dbj|BAK03249.1|  predicted protein                                      241   4e-72    
gb|AGR51646.1|  soluble acid invertase                                  239   5e-72    
gb|AFV94469.1|  soluble acid invertase 6                                241   5e-72    
gb|AFV94470.1|  soluble acid invertase 7                                241   5e-72    
emb|CAA08812.1|  sucrose 1F-fructosyltransferase                        239   5e-72    
gb|AAC16655.1|  soluble acid invertase                                  238   6e-72    
emb|CAD58683.1|  putative soluble acid invertase                        237   6e-72    
emb|CAB60153.1|  sucrose:sucrose 1-fructosyl transferase                239   6e-72    
gb|AAC16654.1|  soluble acid invertase                                  238   6e-72    
gb|AAB71136.1|  acid invertase                                          240   7e-72    
gb|AFJ21575.1|  vacuolar invertase                                      239   7e-72    
dbj|BAJ94230.1|  predicted protein                                      239   1e-71    
gb|AFV94472.1|  soluble acid invertase 9                                240   1e-71    
gb|EMT19913.1|  Beta-fructofuranosidase 1                               239   1e-71    
gb|EMT19914.1|  Beta-fructofuranosidase 1                               236   2e-71    
gb|AFV94412.1|  soluble acid invertase 1                                239   2e-71    
ref|XP_002446857.1|  hypothetical protein SORBIDRAFT_06g023760          239   2e-71    
gb|AAL87233.1|AF481763_1  fructosyltransferase                          238   2e-71    
gb|AFV94414.1|  soluble acid invertase 3                                239   2e-71    
emb|CAG25609.1|  acid beta-fructofuranosidase precursor                 238   3e-71    
gb|EMT19915.1|  Beta-fructofuranosidase 1                               238   3e-71    
gb|EAZ21424.1|  hypothetical protein OsJ_05029                          236   3e-71    
gb|ACS92722.1|  vacuolar invertase                                      238   5e-71    
ref|XP_010933713.1|  PREDICTED: beta-fructofuranosidase 1               237   5e-71    
gb|ABB77251.1|  vacuolar invertase BObetaFRUCT3                         237   7e-71    
gb|AAF87246.1|AF276704_1  vacuolar acid invertase                       237   8e-71    
ref|NP_001045626.1|  Os02g0106100                                       237   8e-71    
emb|CAA64953.1|  invertase                                              235   2e-70    
gb|EMT23832.1|  6(G)-fructosyltransferase                               234   3e-70    
emb|CAF22241.1|  soluble acid invertase                                 235   3e-70    
gb|AFV94413.1|  soluble acid invertase 2                                236   3e-70    
ref|XP_008680035.1|  PREDICTED: beta-fructofuranosidase 1-like          233   3e-70    
emb|CAA66237.1|  invertase 5                                            234   3e-70    
ref|XP_008668436.1|  PREDICTED: uncharacterized protein LOC100383...    235   5e-70    
gb|AFW66816.1|  hypothetical protein ZEAMMB73_813171                    233   5e-70    
emb|CAA66238.1|  invertase 6                                            233   8e-70    
sp|P49175.1|INV1_MAIZE  RecName: Full=Beta-fructofuranosidase 1; ...    233   3e-69    
dbj|BAK04106.1|  predicted protein                                      231   9e-69    
ref|XP_009406946.1|  PREDICTED: beta-fructofuranosidase 1-like          229   1e-68    
ref|XP_003571181.2|  PREDICTED: sucrose:sucrose 1-fructosyltransf...    231   1e-68    
gb|AAZ29516.1|  fructosyltransferase-like protein                       231   2e-68    
gb|AFP72241.1|  vacuolar invertase                                      230   2e-68    
dbj|BAM74664.1|  acid invertase                                         214   4e-68    
pdb|3UGF|A  Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachy...    226   7e-68    
gb|AAC36117.1|  soluble acid invertase                                  214   2e-67    
emb|CBM41476.2|  sucrose:(sucrose/fructan) 6-fructosyltransferase...    227   3e-67    
ref|XP_002976640.1|  hypothetical protein SELMODRAFT_10966              224   4e-67    
ref|XP_002973210.1|  hypothetical protein SELMODRAFT_98949              225   1e-66    
pir||S49256  beta-fructofuranosidase (EC 3.2.1.26) - red goosefoo...    222   2e-66 
gb|AAK72493.2|  soluble acid invertase bfruct3                          225   3e-66    
gb|AAL05427.2|  vacuolar acid invertase                                 223   1e-65    
emb|CAA12061.1|  beta-fructosidase                                      211   3e-65    
gb|EMT16812.1|  6(G)-fructosyltransferase                               221   5e-65    
gb|ADK92854.1|  putative fructosyl transferase                          211   5e-65    
emb|CAA72112.1|  vacuolar invertase                                     207   2e-64    
gb|EMT11750.1|  Beta-fructofuranosidase 1                               219   2e-64    
gb|EMS52383.1|  Beta-fructofuranosidase 1                               218   3e-64    
gb|EMS56293.1|  Beta-fructofuranosidase 1                               218   5e-64    
emb|CAA72113.1|  vacuolar invertase                                     206   6e-64    
gb|KDO65461.1|  hypothetical protein CISIN_1g006523mg                   213   1e-63    
dbj|BAJ24841.1|  fructan:fructan 1-fructosyltransferase                 217   2e-63    
emb|CAA72114.1|  vacuolar invertase                                     205   2e-63    
emb|CAA72111.1|  vacuolar invertase                                     204   5e-63    
emb|CAH18892.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    215   6e-63    
dbj|BAF99808.1|  fructan:fructan 6G-fructosyltransferase 2              215   7e-63    
dbj|BAD26613.1|  putative fructosyltransferase2                         215   8e-63    
sp|Q9FSV7.1|SST_FESAR  RecName: Full=Sucrose:sucrose 1-fructosylt...    214   2e-62    
emb|CAL51272.1|  putative fructan:fructan 6G-fructosyltransferase       214   2e-62    
gb|AAM13671.1|AF492836_1  fructan:fructan 6G-fructosyltransferase       214   2e-62    
gb|EMT09009.1|  Beta-fructofuranosidase, soluble isoenzyme I            213   2e-62    
gb|AAD00558.1|  fructan-fructan 1-fructosyltransferase                  214   2e-62    
emb|CAA08811.1|  1,2-beta-fructan 1F-fructosyltransferase               213   3e-62    
gb|EMT14599.1|  Beta-fructofuranosidase, soluble isoenzyme I            213   5e-62    
gb|ABD72592.1|  fructosyltransferase FTa                                213   6e-62    
gb|AAO86693.1|  sucrose:sucrose 1-fructosyltransferase                  213   7e-62    
dbj|BAF99807.1|  sucrose:sucrose fructosyltransferase                   213   9e-62    
emb|CAL51273.1|  putative sucrose:sucrose 1-fructosyltransferase        213   9e-62    
gb|AFB83199.1|  fructan-fructan 1-fructosyltransferase                  211   2e-61    
dbj|BAK05319.1|  predicted protein                                      209   7e-61    
gb|AFJ21573.1|  fructan:fructan 6G-fructosyltransferase                 209   7e-61    
gb|AFP72242.1|  vacuolar invertase                                      209   7e-61    
emb|CAH18937.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    209   1e-60    
gb|ABX90020.1|  fructan:fructan 1-fructosyltransferase                  209   1e-60    
gb|AFJ21579.1|  fructan:fructan 6G-fructosyltransferase                 209   1e-60    
gb|AAK83982.1|AF393810_1  vacuolar invertase-like protein               197   2e-60    
emb|CAH25486.1|  1,2-beta-fructan 1F-fructosyltransferase               208   2e-60    
gb|EMT29525.1|  6(G)-fructosyltransferase                               206   3e-60    
emb|CBI14850.3|  unnamed protein product                                195   6e-60    
emb|CAA04120.2|  fructan fructan 1-fructosyltransferase                 207   9e-60    
emb|CBI31885.3|  unnamed protein product                                204   1e-59    
dbj|BAE19752.1|  fructan:fructan 1-fructosyltransferase                 206   3e-59    
gb|ACH73188.1|  fructan:fructan 1-fructosyltransferase                  206   3e-59    
emb|CAH18891.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    204   4e-59    
dbj|BAJ91277.1|  predicted protein                                      205   5e-59    
gb|ACL14897.1|  fructan:fructan 1-fructosyltransferase                  205   5e-59    
dbj|BAJ88350.1|  predicted protein                                      205   5e-59    
gb|AFP72238.1|  sucrose:sucrose 1-fructosyltransferase                  205   5e-59    
dbj|BAJ97223.1|  predicted protein                                      205   5e-59    
gb|AAA74584.1|  invertase                                               202   5e-59    
gb|AFP72239.1|  fructan-fructan 1-fructosyltransferase                  205   6e-59    
dbj|BAJ85557.1|  predicted protein                                      205   6e-59    
gb|EMT24081.1|  Beta-fructofuranosidase 1                               205   8e-59    
dbj|BAB82470.1|  sucrose:sucrose 1-fructosytransferase                  204   1e-58    
gb|ACH73191.1|  fructan:fructan 1-fructosyltransferase                  204   1e-58    
gb|EMS57418.1|  Beta-fructofuranosidase, soluble isoenzyme I            206   1e-58    
gb|EMS52931.1|  6(G)-fructosyltransferase                               203   1e-58    
emb|CAH25487.1|  1,2-beta-fructan 1F-fructosyltransferase               204   1e-58    
gb|ACH73190.1|  fructan:fructan 1-fructosyltransferase                  204   1e-58    
sp|Q5FC15.1|GFT_ASPOF  RecName: Full=6(G)-fructosyltransferase; A...    203   2e-58    
gb|ACH73189.1|  fructan:fructan 1-fructosyltransferase                  203   2e-58    
gb|ABS72186.1|  fructan:fructan 1-fructosyltransferase                  203   3e-58    
emb|CAD98793.2|  sucrose-sucrose-1-fructosyltransferase                 203   3e-58    
gb|EMS55535.1|  Beta-fructofuranosidase 1                               201   3e-58    
gb|AAC23502.1|  vacuolar invertase                                      200   3e-58    
gb|ACL13556.1|  sucrose:sucrose 1-fructosyltransferase                  203   3e-58    
dbj|BAE19751.1|  fructan:fructan 1-fructosyltransferase                 202   4e-58    
gb|AFK29572.1|  sucrose: sucrose-1-fructosyltransferase                 202   5e-58    
gb|KHG18769.1|  Acid beta-fructofuranosidase                            199   6e-58    
dbj|BAM66575.1|  sucrose:sucrose 1-fructosyltransferase                 202   7e-58    
ref|XP_006307369.1|  hypothetical protein CARUB_v10008995mg             198   1e-57    
ref|XP_006440371.1|  hypothetical protein CICLE_v10019134mg             199   2e-57    
gb|ACL13558.1|  sucrose:sucrose 1-fructosyltransferase                  201   2e-57    
gb|ACH73196.1|  sucrose:sucrose 1-fructosyltransferase                  200   4e-57    
emb|CAA06838.1|  sucrose sucrose 1-fructosyltransferase                 199   4e-57    
gb|ACL13557.1|  sucrose:sucrose 1-fructosyltransferase                  199   7e-57    
emb|CAH18938.1|  2,1-fructan:2,1-fructan 1-fructosyltransferase p...    196   1e-56    
gb|EMS54026.1|  6(G)-fructosyltransferase                               196   2e-56    
emb|CAC81827.1|  beta-fructofuranosidase                                187   6e-56    
ref|XP_001764172.1|  predicted protein                                  194   1e-55    
gb|AAM21931.1|  sucrose:sucrose 1-fructosyltransferase                  193   7e-55    
ref|XP_001784437.1|  predicted protein                                  192   8e-55    
dbj|BAM66574.1|  fructan:fructan 1-fructosyltransferase                 193   9e-55    
ref|XP_002988349.1|  hypothetical protein SELMODRAFT_183809             189   1e-53    
gb|AFJ21571.1|  sucrose:sucrose 1-fructosyltransferase                  190   1e-53    
sp|P92916.1|GFT_ALLCE  RecName: Full=Bifunctional 6(G)-fructosylt...    190   1e-53    
gb|AFJ21570.1|  sucrose:sucrose 1-fructosyltransferase                  189   3e-53    
gb|ABG00265.1|  sucrose:sucrose 1-fructosyltransferase                  189   3e-53    
ref|XP_002991453.1|  hypothetical protein SELMODRAFT_161653             189   3e-53    
gb|AFJ21576.1|  sucrose:sucrose 1-fructosyltransferase                  189   3e-53    
dbj|BAB82469.1|  sucrose:fructan 6-fructosyltransferase                 184   1e-51    
ref|XP_001755639.1|  predicted protein                                  183   2e-51    
gb|AAL16969.1|AF367453_1  vacuolar acid invertase                       172   2e-51    
gb|AFP72240.1|  sucrose:fructan 6-fructosyltransferase                  184   3e-51    
emb|CAA58235.1|  sucrose:fructan 6-fructosyltransferase                 183   3e-51    
dbj|BAH30253.1|  putative fructosyltransferase                          175   5e-51    
emb|CAD91358.1|  vacuolar invertase                                     181   7e-51    
gb|EMT09010.1|  6(G)-fructosyltransferase                               181   9e-51    
gb|AFK29573.1|  sucrose: fructan 6-fructosyltransferase                 182   9e-51    
gb|ACN93835.1|  putative sucrose:fructan 6-fructosyltransferase         182   1e-50    
dbj|BAO09621.1|  fructosyltransferase                                   181   2e-50    
gb|ACH73195.1|  sucrose:fructan 6-fructosyltransferase                  181   2e-50    
pir||JC7905  fructan 6-fructosyltransferase - wheat                     181   2e-50 
gb|ADP38058.1|  putative sucrose:fructan fructosyl transferase 2        181   3e-50    
gb|ACH73193.1|  sucrose:fructan 6-fructosyltransferase                  181   3e-50    
gb|ACH73192.1|  sucrose:fructan 6-fructosyltransferase                  181   3e-50    
gb|ACI43225.3|  sucrose:fructan 6-fructosyltransferase                  180   5e-50    
dbj|BAM74661.1|  acid invertase                                         167   8e-50    
gb|AAK27319.1|AF211253_1  sucrose:fructan 6-fructosyltransferase        179   1e-49    
gb|ACB13552.1|  cell wall acid invertase                                169   1e-49    
dbj|BAH30252.1|  sucrose: fructan 6-fructosyltransferase                179   2e-49    
gb|AJD73563.1|  sucrose sucrose 1-frutosyltransferase                   167   2e-49    
gb|ACH73194.1|  sucrose:fructan 6-fructosyltransferase                  178   3e-49    
gb|AFU35316.1|  cell wall invertase                                     171   4e-49    
gb|AAO16903.1|  cell-wall invertase                                     167   5e-49    
emb|CAC19366.1|  fructan 1-exohydrolase I                               176   8e-49    
ref|XP_007150512.1|  hypothetical protein PHAVU_005G158500g             176   1e-48    
ref|XP_004986250.1|  PREDICTED: beta-fructofuranosidase, insolubl...    175   2e-48    
ref|XP_002466502.1|  hypothetical protein SORBIDRAFT_01g008910          175   3e-48    
gb|AFU35314.1|  cell wall invertase                                     168   3e-48    
gb|AAG36767.1|AF192394_1  sucrose:fructan 6-fructosyltransferase        175   3e-48    
ref|XP_006845605.1|  hypothetical protein AMTR_s00019p00207760          165   4e-48    
gb|AAL27628.1|AF434727_1  cell wall invertase                           165   5e-48    
ref|XP_006653622.1|  PREDICTED: beta-fructofuranosidase 1-like          174   5e-48    
gb|ADP38057.1|  putative sucrose:fructan fructosyl transferase 1        174   6e-48    
ref|XP_002278880.2|  PREDICTED: beta-fructofuranosidase, insolubl...    174   7e-48    
gb|ADP38056.1|  putative sucrose:fructan fructosyl transferase          174   7e-48    
gb|KDP40759.1|  hypothetical protein JCGZ_24758                         174   9e-48    
ref|XP_002451357.1|  hypothetical protein SORBIDRAFT_04g000620          172   1e-47    
ref|XP_010059629.1|  PREDICTED: beta-fructofuranosidase, insolubl...    173   1e-47    
gb|AFJ21572.1|  fructan:fructan 6G-fructosyltransferase                 173   2e-47    
ref|XP_010245601.1|  PREDICTED: beta-fructofuranosidase, insolubl...    172   2e-47    
dbj|BAF33369.1|  soluble acid invertase                                 167   2e-47    
gb|AAN64292.1|  invertase                                               163   2e-47    
emb|CAA72009.1|  invertase                                              172   2e-47    
ref|XP_002309419.1|  cell-wall invertase family protein                 172   2e-47    
ref|XP_007012302.1|  Glycosyl hydrolases family 32 protein, putative    172   2e-47    
gb|AGT16261.1|  beta-fructofuranosidase                                 172   3e-47    
ref|XP_010245596.1|  PREDICTED: beta-fructofuranosidase, insolubl...    172   3e-47    
ref|XP_004149196.1|  PREDICTED: beta-fructofuranosidase, insolubl...    172   3e-47    
gb|AAC99428.1|  beta-fructofuranosidase                                 162   3e-47    
ref|XP_008442862.1|  PREDICTED: beta-fructofuranosidase, insolubl...    172   4e-47    
ref|XP_011004211.1|  PREDICTED: beta-fructofuranosidase, insolubl...    172   4e-47    
ref|XP_010271619.1|  PREDICTED: beta-fructofuranosidase, insolubl...    171   5e-47    
gb|EMT20540.1|  Beta-fructofuranosidase, insoluble isoenzyme 3          171   6e-47    
gb|AFJ21578.1|  fructan:fructan 6G-fructosyltransferase                 171   7e-47    
ref|XP_003546695.1|  PREDICTED: beta-fructofuranosidase, cell wal...    171   9e-47    
gb|AAC99429.1|  beta-fructofuranosidase                                 161   1e-46    
ref|XP_006426548.1|  hypothetical protein CICLE_v10025243mg             170   2e-46    
ref|XP_004168886.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    166   2e-46    
gb|KDP34087.1|  hypothetical protein JCGZ_07658                         170   2e-46    
gb|ABM65159.1|  cell wall invertase                                     169   2e-46    
ref|XP_002489106.1|  hypothetical protein SORBIDRAFT_0067s002240        169   2e-46    
gb|AFH77950.1|  cell wall invertase                                     170   2e-46    
gb|AAN64291.1|  cell wall invertase                                     160   3e-46    
gb|ABY81288.1|  cell-wall invertase                                     169   3e-46    
emb|CDP08275.1|  unnamed protein product                                169   3e-46    



>gb|AAK71505.2| soluble acid invertase Ib2FRUCT3 [Ipomoea batatas]
Length=661

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNPDSA+WGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILP+
Sbjct  154  GWYHFFYQYNPDSAVWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPD  213

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTDENVQVQNLAYPAD+LDPLLLDWVKYSGNPVLVPPPGIG +DFRDPTTA
Sbjct  214  GQIVMLYTGSTDENVQVQNLAYPADLLDPLLLDWVKYSGNPVLVPPPGIGAQDFRDPTTA  273

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W SPNVGKWL+TIGSKV KTGISLVYETTNFTDYKLLDGVLHAVPGTG
Sbjct  274  WKSPNVGKWLLTIGSKVNKTGISLVYETTNFTDYKLLDGVLHAVPGTG  321



>ref|NP_001234618.1| acid beta-fructofuranosidase precursor [Solanum lycopersicum]
 gb|AAL75449.1|AF465612_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
 dbj|BAA01954.1| beta-fructosidase [Solanum lycopersicum]
Length=553

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  127  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVK+ GNPVLVPPPGIGVKDFRDPTTA
Sbjct  187  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTA  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTG++LVYET+NFT +KLLDGVLHAVPGTG
Sbjct  247  WTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTG  294



>gb|ABX55832.1| soluble acid invertase [Cucumis melo]
Length=636

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  127  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVK+ GNPVLVPPPGIGVKDFRDPTTA
Sbjct  187  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTA  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTG++LVYET+NFT +KLLDGVLHAVPGTG
Sbjct  247  WTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTG  294



>prf||1905419A invertase
Length=635

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  127  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVK+ GNPVLVPPPGIGVKDFRDPTTA
Sbjct  187  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTA  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTG++LVYET+NFT +KLLDGVLHAVPGTG
Sbjct  247  WTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTG  294



>sp|P29000.1|INVA_SOLLC RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Solanum 
lycopersicum]
 pir||S31157 beta-fructofuranosidase (EC 3.2.1.26) precursor - currant tomato
 emb|CAA78060.1| vacuolar invertase precursor [Solanum lycopersicum]
 emb|CAA78061.1| vacuolar invertase precursor [Solanum pimpinellifolium]
 emb|CAA78062.1| beta-fructofuranosidase [Solanum lycopersicum]
 emb|CAA78063.1| beta-fructofuranosidase [Solanum pimpinellifolium]
 gb|AAA34132.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  127  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVK+ GNPVLVPPPGIGVKDFRDPTTA
Sbjct  187  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTA  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTG++LVYET+NFT +KLLDGVLHAVPGTG
Sbjct  247  WTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTG  294



>gb|ADE44160.1| acid invertase [Solanum lycopersicum var. cerasiforme]
Length=636

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  127  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVK+ GNPVLVPPPGIGVKDFRDPTTA
Sbjct  187  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTA  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTG++LVYET+NFT +KLLDGVLHAVPGTG
Sbjct  247  WTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTG  294



>ref|NP_001274993.1| beta-fructosidase [Solanum tuberosum]
 gb|AEV46297.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|AEV46296.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|ADM47340.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46290.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46291.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46292.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46293.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|AEV46294.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46295.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|AAA50305.1| beta-fructosidase [Solanum tuberosum]
Length=639

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|ACC93584.1| beta-fructofuranosidase, partial [Solanum tuberosum]
Length=635

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  126  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  185

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  186  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  245

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  246  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  293



>gb|ABF18956.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|ACC93585.1| beta-fructofuranosidase [Solanum tuberosum]
Length=639

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|AEV46287.1| vacuolar invertase [Solanum tuberosum]
 gb|AEV46288.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIG+KDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGIKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>gb|AEV46289.1| vacuolar invertase [Solanum tuberosum]
Length=639

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIG+KDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGIKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  297



>ref|NP_001234843.1| acid invertase [Solanum lycopersicum]
 gb|AAB30874.1| acid invertase [Solanum lycopersicum]
Length=636

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  127  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVK  GNPVLVPPPGIGVKDFRDPTT 
Sbjct  187  GQIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKLKGNPVLVPPPGIGVKDFRDPTTR  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTG++LVYET+NFT +KLLDGVLHAVPGTG
Sbjct  247  WTGPQNGQWLLTIGSKIGKTGVALVYETSNFTSFKLLDGVLHAVPGTG  294



>gb|AAQ17074.1| acid invertase [Solanum tuberosum]
Length=639

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  190  GQIMMLYTGDTDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGVKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLL  VLHAVPGTG
Sbjct  250  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLGEVLHAVPGTG  297



>gb|AAL75450.1|AF465613_1 minor allergen beta-fructofuranosidase precursor [Solanum lycopersicum]
Length=636

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  127  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVK+  NPVLVPPPGIGVKDFRDP TA
Sbjct  187  GQIIMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKFKANPVLVPPPGIGVKDFRDPITA  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTG++LV ET+NFT +KLLDGVLHAVPGTG
Sbjct  247  WTGPQNGQWLLTIGSKIGKTGVALVCETSNFTSFKLLDGVLHAVPGTG  294



>emb|CAA49831.1| beta-fructofuranosidase [Solanum tuberosum]
Length=634

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHW +LPFAMVPDQWYDINGVWTGSA+ILP+
Sbjct  125  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSASILPD  184

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG +D+ VQVQNLAYP ++ DPLLLDWVKY GNPVLVPPPGIG+KDFRDPTTA
Sbjct  185  GQIMMLYTGVSDDYVQVQNLAYPTNLSDPLLLDWVKYKGNPVLVPPPGIGIKDFRDPTTA  244

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVYET+NFT +KLLD VLHAVPGTG
Sbjct  245  WTGPQNGQWLLTIGSKIGKTGIALVYETSNFTSFKLLDEVLHAVPGTG  292



>ref|XP_009794076.1| PREDICTED: acid beta-fructofuranosidase AIV-18 [Nicotiana sylvestris]
Length=643

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHA+S DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  135  GWYHLFYQYNPDSAIWGNITWGHAISTDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T++ VQVQNLAYPA++ DPLL+DWVKY  NPV+VPPPGIGVKDFRDPTTA
Sbjct  195  GQIMMLYTGDTNDYVQVQNLAYPANLSDPLLIDWVKYQDNPVMVPPPGIGVKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI+LVY+T+NFT++KLLDGVLHAVPGTG
Sbjct  255  WTGPQNGQWLLTIGSKIGKTGIALVYDTSNFTNFKLLDGVLHAVPGTG  302



>dbj|BAM74659.1| acid invertase, partial [Ipomoea batatas]
Length=179

 Score =   286 bits (731),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLI+W HLPFAMVPDQWYD+NGVWTGSATILP+
Sbjct  1    GWYHLFYQYNPDSAVWGNITWGHAVSTDLINWLHLPFAMVPDQWYDVNGVWTGSATILPD  60

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG TD+ VQVQNLA+PA++ DPLL+DWVKY  NPV+ PPPGIGVKDFRDPTTA
Sbjct  61   GRIVMLYTGDTDDYVQVQNLAFPANLSDPLLVDWVKYPNNPVIYPPPGIGVKDFRDPTTA  120

Query  362  WMS-PNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +    G+WL+TIGSKVGKTGISLVYETTNFT +KLLDGVLHAVPGTG
Sbjct  121  WTAGSQNGQWLVTIGSKVGKTGISLVYETTNFTTFKLLDGVLHAVPGTG  169



>ref|XP_009619840.1| PREDICTED: acid beta-fructofuranosidase AIV-18-like [Nicotiana 
tomentosiformis]
 emb|CAC83577.2| vacuolar invertase [Nicotiana tabacum]
Length=643

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHA+S DLIHW +LPFA+VPDQWYDINGVWTGSAT LP+
Sbjct  135  GWYHLFYQYNPDSAIWGNITWGHAISTDLIHWLYLPFALVPDQWYDINGVWTGSATFLPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T++ VQVQNLAYPA++ DPLL+DWVKY GNPV+VPPPGIGVKDFRDPTTA
Sbjct  195  GQIMMLYTGDTNDYVQVQNLAYPANLSDPLLIDWVKYRGNPVMVPPPGIGVKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSK+GKTGI++VY T+NFT++KLLDGVLHAVPGTG
Sbjct  255  WTGPQNGQWLLTIGSKIGKTGIAIVYGTSNFTNFKLLDGVLHAVPGTG  302



>sp|P93761.1|INV1_CAPAN RecName: Full=Acid beta-fructofuranosidase AIV-18; AltName: Full=Acid 
invertase; AltName: Full=Acid sucrose hydrolase [Capsicum 
annuum]
 gb|AAB48484.1| acid beta-fructosidase [Capsicum annuum]
Length=640

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 3/168 (2%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS DLIHW +LPFAMVPDQWYDINGVWTGSATILP+
Sbjct  135  GWYHLFYQYNPDSAIWGNITWGHAVSTDLIHWLYLPFAMVPDQWYDINGVWTGSATILPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G I+MLYTG TD+ VQVQNLAYPA++ DPLLLDWVKY GNPVLVPPPGIGVKDFRDPTTA
Sbjct  195  GLIMMLYTGDTDDYVQVQNLAYPANLSDPLLLDWVKYQGNPVLVPPPGIGVKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P  G+WL+TIGSKVGKTGI+LVYET+NF   KLLDGVLHAVPGTG
Sbjct  255  WTGPQNGQWLLTIGSKVGKTGIALVYETSNF---KLLDGVLHAVPGTG  299



>gb|AAK71504.1| soluble acid invertase FRUCT2 [Ipomoea batatas]
Length=657

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLI+W HLPFAMVPDQWYD+NGVWTGSATILP+
Sbjct  147  GWYHLFYQYNPDSAVWGNITWGHAVSTDLINWLHLPFAMVPDQWYDVNGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG TD+ VQVQNLA+PA++ DPLL+DWVKY  NPV+ PPPGIGVKDFRDPTTA
Sbjct  207  GRIVMLYTGDTDDYVQVQNLAFPANLSDPLLVDWVKYPNNPVIYPPPGIGVKDFRDPTTA  266

Query  362  WMS-PNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +    G+WL+TIGSKVGKTGISLVYETTNFT +KLLDGVLHAVPGTG
Sbjct  267  WTAGSQNGQWLVTIGSKVGKTGISLVYETTNFTTFKLLDGVLHAVPGTG  315



>gb|KDO65460.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=528

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  27   GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  86

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  87   GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  146

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  147  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  193



>gb|KDO65465.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=461

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  201  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  261  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  307



>gb|KDO65463.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=573

 Score =   287 bits (735),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  201  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  261  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  307



>gb|KDO65464.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=494

 Score =   285 bits (729),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  201  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  261  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  307



>gb|KDO65462.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=589

 Score =   287 bits (735),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  201  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  261  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  307



>emb|CDP05324.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHW +LPFAMVPD+ +DINGVWTGSATILP 
Sbjct  33   GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWLYLPFAMVPDRPFDINGVWTGSATILPG  92

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI +LYTG T + VQVQNLAYPA++ DPLLLDW+KY GNPV++PPPGIG KDFRDPTTA
Sbjct  93   GQIAILYTGDTADLVQVQNLAYPANLSDPLLLDWIKYPGNPVMIPPPGIGKKDFRDPTTA  152

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P+  KWL+T+GSKV KTGI+LVYET++F  Y+LLDGVLHAVP TG
Sbjct  153  WLAPDGTKWLVTLGSKVNKTGIALVYETSDFKGYRLLDGVLHAVPRTG  200



>gb|AFU35318.1| soluble acid beta-fructofuranosidase, partial [Cichorium intybus]
Length=261

 Score =   276 bits (707),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPD+A+WGNITWGHA+S DLI+W HLPFAMVPD WYDINGVW+GSAT+LP+
Sbjct  13   GWYHLFYQYNPDAAVWGNITWGHAISTDLINWQHLPFAMVPDHWYDINGVWSGSATLLPD  72

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG +D+ VQVQNLAYPA++ DPLLLDWVKY GNPVLVPPPGIG +DFRDPTTA
Sbjct  73   GKIVMLYTGDSDQEVQVQNLAYPANLSDPLLLDWVKYPGNPVLVPPPGIGAQDFRDPTTA  132

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +PN GKW + +G+K+ KTGI+LVYETTNFT ++LLD V+HA PGTG
Sbjct  133  WFNPN-GKWRVGLGAKIEKTGITLVYETTNFTSFELLDEVMHAFPGTG  179



>gb|ABI17894.1| vacuolar invertase [Coffea canephora]
Length=586

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHW +LPFAMVPD+ +DINGVWTGSATILP 
Sbjct  80   GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWLYLPFAMVPDRPFDINGVWTGSATILPG  139

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIV+LYTG T + VQVQNLAYPA++ DPLLLDW+KY GNPV++PPPGIG KDFRDPTTA
Sbjct  140  GQIVILYTGDTADLVQVQNLAYPANLSDPLLLDWIKYPGNPVMIPPPGIGKKDFRDPTTA  199

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P+  KWL+T+GSKV KTGI+LVYET++F  Y+LLDGVLHAVP TG
Sbjct  200  WLAPDGTKWLVTLGSKVNKTGIALVYETSDFKGYRLLDGVLHAVPRTG  247



>gb|KDO65459.1| hypothetical protein CISIN_1g006523mg [Citrus sinensis]
Length=642

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  201  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  261  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  307



>ref|XP_010259021.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X2 [Nelumbo nucifera]
Length=593

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS+DLIHW +LP AMVPD WYDINGVWTGSAT+LP+
Sbjct  156  GWYHLFYQYNPDSAVWGNITWGHAVSKDLIHWLYLPLAMVPDHWYDINGVWTGSATLLPD  215

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G +V+LYTGSTDE VQVQNLA+PAD  DPLLL W+KY GNPV+VPPPGIG  DFRDPTTA
Sbjct  216  GSVVILYTGSTDEKVQVQNLAHPADPSDPLLLHWIKYPGNPVMVPPPGIGTLDFRDPTTA  275

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P+ G W +T+GSKV +TGISLVY+TTNFT Y+LLDGVLHAVPGTG
Sbjct  276  WLTPD-GNWRLTLGSKVNETGISLVYQTTNFTSYELLDGVLHAVPGTG  322



>gb|AAL27709.3|AF433643_1 vacuolar invertase [Citrus sinensis]
Length=588

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVL+PP  IG KDFRDPTTA
Sbjct  201  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLMPPRHIGPKDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  261  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  307



>ref|XP_007038396.1| Glycosyl hydrolases family 32 protein isoform 2 [Theobroma cacao]
 gb|EOY22897.1| Glycosyl hydrolases family 32 protein isoform 2 [Theobroma cacao]
Length=445

 Score =   281 bits (720),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHW +LP AMVPD WYDINGVWTGSAT+LP+
Sbjct  77   GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWLYLPLAMVPDCWYDINGVWTGSATLLPD  136

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGST+E+ QVQNLAYPA++ DPLLLDW+KY GNPV+VPP GI   +FRDPTTA
Sbjct  137  GQIVMLYTGSTNESAQVQNLAYPANLSDPLLLDWLKYPGNPVIVPPAGIETDEFRDPTTA  196

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W ITIGS+  +T GISLVY+TTNFTDY+LLDGVLHAVPGTG
Sbjct  197  WLGPD-GTWRITIGSRFNETIGISLVYQTTNFTDYELLDGVLHAVPGTG  244



>dbj|BAB82420.1| acid invertase [Citrus unshiu]
Length=172

 Score =   272 bits (695),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  6    GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  65

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY  NPVLVPP  IG KDFRDPTTA
Sbjct  66   GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPVNPVLVPPRHIGPKDFRDPTTA  125

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGS +GKTGISLVY+TT+F  Y+LLD  LH VPG G
Sbjct  126  WAGPD-GKWRLTIGSTIGKTGISLVYQTTDFKTYELLDEYLHPVPGAG  172



>gb|AFH77956.1| vacuolar invertase [Manihot esculenta]
Length=639

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 154/169 (91%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSAT+LP+
Sbjct  140  GWYHLFYQYNPDSAVWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATLLPD  199

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T ++VQVQNLAYPA++ DPLL+DW+KY GNPVLVPPPGI   +FRDPTT 
Sbjct  200  GQIMMLYTGDTIDSVQVQNLAYPANLSDPLLIDWIKYPGNPVLVPPPGIETDEFRDPTTG  259

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGS+V +T G+SLVY+TTNFT Y+LL+G LHAVPGTG
Sbjct  260  WLGPD-GKWRITIGSRVNETIGVSLVYQTTNFTTYELLEGFLHAVPGTG  307



>ref|XP_010259020.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform X1 [Nelumbo nucifera]
Length=664

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS+DLIHW +LP AMVPD WYDINGVWTGSAT+LP+
Sbjct  156  GWYHLFYQYNPDSAVWGNITWGHAVSKDLIHWLYLPLAMVPDHWYDINGVWTGSATLLPD  215

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G +V+LYTGSTDE VQVQNLA+PAD  DPLLL W+KY GNPV+VPPPGIG  DFRDPTTA
Sbjct  216  GSVVILYTGSTDEKVQVQNLAHPADPSDPLLLHWIKYPGNPVMVPPPGIGTLDFRDPTTA  275

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P+ G W +T+GSKV +TGISLVY+TTNFT Y+LLDGVLHAVPGTG
Sbjct  276  WLTPD-GNWRLTLGSKVNETGISLVYQTTNFTSYELLDGVLHAVPGTG  322



>ref|XP_009775767.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana sylvestris]
Length=652

 Score =   286 bits (733),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP++A+WGNI WGHAVSRDLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  150  GWYHLFYQYNPEAAVWGNIVWGHAVSRDLIHWQHLPVAMVADQWYDINGVWTGSATILPD  209

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++VMLYTGST+E+VQVQNLAYPAD  DPLL  WVKY GNPVLVPPPGI  KDFRDPTTA
Sbjct  210  GKLVMLYTGSTNESVQVQNLAYPADPSDPLLRKWVKYEGNPVLVPPPGIAAKDFRDPTTA  269

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSKV KTGISLVY+T +F +++LLDGVLH VPGTG
Sbjct  270  WTTPQ-GKWRITIGSKVNKTGISLVYDTIDFKNFELLDGVLHGVPGTG  316



>ref|XP_006421676.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
 gb|ESR34916.1| hypothetical protein CICLE_v10004465mg [Citrus clementina]
Length=685

 Score =   287 bits (735),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  184  GWYHLFYQYNPDSAVWGNITWGHAVSADLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  243

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  244  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  303

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  304  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  350



>ref|NP_001275874.1| beta-fructofuranosidase, soluble isoenzyme I-like [Citrus sinensis]
 dbj|BAF34363.1| beta-fructofuranosidase [Citrus sinensis]
Length=642

 Score =   286 bits (732),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHA S DLIHW +LP AMVPDQWYDINGVWTGSATILP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAASTDLIHWLYLPIAMVPDQWYDINGVWTGSATILPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGSTD++VQVQNLAYPAD  DPLLLDWVKY GNPVLVPP  IG KDFRDPTTA
Sbjct  201  GQIVMLYTGSTDKSVQVQNLAYPADPSDPLLLDWVKYPGNPVLVPPRHIGPKDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW +TIGSK+GKTGISLVY+TT+F  Y+LLD  LHAVPGTG
Sbjct  261  WAGPD-GKWRLTIGSKIGKTGISLVYQTTDFKTYELLDEYLHAVPGTG  307



>ref|XP_009630517.1| PREDICTED: acid beta-fructofuranosidase-like [Nicotiana tomentosiformis]
Length=652

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP++A+WGNI WGHAVSRDLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  150  GWYHLFYQYNPEAAVWGNIVWGHAVSRDLIHWQHLPVAMVADQWYDINGVWTGSATILPD  209

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++VMLYTGST+E+VQVQNLAYPAD  DPLL  WVKY GNPVLVPPPGI  KDFRDPTTA
Sbjct  210  GKLVMLYTGSTNESVQVQNLAYPADPSDPLLRKWVKYEGNPVLVPPPGIATKDFRDPTTA  269

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSKV KTGISLVY+T +F  ++LLDGVLH VPGTG
Sbjct  270  WTTPQ-GKWRITIGSKVNKTGISLVYDTIDFKKFELLDGVLHGVPGTG  316



>emb|CAA53098.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHA+SRDLI+W HLPFAM PDQWYDINGVWTGSATILP+
Sbjct  154  GWYHLFYQYNPDSAIWGNITWGHAISRDLINWLHLPFAMQPDQWYDINGVWTGSATILPD  213

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG TD+ VQVQNLAYPA++ DPLLLDW+KY  NPV+ PPPGIG  DFRDPTTA
Sbjct  214  GKIVMLYTGDTDDLVQVQNLAYPANLSDPLLLDWIKYPDNPVMFPPPGIGSTDFRDPTTA  273

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSKV KTGISL+Y+TT+F  Y+LLD +LHAVPGTG
Sbjct  274  WIGPD-GKWRITIGSKVNKTGISLMYKTTDFITYELLDNLLHAVPGTG  320



>gb|AAD01606.1| beta-fructofuranosidase [Ipomoea batatas]
Length=656

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 153/170 (90%), Gaps = 2/170 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAV-SRDLIHWFHLPFAMVPDQWYDINGVWTGSATILP  178
            GWYH FYQYNPDSA+WGNITWGHAV   DLI+W HLPFAMVPDQWYD+NGVWTGSATILP
Sbjct  154  GWYHFFYQYNPDSAVWGNITWGHAVFPTDLINWIHLPFAMVPDQWYDVNGVWTGSATILP  213

Query  179  NGQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTT  358
            +G+IVMLYTG TD+ VQVQNLA+PA++ DPLL+DWVKY  NPV+ PPPGIGVKDFRDPTT
Sbjct  214  DGRIVMLYTGDTDDYVQVQNLAFPANLSDPLLVDWVKYPNNPVIYPPPGIGVKDFRDPTT  273

Query  359  AWMS-PNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            AW +    G+WL+TIGSKVGKTGISLVYETTNFT +KLLDGVLHAVPGTG
Sbjct  274  AWTAGSQNGQWLVTIGSKVGKTGISLVYETTNFTTFKLLDGVLHAVPGTG  323



>ref|XP_010536536.1| PREDICTED: acid beta-fructofuranosidase-like [Tarenaya hassleriana]
Length=650

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+SA+WGNI+WGHAVS D+IHW +LPFAMVPDQWYD+NGVWTGSATILPN
Sbjct  143  GWYHLFYQYNPESAVWGNISWGHAVSTDMIHWMYLPFAMVPDQWYDVNGVWTGSATILPN  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G I+MLYTGST  +VQVQNLAYP ++ DPLLLDW KY GNPV+VPPPGIG KDFRDPTTA
Sbjct  203  GMIMMLYTGSTVGSVQVQNLAYPVNLSDPLLLDWAKYPGNPVMVPPPGIGTKDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ PN GKW + IGSKVGKTG+++VYETTNF  Y+L+D VLHAVPGTG
Sbjct  263  WLGPN-GKWRVAIGSKVGKTGLTMVYETTNFISYELVDEVLHAVPGTG  309



>emb|CAA53099.1| beta-fructofuranosidase [Daucus carota]
Length=661

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHA+SRDLI+W HLPFAM PDQWYDINGVWTGSATILP+
Sbjct  154  GWYHLFYQYNPDSAIWGNITWGHAISRDLINWLHLPFAMQPDQWYDINGVWTGSATILPD  213

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG TD+ VQVQNLAYPA++ DPLLLDW+KY  NPV+ PPPGIG  DFRDPTTA
Sbjct  214  GKIVMLYTGDTDDLVQVQNLAYPANLSDPLLLDWIKYPDNPVMFPPPGIGSTDFRDPTTA  273

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSKV KTGISL+Y+TT+F  Y+LLD +LHAVPGTG
Sbjct  274  WIGPD-GKWRITIGSKVNKTGISLMYKTTDFITYELLDNLLHAVPGTG  320



>ref|XP_007210314.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
 gb|EMJ11513.1| hypothetical protein PRUPE_ppa002334mg [Prunus persica]
Length=686

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  152  GWYHFFYQYNPNKAVWGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  211

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLLL+WVKYSGNPVLVPPPGIG KDFRDPTTA
Sbjct  212  GKIVMLYTGSTNESVQVQNLAYPADHSDPLLLNWVKYSGNPVLVPPPGIGYKDFRDPTTA  271

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+LL+GVLHAVPGTG
Sbjct  272  WFTSE-GKWRITIGSKLNKTGISLVYDTKDFKTYELLNGVLHAVPGTG  318



>ref|XP_008238615.1| PREDICTED: acid beta-fructofuranosidase-like [Prunus mume]
Length=686

 Score =   285 bits (729),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  152  GWYHFFYQYNPNKAVWGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  211

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLLL+WVKYSGNPVLVPPPGIG KDFRDPTTA
Sbjct  212  GKIVMLYTGSTNESVQVQNLAYPADHSDPLLLNWVKYSGNPVLVPPPGIGYKDFRDPTTA  271

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+LL+GVLHAVPGTG
Sbjct  272  WFTSE-GKWRITIGSKLNKTGISLVYDTKDFKTYELLNGVLHAVPGTG  318



>ref|XP_007038395.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
 gb|EOY22896.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
Length=646

 Score =   284 bits (726),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHW +LP AMVPD WYDINGVWTGSAT+LP+
Sbjct  142  GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWLYLPLAMVPDCWYDINGVWTGSATLLPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGST+E+ QVQNLAYPA++ DPLLLDW+KY GNPV+VPP GI   +FRDPTTA
Sbjct  202  GQIVMLYTGSTNESAQVQNLAYPANLSDPLLLDWLKYPGNPVIVPPAGIETDEFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W ITIGS+  +T GISLVY+TTNFTDY+LLDGVLHAVPGTG
Sbjct  262  WLGPD-GTWRITIGSRFNETIGISLVYQTTNFTDYELLDGVLHAVPGTG  309



>ref|XP_004298661.1| PREDICTED: acid beta-fructofuranosidase-like [Fragaria vesca 
subsp. vesca]
Length=694

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVSRDLIHW HLP AMV DQWYDINGVWTGSATILPN
Sbjct  159  GWYHFFYQYNPKGAVWGNIVWGHAVSRDLIHWLHLPLAMVADQWYDINGVWTGSATILPN  218

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGST+E+VQVQ LAYPAD  DPLL  W+KYSGNPVL PPPGIG+KDFRDPTTA
Sbjct  219  GQIVMLYTGSTNESVQVQCLAYPADHNDPLLTKWIKYSGNPVLFPPPGIGIKDFRDPTTA  278

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSKV KTGISLVY+T +F  Y+ LDGVLHAVPGTG
Sbjct  279  WYTKE-GKWRITIGSKVNKTGISLVYDTKDFIKYEQLDGVLHAVPGTG  325



>gb|KDP25630.1| hypothetical protein JCGZ_20786 [Jatropha curcas]
Length=659

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNPD+A+WGNI WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  153  GWYHFFYQYNPDAAVWGNIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  212

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLL++WVKYS NPVLVPPPGIG+KDFRDPTTA
Sbjct  213  GKIVMLYTGSTNESVQVQNLAYPADHNDPLLIEWVKYSSNPVLVPPPGIGIKDFRDPTTA  272

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSKVGKTGI+L+Y+T +F +Y+L + VLH VPGTG
Sbjct  273  WYTSE-GKWRITIGSKVGKTGIALIYDTVDFINYELRNQVLHGVPGTG  319



>gb|AEY79730.1| vacuolar invertase isoform 2 [Rosa hybrid cultivar]
Length=640

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVSRDLIHW HLP AMV DQWYDINGVWTGSATILPN
Sbjct  105  GWYHFFYQYNPRGAVWGNIVWGHAVSRDLIHWLHLPLAMVADQWYDINGVWTGSATILPN  164

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
             QIVMLYTGST+E+VQVQ LAYPAD  DPLL  WVKYSGNPVLVPPPGIGVKDFRDPTTA
Sbjct  165  DQIVMLYTGSTNESVQVQCLAYPADHKDPLLTKWVKYSGNPVLVPPPGIGVKDFRDPTTA  224

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W     GKW ITIGSKV KTGISLVY+T +F  Y+ LDGVLHAVPGTG
Sbjct  225  WYITE-GKWRITIGSKVNKTGISLVYDTKDFIKYEQLDGVLHAVPGTG  271



>ref|XP_008234397.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Prunus mume]
Length=637

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPD+W+D NGVWTGS+TILP+
Sbjct  135  GWYHLFYQYNPDSAVWGNITWGHAVSIDLIHWLYLPIAMVPDRWFDANGVWTGSSTILPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIV+LYTGST+E+VQVQNLAYPA++ DPLLL WVKYSGNPVL PPPGIG  DFRDPTTA
Sbjct  195  GQIVILYTGSTNESVQVQNLAYPANLSDPLLLHWVKYSGNPVLTPPPGIGSTDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W ITIGSKV KTGIS+VY T NF DY+LL+GVLHAVPGTG
Sbjct  255  WIGPD-GLWRITIGSKVNKTGISIVYTTANFIDYELLEGVLHAVPGTG  301



>ref|XP_002510944.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
 gb|EEF51546.1| Beta-fructofuranosidase, soluble isoenzyme I precursor, putative 
[Ricinus communis]
Length=639

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 153/169 (91%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRDLIHW +LP AMVPD+WYDINGVWTGSAT+LP+
Sbjct  137  GWYHLFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPMAMVPDKWYDINGVWTGSATLLPD  196

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTG T+ +VQVQNLAYPA++ DPLL+DW+KY GNPVLVPPPGI   +FRDPTTA
Sbjct  197  GQIVMLYTGDTNASVQVQNLAYPANLSDPLLIDWIKYPGNPVLVPPPGIETDEFRDPTTA  256

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            WM P+ G W IT+GS++ +T GISLVY+TTNFT Y+LLDG+LHAVPGTG
Sbjct  257  WMGPD-GTWRITLGSRMNETVGISLVYQTTNFTTYELLDGLLHAVPGTG  304



>ref|XP_007218855.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20054.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
Length=513

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPD+W+D NGVWTGS+TILP+
Sbjct  9    GWYHLFYQYNPDSAVWGNITWGHAVSIDLIHWLYLPLAMVPDRWFDANGVWTGSSTILPD  68

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIV+LYTGST+E+VQVQNLAYPA++ DPLLL WVKYSGNPVL  PPGIG  DFRDPTTA
Sbjct  69   GQIVILYTGSTNESVQVQNLAYPANLSDPLLLHWVKYSGNPVLTAPPGIGSTDFRDPTTA  128

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W IT+GSKV KTGIS+VY T NF DY+LL+GVLHAVPGTG
Sbjct  129  WIGPD-GLWRITLGSKVNKTGISIVYTTANFIDYELLEGVLHAVPGTG  175



>gb|AFR11328.1| acid invertase, partial [Actinidia eriantha]
Length=248

 Score =   270 bits (690),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = +2

Query  8    YHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQ  187
            YHLFYQYNPDSAIWGNITWGHAVS DLIHW +LP AMVPD WYD NGVWTGSAT+LP+GQ
Sbjct  1    YHLFYQYNPDSAIWGNITWGHAVSIDLIHWLYLPIAMVPDHWYDYNGVWTGSATLLPDGQ  60

Query  188  IVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWM  367
            I++LYTG TD+ VQVQNLAYPA++ DPLLLD VKY GNPV+VPPPGIG+KDFR+PTTAW+
Sbjct  61   IIILYTGDTDDYVQVQNLAYPANLSDPLLLDLVKYEGNPVIVPPPGIGIKDFRNPTTAWV  120

Query  368  SPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
             P+ GKW + IGSKV  TGI+LVY+TTNFT Y+LL+GV+HAVPGTG
Sbjct  121  GPD-GKWRVAIGSKVNSTGITLVYQTTNFTSYELLEGVMHAVPGTG  165



>dbj|BAD91193.1| soluble acid invertase [Pyrus communis]
Length=200

 Score =   268 bits (686),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP+ A+WG+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  26   GWYHFFYQWNPNGAVWGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  85

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLL  WVKYSGNP+LVPPPGIG KDFRDPTTA
Sbjct  86   GKIVMLYTGSTNESVQVQNLAYPADHNDPLLTKWVKYSGNPILVPPPGIGYKDFRDPTTA  145

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+ L+GVLHAVPGTG
Sbjct  146  WYTSQ-GKWRITIGSKLNKTGISLVYDTKDFKTYEQLNGVLHAVPGTG  192



>sp|P80065.2|INVB_DAUCA RecName: Full=Beta-fructofuranosidase, soluble isoenzyme I; AltName: 
Full=Invertase; AltName: Full=Saccharase; AltName: Full=Sucrose 
hydrolase; Flags: Precursor [Daucus carota]
 emb|CAA53097.1| beta-fructofuranosidase [Daucus carota]
 emb|CAA77267.1| beta-fructofuranosidase, isoform I [Daucus carota]
Length=661

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHA+SRDLI+W HLPFAM PDQWYDINGVWTGSAT+LP+
Sbjct  154  GWYHLFYQYNPDSAIWGNITWGHAISRDLINWLHLPFAMQPDQWYDINGVWTGSATVLPD  213

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG TD+ VQVQNLAYPA++ DPLLLDW+KY  NPV+ PPPGIG  DFRDPTTA
Sbjct  214  GKIVMLYTGDTDDLVQVQNLAYPANLSDPLLLDWIKYPDNPVMFPPPGIGSTDFRDPTTA  273

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+  + GKW ITIGSKV KTGISL+Y+TT+F  Y+LLD +LHAVPGTG
Sbjct  274  WIGRD-GKWRITIGSKVNKTGISLMYKTTDFITYELLDNLLHAVPGTG  320



>ref|XP_011101120.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYN +SA+WGNITWGHAVSRDLIHW HLP+AMVPDQWYD+NGVWTGSATILP+
Sbjct  145  GWYHLFYQYNQESAVWGNITWGHAVSRDLIHWLHLPYAMVPDQWYDVNGVWTGSATILPD  204

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG T + VQVQ LAYPAD+ DPLLL WVKY  NPV+VPPPGIG KDFRDPTTA
Sbjct  205  GRIMMLYTGDTHDVVQVQCLAYPADLSDPLLLKWVKYQNNPVMVPPPGIGHKDFRDPTTA  264

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+SP+  KW ITIGSK+  TGISLVYET +F  Y+LLDG LH VPGTG
Sbjct  265  WLSPDGDKWRITIGSKINTTGISLVYETADFFKYELLDGYLHEVPGTG  312



>dbj|BAD91192.1| soluble acid invertase [Pyrus communis]
Length=200

 Score =   268 bits (685),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+W+D NGVWTGSAT+LP+
Sbjct  26   GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPD  85

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLLLDWVKY GNP+L PP GIG  DFRDPTTA
Sbjct  86   GQIIMLYTGSTNESVQVQNLAYPANLSDPLLLDWVKYEGNPILTPPSGIGSTDFRDPTTA  145

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW  TIGSK   TGIS+VY TT+F +Y+L DGVLH VPGTG
Sbjct  146  WIGPD-GKWRTTIGSKFNTTGISMVYTTTDFINYELHDGVLHEVPGTG  192



>dbj|BAP47496.1| invertase [Gentiana triflora]
Length=658

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNI+WGHAVS DLIHW HLP + +PD+WYD NGVWTGSATILP+
Sbjct  150  GWYHLFYQYNPDSAVWGNISWGHAVSTDLIHWLHLPISFIPDKWYDSNGVWTGSATILPD  209

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYPA++ DPLLLDWVKY GNPVLVPPPGIG +DFRDPTTA
Sbjct  210  GSIVMLYTGSTDDLVQVQNLAYPANLSDPLLLDWVKYPGNPVLVPPPGIGGQDFRDPTTA  269

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+  KW ITIGSKV KTG+SLVYET +F  YKL DG LH VPGTG
Sbjct  270  WAGPDGKKWFITIGSKVNKTGVSLVYETVDFKKYKLWDGFLHEVPGTG  317



>ref|XP_010264216.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Nelumbo nucifera]
Length=660

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPD A+WGNITWGHAVS+DLIHW +LP AM+PDQWYDINGVWTGSAT LP+
Sbjct  150  GWYHLFYQYNPDGAVWGNITWGHAVSKDLIHWLYLPLAMIPDQWYDINGVWTGSATQLPD  209

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IV+LYTGSTD+ VQVQNLAYPAD  DPLLL W KY GNPV++PPPGIG  DFRDPTTA
Sbjct  210  GSIVVLYTGSTDKMVQVQNLAYPADPSDPLLLRWAKYPGNPVIIPPPGIGSLDFRDPTTA  269

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P+ GKW +T+GSK  KTGISLVY+TTNFT Y L+DGVLHAVPGTG
Sbjct  270  WFTPD-GKWRLTVGSKFHKTGISLVYQTTNFTTYDLVDGVLHAVPGTG  316



>dbj|BAM74662.1| acid invertase, partial [Ipomoea batatas]
Length=177

 Score =   266 bits (681),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+ A+WGNI WGHAVSRDLIHW HLP AM  DQWYDINGVWTGSAT L +
Sbjct  1    GWYHLFYQYNPEGAVWGNIVWGHAVSRDLIHWRHLPIAMTGDQWYDINGVWTGSATFLSD  60

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E+VQVQNLAYPAD  DPLLL+WVKY GN VLVPPPGI  KDFRDPTTA
Sbjct  61   GQLIMLYTGSTNESVQVQNLAYPADPSDPLLLEWVKYEGNLVLVPPPGIDDKDFRDPTTA  120

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W S + GKW ITIGSKV KTGISLVY+T +F  Y+LLDG LH VPGTG
Sbjct  121  W-STSEGKWRITIGSKVNKTGISLVYDTLDFKTYELLDGALHGVPGTG  167



>ref|XP_003635662.2| PREDICTED: acid beta-fructofuranosidase-like, partial [Vitis 
vinifera]
Length=273

 Score =   270 bits (690),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNPD+A+WGNI WGHAVS+DLI W HLP AMV DQWYD NGVWTGSAT+L +
Sbjct  96   GWYHFFYQYNPDAAVWGNIVWGHAVSKDLIEWLHLPLAMVADQWYDTNGVWTGSATLLSD  155

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTG+T+E+VQVQNLAYPAD+ DPLL+DWVKY GNPVLVPPPGI  KDFRDPTTA
Sbjct  156  GQVIMLYTGATNESVQVQNLAYPADLSDPLLVDWVKYPGNPVLVPPPGIDDKDFRDPTTA  215

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW I IGSKV KTGISLVY T +F  Y+L++GVLHAVPGTG
Sbjct  216  WYWPD-GKWRIAIGSKVNKTGISLVYNTEDFKKYELIEGVLHAVPGTG  262



>gb|AAD10239.1| invertase [Oryza sativa Japonica Group]
Length=654

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLI+W HLPFAMVPDQWYD+NGVWTGSATILP+
Sbjct  142  GWYHLFYQYNPDSAVWGNITWGHAVSTDLINWLHLPFAMVPDQWYDVNGVWTGSATILPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG TD+ VQ QNLA+PA++ DPLL+DWVKY  NPV+ PPPGIGVKDFRDPTTA
Sbjct  202  GRIVMLYTGDTDDYVQDQNLAFPANLSDPLLVDWVKYPNNPVIYPPPGIGVKDFRDPTTA  261

Query  362  WMSP-NVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
              +    G+ L+TIGSKVGKTGISLVYETTNFT +KLL GVLHAVPGTG
Sbjct  262  GTAGMQNGQRLVTIGSKVGKTGISLVYETTNFTTFKLLYGVLHAVPGTG  310



>ref|XP_010106222.1| hypothetical protein L484_003380 [Morus notabilis]
 gb|EXC08928.1| hypothetical protein L484_003380 [Morus notabilis]
Length=648

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS DLIHW HLP AMVPD WYDING W+G+ATILP+
Sbjct  145  GWYHLFYQYNPDSAIWGNITWGHAVSSDLIHWLHLPIAMVPDHWYDINGAWSGAATILPD  204

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGSTDE+VQVQNLAYPA++ DPLLL+WVKY GNPVLVPPPGIG KDFRDPTTA
Sbjct  205  GKIIMLYTGSTDESVQVQNLAYPANLSDPLLLNWVKYDGNPVLVPPPGIGYKDFRDPTTA  264

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+  KW +T+GSKV KTGISLVY T +F  Y+LLD  LH VP TG
Sbjct  265  WIGPD-AKWRVTLGSKVNKTGISLVYRTDDFITYELLDHYLHEVPDTG  311



>ref|XP_011070162.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=652

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVSRDLIHW HLP AMVPD WYDINGVWTGSATIL +
Sbjct  149  GWYHFFYQYNPYGAVWGNIAWGHAVSRDLIHWRHLPMAMVPDDWYDINGVWTGSATILED  208

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++VMLYTGST+E+VQVQNLAYPAD LDPLL+DWVKY GNPVLVPPPGIG KDFRDPTTA
Sbjct  209  GRLVMLYTGSTNESVQVQNLAYPADPLDPLLVDWVKYPGNPVLVPPPGIGSKDFRDPTTA  268

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P  GKW   IGSK+ KTGISLVY+T +F  Y+LL+G+LH+VPGTG
Sbjct  269  WLTPQ-GKWRFIIGSKLNKTGISLVYDTKDFKTYELLNGLLHSVPGTG  315



>dbj|BAD91194.1| soluble acid invertase [Pyrus communis]
Length=200

 Score =   266 bits (679),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP+ A WG+I WGHAVS+DLIHWFHLP AMV DQWYDINGVWTGSATILP+
Sbjct  26   GWYHFFYQWNPNGATWGDIVWGHAVSKDLIHWFHLPLAMVADQWYDINGVWTGSATILPD  85

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IV+LYTGST+E+VQVQNLAYPAD  DPLL  WVKYSGNPVLVPPPGIG KDFRDPTTA
Sbjct  86   GKIVVLYTGSTNESVQVQNLAYPADHNDPLLTKWVKYSGNPVLVPPPGIGYKDFRDPTTA  145

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW I IGSK+ KTGISLVY+T +F  Y+ L+GVLHAVPGTG
Sbjct  146  WHTSE-GKWRIIIGSKLNKTGISLVYDTKDFKTYEQLNGVLHAVPGTG  192



>ref|XP_007218853.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 ref|XP_007218854.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20052.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
 gb|EMJ20053.1| hypothetical protein PRUPE_ppa002732mg [Prunus persica]
Length=639

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMVPD+W+D NGVWTGS+TILP+
Sbjct  135  GWYHLFYQYNPDSAVWGNITWGHAVSIDLIHWLYLPLAMVPDRWFDANGVWTGSSTILPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIV+LYTGST+E+VQVQNLAYPA++ DPLLL WVKYSGNPVL  PPGIG  DFRDPTTA
Sbjct  195  GQIVILYTGSTNESVQVQNLAYPANLSDPLLLHWVKYSGNPVLTAPPGIGSTDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W IT+GSKV KTGIS+VY T NF DY+LL+GVLHAVPGTG
Sbjct  255  WIGPD-GLWRITLGSKVNKTGISIVYTTANFIDYELLEGVLHAVPGTG  301



>gb|AFO84092.1| vacuolar invertase [Actinidia chinensis]
Length=632

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH++YQYNPDSAIWGNITWGHAVS DLIHW HLP AMVPD W+D NGVWTGSAT+LP+
Sbjct  126  GWYHIWYQYNPDSAIWGNITWGHAVSTDLIHWLHLPIAMVPDHWFDSNGVWTGSATLLPD  185

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIV+LYTG TD+ VQVQNLAYPA++ DPLLLD VKY GNP++VPPPGIG+KDFRDPTTA
Sbjct  186  GQIVILYTGDTDDYVQVQNLAYPANLSDPLLLDLVKYEGNPIMVPPPGIGMKDFRDPTTA  245

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW + IGSKV  TGI+LVY+TTNFT Y+LL+GV+HAVPGTG
Sbjct  246  WVGPD-GKWRVAIGSKVNTTGITLVYQTTNFTSYELLEGVMHAVPGTG  292



>gb|ACT21538.1| acid invertase [Vigna radiata]
Length=579

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD  GVWTGSATILPN
Sbjct  69   GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPN  128

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPAD  DPLLLDW+K++GNPVLVPPPGIG KDFRDPTTA
Sbjct  129  GEIIMLYTGSTNESVQVQNLAYPADPSDPLLLDWIKHTGNPVLVPPPGIGAKDFRDPTTA  188

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F  Y+L +G+L AVPGTG
Sbjct  189  WLTSE-GKWRITIGSKLNKTGIALVYDTEDFKTYELKEGLLRAVPGTG  235



>gb|KHG09862.1| Beta-fructofuranosidase, soluble isoenzyme I [Gossypium arboreum]
Length=523

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHWF+LP AMVPDQWYDING WTGSAT+LP+
Sbjct  10   GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPD  69

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPA++ DPLLL W+KY GNPV+VPP GI   +FRDPTTA
Sbjct  70   GRIVMLYTGSTNESVQVQNLAYPANLSDPLLLQWLKYPGNPVVVPPTGIEDNEFRDPTTA  129

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W IT+G++   T G +LV++TTNF+DY+LLDGVLHAVPGTG
Sbjct  130  WLGPD-GSWRITVGTRFNTTIGTALVFQTTNFSDYQLLDGVLHAVPGTG  177



>gb|AFU25743.1| truncated soluble acid invertase 1 [Rhododendron hybrid cultivar]
Length=434

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHW +LP AMVPD W+D+NGVWTGSAT+LP+
Sbjct  143  GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWLYLPIAMVPDHWFDLNGVWTGSATLLPD  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD  VQVQNLAYPA++ DPLLLDWVKY  NPV+VPPPGIG+  FRDP+TA
Sbjct  203  GQIIMLYTGDTDNAVQVQNLAYPANLSDPLLLDWVKYEQNPVIVPPPGIGLTYFRDPSTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   G W + IGSKV KTG +LVY+TTNFT ++L+DGV+HAVPGTG
Sbjct  263  WYA-QEGTWRVAIGSKVNKTGTALVYQTTNFTSFELMDGVMHAVPGTG  309



>ref|XP_006355490.1| PREDICTED: acid beta-fructofuranosidase-like [Solanum tuberosum]
Length=653

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP++A+WGNI WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSAT LPN
Sbjct  151  GWYHLFYQYNPEAAVWGNIVWGHAVSKDLIHWQHLPVAMVADQWYDINGVWTGSATFLPN  210

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G ++MLYTGST+E VQVQNLAYPAD  DPLL  W+KY GNPVL+PPPGIG+KDFRDPTTA
Sbjct  211  GDLIMLYTGSTNELVQVQNLAYPADPSDPLLKKWIKYEGNPVLIPPPGIGLKDFRDPTTA  270

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSK+ KTGISLVY+T +F  ++LL G LH VPGTG
Sbjct  271  WTTPE-GKWRITIGSKINKTGISLVYDTIDFKKFELLKGALHGVPGTG  317



>gb|AHK05786.1| vacuolar invertase [Eriobotrya japonica]
Length=646

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRD+IHW +LP AMVPD+W+D NGVWTGSATILPN
Sbjct  143  GWYHLFYQYNPDSAVWGNITWGHAVSRDMIHWLYLPLAMVPDRWFDANGVWTGSATILPN  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I++LYTGST+++VQVQNLAYPA++ DPLLLDW+KY GNPVL PP GIG  DFRDPTTA
Sbjct  203  GEIMILYTGSTNDSVQVQNLAYPANLSDPLLLDWIKYEGNPVLTPPSGIGSTDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK+  TGIS+VY TT+F +Y+L DG+LH VPGTG
Sbjct  263  WIGPD-GKWRITIGSKINTTGISMVYTTTDFINYELHDGLLHEVPGTG  309



>gb|KDP22418.1| hypothetical protein JCGZ_26249 [Jatropha curcas]
Length=627

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS+DLIHW +LP AMVPD+WYDING+WTGSAT+LP+
Sbjct  125  GWYHLFYQYNPDSAVWGNITWGHAVSKDLIHWLYLPLAMVPDKWYDINGMWTGSATLLPD  184

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T+ +VQVQNLAYPA++ DPLLLDWVKY GNPV++PPPGI + +FRDPTT 
Sbjct  185  GQIMMLYTGDTNASVQVQNLAYPANLSDPLLLDWVKYPGNPVIIPPPGIEISEFRDPTTG  244

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW I IGS+V KT G+SLVY+TTNFT Y+ L+GVLHAVPGTG
Sbjct  245  WLGPD-GKWRIAIGSRVNKTIGVSLVYQTTNFTTYEKLEGVLHAVPGTG  292



>ref|XP_009370474.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
 ref|XP_009372889.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=645

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+W+D NGVWTGSAT+LP+
Sbjct  142  GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLLLDWVKY GNP+L PP GIG  DFRDPTTA
Sbjct  202  GQIIMLYTGSTNESVQVQNLAYPANLSDPLLLDWVKYEGNPILTPPSGIGSTDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK   TGIS+VY TT+F +Y+L DGVLH VPGTG
Sbjct  262  WIGPD-GKWRITIGSKFNTTGISMVYTTTDFINYELHDGVLHEVPGTG  308



>gb|AFU25742.1| soluble acid invertase 2 [Rhododendron hybrid cultivar]
Length=643

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHW +LP AMVPD W+D+NGVWTGSAT+LP+
Sbjct  143  GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWLYLPIAMVPDHWFDLNGVWTGSATLLPD  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG TD  VQVQNLAYPA++ DPLLLDWVKY  NPV+VPPPGIG+  FRDP+TA
Sbjct  203  GQIIMLYTGDTDNAVQVQNLAYPANLSDPLLLDWVKYEQNPVIVPPPGIGLTYFRDPSTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   G W + IGSKV KTGI+LVY+TTNFT + L+DGV+HAVPGTG
Sbjct  263  WYAQE-GTWRVAIGSKVNKTGIALVYQTTNFTSFGLMDGVMHAVPGTG  309



>sp|P29001.1|INVA_VIGRR RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Contains: RecName: Full=Acid 
beta-fructofuranosidase 30 kDa subunit; Contains: RecName: 
Full=Acid beta-fructofuranosidase 38 kDa subunit; Flags: 
Precursor [Vigna radiata var. radiata]
 dbj|BAA01107.1| invertase [Vigna radiata]
 prf||1905412A acid invertase
Length=649

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD  GVWTGSATILPN
Sbjct  139  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPN  198

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPAD  DPLLLDW+K++GNPVLVPPPGIG KDFRDPTTA
Sbjct  199  GEIIMLYTGSTNESVQVQNLAYPADPSDPLLLDWIKHTGNPVLVPPPGIGAKDFRDPTTA  258

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F  Y+L +G+L AVPGTG
Sbjct  259  WLTSE-GKWRITIGSKLNKTGIALVYDTEDFKTYELKEGLLRAVPGTG  305



>emb|CDP09916.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPD A+WGNI WGHAVS DLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  151  GWYHLFYQYNPDGAVWGNIVWGHAVSTDLIHWRHLPIAMVADQWYDQNGVWTGSATILPD  210

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ+VMLYTGST+  VQVQNLAYPAD  DPLL++WVKY GNPVLVPPPGI  KDFRDPTTA
Sbjct  211  GQLVMLYTGSTNATVQVQNLAYPADPSDPLLIEWVKYPGNPVLVPPPGIHFKDFRDPTTA  270

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSKV KTGISLVY+T +F  Y+LLDGVLH VPGTG
Sbjct  271  WYTSE-GKWRITIGSKVNKTGISLVYDTVDFKSYELLDGVLHGVPGTG  317



>gb|AFU56882.1| vacuolar invertase [Malus domestica]
Length=645

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+WYD NGVWTGSATILPN
Sbjct  143  GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWYDANGVWTGSATILPN  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I++LYTGST+++VQVQNLAYPA++ DPLLLDW+KY GNPVL PP GIG  DFRDPTTA
Sbjct  203  GEIMILYTGSTNDSVQVQNLAYPANLSDPLLLDWIKYEGNPVLTPPSGIGSTDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK+  TGIS+VY TT+F +Y+L DGVLH VPGTG
Sbjct  263  WIGPD-GKWRITIGSKINTTGISMVYTTTDFINYELHDGVLHEVPGTG  309



>gb|AFV59227.2| vacuolar invertase NvINV [Elsholtzia haichowensis]
Length=637

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+SA+WG ITWGHAVSRDLIHW HLPFAMVPDQWYDI GVWTGSAT LP+
Sbjct  129  GWYHLFYQYNPESAVWGLITWGHAVSRDLIHWLHLPFAMVPDQWYDIKGVWTGSATFLPD  188

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG T + VQVQ LAYPA++ DPLLL+WVK S NPVL PPPGIG KDFRDPTTA
Sbjct  189  GRIVMLYTGDTYDEVQVQCLAYPANLSDPLLLEWVKDSNNPVLFPPPGIGSKDFRDPTTA  248

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+SP+  KW +TIGSKV  TGISLVYET +F  Y+LLD  LH VPGTG
Sbjct  249  WLSPDGDKWRLTIGSKVNTTGISLVYETKDFVKYELLDEYLHQVPGTG  296



>gb|KHN42772.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=534

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNI+WGHAVSRD+IHWF+LP AM PD WYDINGVWTGSATILP 
Sbjct  29   GWYHLFYQYNPDSAIWGNISWGHAVSRDMIHWFYLPIAMGPDTWYDINGVWTGSATILPG  88

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I++LYTG T+E VQVQNLAYPA++ DPLLLDWVKY+GNPVLVPPPGIG KDFRDPTT 
Sbjct  89   GKIIILYTGDTNEYVQVQNLAYPANLSDPLLLDWVKYAGNPVLVPPPGIGPKDFRDPTTG  148

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW + IGSK GK GISLVY TT+F +++  D  LHAVPGTG
Sbjct  149  WIGPD-GKWRVAIGSKKGKKGISLVYTTTDFVNFESNDHYLHAVPGTG  195



>ref|XP_009374489.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=646

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+W+D NGVWTGSATILPN
Sbjct  144  GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWFDANGVWTGSATILPN  203

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I++LYTGST+++VQVQNLAYPA++ DPLLLDW+KY GNPVL PP GIG  DFRDPTTA
Sbjct  204  GEIMILYTGSTNDSVQVQNLAYPANLSDPLLLDWIKYEGNPVLTPPSGIGSTDFRDPTTA  263

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK+  TGIS+VY TT+F +Y+L DGVLH VPGTG
Sbjct  264  WIGPD-GKWRITIGSKINTTGISMVYTTTDFVNYELYDGVLHEVPGTG  310



>ref|XP_008373808.1| PREDICTED: acid beta-fructofuranosidase [Malus domestica]
Length=681

 Score =   277 bits (708),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP+ AIWG+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  147  GWYHFFYQWNPNGAIWGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLL  WVKYSGNP+LVPPPGIG KDFRDPTTA
Sbjct  207  GKIVMLYTGSTNESVQVQNLAYPADHNDPLLTKWVKYSGNPILVPPPGIGYKDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+ L+GVLHAVPGTG
Sbjct  267  WYTSQ-GKWRITIGSKLNKTGISLVYDTKDFKTYEQLNGVLHAVPGTG  313



>ref|XP_011101190.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=621

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYN DSAIW NITWGHAVSRDLIHW HLP AM+PDQWYDINGVWTGSATILP+
Sbjct  105  GWYHLFYQYNQDSAIWSNITWGHAVSRDLIHWLHLPCAMLPDQWYDINGVWTGSATILPD  164

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG+T + VQVQ LAYPA++ DPLLL+WVKY  NPV++PPPGIG +DFRDPTTA
Sbjct  165  GRIMMLYTGNTHDLVQVQCLAYPANLSDPLLLEWVKYPNNPVMIPPPGIGHEDFRDPTTA  224

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W SP   KW ITIGSKV K GISLVYET +F  Y+LL+G LH VPGTG
Sbjct  225  WRSPGGDKWRITIGSKVNKMGISLVYETADFFKYELLEGYLHEVPGTG  272



>gb|KHN04338.1| Acid beta-fructofuranosidase [Glycine soja]
Length=555

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD+ GVWTGSATILPN
Sbjct  47   GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPN  106

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPA+  DPLL+DW+KY GNPVLVPPPGIG KDFRDPTTA
Sbjct  107  GEIIMLYTGSTNESVQVQNLAYPANPSDPLLVDWIKYPGNPVLVPPPGIGAKDFRDPTTA  166

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F +Y+L +G+L AV GTG
Sbjct  167  WLTSE-GKWRITIGSKLNKTGIALVYDTEDFKNYELKEGLLRAVAGTG  213



>gb|AFV59228.1| vacuolar invertase CvINV [Elsholtzia haichowensis]
Length=637

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+SA+WG ITWGHAVSRDLIHW HLPFAMVPDQWYDI GVWTGSAT LP+
Sbjct  129  GWYHLFYQYNPESAVWGLITWGHAVSRDLIHWLHLPFAMVPDQWYDIKGVWTGSATFLPD  188

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG T + VQVQ LAYPA++ DPLLL+WVK S NPVL PPPGIG KDFRDPTTA
Sbjct  189  GRIVMLYTGDTYDEVQVQCLAYPANLSDPLLLEWVKDSNNPVLFPPPGIGSKDFRDPTTA  248

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+SP+  KW +TIGSKV  TGISLVYET +F  Y+LLD  LH VPGTG
Sbjct  249  WLSPDGDKWRLTIGSKVNTTGISLVYETKDFVKYELLDEYLHQVPGTG  296



>gb|AFH77957.1| vacuolar invertase [Manihot esculenta]
Length=660

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  155  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWLHLPLAMVADQWYDQNGVWTGSATILPD  214

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLLLDWVKYSGNPVLVPPPGI  KDFRDPTTA
Sbjct  215  GKIVMLYTGSTNESVQVQNLAYPADPNDPLLLDWVKYSGNPVLVPPPGIDTKDFRDPTTA  274

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW I+IGSK+GKTGI+L+Y+T +F +YKL    LH VPGTG
Sbjct  275  WYTSE-GKWRISIGSKIGKTGIALIYDTEDFINYKLQPQALHGVPGTG  321



>ref|XP_008376436.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Malus domestica]
Length=645

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+W+D NGVWTGSAT+LP+
Sbjct  142  GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+++VQVQNLAYPA++ DPLLLDWVKY GNP+L PP GIG  DFRDPTTA
Sbjct  202  GQIIMLYTGSTNDSVQVQNLAYPANLSDPLLLDWVKYEGNPILTPPSGIGSTDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW  TIGSK  KTGIS+VY TT+F +Y+L DGVLH VPGTG
Sbjct  262  WIGPD-GKWRTTIGSKFNKTGISMVYTTTDFINYELHDGVLHEVPGTG  308



>ref|XP_009343902.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
 ref|XP_009343903.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=681

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP+ A+WG+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  147  GWYHFFYQWNPNGAVWGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLL  WVKYSGNP+LVPPPGIG KDFRDPTTA
Sbjct  207  GKIVMLYTGSTNESVQVQNLAYPADHNDPLLTKWVKYSGNPILVPPPGIGYKDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+ L+GVLHAVPGTG
Sbjct  267  WYTSQ-GKWRITIGSKLNKTGISLVYDTKDFKTYEQLNGVLHAVPGTG  313



>dbj|BAF35859.1| soluble acid invertase [Pyrus pyrifolia var. culta]
 dbj|BAG30920.1| soluble acid invertase [Pyrus pyrifolia]
Length=681

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP+ A+WG+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  147  GWYHFFYQWNPNGAVWGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLL  WVKYSGNP+LVPPPGIG KDFRDPTTA
Sbjct  207  GKIVMLYTGSTNESVQVQNLAYPADHNDPLLTKWVKYSGNPILVPPPGIGYKDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+ L+GVLHAVPGTG
Sbjct  267  WYTSQ-GKWRITIGSKLNKTGISLVYDTKDFKTYEQLNGVLHAVPGTG  313



>gb|AAB47172.1| vacuolar invertase 2, GIN2 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 664 aa]
Length=664

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNPD+A+WGNI WGHAVS+DLI W HLP AMV DQWYD NGVWTGSAT+L +
Sbjct  156  GWYHFFYQYNPDAAVWGNIVWGHAVSKDLIEWLHLPLAMVADQWYDTNGVWTGSATLLSD  215

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTG+T+E+VQVQNLAYPAD+ DPLL+DWVKY GNPVLVPPPGI  KDFRDPTTA
Sbjct  216  GQVIMLYTGATNESVQVQNLAYPADLSDPLLVDWVKYPGNPVLVPPPGIDDKDFRDPTTA  275

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW I IGSKV KTGISLVY T +F  Y+L++GVLHAVPGTG
Sbjct  276  WYWPD-GKWRIAIGSKVNKTGISLVYNTEDFKKYELIEGVLHAVPGTG  322



>gb|ACQ82802.1| vacuolar invertase [Gossypium hirsutum]
Length=645

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS+DLIHWF+LP AMVPDQWYDING WTGSAT+LP+
Sbjct  132  GWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPD  191

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPA++ DPLLL W+KY GNPV+VPP GI   +FRDPTTA
Sbjct  192  GRIVMLYTGSTNESVQVQNLAYPANLSDPLLLQWLKYPGNPVVVPPTGIEDNEFRDPTTA  251

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W IT+G++   T G +LV++TTNF+DY+LLDGVLHAVPGTG
Sbjct  252  WLGPD-GSWRITVGTRFNTTIGTALVFQTTNFSDYQLLDGVLHAVPGTG  299



>gb|KHN09790.1| Acid beta-fructofuranosidase [Glycine soja]
Length=619

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD+ GVWTGSATILPN
Sbjct  111  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPN  170

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPAD  DPLL+DW+KY GNPVLVPPPGIG KDFRDPTTA
Sbjct  171  GEIIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYPGNPVLVPPPGIGAKDFRDPTTA  230

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F  Y+L +G+L AV GTG
Sbjct  231  WLTSE-GKWRITIGSKLNKTGIALVYDTEDFKSYELKEGLLRAVDGTG  277



>ref|XP_011033927.1| PREDICTED: acid beta-fructofuranosidase [Populus euphratica]
Length=661

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP +A+WG+I WGHAVSRDLIHW HLP AMV D+WYD NGVWTGSATILP+
Sbjct  154  GWYHFFYQYNPHAAVWGDIVWGHAVSRDLIHWLHLPLAMVADKWYDKNGVWTGSATILPD  213

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLLL WVKYSGNPVLVPPPGIG KDFRDPTTA
Sbjct  214  GKIVMLYTGSTNESVQVQNLAYPADHDDPLLLKWVKYSGNPVLVPPPGIGAKDFRDPTTA  273

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW I IGSK+ KTGI+LVY+T +F +Y+LL G+LH VP TG
Sbjct  274  WKTSE-GKWRIVIGSKINKTGIALVYDTEDFINYELLSGILHGVPETG  320



>ref|XP_009350311.1| PREDICTED: acid beta-fructofuranosidase-like [Pyrus x bretschneideri]
Length=680

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP+ A+WG+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+
Sbjct  147  GWYHFFYQWNPNGAVWGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLL  WVKYSGNP+LVPPPG+G KDFRDPTTA
Sbjct  207  GKIVMLYTGSTNESVQVQNLAYPADHNDPLLTKWVKYSGNPILVPPPGVGYKDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+ L+GVLHAVPGTG
Sbjct  267  WYTSQ-GKWRITIGSKLNKTGISLVYDTKDFKTYEQLNGVLHAVPGTG  313



>ref|NP_001284469.1| acid beta-fructofuranosidase-like [Cucumis melo]
 gb|ACJ04702.1| invertase 2 [Cucumis melo]
Length=630

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+SA+WGNI+WGHAVSRDLIHW +LP+AMVPDQ YD+NGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPESAVWGNISWGHAVSRDLIHWLYLPYAMVPDQSYDVNGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG T + VQVQNLAYPA++ DPLLL+WVKY GNPVLVPPPGIG+KDFRDPTTA
Sbjct  190  GRIIMLYTGDTIDGVQVQNLAYPANLTDPLLLNWVKYPGNPVLVPPPGIGLKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGS+VG T G+SLVY T +F  Y+L+D  LHAVPGTG
Sbjct  250  WLGPD-GKWRITIGSRVGTTLGVSLVYTTNDFIKYELVDRFLHAVPGTG  297



>ref|XP_002272809.3| PREDICTED: acid beta-fructofuranosidase-like [Vitis vinifera]
Length=661

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNPD+A+WGNI WGHAVS+DLI W HLP AMV DQWYD NGVWTGSAT+L +
Sbjct  153  GWYHFFYQYNPDAAVWGNIVWGHAVSKDLIEWLHLPLAMVADQWYDTNGVWTGSATLLSD  212

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTG+T+E+VQVQNLAYPAD+ DPLL+DWVKY GNPVLVPPPGI  +DFRDPTTA
Sbjct  213  GQVIMLYTGATNESVQVQNLAYPADLSDPLLVDWVKYPGNPVLVPPPGIDDRDFRDPTTA  272

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW I IGSKV KTGISLVY T +F  Y+L++GVLHAVPGTG
Sbjct  273  WYWPD-GKWRIAIGSKVNKTGISLVYNTEDFKKYELIEGVLHAVPGTG  319



>ref|XP_003549902.1| PREDICTED: acid beta-fructofuranosidase-like isoform 1 [Glycine 
max]
Length=645

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD+ GVWTGSATILPN
Sbjct  137  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPN  196

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPAD  DPLL+DW+KY GNPVLVPPPGIG KDFRDPTTA
Sbjct  197  GEIIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYPGNPVLVPPPGIGTKDFRDPTTA  256

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F  Y+L +G+L AV GTG
Sbjct  257  WLTSE-GKWRITIGSKLNKTGIALVYDTEDFKSYELKEGLLRAVDGTG  303



>ref|XP_003526374.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=646

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNI+WGHAVSRD+IHWF+LP AM PD WYDINGVWTGSATILP 
Sbjct  141  GWYHLFYQYNPDSAIWGNISWGHAVSRDMIHWFYLPIAMGPDTWYDINGVWTGSATILPG  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I++LYTG T+E VQVQNLAYPA++ DPLLLDWVKY+GNPVLVPPPGIG KDFRDPTT 
Sbjct  201  GKIIILYTGDTNEYVQVQNLAYPANLSDPLLLDWVKYAGNPVLVPPPGIGPKDFRDPTTG  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW + IGSK GK GISLVY TT+F +++  D  LHAVPGTG
Sbjct  261  WIGPD-GKWRVAIGSKKGKKGISLVYTTTDFVNFESNDHYLHAVPGTG  307



>gb|ADF27779.1| soluble acid invertase 1 [Orobanche ramosa]
Length=661

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW HLP ++VPDQWYDINGVW+GS+TILP+
Sbjct  151  GWYHLFYQYNPDSAVWGNITWGHAVSMDLIHWLHLPLSVVPDQWYDINGVWSGSSTILPD  210

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG T + VQVQ LAYPA++ DPLLL+WVK   NPVLVPPPGIG KDFRDPTTA
Sbjct  211  GRIIMLYTGDTYDVVQVQCLAYPANLSDPLLLNWVKDPSNPVLVPPPGIGHKDFRDPTTA  270

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+SP+  KW ITIGSKV KTGISLVYET +F  Y LLDG L+AVPGTG
Sbjct  271  WLSPDGHKWRITIGSKVNKTGISLVYETKDFVKYNLLDGYLNAVPGTG  318



>ref|XP_003525803.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=645

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD+ GVWTGSATILPN
Sbjct  137  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDMQGVWTGSATILPN  196

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPA+  DPLL+DW+KY GNPVLVPPPGIG KDFRDPTTA
Sbjct  197  GEIIMLYTGSTNESVQVQNLAYPANPSDPLLVDWIKYPGNPVLVPPPGIGAKDFRDPTTA  256

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F +Y+L +G+L AV GTG
Sbjct  257  WLTSE-GKWRITIGSKLNKTGIALVYDTEDFKNYELKEGLLRAVAGTG  303



>gb|KHG24404.1| Beta-fructofuranosidase, soluble isoenzyme I [Gossypium arboreum]
Length=312

 Score =   264 bits (675),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP SAIWGNITWGHAVSRDLIHW +LP A+VPD WYDI GVWTGSATILP+
Sbjct  16   GWYHLFYQYNPYSAIWGNITWGHAVSRDLIHWLYLPLALVPDHWYDIKGVWTGSATILPD  75

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
             QI+MLYTG T+E+VQVQNLAYPA++ DPLLL W+KY GNPV+VPPPGI   DFRDPTTA
Sbjct  76   AQIIMLYTGETNESVQVQNLAYPANLSDPLLLHWLKYPGNPVMVPPPGIKPDDFRDPTTA  135

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P  G W +T+GSK   T GISLVY TTNF DY+ LDGVLHAVPGTG
Sbjct  136  WLGPE-GTWRLTMGSKFNTTIGISLVYHTTNFRDYEQLDGVLHAVPGTG  183



>ref|XP_010476187.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Camelina 
sativa]
Length=670

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  149  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPLAMVADQWYDSNGVWTGSATILPD  208

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D+ DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  209  GSIVMLYTGSTDKAVQVQNLAYPEDLNDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  268

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSK+ KTGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  269  WKTPE-GKWRITIGSKINKTGISLVYDTTDFKTYEKLDSLLHGVPNTG  315



>dbj|BAF35858.1| Soluble acid invertase [Pyrus pyrifolia var. culta]
Length=645

 Score =   273 bits (699),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+W+D NGVWTGSAT+LP+
Sbjct  142  GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLLLDWVKY GNP+L PP GIG  DFRDPTTA
Sbjct  202  GQIIMLYTGSTNESVQVQNLAYPANLSDPLLLDWVKYEGNPILTPPSGIGSTDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK   TGIS+VY T +F +Y+L +GVLH VPGTG
Sbjct  262  WIGPD-GKWRITIGSKFNTTGISMVYTTNDFINYELHNGVLHEVPGTG  308



>gb|AAL27629.1|AF434728_1 vacuolar invertase [Citrus aurantium]
Length=172

 Score =   258 bits (660),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  8    YHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQ  187
            YHLFYQYNP+ AIWG+I WGHAVS+DLIHW+HLP AMV DQWYDI GVWTGSATILP+G+
Sbjct  1    YHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILPDGK  60

Query  188  IVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWM  367
            ++MLYTGST+E+VQVQNLAYPAD  DPLL+ WVKY GNPVLVPPPGIG KDFRDPTTAW+
Sbjct  61   LMMLYTGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIGAKDFRDPTTAWL  120

Query  368  SPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            +   GKW I IGS++ +TGI+ VY+T +F +Y+LL GVLH VP TG
Sbjct  121  TSE-GKWRIAIGSRINRTGITFVYDTKDFINYELLRGVLHGVPNTG  165



>dbj|BAG30919.1| soluble acid invertase [Pyrus pyrifolia]
Length=645

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+W+D NGVWTGSAT+LP+
Sbjct  142  GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWFDANGVWTGSATLLPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLLLDWVKY GNP+L PP GIG  DFRDPTTA
Sbjct  202  GQIIMLYTGSTNESVQVQNLAYPANLSDPLLLDWVKYEGNPILTPPSGIGSTDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK   TGIS+VY T +F +Y+L +GVLH VPGTG
Sbjct  262  WIGPD-GKWRITIGSKFNTTGISMVYTTNDFINYELHNGVLHEVPGTG  308



>ref|XP_010493951.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar [Camelina 
sativa]
Length=669

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  148  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPLAMVADQWYDSNGVWTGSATILPD  207

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D+ DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  208  GSIVMLYTGSTDKAVQVQNLAYPEDLNDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  267

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSK+ KTGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  268  WKTPE-GKWRITIGSKINKTGISLVYDTTDFKTYEKLDSLLHGVPNTG  314



>gb|AFD62256.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD+ GVWTGSATILP+
Sbjct  136  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDLQGVWTGSATILPD  195

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E+VQVQNLAYPAD  DPLL+DW+KYS NPVLVPPPGIG KDFRDPTTA
Sbjct  196  GQLIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYSKNPVLVPPPGIGAKDFRDPTTA  255

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGI+LVY+T +F  Y+L + +L AVPGTG
Sbjct  256  WFTSE-GKWRITIGSKLNKTGIALVYDTEDFKSYELKEELLRAVPGTG  302



>ref|XP_002303519.1| vacuolar invertase family protein [Populus trichocarpa]
 gb|EEE78498.1| vacuolar invertase family protein [Populus trichocarpa]
Length=662

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP +A+WG+I WGHAVS+DLIHW HLP AMV D+WYD NGVWTGSATILP+
Sbjct  155  GWYHFFYQYNPHAAVWGDIVWGHAVSKDLIHWLHLPLAMVADKWYDKNGVWTGSATILPD  214

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLLL WVKYSGNPVLVPPPGIG KDFRDPTTA
Sbjct  215  GKIVMLYTGSTNESVQVQNLAYPADHDDPLLLKWVKYSGNPVLVPPPGIGAKDFRDPTTA  274

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW I IGSK+ KTGI+LVY+T +F +Y+LL G+LH VP TG
Sbjct  275  WKTSE-GKWRIIIGSKINKTGIALVYDTEDFINYELLSGILHGVPKTG  321



>ref|XP_009340588.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Pyrus x bretschneideri]
Length=645

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS D+IHW +LP AMVPD+W+D NGVWTGSATILPN
Sbjct  143  GWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAMVPDRWFDANGVWTGSATILPN  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G I++LYTGST+++VQVQ LAYPA++ DPLLLDW+KY GNPVL PP GIG  DFRDPTTA
Sbjct  203  GDIMILYTGSTNDSVQVQTLAYPANLSDPLLLDWIKYEGNPVLTPPSGIGSTDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK+  TGIS+VY TT+F +Y+L DGVLH VPGTG
Sbjct  263  WIGPD-GKWRITIGSKINTTGISMVYTTTDFVNYELYDGVLHEVPGTG  309



>emb|CAA47636.1| soluble beta-fructosidase [Daucus carota]
 emb|CAA77266.1| beta-fructofuranosidase, isoform II [Daucus carota]
Length=650

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGN-ITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILP  178
            GWYHLFYQYNPD AIWGN I WGHAVS DLIHW HLP AMV D WYD+NGVWTGSATILP
Sbjct  141  GWYHLFYQYNPDGAIWGNKIVWGHAVSSDLIHWKHLPVAMVTDHWYDVNGVWTGSATILP  200

Query  179  NGQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTT  358
            +GQIVMLYTGST+E+VQVQNLAYPAD  DPLL++WVKY GNPVLVPPPGI  KDFRDPTT
Sbjct  201  DGQIVMLYTGSTNESVQVQNLAYPADPSDPLLIEWVKYPGNPVLVPPPGIDFKDFRDPTT  260

Query  359  AWMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            AW +P  GKW + IGSK+ KTGISLVY+T +F ++ LLDGVLHAV GTG
Sbjct  261  AWRTPE-GKWRLIIGSKLNKTGISLVYDTVDFKNFTLLDGVLHAVHGTG  308



>ref|XP_002321831.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
 gb|EEF05958.2| hypothetical protein POPTR_0015s14790g [Populus trichocarpa]
Length=636

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LPFAMVPD WYDINGVWTGSAT+LP+
Sbjct  134  GWYHLFYQYNPDSAVWGNITWGHAVSTDLIHWLYLPFAMVPDHWYDINGVWTGSATLLPD  193

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLL+DWVKY  NPV+ PP G    +FRDPTTA
Sbjct  194  GQIMMLYTGSTNESVQVQNLAYPANLSDPLLIDWVKYPNNPVITPPNGTETDEFRDPTTA  253

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            WM P+ G W ITIGS+  K+ GISLVY+T+NFT Y+LL+GVLHAVPGTG
Sbjct  254  WMGPD-GTWRITIGSRHNKSIGISLVYQTSNFTTYELLEGVLHAVPGTG  301



>ref|XP_010458650.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Camelina 
sativa]
Length=669

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  148  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPLAMVADQWYDSNGVWTGSATILPD  207

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D+ DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  208  GSIVMLYTGSTDKAVQVQNLAYPEDLNDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  267

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSK+ KTGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  268  WKTPE-GKWRITIGSKINKTGISLVYDTTDFKTYEKLDTLLHGVPNTG  314



>gb|KHN11662.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=534

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH+FYQYNPDSA+WGNITWGHAVSRDLIHW +LP A+VPD+W+DI+GVW+GSAT+LP+
Sbjct  29   GWYHIFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPIALVPDKWFDISGVWSGSATLLPD  88

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG+TD NVQVQNLAYPA++ DPLLLDWVKY+ NPVLVPPPGIG KDFRDPTTA
Sbjct  89   GKILMLYTGNTDRNVQVQNLAYPANLSDPLLLDWVKYANNPVLVPPPGIGPKDFRDPTTA  148

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+  KW ITIGSK+ KTG+SL+Y+T +F  Y+  D  LH VPGTG
Sbjct  149  WIGPD-EKWRITIGSKLNKTGLSLLYKTQDFIHYEQSDRYLHQVPGTG  195



>gb|KDO48371.1| hypothetical protein CISIN_1g0052792mg, partial [Citrus sinensis]
Length=553

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+ AIWG+I WGHAVS+DLIHW+HLP AMV DQWYDI GVWTGSATILP+
Sbjct  142  GWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+++MLYTGST+E+VQVQNLAYPAD  DPLL+ WVKY GNPVLVPPPGIG KDFRDPTTA
Sbjct  202  GKLMMLYTGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIGAKDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I IGS++ +TGI+ VY+T +F +Y+LL GVLH VP TG
Sbjct  262  WLTSE-GKWRIAIGSRINRTGITFVYDTKDFINYELLRGVLHGVPNTG  308



>gb|AFR69121.1| vacuolar invertase [Manihot esculenta]
Length=653

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV +QWYD NGVWTGSATILP+
Sbjct  147  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWLHLPLAMVANQWYDQNGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G I+MLYTGST+E+VQVQNLAYPAD  DPLLL+W KYSGNPVLVPPPGI +KDFRDPTTA
Sbjct  207  GNIIMLYTGSTNESVQVQNLAYPADANDPLLLEWTKYSGNPVLVPPPGIDIKDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW I+IGSKVGKTG++L+Y+T +F +Y+L    LH VPGTG
Sbjct  267  WYTSE-GKWRISIGSKVGKTGVALIYDTEDFINYQLKSEALHGVPGTG  313



>emb|CAD19321.1| acid vacuolar invertase [Beta vulgaris]
Length=675

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVS+DLI W HLP AMV D+WYD NGVWTGSATILP+
Sbjct  166  GWYHFFYQYNPAGAVWGNIVWGHAVSKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPD  225

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLLL+WVKY GNPVLVPPPGIG  DFRDPTTA
Sbjct  226  GQIMMLYTGSTNESVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTA  285

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGISLVY+TT+F +Y+LL  +LHAV GTG
Sbjct  286  WLTSE-GKWRITIGSKINKTGISLVYDTTDFKNYELLSNILHAVQGTG  332



>ref|XP_011010942.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like, 
partial [Populus euphratica]
Length=520

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LPFAMVPD WYDINGVWTGSAT+LP+
Sbjct  18   GWYHLFYQYNPDSAVWGNITWGHAVSPDLIHWLYLPFAMVPDHWYDINGVWTGSATLLPD  77

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLL+DWVKY  NPV+ PP G    +FRDPTTA
Sbjct  78   GQIMMLYTGSTNESVQVQNLAYPANLSDPLLIDWVKYPKNPVITPPNGTETDEFRDPTTA  137

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            WM P+   W ITIGS+  K+ GISLVY+T+NFT Y+LL+GVLHAVPGTG
Sbjct  138  WMGPD-RTWRITIGSRHNKSIGISLVYQTSNFTTYELLEGVLHAVPGTG  185



>ref|XP_007155629.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
 gb|ESW27623.1| hypothetical protein PHAVU_003G217900g [Phaseolus vulgaris]
Length=651

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD  GVWTGSATILPN
Sbjct  139  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPN  198

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPAD  DPLL+DW+K+ GNPVLVPPPGIG KDFRDPTTA
Sbjct  199  GEIIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKHPGNPVLVPPPGIGAKDFRDPTTA  258

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F  Y+L +G L AVPGTG
Sbjct  259  WLTSE-GKWRITIGSKLNKTGIALVYDTDDFKTYELKNGHLRAVPGTG  305



>sp|O24509.1|INVA_PHAVU RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Phaseolus 
vulgaris]
 gb|AAB68679.1| soluble acid invertase [Phaseolus vulgaris]
Length=651

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD  GVWTGSATILPN
Sbjct  139  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPN  198

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLAYPAD  DPLL+DW+K+ GNPVLVPPPGIG KDFRDPTTA
Sbjct  199  GEIIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKHPGNPVLVPPPGIGAKDFRDPTTA  258

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+LVY+T +F  Y+L +G L AVPGTG
Sbjct  259  WLTSE-GKWRITIGSKLNKTGIALVYDTDDFKTYELKNGHLRAVPGTG  305



>gb|AAC99434.1| beta-fructofuranosidase [Hamamelis virginiana]
Length=171

 Score =   257 bits (656),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  11   HLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQI  190
            HLFYQYNPDSA+WGNITWGHAVSRD+IHW +LP AM+PD W+D  GVWTGSAT+LP+G+I
Sbjct  2    HLFYQYNPDSAVWGNITWGHAVSRDMIHWLYLPIAMIPDHWFDWFGVWTGSATLLPDGRI  61

Query  191  VMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMS  370
            ++LYTG TD  VQVQNLAYPA+  DPLLLDWVKY  NPV+VPP GI  KDFRDPTTAW+ 
Sbjct  62   IILYTGETDHYVQVQNLAYPANQSDPLLLDWVKYEDNPVIVPPTGIKPKDFRDPTTAWLG  121

Query  371  PNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            P+ G W +T+GSKV KTGISLVY+TTNFT Y+LLDGVLHAV GTG
Sbjct  122  PD-GTWRVTVGSKVNKTGISLVYQTTNFTSYELLDGVLHAVVGTG  165



>gb|AFP23357.1| soluble acid invertase [Litchi chinensis]
Length=643

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRDLIHW +LP AMVPDQ YDINGVWTGSAT+LP+
Sbjct  144  GWYHLFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPIAMVPDQPYDINGVWTGSATLLPD  203

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTG T E VQVQNLAYPA++ DPLLL WVKYSGNPVLVPP  I  KDFRDPTT 
Sbjct  204  GQIVMLYTGDTAELVQVQNLAYPANLSDPLLLHWVKYSGNPVLVPPTHIAPKDFRDPTTG  263

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK+  TG SL+Y TT+F  Y+LLD VLHAVPGTG
Sbjct  264  WIGPD-GKWRITIGSKINGTGFSLIYHTTDFKTYELLDHVLHAVPGTG  310



>gb|EYU24750.1| hypothetical protein MIMGU_mgv1a0026273mg, partial [Erythranthe 
guttata]
Length=419

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVS+DLIHW HLP AMVPD WYDINGVWTGSATIL +
Sbjct  6    GWYHFFYQYNPYGAVWGNIVWGHAVSKDLIHWRHLPIAMVPDNWYDINGVWTGSATILED  65

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E+VQVQNLAYP+D+ DPLL+DWVKY GNPVL PPPGI  +DFRDPTTA
Sbjct  66   GQLIMLYTGSTNESVQVQNLAYPSDLSDPLLVDWVKYPGNPVLGPPPGIAPQDFRDPTTA  125

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P  GKW  TIGS++ KTGISLVY+T +F  ++LL+G LH V GTG
Sbjct  126  WLTPE-GKWRFTIGSQINKTGISLVYDTKDFKTFELLNGALHRVAGTG  172



>ref|XP_003598216.1| Acid beta-fructofuranosidase [Medicago truncatula]
Length=517

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNI+WGHAVS D+IHW +LP AM PD+W+DINGVWTGSAT+LP+
Sbjct  12   GWYHLFYQYNPDSAVWGNISWGHAVSSDMIHWLYLPIAMEPDKWFDINGVWTGSATLLPD  71

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+++MLYTG TD  VQVQNLA+PA++ DPLLLDWVKY+ NP+L PPPGIG KDFRDPTT 
Sbjct  72   GEVIMLYTGDTDNYVQVQNLAHPANLSDPLLLDWVKYANNPILEPPPGIGSKDFRDPTTG  131

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW + IGSK G+TG+SLVY+TTNF +++L D  LHAVPGTG
Sbjct  132  WIGPD-GKWRVLIGSKKGQTGLSLVYKTTNFINFELNDNYLHAVPGTG  178



>gb|AFD62255.1| acid invertase [Kummerowia stipulacea]
Length=644

 Score =   271 bits (692),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH  YQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD+ GVWTGSATILP+
Sbjct  136  GWYHFLYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDLQGVWTGSATILPD  195

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E+VQVQNLAYPAD  DPLL+DW+KYS NPVLVPPPGIG KDFRDPTTA
Sbjct  196  GQLIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYSKNPVLVPPPGIGAKDFRDPTTA  255

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGI+LVY+T +F  Y+L + +L AVPGTG
Sbjct  256  WFTSE-GKWRITIGSKLNKTGIALVYDTEDFKSYELKEELLRAVPGTG  302



>emb|CAA57392.1| beta-fructofuranosidase [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   259 bits (662),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  11   HLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQI  190
            H FYQYNP  A+WGNI WGHAVS+DLI W HLP AMV D+WYD NGVWTGSATILP+GQI
Sbjct  2    HFFYQYNPAGAVWGNIVWGHAVSKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPDGQI  61

Query  191  VMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMS  370
            +MLYTGST+E+VQVQNLAYPA++ DPLLL+WVKY GNPVLVPPPGIG  DFRDPTTAW++
Sbjct  62   MMLYTGSTNESVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTAWLT  121

Query  371  PNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
               GKW ITIGSK+ KTGISLVY+TT+F +Y+LL  +LHAV GTG
Sbjct  122  SE-GKWRITIGSKINKTGISLVYDTTDFKNYELLSNILHAVQGTG  165



>ref|XP_010676175.1| PREDICTED: acid beta-fructofuranosidase-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=677

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVS+DLI W HLP AMV D+WYD NGVWTGSATILP+
Sbjct  168  GWYHFFYQYNPAGAVWGNIVWGHAVSKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPD  227

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLLL+WVKY GNPVLVPPPGIG  DFRDPTTA
Sbjct  228  GQIMMLYTGSTNESVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTA  287

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGISLVY+TT+F +Y+LL  +LHAV GTG
Sbjct  288  WLTSE-GKWRITIGSKLNKTGISLVYDTTDFKNYELLSNILHAVQGTG  334



>ref|XP_011081205.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I [Sesamum 
indicum]
Length=655

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI+WGHAVS+DLI+W HLP AMVPDQWYDINGVWTGSATIL +
Sbjct  153  GWYHFFYQYNPSGAVWGNISWGHAVSKDLINWRHLPLAMVPDQWYDINGVWTGSATILQD  212

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ+VMLYTGST+ +VQVQNLAYPAD  DPLL++WVKYS NPVLVPPPGI   DFRDPTTA
Sbjct  213  GQLVMLYTGSTNTSVQVQNLAYPADQSDPLLINWVKYSANPVLVPPPGIMDHDFRDPTTA  272

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P   KW I IGSK+ KTGISLVY+T +F  Y++LDGVLHAVP TG
Sbjct  273  WLTPE-RKWRIIIGSKINKTGISLVYDTMDFKTYEMLDGVLHAVPETG  319



>ref|XP_003533514.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=630

 Score =   270 bits (691),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH+FYQYNPDSA+WGNITWGHAVSRDLIHW +LP A+VPD+W+DI+GVW+GSAT+LP+
Sbjct  125  GWYHIFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPIALVPDKWFDISGVWSGSATLLPD  184

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG+TD NVQVQNLAYPA++ DPLLLDWVKY+ NPVLVPPPGIG KDFRDPTTA
Sbjct  185  GKILMLYTGNTDRNVQVQNLAYPANLSDPLLLDWVKYANNPVLVPPPGIGPKDFRDPTTA  244

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+  KW ITIGSK+ KTG+SL+Y+T +F  Y+  D  LH VPGTG
Sbjct  245  WIGPD-EKWRITIGSKLNKTGLSLLYKTQDFIHYEQSDRYLHQVPGTG  291



>gb|ACZ05614.1| vacuolar invertase 2 [Gossypium hirsutum]
Length=618

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP SAIWGNITWGHAVSRDLIHW +LP A+VPD WYDI GVWTGSATIL +
Sbjct  113  GWYHLFYQYNPYSAIWGNITWGHAVSRDLIHWLYLPLALVPDHWYDIKGVWTGSATILAD  172

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T+E+VQVQNLAYPA+V DPLLL W+KY GNPV+VPPPG+   DFRDPTTA
Sbjct  173  GQIIMLYTGETNESVQVQNLAYPANVSDPLLLHWLKYPGNPVMVPPPGVKPDDFRDPTTA  232

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W +T+GSK   T GISLVY TTNF DY+LLDGVLHAVPGTG
Sbjct  233  WLGPD-GTWRLTMGSKFDTTIGISLVYHTTNFRDYELLDGVLHAVPGTG  280



>gb|ADP08983.1| vacuolar invertase 1 [Gossypium hirsutum]
Length=648

 Score =   271 bits (692),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 150/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS DLIHWF+LP AMVPDQWYDING WTGSAT+LP+
Sbjct  135  GWYHLFYQYNPDSAIWGNITWGHAVSTDLIHWFYLPLAMVPDQWYDINGCWTGSATLLPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+++VQVQNLAYPA++ DPLLL W+KY GNPV+VPP GI  ++FRDPTTA
Sbjct  195  GRIVMLYTGSTNDSVQVQNLAYPANLSDPLLLQWLKYPGNPVVVPPTGIEDEEFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W I +G++   T G +LV++TTNF+DY+LLDGVLHAVPGTG
Sbjct  255  WLGPD-GSWRIVVGTRFNTTIGTALVFQTTNFSDYELLDGVLHAVPGTG  302



>ref|NP_001275813.1| acid beta-fructofuranosidase-like [Citrus sinensis]
 ref|XP_006440372.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
 dbj|BAF34362.1| beta-fructofuranosidase [Citrus sinensis]
 gb|ESR53612.1| hypothetical protein CICLE_v10019134mg [Citrus clementina]
Length=687

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+ AIWG+I WGHAVS+DLIHW+HLP AMV DQWYDI GVWTGSATILP+
Sbjct  142  GWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+++MLYTGST+E+VQVQNLAYPAD  DPLL+ WVKY GNPVLVPPPGIG KDFRDPTTA
Sbjct  202  GKLMMLYTGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIGAKDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I IGS++ +TGI+ VY+T +F +Y+LL GVLH VP TG
Sbjct  262  WLTSE-GKWRIAIGSRINRTGITFVYDTKDFINYELLRGVLHGVPNTG  308



>gb|AGU12782.1| vacuolar invertase 2a [Gossypium hirsutum]
Length=618

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP SAIWGNITWGHAVSRDLIHW +LP A+VPD WYDI GVWTGSATIL +
Sbjct  113  GWYHLFYQYNPYSAIWGNITWGHAVSRDLIHWLYLPLALVPDHWYDIKGVWTGSATILAD  172

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T+E+VQVQNLAYPA+V DPLLL W+KY GNPV+VPPPG+   DFRDPTTA
Sbjct  173  GQIIMLYTGETNESVQVQNLAYPANVSDPLLLHWLKYPGNPVMVPPPGVKPDDFRDPTTA  232

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W +T+GSK   T GISLVY TTNF DY+LLDGVLHAVPGTG
Sbjct  233  WLGPD-GTWRLTMGSKFDTTIGISLVYHTTNFRDYELLDGVLHAVPGTG  280



>gb|AFS17280.1| acid vacuolar invertase [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=658

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVS+DLI+W HLP AMV DQWYD NGVWTGSATILP+
Sbjct  156  GWYHFFYQYNPAGAVWGNIVWGHAVSKDLINWNHLPIAMVADQWYDFNGVWTGSATILPD  215

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+M+YTGST+E+VQVQNLAYPAD+ DPLL  WVKY GNPVLVPPPGI   DFRDPTTA
Sbjct  216  GQIMMVYTGSTNESVQVQNLAYPADLSDPLLQKWVKYPGNPVLVPPPGIDKLDFRDPTTA  275

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW +TIGSKV KTGISLVY+TT+F  Y+LL  +LHAVPGTG
Sbjct  276  WLTSE-GKWRLTIGSKVNKTGISLVYDTTDFKHYELLSNILHAVPGTG  322



>gb|KHN42709.1| Acid beta-fructofuranosidase [Glycine soja]
Length=675

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHWFHLP AMV DQWYD NGVWTGSATILP+
Sbjct  165  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWFHLPLAMVADQWYDKNGVWTGSATILPD  224

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E++QVQNLAYPAD  DPLL+DW+KY  NPVL PPPGI  KDFRDPTTA
Sbjct  225  GQVIMLYTGSTNESMQVQNLAYPADPSDPLLVDWIKYPANPVLFPPPGIDAKDFRDPTTA  284

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I+IGSK+ KTGI+LVY+T +F  ++ ++GVLHAVPGTG
Sbjct  285  WITSE-GKWRISIGSKLNKTGIALVYDTNDFKTFERVEGVLHAVPGTG  331



>ref|NP_001284386.1| acid beta-fructofuranosidase-like [Cucumis melo]
 gb|ACS94417.1| acid invertase 1 [Cucumis melo]
Length=680

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP +A+WGNI WGHAVS DLIHWFHLP A+VPDQWYDINGVWTGSATILP+
Sbjct  147  GWYHFFYQYNPRAAVWGNIVWGHAVSTDLIHWFHLPLALVPDQWYDINGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+M YTGST E+VQVQNLAYPA++ DPLL++WVK+SGNPVLVPPPGI  +DFRDPTTA
Sbjct  207  GQIMMFYTGSTKEHVQVQNLAYPANLSDPLLINWVKFSGNPVLVPPPGIDFRDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W S + GKW I IGSKV +TGISLVY+T +F  ++LLD +L AV GTG
Sbjct  267  W-STSEGKWRIAIGSKVNRTGISLVYDTEDFKHFQLLDNLLCAVAGTG  313



>dbj|BAB82419.1| acid invertase [Citrus unshiu]
Length=687

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+ AIWG+I WGHAVS+DLIHW+HLP AMV DQWYDI GVWTGSATILP+
Sbjct  142  GWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+++MLYTGST+E+VQVQNLAYPAD  DPLL+ WVKY GNPVLVPPPGIG KDFRDPTTA
Sbjct  202  GKLMMLYTGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIGSKDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I IGS++ +TGI+ VY+T +F +Y+LL GVLH VP TG
Sbjct  262  WLTSE-GKWRIAIGSRINRTGITFVYDTKDFINYELLRGVLHGVPNTG  308



>ref|XP_011000150.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
 ref|XP_011000151.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Populus euphratica]
Length=642

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LPFAMVPD WYDINGVWTGSAT+LP+
Sbjct  140  GWYHLFYQYNPDSAVWGNITWGHAVSPDLIHWLYLPFAMVPDHWYDINGVWTGSATLLPD  199

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLL+DWVKY  NPV+ PP G    +FRDPTTA
Sbjct  200  GQIMMLYTGSTNESVQVQNLAYPANLSDPLLIDWVKYPNNPVITPPNGTETDEFRDPTTA  259

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            WM P+   W ITIGS+  K+ GISLVY+T+NFT Y+LL+GVLHAVPGTG
Sbjct  260  WMGPD-RTWRITIGSRHNKSIGISLVYQTSNFTTYELLEGVLHAVPGTG  307



>ref|XP_010676174.1| PREDICTED: acid beta-fructofuranosidase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 emb|CAC81825.1| beta-fructofuranosidase [Beta vulgaris]
Length=691

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVS+DLI W HLP AMV D+WYD NGVWTGSATILP+
Sbjct  168  GWYHFFYQYNPAGAVWGNIVWGHAVSKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPD  227

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLAYPA++ DPLLL+WVKY GNPVLVPPPGIG  DFRDPTTA
Sbjct  228  GQIMMLYTGSTNESVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTA  287

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGISLVY+TT+F +Y+LL  +LHAV GTG
Sbjct  288  WLTSE-GKWRITIGSKLNKTGISLVYDTTDFKNYELLSNILHAVQGTG  334



>emb|CBI24585.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRD+IHW +LP AMVPD+W+D+NGVWTGSATILPN
Sbjct  34   GWYHLFYQYNPDSAVWGNITWGHAVSRDMIHWLYLPLAMVPDRWFDLNGVWTGSATILPN  93

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T+++VQVQNLAYPA++ DPLLL W+KY  NPV+VPP GIG  DFRDPTT 
Sbjct  94   GQIIMLYTGDTNDSVQVQNLAYPANLSDPLLLHWIKYENNPVMVPPAGIGSDDFRDPTTM  153

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+  + G W + +GS V  TGI LV++TTNFTD++LLDG LH VPGTG
Sbjct  154  WVGAD-GNWRVAVGSLVNTTGIVLVFQTTNFTDFELLDGELHGVPGTG  200



>ref|XP_010093687.1| Acid beta-fructofuranosidase [Morus notabilis]
 gb|EXB54467.1| Acid beta-fructofuranosidase [Morus notabilis]
Length=662

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WGNI WGHAVS+DLIHW HLP AMV DQWYD NGVW+GSATILP+
Sbjct  150  GWYHFFYQYNPNGAVWGNIVWGHAVSKDLIHWLHLPLAMVADQWYDQNGVWSGSATILPD  209

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
             ++VMLYTGST+E+VQVQNLAYP D  DPLL+ W KYSGNPVLVPPPGI  KDFRDPTTA
Sbjct  210  NRVVMLYTGSTNESVQVQNLAYPVDPSDPLLIKWEKYSGNPVLVPPPGINKKDFRDPTTA  269

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I IGSK+ KTGISLVY+T +F  Y+ LDG+LH VPGTG
Sbjct  270  WLTSE-GKWRIIIGSKINKTGISLVYDTLDFKTYERLDGILHGVPGTG  316



>ref|XP_004499664.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Cicer arietinum]
Length=636

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP S+IWGNITWGHAVS+D+IHW +LP AM P++W+DINGVWTGSAT+LP+
Sbjct  131  GWYHLFYQYNPYSSIWGNITWGHAVSKDMIHWLYLPIAMKPNKWFDINGVWTGSATLLPD  190

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG T+E VQVQNLAYPA++ DPLLLDWVKY+ NP++ PPPGIG K+FRDPTTA
Sbjct  191  GKIIMLYTGDTNEYVQVQNLAYPANLSDPLLLDWVKYANNPIIEPPPGIGPKNFRDPTTA  250

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW + IGSK G+TGISLVY+TTNFT+++L D  LHAVPGTG
Sbjct  251  WIGPD-GKWRVLIGSKKGQTGISLVYKTTNFTNFELNDRYLHAVPGTG  297



>gb|KEH31660.1| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=531

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  23   GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDSNGVWTGSATILPD  82

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E VQVQNLAYPAD+ DPLL+DW+KY  NPVLVPPPGI  KDFRDPTTA
Sbjct  83   GQVIMLYTGSTNETVQVQNLAYPADLNDPLLVDWIKYPANPVLVPPPGILPKDFRDPTTA  142

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTG++LVY+T +F  Y+  + +L AVPGTG
Sbjct  143  WLTSE-GKWRITIGSKINKTGVALVYDTVDFKTYERKEDLLDAVPGTG  189



>gb|AES68467.2| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=632

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNI+WGHAVS D+IHW +LP AM PD+W+DINGVWTGSAT+LP+
Sbjct  127  GWYHLFYQYNPDSAVWGNISWGHAVSSDMIHWLYLPIAMEPDKWFDINGVWTGSATLLPD  186

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+++MLYTG TD  VQVQNLA+PA++ DPLLLDWVKY+ NP+L PPPGIG KDFRDPTT 
Sbjct  187  GEVIMLYTGDTDNYVQVQNLAHPANLSDPLLLDWVKYANNPILEPPPGIGSKDFRDPTTG  246

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW + IGSK G+TG+SLVY+TTNF +++L D  LHAVPGTG
Sbjct  247  WIGPD-GKWRVLIGSKKGQTGLSLVYKTTNFINFELNDNYLHAVPGTG  293



>ref|XP_004143623.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Cucumis sativus]
 ref|XP_004163106.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Cucumis sativus]
 gb|KGN50433.1| hypothetical protein Csa_5G174590 [Cucumis sativus]
Length=630

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 150/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+SA+WGNI+WGHAVSRDLIHW +LP+AMVPDQ YD+NGVWTGSATILP+
Sbjct  130  GWYHLFYQYNPESAVWGNISWGHAVSRDLIHWLYLPYAMVPDQPYDVNGVWTGSATILPD  189

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG T + VQVQNLAYPA++ DPLLL+WVK+ GNPVLVPPPGIG KDFRDPTTA
Sbjct  190  GRIVMLYTGDTIDGVQVQNLAYPANLSDPLLLNWVKHPGNPVLVPPPGIGPKDFRDPTTA  249

Query  362  WMSPNVGKWLITIGSKVGKT-GISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGS+VG T G+S+VY T +F  Y+L+D  LHAVPGTG
Sbjct  250  WLGPD-GKWRITIGSRVGTTLGVSMVYTTDDFIKYELVDRFLHAVPGTG  297



>ref|XP_007157332.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
 gb|ESW29326.1| hypothetical protein PHAVU_002G061200g [Phaseolus vulgaris]
Length=649

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSATILPN
Sbjct  139  GWYHFFYQYNPKGAVWGDIVWGHAVSRDLIHWLHLPLAMVADQWYDKNGVWTGSATILPN  198

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+++MLYTGST+E+VQVQNLAYPAD+ DPLL+DW+KY  NPVL PPPGI  KDFRDPTTA
Sbjct  199  GEVIMLYTGSTNESVQVQNLAYPADLSDPLLVDWIKYPSNPVLFPPPGIDTKDFRDPTTA  258

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I+IGSK+ KTGI+LVY+T +F  Y+ ++G+L AVPGTG
Sbjct  259  WLTSE-GKWRISIGSKLNKTGIALVYDTNDFKTYERVEGLLRAVPGTG  305



>ref|XP_007039920.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
 gb|EOY24421.1| Glycosyl hydrolases family 32 protein [Theobroma cacao]
Length=766

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRD+IHW HLP AMV DQWYD+NGVWTGSATILP+
Sbjct  258  GWYHFFYQYNPNAAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDVNGVWTGSATILPD  317

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++VMLYTGST E VQVQNLAYPA+  DPLL++WVKY GNPVLVPPPGI   DFRDPTTA
Sbjct  318  GKVVMLYTGSTAEAVQVQNLAYPANPNDPLLINWVKYPGNPVLVPPPGIDKMDFRDPTTA  377

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTGI+L+Y+TT+F +Y+ LDG LHAV GTG
Sbjct  378  WLTSE-GKWRITIGSKINKTGIALIYDTTDFINYERLDGALHAVSGTG  424



>ref|XP_004147588.1| PREDICTED: acid beta-fructofuranosidase-like [Cucumis sativus]
 gb|KGN50220.1| hypothetical protein Csa_5G160230 [Cucumis sativus]
Length=685

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP +A+WGNI WGHAVS DLIHW HLP A+VPDQWYDINGVWTGSATILP+
Sbjct  147  GWYHFFYQYNPRAAVWGNIVWGHAVSTDLIHWLHLPLALVPDQWYDINGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST E+VQVQNLAYPA++ DPLL+DWVK+SGNPVLVPPPGI  +DFRDPTTA
Sbjct  207  GRIMMLYTGSTKEHVQVQNLAYPANLSDPLLIDWVKFSGNPVLVPPPGIDFRDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW I IGSKV +TGISLVY+T +F  ++LLD +L AV GTG
Sbjct  267  WFTSE-GKWRIAIGSKVNRTGISLVYDTEDFKHFQLLDNLLCAVAGTG  313



>ref|XP_006417255.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
 gb|ESQ35608.1| hypothetical protein EUTSA_v10007016mg [Eutrema salsugineum]
Length=660

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            G+YH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  140  GYYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPLAMVADQWYDSNGVWTGSATILPD  199

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD++VQVQNLAYP D  DPLLL WVK+SGNPVLVPPPGI  KDFRDPTTA
Sbjct  200  GSIVMLYTGSTDKSVQVQNLAYPEDPNDPLLLKWVKFSGNPVLVPPPGILPKDFRDPTTA  259

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ +TGISLVY+TT+F  Y+ LD +LHAVP TG
Sbjct  260  WKTSE-GKWRITIGSKINRTGISLVYDTTDFKTYERLDTLLHAVPNTG  306



>ref|XP_006573732.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=675

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHWFHLP AMV DQWYD NGVWTGSATILP+
Sbjct  165  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWFHLPLAMVADQWYDKNGVWTGSATILPD  224

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E++QVQNLAYPAD  DPLL+DW+KY  NPVL PPPGI  KDFRDPTTA
Sbjct  225  GQVIMLYTGSTNESMQVQNLAYPADPSDPLLVDWIKYPANPVLFPPPGIDAKDFRDPTTA  284

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I+IGSK+ KTGI+LVY+T +F  ++ ++GVLH VPGTG
Sbjct  285  WITSE-GKWRISIGSKLNKTGIALVYDTNDFKTFERVEGVLHVVPGTG  331



>gb|KHN32440.1| Beta-fructofuranosidase, soluble isoenzyme I [Glycine soja]
Length=579

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH+FYQYNPDSA+WGNITWGHAVSRDLIHW +LP A+ PD+W+D+NGVW+GSAT+LP+
Sbjct  83   GWYHVFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPIALFPDKWFDVNGVWSGSATLLPD  142

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGSTD+NVQVQNLAYPA++ DPLLLDWVKY+ NPVL PPPGIG KDFRDPTTA
Sbjct  143  GKILMLYTGSTDQNVQVQNLAYPANLSDPLLLDWVKYADNPVLAPPPGIGPKDFRDPTTA  202

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+  KW ITIGSK+  TG+SLVY+T +F  Y+  D  LH VPGTG
Sbjct  203  WFGPD-EKWRITIGSKLNGTGLSLVYKTQDFIHYEQNDHYLHQVPGTG  249



>ref|XP_007148711.1| hypothetical protein PHAVU_005G008200g [Phaseolus vulgaris]
 gb|ESW20705.1| hypothetical protein PHAVU_005G008200g [Phaseolus vulgaris]
Length=633

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRD+IHW +LP AMVP+ WYDINGVWTGSATILP 
Sbjct  133  GWYHLFYQYNPDSAVWGNITWGHAVSRDMIHWLYLPIAMVPNDWYDINGVWTGSATILPG  192

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG T+  VQVQNLAYPA++ DPLLL WVKY GNP+L+PPPGIG KDFRDPTT 
Sbjct  193  GKIIMLYTGDTNHYVQVQNLAYPANLSDPLLLHWVKYPGNPILLPPPGIGSKDFRDPTTG  252

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+  + GKW ITIGSK GKTG+SLVY+TT+F +++  D  LHAVPGTG
Sbjct  253  WIGSD-GKWRITIGSKKGKTGLSLVYKTTDFINFEPNDHYLHAVPGTG  299



>ref|XP_006878590.1| hypothetical protein AMTR_s00011p00252750 [Amborella trichopoda]
 gb|ERM94735.1| hypothetical protein AMTR_s00011p00252750 [Amborella trichopoda]
Length=640

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGH VS+DLIHW +L  AMV DQWYDINGVWTGSAT+LP 
Sbjct  137  GWYHLFYQYNPDSAVWGNITWGHTVSKDLIHWLYLDLAMVRDQWYDINGVWTGSATLLPT  196

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST+E+VQVQNLA PAD  DPLL DWVKYSGNPVL PP  I  KDFRDPTTA
Sbjct  197  GEIIMLYTGSTNESVQVQNLAIPADPSDPLLKDWVKYSGNPVLTPPQEILPKDFRDPTTA  256

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+  + G W + IGSK+ KTGISLVY+T++F +YKL++GVLHAVPGTG
Sbjct  257  WLGSD-GLWRLIIGSKINKTGISLVYKTSDFVNYKLVEGVLHAVPGTG  303



>gb|EYU30506.1| hypothetical protein MIMGU_mgv1a0199921mg, partial [Erythranthe 
guttata]
Length=562

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVS+DLIHW HLP AMVPD WYDINGVWTGSATIL +
Sbjct  149  GWYHFFYQYNPYGAVWGNIVWGHAVSKDLIHWRHLPIAMVPDNWYDINGVWTGSATILED  208

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E+VQVQNLAYP+D+ DPLL+DWVKY GNPVL PPPGI  +DFRDPTTA
Sbjct  209  GQLIMLYTGSTNESVQVQNLAYPSDLSDPLLVDWVKYPGNPVLGPPPGIAPQDFRDPTTA  268

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P  GKW  TIGS++ KTGISLVY+T +F  ++LL+G LH V GTG
Sbjct  269  WLTPE-GKWRFTIGSQINKTGISLVYDTKDFKTFELLNGALHRVAGTG  315



>ref|XP_002265534.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Vitis vinifera]
Length=649

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRD+IHW +LP AMVPD+W+D+NGVWTGSATILPN
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSRDMIHWLYLPLAMVPDRWFDLNGVWTGSATILPN  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T+++VQVQNLAYPA++ DPLLL W+KY  NPV+VPP GIG  DFRDPTT 
Sbjct  201  GQIIMLYTGDTNDSVQVQNLAYPANLSDPLLLHWIKYENNPVMVPPAGIGSDDFRDPTTM  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+  + G W + +GS V  TGI LV++TTNFTD++LLDG LH VPGTG
Sbjct  261  WVGAD-GNWRVAVGSLVNTTGIVLVFQTTNFTDFELLDGELHGVPGTG  307



>ref|XP_003540575.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Glycine max]
Length=614

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH+FYQYNPDSA+WGNITWGHAVSRDLIHW +LP A+ PD+W+D+NGVW+GSAT+LP+
Sbjct  118  GWYHVFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPIALFPDKWFDVNGVWSGSATLLPD  177

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGSTD+NVQVQNLAYPA++ DPLLLDWVKY+ NPVL PPPGIG KDFRDPTTA
Sbjct  178  GKILMLYTGSTDQNVQVQNLAYPANLSDPLLLDWVKYADNPVLAPPPGIGPKDFRDPTTA  237

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+  KW ITIGSK+  TG+SLVY+T +F  Y+  D  LH VPGTG
Sbjct  238  WFGPD-EKWRITIGSKLNGTGLSLVYKTQDFIHYEQNDHYLHQVPGTG  284



>gb|AAB68823.1| acid invertase [Citrus unshiu]
Length=247

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +2

Query  11   HLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQI  190
            HLFYQYNP+ AIWG+I WGHAVS+DLIHW+HLP AMV DQWYDI GVWT SATILP+G++
Sbjct  1    HLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTASATILPDGKL  60

Query  191  VMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMS  370
            +MLYTGST+E+VQVQNLAYPAD  DPLL+ WVKY GNPVLVPPPGIG KDFRDPTTAW++
Sbjct  61   MMLYTGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIGAKDFRDPTTAWLT  120

Query  371  PNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
               GKW I IGS++ +TGI+ VY+T +F +Y+LL GVLH VP TG
Sbjct  121  SE-GKWRIAIGSRINRTGITFVYDTKDFINYELLRGVLHGVPNTG  164



>emb|CAA77268.1| Inv*Dc4' protein [Daucus carota]
Length=570

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+SA+WGNITWGHAVS+DLI+WFHLP AMVPD WYDI GVWTGSATILP+
Sbjct  124  GWYHFFYQYNPNSAVWGNITWGHAVSKDLINWFHLPIAMVPDNWYDIAGVWTGSATILPD  183

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T    +VQNLAYPA++ DPLLL+WVK+ GNPV+VPPPGIG KDFRDPTTA
Sbjct  184  GQIIMLYTGKTANLTEVQNLAYPANLSDPLLLEWVKHPGNPVMVPPPGIGFKDFRDPTTA  243

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+  + G W ITIGSKV   G+SLVY+T NFT+++LLD +LH VPG+G
Sbjct  244  WLGLD-GMWRITIGSKVNNNGLSLVYKTANFTEFELLDELLHEVPGSG  290



>ref|XP_003538727.1| PREDICTED: acid beta-fructofuranosidase-like [Glycine max]
Length=622

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    WYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNG  184
            WYH FYQYNP  A+WG+I WGHAVSRD+IHW HLP AM+ DQWYD NGVWTGSATILP+G
Sbjct  161  WYHFFYQYNPKGAVWGDIVWGHAVSRDMIHWLHLPLAMMADQWYDKNGVWTGSATILPDG  220

Query  185  QIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAW  364
            QI+MLYTGST+E+VQVQNLAYPAD  DPLL+DW+KY  NPVL PPPGI  KDFRDPTTAW
Sbjct  221  QIIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYPANPVLFPPPGIDAKDFRDPTTAW  280

Query  365  MSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            ++   GKW I+IGSK+ KTGI+LVY+T +F  ++ ++GVLHAVPGTG
Sbjct  281  LTSE-GKWRISIGSKLNKTGIALVYDTIDFKTFEHVEGVLHAVPGTG  326



>emb|CAD12104.1| beta-fructofuranosidase [Cichorium intybus]
Length=646

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQY+PD+ +WG I WGHAVS+DLI+W HLP AM  D+WYD  GVWTGSATILPN
Sbjct  147  GWYHLFYQYHPDAPVWGKIVWGHAVSKDLINWRHLPIAMETDEWYDEQGVWTGSATILPN  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++V+LYTGST+E+VQVQNLAYPAD  DPLL+ WVKY GNPVLVPPPGI  KDFRDPTTA
Sbjct  207  GELVVLYTGSTNESVQVQNLAYPADPSDPLLIKWVKYPGNPVLVPPPGIDNKDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSK+ KTGISLVY+T +F  ++LLDG+LHAVPGTG
Sbjct  267  WKTPE-GKWRITIGSKINKTGISLVYDTEDFKTFELLDGLLHAVPGTG  313



>sp|Q43857.1|INVA_VICFA RecName: Full=Acid beta-fructofuranosidase; AltName: Full=Acid 
invertase; Short=AI; AltName: Full=Acid sucrose hydrolase; 
AltName: Full=Vacuolar invertase; Flags: Precursor [Vicia faba]
 emb|CAA89992.1| vacuolar invertase; beta-fructofuranosidase [Vicia faba var. 
minor]
Length=642

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  131  GWYHFFYQYNPNGAVWGDIVWGHAVSRDLIHWLHLPLAMVADQWYDSNGVWTGSATILPD  190

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E VQVQNLAYPAD+ DPLL+DW+KY  NPVLVPPPGI  KDFRDPTTA
Sbjct  191  GQVIMLYTGSTNEFVQVQNLAYPADLNDPLLVDWIKYPSNPVLVPPPGILPKDFRDPTTA  250

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTG++LVY+T +F  Y+  D +L+AVPGTG
Sbjct  251  WLTTE-GKWRITIGSKINKTGVALVYDTVDFKTYERKDMLLNAVPGTG  297



>gb|AAB47171.1| vacuolar invertase 1, GIN1 [Vitis vinifera=grape berries, Sultana, 
berries, Peptide, 642 aa]
Length=642

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRD+IHW +LP AMVPD+W+D+NGVWTGSATILPN
Sbjct  134  GWYHLFYQYNPDSAVWGNITWGHAVSRDMIHWLYLPLAMVPDRWFDLNGVWTGSATILPN  193

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTG T+++VQVQNLAYPA++ DPLLL W+KY  NPV+VPP GIG  DFRDPTT 
Sbjct  194  GQIIMLYTGDTNDSVQVQNLAYPANLSDPLLLHWIKYENNPVMVPPAGIGSDDFRDPTTM  253

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+  + G W + +GS V  TGI LV++TTNFTD++L DG LH VPGTG
Sbjct  254  WVGAD-GNWRVAVGSLVNTTGIVLVFQTTNFTDFELFDGELHGVPGTG  300



>ref|XP_006391837.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
 gb|ESQ29123.1| hypothetical protein EUTSA_v10023331mg [Eutrema salsugineum]
Length=655

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LPFAMVPDQWYD NGVWTGSAT L +
Sbjct  136  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDD  195

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  196  GSIVMLYTGSTDKFVQVQNLAYPEDPKDPLLLKWTKFSGNPVLVPPPGIGTKDFRDPTTA  255

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+TT+F  Y+  D +LH VP TG
Sbjct  256  WKT-SAGKWRITIGSKINRTGISLVYDTTDFKTYEKHDTLLHQVPNTG  302



>gb|KHN34956.1| Acid beta-fructofuranosidase [Glycine soja]
Length=667

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  5    WYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNG  184
            WYH FYQYNP  A+WG+I WGHAVSRD+IHW HLP AM+ DQWYD NGVWTGSATILP+G
Sbjct  158  WYHFFYQYNPKGAVWGDIVWGHAVSRDMIHWLHLPLAMMADQWYDKNGVWTGSATILPDG  217

Query  185  QIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAW  364
            QI+MLYTGST+E+VQVQNLAYPAD  DPLL+DW+KY  NPVL PPPGI  KDFRDPTTAW
Sbjct  218  QIIMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYPANPVLFPPPGIDAKDFRDPTTAW  277

Query  365  MSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            ++   GKW I+IGSK+ KTGI+LVY+T +F  ++ ++GVLHAVPGTG
Sbjct  278  LTSE-GKWRISIGSKLNKTGIALVYDTIDFKTFEHVEGVLHAVPGTG  323



>ref|XP_011076337.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Sesamum indicum]
Length=657

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVSRDLIHW HLP+AMVPDQWYDINGVWTGSATILP+
Sbjct  148  GWYHLFYQYNPDSAVWGNITWGHAVSRDLIHWLHLPYAMVPDQWYDINGVWTGSATILPD  207

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTG T + VQVQ LAYPA++ DPLLL+WVK   NPVLVPPPGIG+KDFRDPTTA
Sbjct  208  GRIIMLYTGDTYDVVQVQCLAYPANLSDPLLLEWVKDPNNPVLVPPPGIGLKDFRDPTTA  267

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+SP+  KW ITIGSKV KTGISLVYET +F  Y+LLDG LH VPGTG
Sbjct  268  WLSPDGDKWRITIGSKVDKTGISLVYETKDFIKYELLDGYLHQVPGTG  315



>ref|XP_009148607.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar-like [Brassica 
rapa]
Length=662

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSAT L +
Sbjct  142  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPLAMVADQWYDANGVWTGSATFLED  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD++VQVQNLAYP D+ DPLLL WVK+SGNPVLVPPPGI  KDFRDPTTA
Sbjct  202  GSIVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKFSGNPVLVPPPGILPKDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  262  WKT-SAGKWRITIGSKINRTGISLVYDTTDFKTYEKLDTLLHKVPNTG  308



>emb|CDX98080.1| BnaA06g08310D [Brassica napus]
Length=662

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSAT L +
Sbjct  142  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPLAMVADQWYDANGVWTGSATFLED  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD++VQVQNLAYP D+ DPLLL WVK+SGNPVLVPPPGI  KDFRDPTTA
Sbjct  202  GSIVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKFSGNPVLVPPPGILPKDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  262  WKT-SAGKWRITIGSKINRTGISLVYDTTDFKTYEKLDTLLHKVPNTG  308



>ref|XP_002889923.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66182.1| beta-fructosidase [Arabidopsis lyrata subsp. lyrata]
Length=663

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  143  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPIAMVADQWYDSNGVWTGSATILPD  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  203  GSIVMLYTGSTDKAVQVQNLAYPEDPSDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ +TGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  263  WKTSE-GKWRITIGSKLNRTGISLVYDTTDFKTYEKLDTLLHRVPNTG  309



>ref|XP_003608758.1| Acid beta-fructofuranosidase [Medicago truncatula]
Length=640

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  132  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDSNGVWTGSATILPD  191

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E VQVQNLAYPAD+ DPLL+DW+KY  NPVLVPPPGI  KDFRDPTTA
Sbjct  192  GQVIMLYTGSTNETVQVQNLAYPADLNDPLLVDWIKYPANPVLVPPPGILPKDFRDPTTA  251

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTG++LVY+T +F  Y+  + +L AVPGTG
Sbjct  252  WLTSE-GKWRITIGSKINKTGVALVYDTVDFKTYERKEDLLDAVPGTG  298



>ref|XP_004171067.1| PREDICTED: LOW QUALITY PROTEIN: acid beta-fructofuranosidase-like 
[Cucumis sativus]
Length=685

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP +A+WGNI W HAVS DLIHW HLP A+VPDQWYDINGVWTGSATILP+
Sbjct  147  GWYHFFYQYNPRAAVWGNIVWXHAVSTDLIHWLHLPLALVPDQWYDINGVWTGSATILPD  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+MLYTGST E+VQVQNLAYPA++ DPLL+DWVK+SGNPVLVPPPGI  +DFRDPTTA
Sbjct  207  GRIMMLYTGSTKEHVQVQNLAYPANLSDPLLIDWVKFSGNPVLVPPPGIDFRDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW I IGSKV +TGISLVY+T +F  ++LLD +L AV GTG
Sbjct  267  WFTSE-GKWRIAIGSKVNRTGISLVYDTEDFKHFQLLDNLLCAVAGTG  313



>gb|AES90955.2| soluble acid invertase FRUCT2 [Medicago truncatula]
Length=643

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  135  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDSNGVWTGSATILPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E VQVQNLAYPAD+ DPLL+DW+KY  NPVLVPPPGI  KDFRDPTTA
Sbjct  195  GQVIMLYTGSTNETVQVQNLAYPADLNDPLLVDWIKYPANPVLVPPPGILPKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTG++LVY+T +F  Y+  + +L AVPGTG
Sbjct  255  WLTSE-GKWRITIGSKINKTGVALVYDTVDFKTYERKEDLLDAVPGTG  301



>gb|ADF27780.1| soluble acid invertase 2 [Orobanche ramosa]
Length=544

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP  A+WGNI WGHAVSRDLI+W HLP AMVPD WYDINGVWTG+ATIL +
Sbjct  27   GWYHFFYQYNPYGAVWGNIVWGHAVSRDLINWRHLPIAMVPDHWYDINGVWTGTATILQD  86

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ+VMLYTGST+E+VQVQNLAYPAD  DPLL+DWVKYS NPVL PPP I   DFRDPTTA
Sbjct  87   GQLVMLYTGSTNESVQVQNLAYPADPSDPLLVDWVKYSANPVLDPPPWIEPTDFRDPTTA  146

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW  TIGSKV KTG+SLVY+T +F  ++LLD VLHAVPGTG
Sbjct  147  WLTSQ-GKWRFTIGSKVNKTGMSLVYDTEDFKTFQLLDSVLHAVPGTG  193



>gb|AEM00023.1| vacuolar acid invertase [Manihot esculenta]
Length=502

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  17   FYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQIVM  196
            FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV +QWYD NGVWTGSATILP+G I+M
Sbjct  1    FYQYNPNAAVWGDIVWGHAVSRDLIHWLHLPLAMVANQWYDQNGVWTGSATILPDGNIIM  60

Query  197  LYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMSPN  376
            LYTGST+E+VQVQNLAYPAD  DPLLL+W KYSGNPVLVPPPGI +KDFRDPTTAW +  
Sbjct  61   LYTGSTNESVQVQNLAYPADANDPLLLEWTKYSGNPVLVPPPGIDIKDFRDPTTAWHTSE  120

Query  377  VGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
             GKW I+IGSKVGKTG++L+Y+T +F +Y+L    LH VPGTG
Sbjct  121  -GKWRISIGSKVGKTGVALIYDTEDFINYQLKSEALHGVPGTG  162



>ref|XP_010533769.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Tarenaya 
hassleriana]
Length=678

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMVPDQWYD NGVWTGSATIL +
Sbjct  167  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPLAMVPDQWYDANGVWTGSATILDD  226

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGST+E+VQVQNLAYP D  DPLLL WVKYSGNPVLVPPPGI  KDFRDPTTA
Sbjct  227  GSIVMLYTGSTNESVQVQNLAYPEDPNDPLLLKWVKYSGNPVLVPPPGIHPKDFRDPTTA  286

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW  TIGSK+ +TGISL+Y+TT+F  Y+ L  +LH VPGTG
Sbjct  287  WRT-SAGKWRFTIGSKLNRTGISLLYDTTDFKTYQQLPSLLHRVPGTG  333



>gb|AGW23637.1| soluble acid invertase [Lilium davidii]
Length=635

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGH+VSRDLIHW HLP A VPD WYD NGVWTGSAT LP+
Sbjct  123  GWYHLFYQYNPDSAVWGNITWGHSVSRDLIHWLHLPLAFVPDHWYDANGVWTGSATFLPD  182

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVM+YTGST E VQVQNLAYPAD+ DPLLL+W+K   NPVL+PPPGIG KDFRDPTTA
Sbjct  183  GRIVMVYTGSTTEAVQVQNLAYPADLDDPLLLNWIKSDANPVLLPPPGIGAKDFRDPTTA  242

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W       W + IGSK    TGI L+Y T +F DY+LL GVLH+VPGTG
Sbjct  243  WYDAATEAWKLAIGSKDQNHTGICLIYRTNDFIDYELLPGVLHSVPGTG  291



>gb|AAV70979.1| vacuolar invertase [Mesembryanthemum crystallinum]
Length=232

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +2

Query  8    YHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQ  187
            YHLFYQYNP SA+WGNITWGHAVS DLIHW HLP AMVPDQWYDINGVWTGSATILP+G+
Sbjct  1    YHLFYQYNPYSAVWGNITWGHAVSTDLIHWKHLPLAMVPDQWYDINGVWTGSATILPDGK  60

Query  188  IVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWM  367
            I+M+YTG TD+ VQVQNLAYP D+ DPLLL+WVKY GNPV+ PP GIG KDFRDPTTAW+
Sbjct  61   IMMVYTGDTDQFVQVQNLAYPKDLSDPLLLEWVKYPGNPVMTPPKGIGAKDFRDPTTAWV  120

Query  368  SPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
             P+ G W + IGSKV KTGIS+VY+TT+F  Y L+   LH+VPGTG
Sbjct  121  GPD-GVWRLIIGSKVNKTGISMVYKTTDFISYDLV-ANLHSVPGTG  164



>gb|ADI70685.1| vacuolar invertase INV2, partial [Nicotiana tabacum]
Length=231

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +2

Query  35   DSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQIVMLYTGST  214
            ++A+WGNI WGHAVSRDLIHW HLP AMV DQWYDINGVWTGSATILP+G++VMLYTGST
Sbjct  1    EAAVWGNIVWGHAVSRDLIHWQHLPVAMVADQWYDINGVWTGSATILPDGKLVMLYTGST  60

Query  215  DENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMSPNVGKWLI  394
            +E+VQVQNLAYPAD  DPLL  WVKY GNPVLVPPPGI  KDFRDPTTAW +P  GKW I
Sbjct  61   NESVQVQNLAYPADPSDPLLRKWVKYEGNPVLVPPPGIATKDFRDPTTAWTTPQ-GKWRI  119

Query  395  TIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            TIGSKV KTGISLVY+T +F  ++LLDGVLH VPGTG
Sbjct  120  TIGSKVNKTGISLVYDTIDFKKFELLDGVLHGVPGTG  156



>gb|AAD43622.1|AC005698_21 T3P18.21 [Arabidopsis thaliana]
Length=650

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  131  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDD  190

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTDE VQVQNLAYP D  DPLLL WVK+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  191  GSIVMLYTGSTDEFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAKDFRDPTTA  250

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  251  WKTSS-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  297



>gb|AAF19535.1|AC007190_3 F23N19.3 [Arabidopsis thaliana]
Length=728

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  131  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDD  190

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTDE VQVQNLAYP D  DPLLL WVK+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  191  GSIVMLYTGSTDEFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAKDFRDPTTA  250

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  251  WKTSS-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  297



>gb|AAM52062.1| vacuolar acid invertase PsI-1 [Pisum sativum]
Length=647

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV DQWYD NGVWTGSATILP+
Sbjct  135  GWYHFFYQYNPNGAVWGDIVWGHAVSRDIIHWLHLPLAMVADQWYDSNGVWTGSATILPD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGST+E+VQVQNLAYPAD+ DPLL+DW+KY  NPVLVPP GI  KDFRDPTTA
Sbjct  195  GQVIMLYTGSTNESVQVQNLAYPADLNDPLLVDWIKYPSNPVLVPPKGILPKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTG++LVY+T +F  Y+  D +L+AVPGTG
Sbjct  255  WLTTE-GKWRITIGSKINKTGVALVYDTVDFKTYERKDVLLNAVPGTG  301



>emb|CDY46906.1| BnaA09g12880D [Brassica napus]
Length=654

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LPFAMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPKDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  255  WKTSD-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  301



>ref|XP_009113064.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Brassica 
rapa]
Length=654

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LPFAMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPKDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  255  WKTSD-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  301



>ref|NP_564798.1| acid beta-fructofuranosidase 3 [Arabidopsis thaliana]
 sp|Q43348.1|INVA3_ARATH RecName: Full=Acid beta-fructofuranosidase 3, vacuolar; Short=At 
beta fruct3; Short=AtBETAFRUCT3; AltName: Full=Acid invertase 
3; Short=AI 3; AltName: Full=Acid sucrose hydrolase 3; 
AltName: Full=Vacuolar invertase 3; Short=Inv-V3; Short=VAC-INV 
3; Short=VI 3; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67560.1| beta-fructosidase [Arabidopsis thaliana]
 gb|AAK82531.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
 gb|AAL32559.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAL36260.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAM45114.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AEE33991.1| beta-fructofuranosidase [Arabidopsis thaliana]
Length=648

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  129  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDD  188

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTDE VQVQNLAYP D  DPLLL WVK+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  189  GSIVMLYTGSTDEFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAKDFRDPTTA  248

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  249  WKTSS-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  295



>gb|AAK62665.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
 gb|AAN18078.1| At1g62660/F23N19_3 [Arabidopsis thaliana]
Length=648

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  129  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDD  188

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTDE VQVQNLAYP D  DPLLL WVK+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  189  GSIVMLYTGSTDEFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAKDFRDPTTA  248

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  249  WKTSS-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  295



>emb|CAA64781.1| beta-fructosidase [Arabidopsis thaliana]
Length=639

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  120  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDD  179

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTDE VQVQNLAYP D  DPLLL WVK+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  180  GSIVMLYTGSTDEFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAKDFRDPTTA  239

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  240  WKTSS-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  286



>gb|EPS61897.1| soluble acid invertase 1, partial [Genlisea aurea]
Length=561

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQ+NPD+A+WG I+WGHAVSRDLIHW +LP+AMVPDQWYDINGVWTGSATILP+
Sbjct  55   GWYHLFYQHNPDAAVWGVISWGHAVSRDLIHWLYLPYAMVPDQWYDINGVWTGSATILPD  114

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IV+LYTG T + VQVQ LA PA++ DPLLLDWVK+  NP+L PP GI  KDFRDPTTA
Sbjct  115  GAIVILYTGDTTDAVQVQCLAVPANLSDPLLLDWVKHPSNPILTPPHGILPKDFRDPTTA  174

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++P   KW ITIGSKV KTGISLVYET++F  Y LLDG LHAV GTG
Sbjct  175  WLAPAGDKWRITIGSKVNKTGISLVYETSDFVKYDLLDGYLHAVQGTG  222



>ref|XP_004515737.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=658

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRD+IHW HLP AMV D+WYD NGVWTGSATIL +
Sbjct  150  GWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADEWYDKNGVWTGSATILSD  209

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGST+E+VQVQNLAYPAD  DPLL+DW+KY  NPVL PPPGI  KDFRDPTTA
Sbjct  210  GQIVMLYTGSTNESVQVQNLAYPADPSDPLLVDWIKYPSNPVLFPPPGILSKDFRDPTTA  269

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW ITIGSK+ KTG++LVY+T +F  Y+   G+L+AVPGTG
Sbjct  270  WLTAE-GKWRITIGSKINKTGVALVYDTVDFKTYERKQGLLNAVPGTG  316



>gb|KFK40589.1| hypothetical protein AALP_AA2G015400 [Arabis alpina]
Length=650

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LPFA+VPDQWYD NGVWTGSAT L +
Sbjct  124  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPFALVPDQWYDANGVWTGSATFLDD  183

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D+ DPLLL W KY GNPVLVPPPGIG KDFRDPTTA
Sbjct  184  GSIVMLYTGSTDKFVQVQNLAYPEDLSDPLLLKWTKYPGNPVLVPPPGIGEKDFRDPTTA  243

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSKV KTGISL+Y+TT+F  Y+  D  LH VP TG
Sbjct  244  WKT-SAGKWRITIGSKVNKTGISLIYDTTDFKTYEKHDTWLHQVPNTG  290



>ref|XP_010259194.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Nelumbo nucifera]
Length=517

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+SA+WGNITWGHA+S+DLI+W +LPFAMVPD+WYDINGVWTGSAT+LP+
Sbjct  148  GWYHLFYQYNPESAVWGNITWGHAISKDLINWENLPFAMVPDEWYDINGVWTGSATLLPD  207

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IV+LYTG T + VQVQNLAYPAD  DP L+ WVKY GNP+LVPPP I   DFRDPTTA
Sbjct  208  GSIVVLYTGFTKDKVQVQNLAYPADPSDPRLIHWVKYPGNPILVPPPHIRDLDFRDPTTA  267

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ G W + IGSK+  TGISLVY TTNFT Y+LLDG+LHAVP TG
Sbjct  268  WFGPD-GHWRVAIGSKINDTGISLVYHTTNFTTYELLDGLLHAVPETG  314



>emb|CAE01318.1| acid vacuolar invertase [Coffea arabica]
Length=161

 Score =   249 bits (636),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  41   AIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQIVMLYTGSTDE  220
            A+WGNI WGHAVSRDLIHW +LPFAMVPD+ +D+NGVWTGSATILP G+IVMLYTG TD+
Sbjct  1    AVWGNIVWGHAVSRDLIHWLYLPFAMVPDRPFDVNGVWTGSATILPGGKIVMLYTGDTDD  60

Query  221  NVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMSPNVGKWLITI  400
             VQVQNLAYPA++ DPLLLDW+KY GNPV++PPPGIG KDFRDPTTAW++P+  KWL+T+
Sbjct  61   LVQVQNLAYPANLSDPLLLDWIKYPGNPVMIPPPGIGKKDFRDPTTAWLAPDGTKWLVTL  120

Query  401  GSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            GSK+ KTGI++VYET++F  Y+LLDGVLHAVP TG
Sbjct  121  GSKINKTGIAMVYETSDFKGYRLLDGVLHAVPHTG  155



>gb|AAL27710.3|AF433644_1 vacuolar invertase [Malus pumila]
Length=247

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +2

Query  17   FYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQIVM  196
            F    P  +  G+I WGHAVS+DLIHW HLP AMV DQWYDINGVWTGSATILP+G+IVM
Sbjct  3    FLSVQPQQSSMGDIVWGHAVSKDLIHWLHLPLAMVADQWYDINGVWTGSATILPDGKIVM  62

Query  197  LYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMSPN  376
            LYTGST+E+VQVQNLAYPAD  DPLLL+WVKYSGNPVLVPPPGIG KDFRDPTTAW +  
Sbjct  63   LYTGSTNESVQVQNLAYPADHSDPLLLNWVKYSGNPVLVPPPGIGYKDFRDPTTAWFTSE  122

Query  377  VGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
             GKW ITIGSK+ KTG+SLVY+T +F  Y+LL+GVLHAVPGTG
Sbjct  123  -GKWRITIGSKLNKTGMSLVYDTKDFKTYELLNGVLHAVPGTG  164



>ref|XP_002888009.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64268.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=654

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPDDPSDPLLLKWAKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  D +LH VP TG
Sbjct  255  WKT-STGKWRITIGSKINRTGISLIYDTTDFKTYEKHDTLLHQVPNTG  301



>emb|CAA61624.1| beta-fructofuranosidase [Arabidopsis thaliana]
Length=562

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  43   GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWTGSATFLDD  102

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD  VQVQNLAYP D  DPLLL WVK+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  103  GSIVMLYTGSTDGFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAKDFRDPTTA  162

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  D +LH VP TG
Sbjct  163  WKTSS-GKWRITIGSKINRTGISLIYDTTDFKTYEKHDTLLHQVPNTG  209



>ref|XP_006300839.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
 gb|EOA33737.1| hypothetical protein CARUB_v10019930mg [Capsella rubella]
Length=648

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPLAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPSDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TG+SLVY+TT+F  Y+  + +LH VP TG
Sbjct  255  WKT-SAGKWRITIGSKINRTGVSLVYDTTDFKTYEKRETLLHQVPNTG  301



>ref|XP_002532576.1| Acid beta-fructofuranosidase precursor, putative [Ricinus communis]
 gb|EEF29810.1| Acid beta-fructofuranosidase precursor, putative [Ricinus communis]
Length=649

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV D+WYD NGVWTGSATILP+
Sbjct  143  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLHLPLAMVADEWYDQNGVWTGSATILPD  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYP D  DPLLL WVKYSGNPVLVPPPGI   DFRDPTTA
Sbjct  203  GKIVMLYTGSTNESVQVQNLAYPEDHDDPLLLKWVKYSGNPVLVPPPGIKSLDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSKVG+TGI+L+Y+T +F +Y+L    LH V GTG
Sbjct  263  WFTSE-GKWRITIGSKVGRTGIALIYDTEDFINYELQQHELHGVSGTG  309



>emb|CDY30056.1| BnaC05g09640D [Brassica napus]
Length=659

 Score =   263 bits (673),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSAT L +
Sbjct  142  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPLAMVADQWYDANGVWTGSATFLED  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD++VQVQNLAYP D+ DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  202  GSIVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+TT+F  Y+ L+ +LH VP TG
Sbjct  262  WKT-SAGKWRITIGSKINRTGISLVYDTTDFKTYEKLETLLHKVPNTG  308



>emb|CDY31826.1| BnaC09g13230D [Brassica napus]
Length=654

 Score =   263 bits (673),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVS+DLIHW +LPFAMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNGAVWGDIFWGHAVSKDLIHWLYLPFAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPKDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  255  WKTSD-GKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTG  301



>emb|CDY39805.1| BnaA09g10570D [Brassica napus]
Length=606

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            G YH  YQYN + A+WG+I WGHAV++DLIHWFHLP AMVPDQWYD NGVWTGSAT+L +
Sbjct  123  GLYHFVYQYNINGAVWGDIAWGHAVAKDLIHWFHLPLAMVPDQWYDANGVWTGSATLLDD  182

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD  VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  183  GSIVMLYTGSTDNFVQVQNLAYPEDPSDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  242

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSKV +TGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  243  WKTLD-GKWRITIGSKVNRTGISLVYDTTDFKTYEKLDNLLHQVPDTG  289



>gb|AAG36942.1|AF274298_1 acid invertase [Brassica oleracea]
Length=663

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSAT L +
Sbjct  143  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPIAMVADQWYDANGVWTGSATFLDD  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G +VMLYTGSTD++VQVQNLAYP D+ DPLLL WVKYSGNPVLVPPPGI  KDFRDPTTA
Sbjct  203  GSLVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKYSGNPVLVPPPGILPKDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ KTGISLVY+T +F  Y+  D +LH VP TG
Sbjct  263  WKTSD-GKWRITIGSKINKTGISLVYDTIDFKTYEKHDTLLHKVPNTG  309



>gb|AEY79729.1| vacuolar invertase isoform 1 [Rosa hybrid cultivar]
Length=588

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSAIWGNITWGHAVS DLIHW +LP AMV DQWYD NGVW+GSAT+LP+
Sbjct  142  GWYHLFYQYNPDSAIWGNITWGHAVSTDLIHWLYLPIAMVADQWYDANGVWSGSATLLPD  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTG T + VQV  LA+PA++ DPLLLDWVKYSGNPVL PPPGI   DFRDPTTA
Sbjct  202  GQIVMLYTGDTVDAVQVVCLAHPANLSDPLLLDWVKYSGNPVLTPPPGILTTDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ GKW ITIGSKV  TGIS VY T +F  Y +  GVLHAVPGTG
Sbjct  262  WTGPD-GKWRITIGSKVNTTGISFVYHTEDFKTYNMSKGVLHAVPGTG  308



>ref|XP_009118103.1| PREDICTED: acid beta-fructofuranosidase 4, vacuolar [Brassica 
rapa]
Length=663

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSAT L +
Sbjct  143  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPIAMVADQWYDANGVWTGSATFLDD  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G +VMLYTGSTD++VQVQNLAYP D+ DPLLL WVKYSGNPVLVPPPGI  KDFRDPTTA
Sbjct  203  GSLVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKYSGNPVLVPPPGILPKDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ KTGISLVY+T +F  Y+  D +LH VP TG
Sbjct  263  WKTSD-GKWRITIGSKINKTGISLVYDTIDFKTYEKHDTLLHKVPNTG  309



>emb|CDY26548.1| BnaA09g47290D [Brassica napus]
Length=663

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSAT L +
Sbjct  143  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPIAMVADQWYDANGVWTGSATFLDD  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G +VMLYTGSTD++VQVQNLAYP D+ DPLLL WVKYSGNPVLVPPPGI  KDFRDPTTA
Sbjct  203  GSLVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKYSGNPVLVPPPGILPKDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ KTGISLVY+T +F  Y+  D +LH VP TG
Sbjct  263  WKTSD-GKWRITIGSKINKTGISLVYDTIDFKTYEKHDTLLHKVPNTG  309



>emb|CDY39804.1| BnaA09g10560D [Brassica napus]
Length=631

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLPFAMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLHLPFAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVL PPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPNDPLLLKWTKFSGNPVLEPPPGIGDKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+T +F  Y+  D +LH VP TG
Sbjct  255  WKTSD-GKWRITIGSKINRTGISLVYDTVDFKTYEKHDILLHQVPNTG  301



>ref|XP_009112697.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Brassica 
rapa]
Length=655

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLPFAMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLHLPFAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVL PPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPNDPLLLKWTKFSGNPVLEPPPGIGDKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+T +F  Y+  D +LH VP TG
Sbjct  255  WKTSD-GKWRITIGSKINRTGISLVYDTVDFKTYEKHDILLHQVPNTG  301



>ref|XP_010430328.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X1 [Camelina sativa]
 ref|XP_010430329.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like isoform 
X2 [Camelina sativa]
Length=648

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPLAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPSDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+TT+F  Y+  + +LH VP TG
Sbjct  255  WKTSS-GKWRITIGSKINRTGISLVYDTTDFKTYEKHETLLHQVPNTG  301



>ref|NP_563901.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
 sp|Q39041.2|INVA4_ARATH RecName: Full=Acid beta-fructofuranosidase 4, vacuolar; Short=At 
beta fruct4; Short=AtBETAFRUCT4; AltName: Full=Acid invertase 
4; Short=AI 4; AltName: Full=Acid sucrose hydrolase 4; 
AltName: Full=Vacuolar invertase 4; Short=Inv-V4; Short=VAC-INV 
4; Short=VI 4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12569.1|AC022522_2 beta-fructosidase [Arabidopsis thaliana]
 emb|CAA72321.1| beta-fructosidase [Arabidopsis thaliana]
 gb|AAK76683.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AAN13204.1| putative beta-fructosidase [Arabidopsis thaliana]
 gb|AEE28855.1| acid beta-fructofuranosidase 4 [Arabidopsis thaliana]
Length=664

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSAT LP+
Sbjct  144  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPIAMVADQWYDSNGVWTGSATFLPD  203

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  204  GSIVMLYTGSTDKAVQVQNLAYPEDPNDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  263

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+ LD +LH VP TG
Sbjct  264  WKTSE-GKWRITIGSKLNKTGISLVYDTIDFKTYEKLDTLLHRVPNTG  310



>emb|CDY15984.1| BnaC08g41390D [Brassica napus]
Length=680

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AMV DQWYD NGVWTGSAT L +
Sbjct  162  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPIAMVADQWYDANGVWTGSATFLDD  221

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G + MLYTGSTD++VQVQNLAYP D+ DPLLL WVKYSGNPVLVPPPGI  KDFRDPTTA
Sbjct  222  GSLAMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKYSGNPVLVPPPGILPKDFRDPTTA  281

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ KTGISLVY+T +F  Y+  D +LH VP TG
Sbjct  282  WKTSD-GKWRITIGSKINKTGISLVYDTIDFKTYEKQDALLHKVPNTG  328



>emb|CAA66330.1| beta-fructosidase [Arabidopsis thaliana]
Length=660

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVSRDLIHW HLP AMV DQWYD NGVWTGSAT LP+
Sbjct  140  GWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPIAMVADQWYDSNGVWTGSATFLPD  199

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  200  GSIVMLYTGSTDKAVQVQNLAYPEDPNDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  259

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK+ KTGISLVY+T +F  Y+ LD +LH VP TG
Sbjct  260  WKTSE-GKWRITIGSKLNKTGISLVYDTIDFKTYEKLDTLLHRVPNTG  306



>ref|XP_004511663.1| PREDICTED: acid beta-fructofuranosidase-like [Cicer arietinum]
Length=646

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WG+I WGHAVSRDLIHWFHLP AMV D+WYD  GVWTGSATILPN
Sbjct  138  GWYHFFYQYNPNGAVWGDIVWGHAVSRDLIHWFHLPLAMVADKWYDQKGVWTGSATILPN  197

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+++MLYTG+T+E VQVQNLAYP+D  DPLL+DW+KY  NPVL PPPGI V DFRDPTTA
Sbjct  198  GEVIMLYTGATNELVQVQNLAYPSDPSDPLLIDWIKYPKNPVLFPPPGINVHDFRDPTTA  257

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W++   GKW I+IGSK+ KTGI+LVYET +F  ++ ++GVL AVP  G
Sbjct  258  WLTSQ-GKWRISIGSKINKTGIALVYETQDFRTFERVEGVLRAVPKVG  304



>ref|XP_010259193.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Nelumbo nucifera]
Length=676

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP+SA+WGNITWGHA+S+DLI+W +LPFAMVPD+WYDINGVWTGSAT+LP+
Sbjct  148  GWYHLFYQYNPESAVWGNITWGHAISKDLINWENLPFAMVPDEWYDINGVWTGSATLLPD  207

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IV+LYTG T + VQVQNLAYPAD  DP L+ WVKY GNP+LVPPP I   DFRDPTTA
Sbjct  208  GSIVVLYTGFTKDKVQVQNLAYPADPSDPRLIHWVKYPGNPILVPPPHIRDLDFRDPTTA  267

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ G W + IGSK+  TGISLVY TTNFT Y+LLDG+LHAVP TG
Sbjct  268  WFGPD-GHWRVAIGSKINDTGISLVYHTTNFTTYELLDGLLHAVPETG  314



>emb|CDY03265.1| BnaC09g10830D [Brassica napus]
Length=631

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLPFAMVPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLHLPFAMVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVL PPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPNDPLLLKWTKFSGNPVLEPPPGIGDKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+T +F  Y+  D +LH VP TG
Sbjct  255  WKTSD-GKWRITIGSKINRTGISLVYDTVDFKTYEKHDILLHHVPNTG  301



>gb|AAG36943.1|AF274299_1 acid invertase [Brassica oleracea]
Length=662

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW HLP AM  DQWYD NGVWTGSAT L +
Sbjct  142  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPLAMAADQWYDANGVWTGSATFLED  201

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD++VQVQNLAYP D+ DPLLL WVK+ GNPVLVPPPGI  KDFRDPTTA
Sbjct  202  GSIVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKFPGNPVLVPPPGILPKDFRDPTTA  261

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+TT+F  Y+ L+ +LH VP TG
Sbjct  262  WKT-SAGKWRITIGSKINRTGISLVYDTTDFKTYEKLETLLHKVPNTG  308



>emb|CAA72109.1| vacuolar invertase [Allium cepa]
Length=188

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WGNI WGHAVSRDL+HW HLP AMVPDQWYDINGVWTGSATILP+
Sbjct  13   GWYHFFYQYNPEGAVWGNIAWGHAVSRDLVHWTHLPLAMVPDQWYDINGVWTGSATILPD  72

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTG+T E+VQVQNLA PAD  D LLL W K   NP+LVPPPGIG KDFRDPTTA
Sbjct  73   GQIVMLYTGATSESVQVQNLAVPADQSDTLLLRWKKSEANPILVPPPGIGDKDFRDPTTA  132

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+   W I IGSK    +GI++VY T +F +YKL+ G+LHAV   G
Sbjct  133  WYEPSDDTWRIVIGSKDSSHSGIAIVYSTKDFINYKLIPGILHAVERVG  181



>ref|XP_004307806.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=504

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMV DQWYD NGVW+GSAT+LP+
Sbjct  29   GWYHLFYQYNPDSAVWGNITWGHAVSTDLIHWLYLPLAMVADQWYDANGVWSGSATLLPD  88

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG T + VQVQ LAYP ++ DPLLLDWVKYSGNPVL PPPGI   DFRDPTTA
Sbjct  89   GNIVMLYTGDTVDAVQVQCLAYPGNLSDPLLLDWVKYSGNPVLTPPPGILSTDFRDPTTA  148

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK+  TG+S VY T +F +Y +  G+LH VPGTG
Sbjct  149  WIGPD-GKWRITIGSKINTTGVSFVYITEDFINYNMSQGLLHEVPGTG  195



>emb|CDY03264.1| BnaC09g10840D [Brassica napus]
Length=606

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            G YH FYQYN + A+WG+I WGHAVS+DLIHWFH P AMVPDQWYD NGVWTGSAT+L +
Sbjct  123  GLYHFFYQYNLNGAVWGDIAWGHAVSKDLIHWFHFPLAMVPDQWYDANGVWTGSATLLDD  182

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD  VQV NLAYP D  DPLL+ W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  183  GSIVMLYTGSTDNFVQVLNLAYPEDPSDPLLMKWTKFSGNPVLVPPPGIGAKDFRDPTTA  242

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSKV +TGISLVY+TT+F  Y+ LD +LH VP TG
Sbjct  243  WKTLD-GKWRITIGSKVNRTGISLVYDTTDFKTYEKLDNLLHQVPDTG  289



>ref|XP_010473488.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar [Camelina 
sativa]
Length=648

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP A+VPDQWYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPLALVPDQWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPSDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TGISLVY+TT+F  Y+  + +LH VP TG
Sbjct  255  WKTSS-GKWRITIGSKINRTGISLVYDTTDFKTYEKHETLLHQVPNTG  301



>ref|XP_010418267.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=648

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP++A+WG+I WGHAVS+DLIHW +LP AMVPD+WYD NGVWTGSAT L +
Sbjct  135  GWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPLAMVPDKWYDANGVWTGSATFLDD  194

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTGSTD+ VQVQNLAYP D  DPLLL W K+SGNPVLVPPPGIG KDFRDPTTA
Sbjct  195  GSIVMLYTGSTDKFVQVQNLAYPEDPSDPLLLKWTKFSGNPVLVPPPGIGAKDFRDPTTA  254

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSKV +TGISL+Y+TT+F  Y+  + +LH VP TG
Sbjct  255  WKTSS-GKWRITIGSKVNRTGISLLYDTTDFKTYEKHETLLHQVPNTG  301



>emb|CAC81826.1| beta-fructofuranosidase [Beta vulgaris]
Length=284

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            G+YHLFYQYNPDSA+WGNITWGHA+S DLIHW +LP +M PDQWYDINGV TGSATILP+
Sbjct  6    GFYHLFYQYNPDSAVWGNITWGHAISTDLIHWKYLPISMKPDQWYDINGVXTGSATILPD  65

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+M+YTG TD+ VQVQNLAYPA++ DPLLLDWVKY GNPVL PP GIG KDFRDPTTA
Sbjct  66   GKIMMVYTGDTDKFVQVQNLAYPANLSDPLLLDWVKYPGNPVLTPPEGIGAKDFRDPTTA  125

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W + IGSK G TGISLVY+T +F  Y+ L+  LHAVPGTG
Sbjct  126  WVGPD-GIWRLIIGSKTGTTGISLVYKTKDFKTYE-LESNLHAVPGTG  171



>dbj|BAM74660.1| acid invertase, partial [Ipomoea batatas]
Length=177

 Score =   246 bits (629),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIW-GNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILP  178
            GWYHLFYQYNP+SAIW  NITWGHAVSRD+IHW HLP+AM+PDQ YD+ GVWTGSAT LP
Sbjct  1    GWYHLFYQYNPNSAIWVENITWGHAVSRDMIHWLHLPYAMLPDQPYDLRGVWTGSATTLP  60

Query  179  NGQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTT  358
            +G I+MLYTG+T  NVQVQNLAYPA++ DPLLL WVKYSGNPV+ PP GI + +FRDP++
Sbjct  61   DGNIMMLYTGNT--NVQVQNLAYPANLSDPLLLKWVKYSGNPVIAPPLGIDLLEFRDPSS  118

Query  359  AWMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            AW     G+W +TIGS+VGKTG++ +YETT+F  YKLLD  LH+VP TG
Sbjct  119  AWAGIEKGQWFVTIGSQVGKTGVAFIYETTDFKRYKLLDEFLHSVPRTG  167



>ref|XP_010672026.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Beta vulgaris subsp. vulgaris]
Length=645

 Score =   260 bits (664),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            G+YHLFYQYNPDSA+WGNITWGHA+S DLIHW +LP +M PDQWYDINGVWTGSATILP+
Sbjct  145  GFYHLFYQYNPDSAVWGNITWGHAISTDLIHWKYLPISMKPDQWYDINGVWTGSATILPD  204

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I+M+YTG TD+ VQVQNLAYPA++ DPLLLDWVKY GNPVL PP GIG KDFRDPTTA
Sbjct  205  GKIMMVYTGDTDKFVQVQNLAYPANLSDPLLLDWVKYPGNPVLTPPEGIGAKDFRDPTTA  264

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ G W + IGSK G TGISLVY+T +F  Y+ L+  LHAVPGTG
Sbjct  265  WVGPD-GIWRLIIGSKTGTTGISLVYKTKDFKTYE-LESNLHAVPGTG  310



>ref|XP_010062212.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
[Eucalyptus grandis]
 gb|KCW90831.1| hypothetical protein EUGRSUZ_A02888 [Eucalyptus grandis]
Length=654

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS+DLIHW +LP AMVPD+W+DI GVWTGSAT+LP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSKDLIHWLYLPLAMVPDRWFDIGGVWTGSATLLPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG    +VQVQNLAYPA++ DPLLLDWVKY  NPV+VPP GI   +FRDPTTA
Sbjct  201  GRIVMLYTGDMANSVQVQNLAYPANLSDPLLLDWVKYPDNPVIVPPAGIEYDEFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ PN G W + IG+KV  TG++L+YETTNFT Y+   GVLHAV GTG
Sbjct  261  WIGPN-GTWRLLIGTKVNSTGMALIYETTNFTTYEAAPGVLHAVNGTG  307



>ref|XP_002303584.2| hypothetical protein POPTR_0003s12640g [Populus trichocarpa]
 gb|EEE78563.2| hypothetical protein POPTR_0003s12640g [Populus trichocarpa]
Length=612

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP +A+WG+I WGHAVSRDLI+WFHLP A+V D+W+DINGVWTGSATIL N
Sbjct  107  GWYHFFYQHNPHAAVWGDIVWGHAVSRDLINWFHLPLAIVSDEWFDINGVWTGSATILLN  166

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTGST+E+VQVQNLAYPAD  DPLLL WVKYSGNPVLV PPGI   DFRDPTTA
Sbjct  167  GKIVMLYTGSTNESVQVQNLAYPADHNDPLLLKWVKYSGNPVLVSPPGIDPNDFRDPTTA  226

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK   TGI+LVY+T +F ++K L GVLH VPGTG
Sbjct  227  WYTSE-GKWRITIGSKANNTGIALVYDTEDFINFK-LSGVLHGVPGTG  272



>ref|XP_004307805.1| PREDICTED: beta-fructofuranosidase, soluble isoenzyme I-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=644

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLIHW +LP AMV DQWYD NGVW+GSAT+LP+
Sbjct  141  GWYHLFYQYNPDSAVWGNITWGHAVSTDLIHWLYLPLAMVADQWYDANGVWSGSATLLPD  200

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG T + VQVQ LAYP ++ DPLLLDWVKYSGNPVL PPPGI   DFRDPTTA
Sbjct  201  GNIVMLYTGDTVDAVQVQCLAYPGNLSDPLLLDWVKYSGNPVLTPPPGILSTDFRDPTTA  260

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+ GKW ITIGSK+  TG+S VY T +F +Y +  G+LH VPGTG
Sbjct  261  WIGPD-GKWRITIGSKINTTGVSFVYITEDFINYNMSQGLLHEVPGTG  307



>ref|XP_011022761.1| PREDICTED: acid beta-fructofuranosidase-like [Populus euphratica]
Length=648

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP +A+WG+I WGHAVSRDLI+WFHLP A+V D+W+DINGVWTGSATILPN
Sbjct  143  GWYHFFYQHNPHAAVWGDIVWGHAVSRDLINWFHLPLAIVADEWFDINGVWTGSATILPN  202

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+I MLYTGST+E+VQVQNLAYPAD  DPLLL WVKYSGNPVLV PPGI   DFRDPTTA
Sbjct  203  GKIAMLYTGSTNESVQVQNLAYPADHNDPLLLKWVKYSGNPVLVSPPGIDPNDFRDPTTA  262

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW ITIGSK   TGI+LVY+T +F ++K + GVLH VPGTG
Sbjct  263  WYTSE-GKWRITIGSKANFTGIALVYDTEDFINFK-MSGVLHGVPGTG  308



>ref|XP_010906620.1| PREDICTED: beta-fructofuranosidase 1-like [Elaeis guineensis]
Length=653

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNI WGHAVSRDL+HW HLP AMVPD+WYD +GVWTGSATILP 
Sbjct  140  GWYHLFYQYNPDSAVWGNIAWGHAVSRDLVHWDHLPLAMVPDRWYDHSGVWTGSATILPT  199

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+VQVQNLA PAD  DPLL  WVK   NPVL PPPGIG +DFRDPTTA
Sbjct  200  GQIIMLYTGSTNESVQVQNLAVPADPADPLLKTWVKSDSNPVLAPPPGIGARDFRDPTTA  259

Query  362  WMSPNVGKWLITIGSKVGK-TGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+   W I IGSK G   GI +VY+T +F  Y+L+ GVLH VPGTG
Sbjct  260  WYDPSDDTWRIAIGSKDGSHAGIVIVYKTRDFARYELVPGVLHRVPGTG  308



>gb|AEB66649.1| vacuole invertase [Rumex dentatus]
Length=567

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLI+W +LP AMVPD+W+D NGVWTGSAT+LP 
Sbjct  134  GWYHLFYQYNPDSAVWGNITWGHAVSTDLINWLYLPLAMVPDRWFDWNGVWTGSATLLPG  193

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG TD  VQVQNLAYPA++ DPLLL+W+KY  NPV+ PP GI +KDFRDPTTA
Sbjct  194  GDIVMLYTGDTDNYVQVQNLAYPANLSDPLLLEWLKYPDNPVMTPPEGIALKDFRDPTTA  253

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLL-DGVLHAVPGTG  505
            W+ P+ G W +T+GSKV KTGI+LVY+T+NFT Y+L+ D VLH+V GTG
Sbjct  254  WIGPD-GLWRVTVGSKVNKTGIALVYKTSNFTSYELIEDHVLHSVAGTG  301



>gb|AEB66648.1| vacuole invertase [Rumex dentatus]
Length=567

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNITWGHAVS DLI+W +LP AMVPD+W+D NGVWTGSAT+LP 
Sbjct  134  GWYHLFYQYNPDSAVWGNITWGHAVSTDLINWLYLPLAMVPDRWFDWNGVWTGSATLLPG  193

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG TD  VQVQNLAYPA++ DPLLL+W+KY  NPV+ PP GI +KDFRDPTTA
Sbjct  194  GDIVMLYTGDTDNYVQVQNLAYPANLSDPLLLEWLKYPDNPVMTPPEGIALKDFRDPTTA  253

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLL-DGVLHAVPGTG  505
            W+ P+ G W +T+GSKV KTGI+LVY+T+NFT Y+L+ D VLH+V GTG
Sbjct  254  WIGPD-GLWRVTVGSKVNKTGIALVYKTSNFTSYELIEDHVLHSVAGTG  301



>ref|XP_010053435.1| PREDICTED: acid beta-fructofuranosidase-like [Eucalyptus grandis]
 gb|KCW77732.1| hypothetical protein EUGRSUZ_D02029 [Eucalyptus grandis]
Length=653

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNPD+A+WGNI WGHAVS DLIHW +LP AMV DQWYDINGVW+GSAT+LP+
Sbjct  151  GWYHFFYQYNPDAAVWGNIVWGHAVSEDLIHWLYLPLAMVADQWYDINGVWSGSATVLPD  210

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQ++MLYTGS++E+ Q+QNLAYPA++ DPLL+DWVK+ GNP+L PP  I   DFRDPTTA
Sbjct  211  GQVMMLYTGSSNESQQLQNLAYPANLSDPLLIDWVKHPGNPILAPPQCIDKLDFRDPTTA  270

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +   GKW   +G+K+ KTG+S VYET +F  YKLL G+LHAVPGTG
Sbjct  271  WYTSG-GKWRFAVGAKINKTGVSFVYETEDFKSYKLLPGLLHAVPGTG  317



>gb|EYU24965.1| hypothetical protein MIMGU_mgv1a004782mg [Erythranthe guttata]
Length=510

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  26   YNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPNGQIVMLYT  205
            YN D+A+WGNITWGHAVS+DLIHW HLPFAMV DQWYDINGVWTGSATILP+G+I+MLYT
Sbjct  5    YNEDAAVWGNITWGHAVSKDLIHWLHLPFAMVRDQWYDINGVWTGSATILPDGRIIMLYT  64

Query  206  GSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTAWMSPNVGK  385
            G T++ VQVQ L+YPA+  DPLL+DWVK   NPVL PPPGIG KDFRDPTTAW+SP   +
Sbjct  65   GDTNDFVQVQCLSYPANQSDPLLIDWVKDPSNPVLTPPPGIGAKDFRDPTTAWLSPGGDR  124

Query  386  WLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W ITIGSKV  TGISLVYET +F  Y+LLDG LH V GTG
Sbjct  125  WRITIGSKVNTTGISLVYETEDFVKYELLDGYLHEVAGTG  164



>ref|XP_010419461.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like, partial 
[Camelina sativa]
Length=353

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP   +WGNI WGHAVS+DLIHW +LP AMVPDQWYD+NGV TGSAT L +
Sbjct  129  GWYHFFYQHNPYGTVWGNIVWGHAVSKDLIHWLYLPIAMVPDQWYDVNGVITGSATFLDD  188

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG T E VQVQNLAYP D  DPLLL WVK+SGNP+L+PPPGIG KDFRDPTTA
Sbjct  189  GSIVMLYTGITGEFVQVQNLAYPEDPSDPLLLKWVKFSGNPILLPPPGIGAKDFRDPTTA  248

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW I IGSK+ +TG+SL+Y+TT+F  Y+LLD +LH V  TG
Sbjct  249  WKTSS-GKWRIAIGSKINRTGVSLLYDTTDFKTYELLDTLLHQVSNTG  295



>ref|XP_010430330.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=643

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP   +WGNI WGHAVS+DLIHW +LP AMVPDQWYD+NGV TGSAT L +
Sbjct  129  GWYHFFYQHNPYGTVWGNIVWGHAVSKDLIHWLYLPIAMVPDQWYDVNGVITGSATFLDD  188

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG T E VQVQNLAYP D  DPLLL WVK+SGNP+L+PPPGIG KDFRDPTTA
Sbjct  189  GSIVMLYTGITGEFVQVQNLAYPEDPSDPLLLKWVKFSGNPILLPPPGIGAKDFRDPTTA  248

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW I IGSK+ +TG+SLVY+TT+F  Y+LLD +LH VP TG
Sbjct  249  WKT-SAGKWRIVIGSKINRTGVSLVYDTTDFKTYELLDTLLHQVPNTG  295



>ref|NP_001234069.1| invertase [Solanum lycopersicum]
 emb|CAJ19056.1| invertase [Solanum lycopersicum]
Length=652

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP++A+WGNI WGHAVSRDLIHW HLP AMV DQWYDINGVWTGSAT LPN
Sbjct  150  GWYHLFYQYNPEAAVWGNIVWGHAVSRDLIHWQHLPVAMVADQWYDINGVWTGSATFLPN  209

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G ++MLYTGST+E++QVQNLAYPAD  DPLL  W+KY GNPV +PPPGIG+KDFRDPTTA
Sbjct  210  GDLIMLYTGSTNESIQVQNLAYPADPSDPLLRKWIKYEGNPVPIPPPGIGLKDFRDPTTA  269

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P  GKW ITIGSK+ KTGISLVY+T +F  ++LL G+LH VPGTG
Sbjct  270  WTTPE-GKWRITIGSKINKTGISLVYDTIDFKKFELLKGMLHGVPGTG  316



>ref|XP_010941127.1| PREDICTED: beta-fructofuranosidase 1-like [Elaeis guineensis]
Length=661

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            G YHLFYQYNPDSA+WGNITWGHAVSRDL+HW HLP AMVPD WYD+ GVWTGSATILP 
Sbjct  149  GLYHLFYQYNPDSAVWGNITWGHAVSRDLVHWAHLPLAMVPDHWYDLRGVWTGSATILPT  208

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTGST+E+VQVQNLA PAD  DPLL  WVK   NPVL PPPGIG KDFRDPTTA
Sbjct  209  GQIVMLYTGSTNESVQVQNLAVPADPSDPLLKTWVKSDSNPVLAPPPGIGPKDFRDPTTA  268

Query  362  WMSPNVGKWLITIGSKVGK-TGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+ G W   +GSK G   GI +VY T +F  Y+L+ G+LH VPGTG
Sbjct  269  WYDPSDGTWKFAVGSKDGSHAGIVIVYRTPDFVRYELVPGLLHRVPGTG  317



>ref|XP_006300852.1| hypothetical protein CARUB_v10019944mg [Capsella rubella]
 gb|EOA33750.1| hypothetical protein CARUB_v10019944mg [Capsella rubella]
Length=640

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP+  +WG+I WGHAVS+DLIHW HLP AMVPDQWYD+NGV TGSAT L +
Sbjct  126  GWYHFFYQHNPNGTVWGDIVWGHAVSKDLIHWLHLPIAMVPDQWYDVNGVLTGSATFLDD  185

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG TD+ VQVQNLAYP D  DPLLL WVK+SGNP+L+PP GIG KDFRDPTTA
Sbjct  186  GSIVMLYTGITDKFVQVQNLAYPEDPSDPLLLKWVKFSGNPILLPPLGIGAKDFRDPTTA  245

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW ITIGSK+ +TG+SLVY+TT+F  Y+LLD +LH V  TG
Sbjct  246  WKT-SAGKWRITIGSKINRTGVSLVYDTTDFKTYELLDTLLHQVSNTG  292



>ref|XP_009384549.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=645

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 136/171 (80%), Gaps = 3/171 (2%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP SA+WGNITWGHAVS DL+HWF+LP AMVPD WYD NGVWTGSATILP+
Sbjct  128  GWYHLFYQYNPASAVWGNITWGHAVSLDLVHWFYLPIAMVPDHWYDANGVWTGSATILPD  187

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++ MLYTGST E VQVQNLA+PAD  DPLLL WVK   NPVLVPPPGI  KDFRDPTTA
Sbjct  188  GRLAMLYTGSTAELVQVQNLAFPADQDDPLLLTWVKSESNPVLVPPPGIAPKDFRDPTTA  247

Query  362  WMSPNVGKWLITIGSK---VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+   W I IGSK       GI+LVY T++F  Y+LL GVLH+V GTG
Sbjct  248  WYVPSESAWRIAIGSKNDSQRHAGIALVYRTSDFLSYELLPGVLHSVAGTG  298



>gb|AEX15265.1| vacuolar invertase [Musa acuminata AAA Group]
Length=645

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 136/171 (80%), Gaps = 3/171 (2%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNP SA+WGNITWGHAVS DL+HWF+LP AMVPD WYD NGVWTGSATILP+
Sbjct  128  GWYHLFYQYNPASAVWGNITWGHAVSLDLVHWFYLPIAMVPDHWYDANGVWTGSATILPD  187

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++ MLYTGST E VQVQNLA+PAD  DPLLL WVK   NPVLVPPPGI  KDFRDPTTA
Sbjct  188  GRLAMLYTGSTAELVQVQNLAFPADQDDPLLLTWVKSESNPVLVPPPGIAPKDFRDPTTA  247

Query  362  WMSPNVGKWLITIGSK---VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+   W I IGSK       GI+LVY T++F  Y+LL GVLH+V GTG
Sbjct  248  WYVPSESAWRIAIGSKNDSQRHAGIALVYRTSDFLSYELLPGVLHSVAGTG  298



>ref|XP_010473489.1| PREDICTED: acid beta-fructofuranosidase 3, vacuolar-like [Camelina 
sativa]
Length=643

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQ+NP   +WGNI WGHAVS+DLIHW +LP AMVPDQWYD+NGV TGSAT L +
Sbjct  129  GWYHFFYQHNPYGTVWGNIVWGHAVSKDLIHWLYLPVAMVPDQWYDVNGVITGSATFLDD  188

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G IVMLYTG T + VQVQNLAYP D  DPLLL WVK+SGNP+L+PPPGIG KDFRDPTTA
Sbjct  189  GSIVMLYTGITGDFVQVQNLAYPEDPSDPLLLKWVKFSGNPILLPPPGIGAKDFRDPTTA  248

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W + + GKW I IGSK+ +TG+SLVY+TT+F  Y+LLD +LH VP TG
Sbjct  249  WKTSS-GKWRIAIGSKINRTGVSLVYDTTDFKTYELLDTLLHQVPNTG  295



>gb|AAF87245.1|AF276703_1 vacuolar acid invertase [Oryza sativa]
Length=652

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQ+NPDSA+WGNITWGHAVSRDLIHW HLP AMVPD WYDINGVWTGSAT LP+
Sbjct  134  GWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPD  193

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG+T+E+VQVQNLA PAD  DPLL +W K   NPVLVPPPGIG+ DFRDPTTA
Sbjct  194  GRIVMLYTGATEESVQVQNLAEPADPNDPLLREWSKAEANPVLVPPPGIGLTDFRDPTTA  253

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P    W ITIGSK     G++LVY+T +F  Y LL  +LH V GTG
Sbjct  254  WRNPADSAWRITIGSKDRDHAGLALVYKTEDFLHYDLLPTLLHVVKGTG  302



>emb|CAA06839.1| invertase [Allium cepa]
Length=690

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH FYQYNP+ A+WGNI WGHAVSRDL+HW HLP AMVPDQWYDINGVWTGSATILP+
Sbjct  173  GWYHFFYQYNPEGAVWGNIAWGHAVSRDLVHWTHLPLAMVPDQWYDINGVWTGSATILPD  232

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQIVMLYTG+T+E+VQVQNLA PAD  D LLL W K   NP+LVPPPGIG KDFRDPTTA
Sbjct  233  GQIVMLYTGATNESVQVQNLAVPADQSDTLLLRWKKSEANPILVPPPGIGDKDFRDPTTA  292

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+   W I IGSK    +GI++VY T +F +YKL+ G+LHAV   G
Sbjct  293  WYEPSDDTWRIVIGSKDSSHSGIAIVYSTKDFINYKLIPGILHAVERVG  341



>ref|XP_008794813.1| PREDICTED: beta-fructofuranosidase 1-like [Phoenix dactylifera]
Length=664

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDS +WGNITWGHAVSRDL+HW HLP AMVPD+WYD++GVWTGSATILP 
Sbjct  147  GWYHLFYQYNPDSVVWGNITWGHAVSRDLVHWEHLPLAMVPDRWYDLSGVWTGSATILPT  206

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            GQI+MLYTGST+E+ QVQNLA P D  DPLL  W K   NPVL PPPGIG +DFRDPTTA
Sbjct  207  GQIIMLYTGSTNESAQVQNLAVPVDPSDPLLKTWAKSDSNPVLFPPPGIGARDFRDPTTA  266

Query  362  WMSPNVGKWLITIGSKVGK-TGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P+   W I IGSK G   GI +VY T +F  Y+L+ G+LH VPGTG
Sbjct  267  WYDPSDDTWKIAIGSKDGSHVGIVIVYRTRDFVSYELVPGLLHRVPGTG  315



>ref|NP_001053422.1| Os04g0535600 [Oryza sativa Japonica Group]
 dbj|BAF15336.1| Os04g0535600 [Oryza sativa Japonica Group]
 dbj|BAG89376.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94058.1| unnamed protein product [Oryza sativa Japonica Group]
Length=656

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQ+NPDSA+WGNITWGHAVSRDLIHW HLP AMVPD WYDINGVWTGSAT LP+
Sbjct  144  GWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPD  203

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG+T+E+VQVQNLA PAD  DPLL +W K   NPVLVPPPGIG+ DFRDPTTA
Sbjct  204  GRIVMLYTGATEESVQVQNLAEPADPNDPLLREWSKAEANPVLVPPPGIGLTDFRDPTTA  263

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P    W ITIGSK     G++LVY+T +F  Y LL  +LH V GTG
Sbjct  264  WRNPADSAWRITIGSKDRDHAGLALVYKTEDFLHYDLLPTLLHVVKGTG  312



>emb|CAH67112.1| H0502G05.3 [Oryza sativa Indica Group]
 emb|CAH67470.1| OSIGBa0159I10.15 [Oryza sativa Indica Group]
Length=649

 Score =   253 bits (645),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQ+NPDSA+WGNITWGHAVSRDLIHW HLP AMVPD WYDINGVWTGSAT LP+
Sbjct  137  GWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPD  196

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG+T+E+VQVQNLA PAD  DPLL +W K   NPVLVPPPGIG+ DFRDPTTA
Sbjct  197  GRIVMLYTGATEESVQVQNLAEPADPNDPLLREWSKAEANPVLVPPPGIGLTDFRDPTTA  256

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P    W ITIGSK     G++LVY+T +F  Y LL  +LH V GTG
Sbjct  257  WRNPADSAWRITIGSKDRDHAGLALVYKTEDFLHYDLLPTLLHVVKGTG  305



>emb|CAD41525.3| OSJNBb0020O11.6 [Oryza sativa Japonica Group]
Length=666

 Score =   253 bits (646),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQ+NPDSA+WGNITWGHAVSRDLIHW HLP AMVPD WYDINGVWTGSAT LP+
Sbjct  137  GWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPD  196

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG+T+E+VQVQNLA PAD  DPLL +W K   NPVLVPPPGIG+ DFRDPTTA
Sbjct  197  GRIVMLYTGATEESVQVQNLAEPADPNDPLLREWSKAEANPVLVPPPGIGLTDFRDPTTA  256

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P    W ITIGSK     G++LVY+T +F  Y LL  +LH V GTG
Sbjct  257  WRNPADSAWRITIGSKDRDHAGLALVYKTEDFLHYDLLPTLLHVVKGTG  305



>ref|XP_009401797.1| PREDICTED: beta-fructofuranosidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 138/171 (81%), Gaps = 3/171 (2%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQYNPDSA+WGNI+WGHAVSRDL+HW +LP AMVPD+WYD NGVWTGSAT LP+
Sbjct  145  GWYHLFYQYNPDSAVWGNISWGHAVSRDLVHWLYLPLAMVPDRWYDANGVWTGSATTLPD  204

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G++VM+YTG+T E+VQVQNLA+PAD  DPLL+ WVK   NPV+VPP GIG+KDFRDPTTA
Sbjct  205  GRLVMIYTGATMESVQVQNLAFPADPDDPLLVHWVKSECNPVIVPPSGIGLKDFRDPTTA  264

Query  362  WMSPNVGKWLITIGSKVGK---TGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W  P    W + IGSK       GI LVY TT+F  Y+LL GVLH+V GTG
Sbjct  265  WFVPADSAWRVAIGSKNDSQHHAGIVLVYRTTDFVSYELLPGVLHSVTGTG  315



>gb|EEC77707.1| hypothetical protein OsI_16783 [Oryza sativa Indica Group]
 gb|EEE61409.1| hypothetical protein OsJ_15598 [Oryza sativa Japonica Group]
Length=673

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYHLFYQ+NPDSA+WGNITWGHAVSRDLIHW HLP AMVPD WYDINGVWTGSAT LP+
Sbjct  144  GWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLHLPLAMVPDHWYDINGVWTGSATQLPD  203

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG+T+E+VQVQNLA PAD  DPLL +W K   NPVLVPPPGIG+ DFRDPTTA
Sbjct  204  GRIVMLYTGATEESVQVQNLAEPADPNDPLLREWSKAEANPVLVPPPGIGLTDFRDPTTA  263

Query  362  WMSPNVGKWLITIGSK-VGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W +P    W ITIGSK     G++LVY+T +F  Y LL  +LH V GTG
Sbjct  264  WRNPADSAWRITIGSKDRDHAGLALVYKTEDFLHYDLLPTLLHVVKGTG  312



>ref|XP_007131343.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
 gb|ESW03337.1| hypothetical protein PHAVU_011G005900g [Phaseolus vulgaris]
Length=627

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  2    GWYHLFYQYNPDSAIWGNITWGHAVSRDLIHWFHLPFAMVPDQWYDINGVWTGSATILPN  181
            GWYH+FYQYNP+SA++GNITWGHAVS DLIHW +LP AM+ D WYD  GVW+GSAT+LP+
Sbjct  131  GWYHIFYQYNPESAVFGNITWGHAVSTDLIHWLYLPIAMLRDSWYDAKGVWSGSATLLPD  190

Query  182  GQIVMLYTGSTDENVQVQNLAYPADVLDPLLLDWVKYSGNPVLVPPPGIGVKDFRDPTTA  361
            G+IVMLYTG+T +NVQVQNLAYPA++ DPLLL WVKY+ NPV++PPPGIG KDFRDPTTA
Sbjct  191  GRIVMLYTGNTHQNVQVQNLAYPANLSDPLLLHWVKYADNPVVLPPPGIGPKDFRDPTTA  250

Query  362  WMSPNVGKWLITIGSKVGKTGISLVYETTNFTDYKLLDGVLHAVPGTG  505
            W+ P+  KW + IGSKV +TG+SLVY+T +F  Y+L D  +H VPGTG
Sbjct  251  WVGPD-DKWRVLIGSKVNQTGLSLVYKTQDFIHYELNDEYMHEVPGTG  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517811659326