BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33173_g1_i1 len=623 path=[1:0-622]

Length=623
                                                                      Score     E

ref|XP_008245943.1|  PREDICTED: pathogenesis-related protein PR-4       191   4e-58   
ref|XP_007206107.1|  hypothetical protein PRUPE_ppa012991mg             191   8e-58   
ref|XP_008245121.1|  PREDICTED: pathogenesis-related protein PR-4...    187   3e-56   
ref|XP_010675460.1|  PREDICTED: pathogenesis-related protein PR-4...    186   6e-56   
gb|KEH43011.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   185   8e-56   
emb|CAA41437.1|  pathogenesis-related protein 4A                        184   2e-55   Nicotiana tabacum [American tobacco]
gb|AFP93970.1|  PR4                                                     183   5e-55   
ref|XP_009763689.1|  PREDICTED: pathogenesis-related protein PR-4A      183   7e-55   
gb|AFN21550.1|  pathogenesis-related protein 4                          181   3e-54   
ref|XP_009614804.1|  PREDICTED: pathogenesis-related protein PR-4B      181   3e-54   
pir||S23800  pathogenesis-related protein 4B - common tobacco           181   3e-54
ref|XP_004495803.1|  PREDICTED: pathogenesis-related protein PR-4...    179   2e-53   
ref|XP_004495804.1|  PREDICTED: pathogenesis-related protein PR-4...    178   3e-53   
gb|AFK42642.1|  unknown                                                 179   3e-53   
ref|NP_001234083.1|  pathogenesis-related protein P2 precursor          179   3e-53   
gb|KEH43013.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   179   4e-53   
gb|AAF61435.1|AF137352_1  pre-hevein-like protein                       177   7e-53   Pisum sativum [garden pea]
ref|NP_001275608.1|  pathogenesis-related protein P2-like precursor     177   9e-53   
gb|AAF61434.1|AF137351_1  pathogenesis-related protein 4A               174   2e-51   Pisum sativum [garden pea]
ref|XP_008456018.1|  PREDICTED: pathogenesis-related protein PR-4...    173   6e-51   
ref|XP_004139239.1|  PREDICTED: pathogenesis-related protein P2-like    172   6e-51   
ref|XP_010674854.1|  PREDICTED: pathogenesis-related protein PR-4       171   2e-50   
gb|AFK82275.1|  PR-4 protein                                            171   3e-50   
ref|XP_010917598.1|  PREDICTED: pathogenesis-related protein PR-4...    171   3e-50   
ref|XP_004293631.1|  PREDICTED: pathogenesis-related protein PR-4...    170   9e-50   
gb|AAF63520.1|AF244122_1  pathogenesis-related protein 4                169   1e-49   Capsicum annuum
gb|AHK06886.1|  pathogenesis-related protein 4                          170   1e-49   
ref|XP_004291679.1|  PREDICTED: pathogenesis-related protein PR-4...    169   2e-49   
ref|XP_004139237.1|  PREDICTED: pathogenesis-related protein P2-like    169   2e-49   
gb|AFD50744.1|  PR-4 protein                                            168   3e-49   
gb|ABK21833.1|  unknown                                                 167   1e-48   Picea sitchensis
ref|XP_004139241.1|  PREDICTED: pathogenesis-related protein P2-like    167   2e-48   
ref|XP_008775462.1|  PREDICTED: pathogenesis-related protein PR-4...    167   2e-48   
ref|XP_008370705.1|  PREDICTED: pathogenesis-related protein PR-4       167   2e-48   
gb|AFH74426.1|  pathogenesis-related protein 4                          166   2e-48   
ref|XP_007206115.1|  hypothetical protein PRUPE_ppa013052mg             166   3e-48   
gb|AFD50746.1|  PR-4 protein                                            166   4e-48   
gb|ABK23104.1|  unknown                                                 166   4e-48   Picea sitchensis
gb|KEH43012.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   165   5e-48   
emb|CDP19703.1|  unnamed protein product                                165   6e-48   
ref|XP_006424012.1|  hypothetical protein CICLE_v10029536mg             165   8e-48   
ref|XP_007206349.1|  hypothetical protein PRUPE_ppa017635mg             164   8e-48   
ref|XP_008218271.1|  PREDICTED: pathogenesis-related protein PR-4...    166   8e-48   
ref|XP_007030553.1|  Pathogenesis-related protein P2                    164   1e-47   
gb|AFK45681.1|  unknown                                                 164   2e-47   
sp|P83343.1|PR4_PRUPE  RecName: Full=Pathogenesis-related protein...    162   2e-47   Prunus persica
ref|NP_001237347.1|  uncharacterized protein LOC100500393 precursor     164   2e-47   
ref|XP_002531286.1|  Wound-induced protein WIN1 precursor, putative     163   4e-47   Ricinus communis
gb|KDO54392.1|  hypothetical protein CISIN_1g032389mg                   163   5e-47   
ref|XP_006487788.1|  PREDICTED: pathogenesis-related protein PR-4...    163   5e-47   
emb|CDP19702.1|  unnamed protein product                                162   5e-47   
gb|KHN14699.1|  Pathogenesis-related protein PR-4B                      163   5e-47   
ref|XP_008218273.1|  PREDICTED: pathogenesis-related protein PR-4...    162   7e-47   
gb|AIN56735.1|  pseudo-hevein                                           162   1e-46   
ref|XP_010278162.1|  PREDICTED: pathogenesis-related protein PR-4...    162   1e-46   
ref|XP_002264720.1|  PREDICTED: pathogenesis-related protein PR-4       162   1e-46   Vitis vinifera
gb|ACI31201.1|  pathogenesis-related protein                            162   1e-46   Lycoris radiata [higanbana]
gb|AEW12795.1|  pathogenesis-related protein 4                          161   2e-46   
emb|CAN80017.1|  hypothetical protein VITISV_026189                     161   2e-46   Vitis vinifera
ref|XP_002449459.1|  hypothetical protein SORBIDRAFT_05g014060          161   2e-46   Sorghum bicolor [broomcorn]
gb|EMT07303.1|  Wheatwin-1                                              160   5e-46   
ref|XP_008355821.1|  PREDICTED: pathogenesis-related protein PR-4...    160   6e-46   
ref|XP_004959105.1|  PREDICTED: pathogenesis-related protein PR-4...    160   7e-46   
ref|XP_008778929.1|  PREDICTED: pathogenesis-related protein PR-4...    160   8e-46   
dbj|BAD11073.1|  pathogenesis-related protein 4b                        161   9e-46   Capsicum chinense [Scotch bonnet]
emb|CAB62537.1|  pseudo-hevein                                          161   1e-45   Hevea brasiliensis [Para rubber tree]
ref|XP_010102286.1|  Pathogenesis-related protein P2                    159   1e-45   
ref|XP_010917599.1|  PREDICTED: pathogenesis-related protein PR-4...    159   1e-45   
ref|XP_006347743.1|  PREDICTED: wound-induced protein WIN1-like         160   2e-45   
ref|XP_002531285.1|  Wound-induced protein WIN1 precursor, putative     159   2e-45   Ricinus communis
gb|AAB94514.1|  pathogenesis-related protein-4                          159   2e-45   Dioscorea bulbifera [aerial yam]
emb|CAA87070.1|  pathogenesis-related protein PR-4 type                 158   2e-45   Sambucus nigra
ref|XP_002884464.1|  hypothetical protein ARALYDRAFT_477741             160   3e-45   
gb|AAS78779.1|  pathogenesis-related protein precursor                  158   3e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007023212.1|  Pathogenesis-related protein PR-4B                 160   3e-45   
ref|XP_003577406.1|  PREDICTED: pathogenesis-related protein PR-4...    158   3e-45   
gb|KFK37886.1|  hypothetical protein AALP_AA3G042000                    160   5e-45   
ref|NP_001235941.1|  uncharacterized protein LOC100526916 precursor     157   6e-45   
ref|XP_006408160.1|  hypothetical protein EUTSA_v10021503mg             159   7e-45   
ref|NP_187123.1|  pathogenesis-related 4                                159   8e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAC33732.1|  PR-4 type protein                                       157   9e-45   Vitis vinifera
ref|XP_009134785.1|  PREDICTED: hevein-like preproprotein               159   1e-44   
gb|AIE39008.1|  pathogenesis-related protein 4                          156   1e-44   
gb|KEH43010.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   156   1e-44   
emb|CDY40674.1|  BnaC03g33900D                                          159   1e-44   
ref|XP_006838866.1|  hypothetical protein AMTR_s00002p00266700          156   2e-44   
ref|XP_011032398.1|  PREDICTED: pathogenesis-related protein PR-4...    157   3e-44   
ref|XP_004980477.1|  PREDICTED: pathogenesis-related protein PR-4...    155   4e-44   
ref|XP_006387539.1|  hypothetical protein POPTR_0876s00200g             157   4e-44   
ref|XP_006487793.1|  PREDICTED: pathogenesis-related protein PR-4A      155   5e-44   
ref|XP_010042120.1|  PREDICTED: wound-induced protein WIN1-like         155   5e-44   
gb|ABK63195.1|  hevein-like                                             157   6e-44   Populus tremula x Populus alba [gray poplar]
ref|XP_002531287.1|  Wound-induced protein WIN2 precursor, putative     157   6e-44   Ricinus communis
ref|XP_004230092.1|  PREDICTED: wound-induced protein WIN1              156   8e-44   
ref|XP_006424015.1|  hypothetical protein CICLE_v10029328mg             156   8e-44   
ref|XP_006487791.1|  PREDICTED: hevein-like preproprotein-like          156   8e-44   
ref|XP_002319076.1|  HEV1.2 family protein                              156   9e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006487790.1|  PREDICTED: hevein-like preproprotein-like          156   9e-44   
ref|XP_011038564.1|  PREDICTED: pro-hevein-like                         156   1e-43   
gb|AAB29959.2|  pathogen- and wound-inducible antifungal protein ...    156   1e-43   Nicotiana tabacum [American tobacco]
gb|AAT67050.1|  pathogenesis-related protein 4                          154   1e-43   Triticum monococcum [einkorn wheat]
ref|XP_002264647.1|  PREDICTED: pathogenesis-related protein PR-4       155   1e-43   Vitis vinifera
ref|XP_004494704.1|  PREDICTED: hevein-like preproprotein-like          156   1e-43   
ref|XP_009793591.1|  PREDICTED: wound-induced protein WIN1-like         156   1e-43   
ref|XP_010524916.1|  PREDICTED: hevein-like preproprotein               156   1e-43   
ref|XP_009407234.1|  PREDICTED: pathogenesis-related protein PR-4...    154   2e-43   
pdb|4JP7|A  Chain A, High Resolution Structure Of A Papaya Barwin...    153   2e-43   
ref|XP_008456027.1|  PREDICTED: pathogenesis-related protein PR-4...    153   2e-43   
ref|NP_001275628.1|  wound-induced protein WIN2 precursor               155   3e-43   
ref|XP_010551191.1|  PREDICTED: pathogenesis-related protein PR-4...    153   4e-43   
ref|XP_010027183.1|  PREDICTED: pathogenesis-related protein PR-4...    153   4e-43   
gb|AAB29960.1|  CBP20                                                   155   4e-43   Nicotiana tabacum [American tobacco]
ref|XP_009610436.1|  PREDICTED: wound-induced protein WIN1-like         155   4e-43   
emb|CAC81819.1|  pi1                                                    152   5e-43   Solanum lycopersicum
ref|XP_011038567.1|  PREDICTED: pathogenesis-related protein PR-4...    154   5e-43   
ref|XP_004979597.1|  PREDICTED: wheatwin-2-like                         152   5e-43   
ref|XP_011038565.1|  PREDICTED: pathogenesis-related protein PR-4...    154   6e-43   
ref|XP_011038566.1|  PREDICTED: pathogenesis-related protein PR-4...    154   7e-43   
ref|XP_010418259.1|  PREDICTED: hevein-like preproprotein               153   1e-42   
ref|XP_006298619.1|  hypothetical protein CARUB_v10014707mg             153   1e-42   
gb|ABR13276.1|  putative pathogenesis-related protein class 4           150   1e-42   Prunus dulcis [sweet almond]
ref|XP_006424014.1|  hypothetical protein CICLE_v10029327mg             153   1e-42   
gb|KDP23668.1|  hypothetical protein JCGZ_23501                         151   1e-42   
ref|XP_010042121.1|  PREDICTED: pathogenesis-related protein PR-4...    151   2e-42   
ref|XP_004139240.1|  PREDICTED: wound-induced protein WIN1-like         151   2e-42   
gb|KFK37885.1|  hypothetical protein AALP_AA3G041900                    150   3e-42   
gb|AGV54773.1|  pro-hevein                                              152   3e-42   
ref|XP_007147175.1|  hypothetical protein PHAVU_006G102200g             152   4e-42   
ref|XP_004230091.1|  PREDICTED: wound-induced protein WIN2              152   4e-42   
ref|XP_010043257.1|  PREDICTED: barwin-like                             150   4e-42   
ref|XP_002319077.1|  class 4 pathogenesis-related family protein        152   4e-42   Populus trichocarpa [western balsam poplar]
gb|KGN60798.1|  hypothetical protein Csa_2G010340                       149   5e-42   
gb|AAB49688.1|  wound-induced protein                                   152   6e-42   Solanum lycopersicum
gb|EMT08280.1|  Pathogenesis-related protein PR-4B                      150   6e-42   
ref|XP_002884463.1|  PR4-type protein                                   149   6e-42   
ref|XP_009402990.1|  PREDICTED: pathogenesis-related protein PR-4...    149   7e-42   
ref|XP_010278163.1|  PREDICTED: pathogenesis-related protein PR-4...    149   9e-42   
ref|XP_006663016.1|  PREDICTED: pathogenesis-related protein PR-4...    149   9e-42   
ref|XP_003554709.1|  PREDICTED: wound-induced protein WIN2-like         151   9e-42   
gb|AFP66573.1|  pathogenesis response protein PR                        149   1e-41   
ref|XP_004156469.1|  PREDICTED: wound-induced protein WIN1-like         149   1e-41   
gb|ACU14858.1|  unknown                                                 151   1e-41   Glycine max [soybeans]
gb|AFX67005.1|  wound-induced protein WIN2                              151   1e-41   
ref|XP_006424016.1|  hypothetical protein CICLE_v10029528mg             149   1e-41   
ref|NP_001130495.1|  uncharacterized protein LOC100191593 precursor     149   1e-41   Zea mays [maize]
ref|XP_003554704.1|  PREDICTED: pro-hevein                              151   1e-41   
ref|XP_008678014.1|  PREDICTED: barwin-like                             149   1e-41   
emb|CAA05978.1|  prohevein                                              150   2e-41   Hevea brasiliensis [Para rubber tree]
gb|KEH24556.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   150   2e-41   
sp|P02877.2|HEVE_HEVBR  RecName: Full=Pro-hevein; AltName: Full=M...    150   2e-41   Hevea brasiliensis [Para rubber tree]
gb|AFK37675.1|  unknown                                                 150   2e-41   
gb|AAO63574.1|  HEV2.2                                                  150   2e-41   Hevea brasiliensis [Para rubber tree]
gb|AAO63573.1|  HEV2.1                                                  150   2e-41   Hevea brasiliensis [Para rubber tree]
gb|EAY81551.1|  hypothetical protein OsI_36717                          148   2e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_010524917.1|  PREDICTED: pathogenesis-related protein PR-4...    148   2e-41   
gb|AAO63572.1|  HEV1.2                                                  150   3e-41   Hevea brasiliensis [Para rubber tree]
gb|AAR97870.1|  proteinase inhibitor                                    147   3e-41   Capsicum annuum
gb|AAO63571.1|  HEV1.1                                                  150   3e-41   Hevea brasiliensis [Para rubber tree]
ref|XP_010485856.1|  PREDICTED: pathogenesis-related protein PR-4...    147   4e-41   
gb|ADT91689.1|  hevein-1                                                147   4e-41   
gb|AGT16000.1|  hypothetical protein SHCRBa_135_C14_R_40                147   7e-41   
ref|XP_007147176.1|  hypothetical protein PHAVU_006G102300g             147   8e-41   
emb|CDY40673.1|  BnaC03g33890D                                          147   9e-41   
ref|XP_002449771.1|  hypothetical protein SORBIDRAFT_05g022950          147   1e-40   Sorghum bicolor [broomcorn]
gb|AGT16081.1|  hypothetical protein SHCRBa_087_K22_F_230               147   1e-40   
ref|XP_010042554.1|  PREDICTED: barwin-like                             146   1e-40   
ref|XP_006298770.1|  hypothetical protein CARUB_v10014871mg             146   2e-40   
ref|XP_010278164.1|  PREDICTED: pathogenesis-related protein PR-4...    147   2e-40   
gb|ADO24163.1|  class I pathogenesis-related protein 4                  148   2e-40   
ref|XP_004302058.1|  PREDICTED: pathogenesis-related protein PR-4...    146   2e-40   
gb|KDP23670.1|  hypothetical protein JCGZ_23503                         146   2e-40   
ref|XP_009134783.1|  PREDICTED: pathogenesis-related protein PR-4...    145   2e-40   
ref|XP_006408161.1|  hypothetical protein EUTSA_v10021723mg             145   2e-40   
ref|XP_004979595.1|  PREDICTED: wheatwin-2-like                         146   2e-40   
ref|XP_009402992.1|  PREDICTED: pathogenesis-related protein PR-4...    145   2e-40   
gb|AGT17287.1|  hypothetical protein SHCRBa_160_O06_R_40                145   2e-40   
ref|XP_003536124.1|  PREDICTED: pathogenesis-related protein PR-4...    145   2e-40   
ref|XP_010043258.1|  PREDICTED: barwin-like                             145   3e-40   
ref|XP_010027182.1|  PREDICTED: wound-induced protein WIN1-like         145   3e-40   
ref|XP_002449772.1|  hypothetical protein SORBIDRAFT_05g022960          145   3e-40   Sorghum bicolor [broomcorn]
ref|XP_007030564.1|  Pathogenesis-related protein PR-4B                 147   3e-40   
ref|XP_008678011.1|  PREDICTED: barwin-like                             145   4e-40   
ref|XP_007144830.1|  hypothetical protein PHAVU_007G187700g             145   4e-40   
gb|AFW60484.1|  win1                                                    147   5e-40   
ref|XP_009364594.1|  PREDICTED: pathogenesis-related protein PR-4       145   6e-40   
gb|KDP23669.1|  hypothetical protein JCGZ_23502                         144   7e-40   
ref|XP_004495613.1|  PREDICTED: pathogenesis-related protein PR-4...    144   9e-40   
ref|NP_001068190.1|  Os11g0592200                                       144   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001068188.1|  Os11g0592000                                       144   1e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EAY81553.1|  hypothetical protein OsI_36719                          144   2e-39   Oryza sativa Indica Group [Indian rice]
gb|AAN60254.1|  unknown                                                 144   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463959.1|  PREDICTED: pathogenesis-related protein PR-4...    143   3e-39   
ref|XP_006663017.1|  PREDICTED: wheatwin-2-like                         143   3e-39   
ref|XP_010102289.1|  hypothetical protein L484_024571                   145   3e-39   
gb|EAY81552.1|  hypothetical protein OsI_36718                          143   3e-39   Oryza sativa Indica Group [Indian rice]
gb|KFK37884.1|  hypothetical protein AALP_AA3G041800                    142   3e-39   
ref|NP_001068189.1|  Os11g0592100                                       143   3e-39   Oryza sativa Japonica Group [Japonica rice]
gb|AAR08364.1|  pathogenesis-related protein 4b                         143   3e-39   Oryza sativa Indica Group [Indian rice]
gb|AFK48556.1|  unknown                                                 144   4e-39   
ref|XP_009134784.1|  PREDICTED: pathogenesis-related protein PR-4...    142   4e-39   
gb|KCW61593.1|  hypothetical protein EUGRSUZ_H04328                     142   4e-39   
ref|XP_010027185.1|  PREDICTED: pathogenesis-related protein PR-4...    142   5e-39   
ref|XP_002884462.1|  PR4-type protein                                   142   5e-39   
gb|AFS89621.1|  pathogenesis-related protein                            142   6e-39   
ref|XP_006663018.1|  PREDICTED: wheatwin-1-like                         142   7e-39   
gb|AAF18934.1|AF112867_1  wound-induced protein CBP1 precursor          144   8e-39   Capsicum annuum
ref|XP_002449770.1|  hypothetical protein SORBIDRAFT_05g022940          141   1e-38   Sorghum bicolor [broomcorn]
gb|AGT16080.1|  hypothetical protein SHCRBa_087_K22_F_200               141   2e-38   
gb|AGT17288.1|  hypothetical protein SHCRBa_160_O06_R_60                140   2e-38   
ref|XP_004979596.1|  PREDICTED: wheatwin-2-like                         140   3e-38   
ref|XP_003535368.1|  PREDICTED: wound-induced protein WIN1-like         140   3e-38   
ref|XP_006424013.1|  hypothetical protein CICLE_v10030085mg             140   3e-38   
ref|XP_010102288.1|  hypothetical protein L484_024570                   142   4e-38   
gb|ACG39688.1|  win1 precursor                                          140   4e-38   Zea mays [maize]
emb|CDY40672.1|  BnaC03g33880D                                          140   4e-38   
gb|KHN18059.1|  Wound-induced protein WIN1                              139   5e-38   
gb|AGT16001.1|  hypothetical protein SHCRBa_135_C14_R_50                139   6e-38   
sp|P28814.1|BARW_HORVU  RecName: Full=Barwin                            139   7e-38   Hordeum vulgare [barley]
gb|EAY81555.1|  hypothetical protein OsI_36720                          139   9e-38   Oryza sativa Indica Group [Indian rice]
prf||2209398A  pathogenesis-related protein                             138   2e-37
ref|XP_006663565.1|  PREDICTED: wheatwin-1-like                         139   2e-37   
pdb|1BW3|A  Chain A, Three-Dimensional Structure In Solution Of B...    137   2e-37   
dbj|BAH82669.1|  PR-4                                                   137   3e-37   Brassica rapa subsp. chinensis [bok-choy]
gb|AFW74503.1|  hypothetical protein ZEAMMB73_639296                    138   3e-37   
ref|XP_008680122.1|  PREDICTED: barwin-like                             137   3e-37   
dbj|BAK04328.1|  predicted protein                                      137   4e-37   
ref|NP_001105464.1|  defence-related protein precursor                  137   5e-37   Zea mays [maize]
emb|CAA71774.1|  pathogenesis-related protein 4                         137   6e-37   Hordeum vulgare [barley]
dbj|BAC16357.1|  hevein-like protein                                    139   7e-37   Eutrema japonicum [wasabe]
gb|EMS54720.1|  Pathogenesis-related protein PR-4A                      135   7e-37   
emb|CAJ40963.1|  putative vacuolar defense protein                      137   8e-37   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001068187.1|  Os11g0591800                                       137   1e-36   Oryza sativa Japonica Group [Japonica rice]
gb|AAB29183.1|  wheatwin1=barwin homolog                                135   2e-36   
emb|CDM86973.1|  unnamed protein product                                136   2e-36   
ref|XP_003577405.1|  PREDICTED: barwin-like                             135   2e-36   
sp|O64393.1|WHW2_WHEAT  RecName: Full=Wheatwin-2; AltName: Full=P...    135   3e-36   Triticum aestivum [Canadian hard winter wheat]
gb|EMT05331.1|  Wheatwin-2                                              135   3e-36   
ref|XP_009414708.1|  PREDICTED: pathogenesis-related protein PR-4...    134   4e-36   
dbj|BAK03737.1|  predicted protein                                      135   4e-36   
ref|XP_006487789.1|  PREDICTED: wound-induced protein WIN1-like         134   4e-36   
sp|O64392.1|WHW1_WHEAT  RecName: Full=Wheatwin-1; AltName: Full=P...    134   6e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008456038.1|  PREDICTED: pathogenesis-related protein PR-4...    132   1e-35   
gb|KCW85275.1|  hypothetical protein EUGRSUZ_B02122                     132   2e-35   
gb|AAU94913.1|  PR protein 4A                                           131   2e-35   Arachis hypogaea [goober]
gb|AFW60479.1|  hypothetical protein ZEAMMB73_033959                    132   8e-35   
gb|AAS78780.1|  putative vacuolar defense protein                       130   4e-34   Triticum aestivum [Canadian hard winter wheat]
gb|AAF00050.1|AF092123_1  pathogenesis-related protein 4                129   5e-34   Triticum aestivum [Canadian hard winter wheat]
gb|AAF02296.1|AF093007_1  PR-4                                          128   6e-34   Triticum aestivum [Canadian hard winter wheat]
gb|AAF02295.1|  PR-4                                                    127   1e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010550915.1|  PREDICTED: pathogenesis-related protein PR-4...    127   1e-32   
gb|ABQ53994.1|  PR-4a protein                                           123   2e-32   Cicer arietinum [garbanzo]
ref|XP_010025013.1|  PREDICTED: pathogenesis-related protein PR-4...    122   4e-31   
gb|KEH27021.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   127   6e-31   
gb|EEC68475.1|  hypothetical protein OsI_36721                          121   7e-31   Oryza sativa Indica Group [Indian rice]
gb|AEO11774.1|  pathogenesis-related protein 4                          119   2e-30   
ref|NP_001176627.1|  Os11g0591700                                       118   2e-29   
gb|KEH27015.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   117   9e-29   
emb|CAJ40961.1|  wheatwin6-b defense protein                            117   2e-28   Triticum aestivum [Canadian hard winter wheat]
sp|Q02243.1|WIN_SOYBN  RecName: Full=Wound-induced protein              111   2e-27   Glycine max [soybeans]
ref|XP_007010321.1|  Pathogenesis-related protein P2                    114   6e-27   
gb|AFD50742.1|  PR-4 protein                                            110   8e-27   
gb|AFD50743.1|  PR-4 protein                                            110   1e-26   
ref|XP_002449714.1|  hypothetical protein SORBIDRAFT_05g021990          109   2e-26   Sorghum bicolor [broomcorn]
ref|XP_006387093.1|  hypothetical protein POPTR_1884s00200g             108   4e-26   
ref|XP_007030556.1|  Pathogenesis-related protein P2 isoform 2          112   4e-26   
ref|XP_010102291.1|  Wound-induced protein WIN2                         110   4e-26   
emb|CAN70110.1|  hypothetical protein VITISV_041168                     107   6e-26   Vitis vinifera
gb|KEH27022.1|  Chitinase / Hevein / PR-4 / Wheatwin2                   111   1e-25   
ref|XP_007030555.1|  Pathogenesis-related protein P2 isoform 1          110   1e-25   
gb|AFD50741.1|  PR-4 protein                                            107   2e-25   
ref|XP_007030557.1|  Pathogenesis-related protein P2                    110   2e-25   
ref|XP_004980668.1|  PREDICTED: wheatwin-2-like                         107   4e-25   
ref|XP_006382800.1|  hypothetical protein POPTR_0005s05580g             106   5e-25   
ref|XP_003553760.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    103   1e-24   
gb|KDP45697.1|  hypothetical protein JCGZ_17304                         103   2e-24   
gb|ACU82402.1|  pathogenesis-related protein 4                          100   8e-24   Vaccinium myrtillus [bilberry]
gb|AFD50740.1|  PR-4 protein                                          98.6    4e-22   
gb|AFD50739.1|  PR-4 protein                                          98.2    5e-22   
ref|XP_006387540.1|  hypothetical protein POPTR_0876s00210g           96.3    5e-22   
dbj|BAE16420.1|  PR-4 homolog                                         94.0    2e-21   
gb|KEH27024.1|  Nodule Cysteine-Rich (NCR) secreted peptide           96.7    3e-21   
ref|XP_006382799.1|  hypothetical protein POPTR_0005s05570g           95.1    3e-21   
gb|AFD50738.1|  PR-4 protein                                          95.1    8e-21   
ref|XP_002962981.1|  hypothetical protein SELMODRAFT_78171            91.3    1e-19   
ref|XP_002993952.1|  hypothetical protein SELMODRAFT_137944           91.3    2e-19   
ref|XP_003620430.1|  Pathogenesis-related protein 4b                  80.9    9e-16   
sp|P81729.1|CHAL_BRARR  RecName: Full=Chitin-binding allergen Bra...  78.2    4e-15   
gb|AAU86912.1|  hevein-like protein                                   73.6    6e-14   
gb|KHN43184.1|  Pathogenesis-related protein PR-4A                    73.6    2e-13   
gb|AET86624.1|  pathogenesis-related protein 4                        72.8    2e-13   
ref|XP_005842865.1|  hypothetical protein CHLNCDRAFT_33383            73.2    4e-13   
emb|CBI35211.3|  unnamed protein product                              72.0    2e-12   
gb|KHN43185.1|  Wound-induced protein WIN2                            66.6    1e-10   
gb|EMT20105.1|  Pathogenesis-related protein PR-4B                    66.6    1e-10   
emb|CDP06821.1|  unnamed protein product                              64.7    3e-10   
gb|EMS52461.1|  Wheatwin-2                                            59.3    2e-08   
gb|KHN43186.1|  Wound-induced protein                                 58.9    2e-08   
gb|EMS66421.1|  Wheatwin-2                                            58.2    4e-08   
gb|EEE52391.1|  hypothetical protein OsJ_34489                        55.1    4e-07   
gb|ABA94528.1|  hypothetical protein LOC_Os11g37930                   55.5    6e-07   
ref|XP_006300057.1|  hypothetical protein CARUB_v10016285mg           52.8    3e-06   
gb|AAQ92330.1|  PR-4                                                  52.0    5e-06   
gb|AGE57662.1|  chitin binding domain-containing protein              54.3    1e-05   
ref|XP_005849323.1|  hypothetical protein CHLNCDRAFT_21703            50.8    2e-05   
emb|CAJ40962.1|  wheatwin6-c defense protein                          51.2    2e-05   
gb|AGE53539.1|  chitin binding domain-containing protein              53.9    2e-05   
ref|XP_005846879.1|  hypothetical protein CHLNCDRAFT_134715           53.5    2e-05   
gb|AGE56636.1|  chitin binding domain-containing protein              53.1    4e-05   
gb|AGE56970.1|  chitin binding domain-containing protein              53.1    4e-05   
gb|AGE59422.1|  chitin binding domain-containing protein              53.1    4e-05   
gb|AGE49160.1|  chitin binding domain-containing protein              53.1    4e-05   
gb|AGE59761.1|  chitin binding domain-containing protein              52.8    5e-05   
gb|AGE50177.1|  chitin binding domain-containing protein              52.8    6e-05   
gb|AGE56983.1|  chitin binding domain-containing protein              50.8    8e-05   
gb|AGE49491.1|  chitin binding domain-containing protein              51.2    1e-04   
ref|YP_001426855.1|  hypothetical protein ATCV1_Z374R                 50.8    2e-04   
gb|AGE55977.1|  chitin binding domain-containing protein              49.3    7e-04   
gb|AGE60099.1|  chitin binding domain-containing protein              49.3    7e-04   
gb|AGE55657.1|  chitin binding domain-containing protein              48.9    8e-04   



>ref|XP_008245943.1| PREDICTED: pathogenesis-related protein PR-4 [Prunus mume]
Length=146

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATYN YNPQNINWD RTASV+CATWDADKPLSWR KYGWTAFCGPVGPTGQ S
Sbjct  25   QSASNVRATYNLYNPQNINWDLRTASVYCATWDADKPLSWRSKYGWTAFCGPVGPTGQDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTNTAT A+VTVRIVDQCSNGGLDLDVNVFNQ+DTNGQG AQGHLT
Sbjct  85   CGKCLLVTNTATGAKVTVRIVDQCSNGGLDLDVNVFNQIDTNGQGNAQGHLT  136



>ref|XP_007206107.1| hypothetical protein PRUPE_ppa012991mg [Prunus persica]
 gb|EMJ07306.1| hypothetical protein PRUPE_ppa012991mg [Prunus persica]
Length=146

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATYN YNPQNINWD RTASVFCATWDADKPLSWR KYGWTAFCGPVGPTGQ S
Sbjct  25   QSASNVRATYNLYNPQNINWDLRTASVFCATWDADKPLSWRSKYGWTAFCGPVGPTGQDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTNT T A+VTVRIVDQCSNGGLDLDVNVFNQ+DTNGQG AQGHL
Sbjct  85   CGKCLLVTNTGTGAKVTVRIVDQCSNGGLDLDVNVFNQIDTNGQGNAQGHL  135



>ref|XP_008245121.1| PREDICTED: pathogenesis-related protein PR-4-like [Prunus mume]
Length=167

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATYN YNPQNINWD RTASV+CATWDADKPLSWR KYGWTAFCGPVGPTGQ S
Sbjct  25   QSASNVRATYNLYNPQNINWDLRTASVYCATWDADKPLSWRSKYGWTAFCGPVGPTGQDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTNT T A VTVRIVDQCSNGGLDLDVNVFNQ+DT+G+G AQGHLT
Sbjct  85   CGKCLLVTNTGTGANVTVRIVDQCSNGGLDLDVNVFNQIDTDGKGNAQGHLT  136



>ref|XP_010675460.1| PREDICTED: pathogenesis-related protein PR-4-like [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRAT+NNYNPQNI ++Y TASV+CATWD DKPLS+R +YGWTAFCGP GPTGQAS
Sbjct  23   QSANNVRATFNNYNPQNIGYNYYTASVYCATWDGDKPLSFRNQYGWTAFCGPAGPTGQAS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTN AT AQVTVRIVDQCSNGGLDLDVNVFNQ+DTNGQGVAQGHL
Sbjct  83   CGRCLRVTNMATGAQVTVRIVDQCSNGGLDLDVNVFNQIDTNGQGVAQGHL  133



>gb|KEH43011.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=146

 Score =   185 bits (470),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATYNNYNPQNINWDY TASV+CATWDA++PLSWR KYGWTAFCGP GPTG+ S
Sbjct  25   QSANNVRATYNNYNPQNINWDYNTASVYCATWDANQPLSWRSKYGWTAFCGPAGPTGRDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTNTAT AQVTVRIVDQCSNGGLDLDVNVFNQ+DTNGQGV  GHLT
Sbjct  85   CGKCLTVTNTATGAQVTVRIVDQCSNGGLDLDVNVFNQIDTNGQGVQNGHLT  136



>emb|CAA41437.1| pathogenesis-related protein 4A [Nicotiana tabacum]
Length=147

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR+TY+ YNPQNINWD R AS FCATWDADKPL+WRQKYGWTAFCGP GP GQ S
Sbjct  26   QSATNVRSTYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQVS  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTNT T  Q TVRIVDQCSNGGLDLDVNVFNQLDTNG G  QGHLT
Sbjct  86   CGRCLRVTNTGTGTQTTVRIVDQCSNGGLDLDVNVFNQLDTNGVGYQQGHLT  137



>gb|AFP93970.1| PR4 [Lens culinaris]
 gb|AFV09177.1| pathogenesis-related protein 4 [Lens culinaris]
Length=146

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATYNNYNPQNINWDY TASV+CATWDA++PLSWR +YGWTAFCGP GPTG+ S
Sbjct  27   QSANNVRATYNNYNPQNINWDYNTASVYCATWDANQPLSWRSQYGWTAFCGPAGPTGRDS  86

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTNTAT  Q+TVRIVDQCSNGGLDLDVNVFNQLDTNG GV  GHLT
Sbjct  87   CGKCLSVTNTATGTQITVRIVDQCSNGGLDLDVNVFNQLDTNGAGVQAGHLT  138



>ref|XP_009763689.1| PREDICTED: pathogenesis-related protein PR-4A [Nicotiana sylvestris]
 sp|P29062.1|PR4A_TOBAC RecName: Full=Pathogenesis-related protein PR-4A; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA42820.1| PR-4a protein [Nicotiana tabacum]
 prf||1804330A pathogenesis-related protein 4
Length=147

 Score =   183 bits (464),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR+TY+ YNPQNINWD R AS FCATWDADKPL+WRQKYGWTAFCGP GP GQ S
Sbjct  26   QSATNVRSTYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDS  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTNT T  Q TVRIVDQCSNGGLDLDVNVFNQLDTNG G  QGHLT
Sbjct  86   CGRCLRVTNTGTGTQTTVRIVDQCSNGGLDLDVNVFNQLDTNGVGYQQGHLT  137



>gb|AFN21550.1| pathogenesis-related protein 4 [Capsicum annuum]
Length=143

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR+TY+ YNPQNINWD RTAS +CATWDADKPL WRQ+YGWTAFCGP GPTGQA+
Sbjct  24   QSATNVRSTYHLYNPQNINWDLRTASAYCATWDADKPLEWRQRYGWTAFCGPAGPTGQAA  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q TVRIVDQCSNGGLDLDVNVFNQLDT+ +G  QGHL
Sbjct  84   CGRCLRVTNTGTGTQATVRIVDQCSNGGLDLDVNVFNQLDTDRRGYQQGHL  134



>ref|XP_009614804.1| PREDICTED: pathogenesis-related protein PR-4B [Nicotiana tomentosiformis]
 sp|P29063.1|PR4B_TOBAC RecName: Full=Pathogenesis-related protein PR-4B; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA42821.1| PR-4b protein [Nicotiana tabacum]
Length=147

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR+TY+ YNPQNINWD R AS FCATWDADKPL+WRQKYGWTAFCGP GP GQ S
Sbjct  26   QSATNVRSTYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDS  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q TVRIVDQCSNGGLDLDVNVFNQLDTNG G  QGHL
Sbjct  86   CGRCLRVTNTGTGTQATVRIVDQCSNGGLDLDVNVFNQLDTNGLGYQQGHL  136



>pir||S23800 pathogenesis-related protein 4B - common tobacco
 emb|CAA41438.1| pathogenesis-related protein 4B [Nicotiana tabacum]
Length=139

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR+TY+ YNPQNINWD R AS FCATWDADKPL+WRQKYGWTAFCGP GP GQ S
Sbjct  18   QSATNVRSTYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDS  77

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q TVRIVDQCSNGGLDLDVNVFNQLDTNG G  QGHL
Sbjct  78   CGRCLRVTNTGTGTQATVRIVDQCSNGGLDLDVNVFNQLDTNGLGYQQGHL  128



>ref|XP_004495803.1| PREDICTED: pathogenesis-related protein PR-4A-like isoform X1 
[Cicer arietinum]
Length=146

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATYN YNPQNI WDY  ASV+CATWD ++PLSWRQKYGWTAFCGPVGP G+ S
Sbjct  25   QSANNVRATYNLYNPQNIGWDYYKASVYCATWDGNQPLSWRQKYGWTAFCGPVGPQGRDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CLRVTNTAT +QVTVRIVDQCSNGGLDLDVNVFNQLDTNGQG  QGHLT
Sbjct  85   CGKCLRVTNTATGSQVTVRIVDQCSNGGLDLDVNVFNQLDTNGQGNQQGHLT  136



>ref|XP_004495804.1| PREDICTED: pathogenesis-related protein PR-4A-like isoform X2 
[Cicer arietinum]
Length=130

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATYN YNPQNI WDY  ASV+CATWD ++PLSWRQKYGWTAFCGPVGP G+ S
Sbjct  9    QSANNVRATYNLYNPQNIGWDYYKASVYCATWDGNQPLSWRQKYGWTAFCGPVGPQGRDS  68

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CLRVTNTAT +QVTVRIVDQCSNGGLDLDVNVFNQLDTNGQG  QGHLT
Sbjct  69   CGKCLRVTNTATGSQVTVRIVDQCSNGGLDLDVNVFNQLDTNGQGNQQGHLT  120



>gb|AFK42642.1| unknown [Medicago truncatula]
Length=144

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATY+ YNPQNINW+Y TASV+CATWDA++PLSWRQKYGWTAFCGP GP G+ S
Sbjct  25   QSANNVRATYHLYNPQNINWNYNTASVYCATWDANQPLSWRQKYGWTAFCGPQGPHGRDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CLRVT+TAT AQ TVRIVDQC+NGGLDLDVNVFNQ+DTNGQG  QGHLT
Sbjct  85   CGKCLRVTSTATGAQATVRIVDQCANGGLDLDVNVFNQIDTNGQGYQQGHLT  136



>ref|NP_001234083.1| pathogenesis-related protein P2 precursor [Solanum lycopersicum]
 sp|P32045.1|PRP2_SOLLC RecName: Full=Pathogenesis-related protein P2; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA41439.1| pathogenesis-related protein P2 [Solanum lycopersicum]
Length=143

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQNINWD RTASV+CATWDADKPL WR++YGWTAFCGP GPTGQAS
Sbjct  24   QSATNVRATYHLYNPQNINWDLRTASVYCATWDADKPLEWRRRYGWTAFCGPAGPTGQAS  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q TVRIVDQC NGGLDLDVNVFN+LDTNG G  +G+L
Sbjct  84   CGRCLRVTNTGTGTQETVRIVDQCRNGGLDLDVNVFNRLDTNGLGYQRGNL  134



>gb|KEH43013.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=144

 Score =   179 bits (453),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATY+ YNPQNINW+Y TASV+CATWDA++PLSWRQKYGWTAFCGP GP G+ S
Sbjct  25   QSANNVRATYHLYNPQNINWNYNTASVYCATWDANQPLSWRQKYGWTAFCGPQGPHGRDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CLRVTNTAT AQ TVRIVDQC+NGGLDLDVNVFNQ+DTNGQG  QGHLT
Sbjct  85   CGKCLRVTNTATGAQATVRIVDQCANGGLDLDVNVFNQIDTNGQGYQQGHLT  136



>gb|AAF61435.1|AF137352_1 pre-hevein-like protein [Pisum sativum]
Length=129

 Score =   177 bits (449),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATYNNYNPQNINWDY  ASV+CATWDA++PLSWR KYGWTAFCGPVGPTG+ S
Sbjct  10   QSANNVRATYNNYNPQNINWDYNRASVYCATWDANQPLSWRSKYGWTAFCGPVGPTGRES  69

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTN AT AQ TVRIVDQC NGGLDLDVNVFNQ+DTN QG  Q HL
Sbjct  70   CGKCLRVTNIATGAQTTVRIVDQCHNGGLDLDVNVFNQIDTNKQGYQQCHL  120



>ref|NP_001275608.1| pathogenesis-related protein P2-like precursor [Solanum tuberosum]
 gb|AFW90570.1| pathogenesis-related protein P2 [Solanum tuberosum]
Length=143

 Score =   177 bits (450),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQNINWD RTAS +CATWDADKPL+WRQ+YGWTAFCGP GP GQAS
Sbjct  24   QSATNVRATYHLYNPQNINWDLRTASAYCATWDADKPLAWRQRYGWTAFCGPAGPRGQAS  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q TVRIVDQCSNGGLDLDVNVFN+LDTNG G  +G+L
Sbjct  84   CGRCLRVTNTGTGTQETVRIVDQCSNGGLDLDVNVFNRLDTNGLGYQRGNL  134



>gb|AAF61434.1|AF137351_1 pathogenesis-related protein 4A [Pisum sativum]
Length=145

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATYNNYNPQNINWDY  ASV+CATWDA++PLSWR  YGWTAFCGP GPTG+ S
Sbjct  27   QSANNVRATYNNYNPQNINWDYNRASVYCATWDANQPLSWRH-YGWTAFCGPAGPTGRDS  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CLRVTNTAT AQVTVRIVDQCSNGGLDLDVNVFNQ+DTNG G   GHLT
Sbjct  86   CGKCLRVTNTATGAQVTVRIVDQCSNGGLDLDVNVFNQIDTNGGGYQAGHLT  137



>ref|XP_008456018.1| PREDICTED: pathogenesis-related protein PR-4-like [Cucumis melo]
Length=142

 Score =   173 bits (438),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQ+INWDY  ASVFCATWDA+KPL WR++YGWTAFCGPVGP G+ S
Sbjct  23   QSATNVRATYHLYNPQDINWDYLRASVFCATWDANKPLEWRRRYGWTAFCGPVGPRGRDS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTNT T A   VRIVDQC+NGGLDLDVNVF ++DTNG G  +GHLT
Sbjct  83   CGRCLRVTNTETGASEIVRIVDQCANGGLDLDVNVFRRIDTNGNGNFRGHLT  134



>ref|XP_004139239.1| PREDICTED: pathogenesis-related protein P2-like [Cucumis sativus]
 ref|XP_004156468.1| PREDICTED: pathogenesis-related protein P2-like [Cucumis sativus]
 gb|KGN60804.1| hypothetical protein Csa_2G010390 [Cucumis sativus]
Length=142

 Score =   172 bits (437),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQ+INWDY  ASVFCATWDADKPL WR++YGWTAFCGPVGP G+ S
Sbjct  23   QSATNVRATYHLYNPQDINWDYLRASVFCATWDADKPLEWRRQYGWTAFCGPVGPRGRDS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T A   VRIVDQC+NGGLDLDVNVF ++DTNG G  +GHL
Sbjct  83   CGRCLRVTNTETGASEIVRIVDQCANGGLDLDVNVFRRIDTNGNGNLRGHL  133



>ref|XP_010674854.1| PREDICTED: pathogenesis-related protein PR-4 [Beta vulgaris subsp. 
vulgaris]
Length=142

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATY+ YNPQNI W+Y TASV+C+T+D +KPL++R+KYGWTAFCGPVGP GQ S
Sbjct  23   QSANNVRATYHIYNPQNIGWNYFTASVYCSTYDGNKPLAFRKKYGWTAFCGPVGPRGQES  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTN AT AQ+ VRIVDQCSNGGLDLDVNVF+Q+DTNGQG AQGHL
Sbjct  83   CGKCLRVTNIATGAQIIVRIVDQCSNGGLDLDVNVFDQIDTNGQGHAQGHL  133



>gb|AFK82275.1| PR-4 protein [Chimonanthus praecox]
Length=142

 Score =   171 bits (433),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNPQ I WDY TASVFCATWDA+KPL+WR KYGWTAFCG VGP GQAS
Sbjct  21   QSASNVRATYHIYNPQQIGWDYNTASVFCATWDANKPLAWRSKYGWTAFCGLVGPRGQAS  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T +Q TVRIVDQCSNGGLDL+  VF QLDTNG G+ QGHL
Sbjct  81   CGKCLRVTNTGTGSQATVRIVDQCSNGGLDLEEGVFRQLDTNGAGIQQGHL  131



>ref|XP_010917598.1| PREDICTED: pathogenesis-related protein PR-4-like [Elaeis guineensis]
Length=143

 Score =   171 bits (433),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATYN+YN   INWD  TASV+CATWDA+ PLSWRQKYGWTAFCGPVGPTG+A+CG+C
Sbjct  26   NVRATYNDYNAAQINWDLNTASVYCATWDANMPLSWRQKYGWTAFCGPVGPTGEAACGKC  85

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            L VTNTAT AQVTVRIVDQCSNGGLDLD +VF+QLDTNGQG+AQGHL
Sbjct  86   LLVTNTATGAQVTVRIVDQCSNGGLDLDHSVFSQLDTNGQGIAQGHL  132



>ref|XP_004293631.1| PREDICTED: pathogenesis-related protein PR-4B-like [Fragaria 
vesca subsp. vesca]
Length=145

 Score =   170 bits (430),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQ+ NWD R  S FC+TWDADKPL WR KYGWTAFCGP GPTGQ +
Sbjct  24   QSATNVRATYHLYNPQDNNWDLRAVSAFCSTWDADKPLEWRSKYGWTAFCGPAGPTGQDA  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTNTAT  Q TVRIVDQCSNGGLDLDVNVFNQ+DT+G G   GHLT
Sbjct  84   CGKCLLVTNTATGTQATVRIVDQCSNGGLDLDVNVFNQIDTDGSGYQAGHLT  135



>gb|AAF63520.1|AF244122_1 pathogenesis-related protein 4 [Capsicum annuum]
Length=131

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR    +YNPQNINWD RTAS  CATWDADKPL WRQ+YGWTAFCGP GPTGQA+
Sbjct  10   QSATNVRYNIPSYNPQNINWDLRTASANCATWDADKPLEWRQRYGWTAFCGPAGPTGQAA  69

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q TVRIVDQCSNGGLDLDV VFNQLDT+ +G  QGHL
Sbjct  70   CGRCLRVTNTGTGTQATVRIVDQCSNGGLDLDVYVFNQLDTDRRGYQQGHL  120



>gb|AHK06886.1| pathogenesis-related protein 4 [Panax ginseng]
Length=170

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATYN Y P+NI WDY  A VFCATWDA KPL+WR+KYGWTAFCGPVGP GQAS
Sbjct  49   QSASNVRATYNIYQPENIGWDYNAARVFCATWDAGKPLAWRRKYGWTAFCGPVGPRGQAS  108

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCL+VTNTATN  VTVRIVDQCSNGGLDLDV VF QLD +G+G AQG LT
Sbjct  109  CGRCLKVTNTATNTFVTVRIVDQCSNGGLDLDVGVFRQLDRDGRGNAQGFLT  160



>ref|XP_004291679.1| PREDICTED: pathogenesis-related protein PR-4B-like [Fragaria 
vesca subsp. vesca]
Length=145

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQ+ NWD R  S +C+TWDADKPL WR KYGWTAFCGP GPTGQ +
Sbjct  24   QSATNVRATYHLYNPQDNNWDLRAVSAYCSTWDADKPLEWRSKYGWTAFCGPAGPTGQDT  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCL VTNTAT AQ TVRIVDQCSNGGLDLDVNVFNQ+DT+G G   GHLT
Sbjct  84   CGRCLLVTNTATGAQATVRIVDQCSNGGLDLDVNVFNQIDTDGSGYQAGHLT  135



>ref|XP_004139237.1| PREDICTED: pathogenesis-related protein P2-like [Cucumis sativus]
 ref|XP_004156467.1| PREDICTED: pathogenesis-related protein P2-like [Cucumis sativus]
 gb|KGN60803.1| hypothetical protein Csa_2G010380 [Cucumis sativus]
Length=142

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQNINWDY  ASV+CATWDA+KPL WR++Y WTAFCGPVGP GQAS
Sbjct  23   QSATNVRATYHLYNPQNINWDYMKASVYCATWDANKPLEWRRRYDWTAFCGPVGPRGQAS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCL+VTN  T A  TVRIVDQCSNGGLDLD+  F  +DTNG G   GHL
Sbjct  83   CGRCLKVTNVETKASTTVRIVDQCSNGGLDLDIKPFKAIDTNGNGYKNGHL  133



>gb|AFD50744.1| PR-4 protein [Pseudotsuga menziesii]
 gb|AFD50745.1| PR-4 protein [Pseudotsuga menziesii]
Length=142

 Score =   168 bits (426),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+NVRATYNNYNPQNI WD   AS +CATWDA KPL WR+KYGWTAFCGPVG  GQAS
Sbjct  23   QQASNVRATYNNYNPQNIGWDLGKASAYCATWDASKPLEWRKKYGWTAFCGPVGAHGQAS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL+VTN  T A V  RIVDQCSNGGLDLD NVFNQ+DT+G+G   GHL
Sbjct  83   CGKCLKVTNRGTGASVIARIVDQCSNGGLDLDTNVFNQIDTDGKGRNAGHL  133



>gb|ABK21833.1| unknown [Picea sitchensis]
 gb|ACN40964.1| unknown [Picea sitchensis]
Length=143

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+NVRATYN YNPQNI WD   AS +CATWDA KPL WR+KYGWTAFCGPVGP GQAS
Sbjct  24   QQASNVRATYNYYNPQNIGWDLGKASAYCATWDASKPLEWRKKYGWTAFCGPVGPHGQAS  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL+VTN  T A V  RIVDQCSNGGLDLD +VFN++DTNG+G   GHL
Sbjct  84   CGKCLKVTNRGTGASVIARIVDQCSNGGLDLDASVFNKIDTNGKGRNDGHL  134



>ref|XP_004139241.1| PREDICTED: pathogenesis-related protein P2-like [Cucumis sativus]
 ref|XP_004156470.1| PREDICTED: pathogenesis-related protein P2-like [Cucumis sativus]
 gb|KGN60802.1| hypothetical protein Csa_2G010370 [Cucumis sativus]
Length=144

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NV ATYN YNPQ I W+Y TASVFC+TWDA+KPL+WR+ YGWTAFCGPVGP+G+ S
Sbjct  25   QSASNVLATYNFYNPQTIGWNYMTASVFCSTWDANKPLNWRKHYGWTAFCGPVGPSGRNS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRV NT T  + TVRIVDQCSNGGLDLD  VF +LDTNG G A+GHL
Sbjct  85   CGRCLRVRNTETGDEETVRIVDQCSNGGLDLDFGVFQKLDTNGNGFARGHL  135



>ref|XP_008775462.1| PREDICTED: pathogenesis-related protein PR-4-like [Phoenix dactylifera]
Length=143

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATYN+YNP   NWD    SV+CATWDA+ PL+WRQKYGWTAFCGPVGPTGQASCG+C
Sbjct  26   NVRATYNDYNPAQHNWDLIATSVYCATWDANMPLAWRQKYGWTAFCGPVGPTGQASCGKC  85

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            L VTNTAT AQ TVRIVDQCSNGGLDLD  VF+QLDTNGQG+AQGHL
Sbjct  86   LLVTNTATGAQATVRIVDQCSNGGLDLDHAVFSQLDTNGQGIAQGHL  132



>ref|XP_008370705.1| PREDICTED: pathogenesis-related protein PR-4 [Malus domestica]
Length=148

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQ  N+D R  S +CATWDADK L WR KYGWTAFCGP GPTGQA+
Sbjct  27   QSATNVRATYHLYNPQQNNYDLRAVSAYCATWDADKSLEWRSKYGWTAFCGPAGPTGQAA  86

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCL VTNT T AQ TVRIVDQCSNGGLDLDVNVFNQ+DT+G G  QGHL
Sbjct  87   CGRCLLVTNTRTGAQATVRIVDQCSNGGLDLDVNVFNQIDTDGXGYQQGHL  137



>gb|AFH74426.1| pathogenesis-related protein 4 [Malus domestica]
Length=148

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQ  N+D R  S +CATWDADK L WR KYGWTAFCGP GPTGQA+
Sbjct  27   QSATNVRATYHLYNPQQNNYDLRAVSAYCATWDADKSLEWRSKYGWTAFCGPAGPTGQAA  86

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCL VTNT T AQ TVRIVDQCSNGGLDLDVNVFNQ+DT+G G  QGHL
Sbjct  87   CGRCLLVTNTRTGAQATVRIVDQCSNGGLDLDVNVFNQIDTDGIGYQQGHL  137



>ref|XP_007206115.1| hypothetical protein PRUPE_ppa013052mg [Prunus persica]
 gb|EMJ07314.1| hypothetical protein PRUPE_ppa013052mg [Prunus persica]
Length=142

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP+ INWD + AS +C+TWDA+KPL WR+K+GWTAFCGPVGP GQAS
Sbjct  21   QSASNVRATYHIYNPEKINWDLKAASAYCSTWDANKPLEWRRKFGWTAFCGPVGPRGQAS  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTN  T  Q  VRIVDQCSNGGLDLD  VF +LDT+GQG AQGHL
Sbjct  81   CGKCLTVTNVRTGTQAKVRIVDQCSNGGLDLDQGVFKRLDTDGQGYAQGHL  131



>gb|AFD50746.1| PR-4 protein [Pseudotsuga menziesii]
Length=142

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+NVRATYNNYNPQNI WD   AS +CATWDA KPL WR+KYGWTAFCGPVG  GQAS
Sbjct  23   QQASNVRATYNNYNPQNIGWDLGKASAYCATWDASKPLEWRKKYGWTAFCGPVGAHGQAS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTN  T A V  RIVDQCSNGGL+LD NVFNQ+DT+G+G   GHL
Sbjct  83   CGKCLEVTNRGTGASVIARIVDQCSNGGLNLDTNVFNQIDTDGKGRNAGHL  133



>gb|ABK23104.1| unknown [Picea sitchensis]
Length=143

 Score =   166 bits (419),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+NVRATYN YNPQNI WD   AS +CATWDA KPL WR+KYGWTAFCGPVGP GQAS
Sbjct  24   QQASNVRATYNYYNPQNIGWDLGKASAYCATWDASKPLEWRKKYGWTAFCGPVGPHGQAS  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL+VTN  T A V  RIVDQCSNGGLDLD +VFN++DT+G+G   GHL
Sbjct  84   CGKCLKVTNRGTGASVIARIVDQCSNGGLDLDASVFNKIDTDGKGRNDGHL  134



>gb|KEH43012.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=144

 Score =   165 bits (418),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA  VR+TY+ YNPQNINWDY  ASV+CATWDA++PL WR+KYGWTAFCGP GP G+ S
Sbjct  25   QSANGVRSTYHLYNPQNINWDYNRASVYCATWDANQPLEWRKKYGWTAFCGPQGPRGRDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NTAT AQ TVRIVDQC+NGGLDLDVNVF ++DTNGQG  +GHL
Sbjct  85   CGKCLRVKNTATGAQETVRIVDQCANGGLDLDVNVFKRIDTNGQGYQKGHL  135



>emb|CDP19703.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   165 bits (418),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNPQNINWD   A V+CATWDA+KPLSWR++YGWTAFCGP GP GQA+
Sbjct  23   QSASNVRATYHLYNPQNINWDLNAARVYCATWDANKPLSWRRQYGWTAFCGPAGPRGQAA  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNTAT AQV VRIVDQCSNGGLDLD+  F Q+DTNGQG A G L
Sbjct  83   CGRCLRVTNTATRAQVVVRIVDQCSNGGLDLDIGPFRQIDTNGQGNANGFL  133



>ref|XP_006424012.1| hypothetical protein CICLE_v10029536mg [Citrus clementina]
 gb|ESR37252.1| hypothetical protein CICLE_v10029536mg [Citrus clementina]
Length=142

 Score =   165 bits (417),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP+ I WD   AS +C+TWDA+KPL+WR+KYGWTAFCGPVGP GQA+
Sbjct  21   QSASNVRATYHLYNPERIGWDLNAASAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTN  T AQ TVRIVDQCSNGGLDLDV VF +LDT+G+G AQGHL
Sbjct  81   CGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHL  131



>ref|XP_007206349.1| hypothetical protein PRUPE_ppa017635mg [Prunus persica]
 gb|EMJ07548.1| hypothetical protein PRUPE_ppa017635mg [Prunus persica]
Length=131

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR+TY+ YNPQ  NWD R  S +CATWDAD+P +WR KYGWTAFCGPVGPTGQ +
Sbjct  10   QSATNVRSTYHLYNPQQNNWDLRAVSAYCATWDADQPFAWRSKYGWTAFCGPVGPTGQDA  69

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTNT T  QVTVRIVDQCSNGGLDLDVN+FNQ+DT+G G AQGHL
Sbjct  70   CGKCLLVTNTRTGDQVTVRIVDQCSNGGLDLDVNMFNQIDTDGNGNAQGHL  120



>ref|XP_008218271.1| PREDICTED: pathogenesis-related protein PR-4-like [Prunus mume]
 ref|XP_008218272.1| PREDICTED: pathogenesis-related protein PR-4-like [Prunus mume]
Length=174

 Score =   166 bits (419),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +3

Query  15   IYEAIIPL---RQRKYKMESRvacclvvvvalvagaaaQSATNVRATYNNYNPQNINWDY  185
            I + II L   R+R+    +++ C L+V V  +  A+AQSA+NVRATY+ YNP+ INWD 
Sbjct  15   IKKDIITLERERERELMKMAKLMCLLLVCVMSLKAASAQSASNVRATYHIYNPEKINWDL  74

Query  186  RTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVD  365
            + AS +C+TWDA+KPL WR+K+GWTAFCGPVGP GQ SCG+CL VTN  T  Q  VRIVD
Sbjct  75   KAASAYCSTWDANKPLEWRRKFGWTAFCGPVGPRGQTSCGKCLTVTNVRTGTQAKVRIVD  134

Query  366  QCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            QCSNGGLDLD  VF +LDT+GQG AQGHL
Sbjct  135  QCSNGGLDLDQGVFKRLDTDGQGHAQGHL  163



>ref|XP_007030553.1| Pathogenesis-related protein P2 [Theobroma cacao]
 gb|EOY11055.1| Pathogenesis-related protein P2 [Theobroma cacao]
Length=142

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP+  NWD    S FCATWDA+KPL WR+KYGWTAFCGP GP GQA+CGRC
Sbjct  25   NVRATYHLYNPEQNNWDLTAVSAFCATWDANKPLEWRRKYGWTAFCGPAGPRGQAACGRC  84

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNT T AQ TVRIVDQCSNGGLDLDVNVF QLDTNG G+AQGHL
Sbjct  85   LRVTNTGTGAQATVRIVDQCSNGGLDLDVNVFRQLDTNGNGIAQGHL  131



>gb|AFK45681.1| unknown [Medicago truncatula]
Length=144

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA  VR+TY+ YNPQNINWDY  ASV+CATWDA++PL WR+KYGWTAFCGP GP G+ S
Sbjct  25   QSANGVRSTYHLYNPQNINWDYNRASVYCATWDANQPLEWRKKYGWTAFCGPQGPRGRDS  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NTAT AQ TVRIVDQC+NGGLDLDV+VF ++DTNGQG  +GHL
Sbjct  85   CGKCLRVKNTATGAQETVRIVDQCANGGLDLDVDVFKRIDTNGQGYQKGHL  135



>sp|P83343.1|PR4_PRUPE RecName: Full=Pathogenesis-related protein PR-4; AltName: Full=PpAz89, 
partial [Prunus persica]
 gb|AAM00217.1|AF362989_1 class 4 pathogenesis-related protein, partial [Prunus persica]
Length=107

 Score =   162 bits (411),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  165  QNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaq  344
            QNINWD RTASVFCATWDADKPLSWR KYGWTAFCGPVGPTGQ SCG+CL VTNT T A+
Sbjct  1    QNINWDLRTASVFCATWDADKPLSWRSKYGWTAFCGPVGPTGQDSCGKCLLVTNTGTGAK  60

Query  345  vtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            VTVRIVDQCSNGGLDLDVNVFNQ+DTNGQG AQGHL
Sbjct  61   VTVRIVDQCSNGGLDLDVNVFNQIDTNGQGNAQGHL  96



>ref|NP_001237347.1| uncharacterized protein LOC100500393 precursor [Glycine max]
 gb|ACU15463.1| unknown [Glycine max]
Length=150

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA NVRATY+ YNP+ I W+  TAS +CATWDA+KPL+WR+KY WTAFCGPVGP G+ S
Sbjct  29   ESAKNVRATYHLYNPEQIGWNLVTASAYCATWDANKPLAWRKKYAWTAFCGPVGPRGRES  88

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTNT T  + TVRIVDQC+NGGLDLDVNVF QLDTNG G  QGHLT
Sbjct  89   CGRCLRVTNTGTGTEATVRIVDQCANGGLDLDVNVFRQLDTNGVGNQQGHLT  140



>ref|XP_002531286.1| Wound-induced protein WIN1 precursor, putative [Ricinus communis]
 gb|EEF31099.1| Wound-induced protein WIN1 precursor, putative [Ricinus communis]
Length=142

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QS +NVRATY+ YNP  INWD R AS FCATWDADKPL+WRQKYGWTAFC PVG  GQA+
Sbjct  22   QSGSNVRATYHFYNPAQINWDLRAASAFCATWDADKPLAWRQKYGWTAFCHPVGQ-GQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQVTVR+VDQCSNGGLDLD  VF Q+DT+G+G+AQGHL
Sbjct  81   CGKCLRVTNTGTGAQVTVRVVDQCSNGGLDLDEGVFRQIDTDGRGIAQGHL  131



>gb|KDO54392.1| hypothetical protein CISIN_1g032389mg [Citrus sinensis]
Length=142

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP+ I WD   A  +C+TWDA+KPL+WR+KYGWTAFCGPVGP GQA+
Sbjct  21   QSASNVRATYHLYNPERIGWDLNAARAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTN  T AQ TVRIVDQCSNGGLDLDV VF +LDT+G+G AQGHL
Sbjct  81   CGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHL  131



>ref|XP_006487788.1| PREDICTED: pathogenesis-related protein PR-4B-like [Citrus sinensis]
Length=142

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP+ I WD   A  +C+TWDA+KPL+WR+KYGWTAFCGPVGP GQA+
Sbjct  21   QSASNVRATYHLYNPERIGWDLNVARAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTN  T AQ TVRIVDQCSNGGLDLDV VF +LDT+G+G AQGHL
Sbjct  81   CGKCLRVTNRGTGAQATVRIVDQCSNGGLDLDVGVFRKLDTDGKGNAQGHL  131



>emb|CDP19702.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATYN YNPQNI WD   ASV+CATWDA+  L WR +YGWTAFCGPVGPTGQAS
Sbjct  23   QSASNVRATYNLYNPQNIGWDLNRASVYCATWDANMSLQWRSQYGWTAFCGPVGPTGQAS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTNTAT AQV VRIVDQCSN GLDLDV  F Q+DTNGQG+  G LT
Sbjct  83   CGRCLRVTNTATGAQVVVRIVDQCSNRGLDLDVGPFRQIDTNGQGINNGFLT  134



>gb|KHN14699.1| Pathogenesis-related protein PR-4B [Glycine soja]
Length=150

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA NVRATY+ YNP+ I W+  TAS +CATWDA+KPL+WR+KY WTAFCGPVGP G+ S
Sbjct  29   ESAKNVRATYHLYNPEQIGWNLVTASAYCATWDANKPLAWRKKYAWTAFCGPVGPRGRES  88

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CLRVTNT T  + TVRIVDQC+NGGLDLDVNVF QLDTNG G  QGHLT
Sbjct  89   CGKCLRVTNTGTGTEATVRIVDQCANGGLDLDVNVFRQLDTNGVGNQQGHLT  140



>ref|XP_008218273.1| PREDICTED: pathogenesis-related protein PR-4-like [Prunus mume]
Length=152

 Score =   162 bits (411),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QS TNVR+TY+ YNPQ  NWD R  S +CATWDAD+P +WR KYGWTAFCGPVGPTGQ +
Sbjct  31   QSDTNVRSTYHLYNPQQNNWDLRAVSAYCATWDADQPFAWRSKYGWTAFCGPVGPTGQDA  90

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTNT T  QVTVRIVDQCSNGGLDLDVN+FNQ+DT+G G AQGHL
Sbjct  91   CGKCLLVTNTRTGDQVTVRIVDQCSNGGLDLDVNMFNQIDTDGNGNAQGHL  141



>gb|AIN56735.1| pseudo-hevein, partial [Dipteryx odorata]
Length=142

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ Y P+  NWD    S +CATWDA+KPLSWR KYGWTAFCGPVGP GQA+
Sbjct  21   QSASNVRATYHLYQPEQHNWDLGAVSAYCATWDANKPLSWRSKYGWTAFCGPVGPQGQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL+VTNT T AQ TVRIVDQCSNGGLDLD+ VF +LDT+G G AQGHLT
Sbjct  81   CGKCLKVTNTRTQAQQTVRIVDQCSNGGLDLDIGVFQKLDTDGNGNAQGHLT  132



>ref|XP_010278162.1| PREDICTED: pathogenesis-related protein PR-4-like [Nelumbo nucifera]
Length=145

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNPQ  NW+    S FC+TWDA+KPLSWR KYGWTAFCGPVGPTGQA+
Sbjct  24   QSASNVRATYHYYNPQQNNWNLNAVSAFCSTWDANKPLSWRSKYGWTAFCGPVGPTGQAA  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+G G  QGHL
Sbjct  84   CGRCLRVTNTRTGAQATVRIVDQCSNGGLDLDWGVFQQIDTDGNGYNQGHL  134



>ref|XP_002264720.1| PREDICTED: pathogenesis-related protein PR-4 [Vitis vinifera]
 emb|CBI35210.3| unnamed protein product [Vitis vinifera]
Length=143

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +3

Query  57   MESRvacclvvvvalvagaaaQSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLS  236
            ME R  C +VV+++LVA AAAQSA+NVRATY+ YNP    WD    S +C+TWDA KPL+
Sbjct  1    MERRGICKVVVLLSLVACAAAQSASNVRATYHYYNPAQNGWDLNAVSAYCSTWDASKPLA  60

Query  237  WRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQL  416
            WR KYGWTAFCGP GPTGQA+CG+CL VTNTAT  Q TVRIVDQCSNGGLDLD  VFNQL
Sbjct  61   WRSKYGWTAFCGPSGPTGQAACGKCLSVTNTATGTQATVRIVDQCSNGGLDLDSGVFNQL  120

Query  417  DTNGQGVAQGHLT  455
            DTNG G A+GHLT
Sbjct  121  DTNGAGYAKGHLT  133



>gb|ACI31201.1| pathogenesis-related protein [Lycoris radiata]
Length=142

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATYN YNP   NWD      +CATWDA +PL WRQKYGWTAFCGPVGPTGQASCGRC
Sbjct  27   NVRATYNIYNPAQNNWDLNKVGAYCATWDAGQPLWWRQKYGWTAFCGPVGPTGQASCGRC  86

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            L VTN AT A+ TVRI+DQCSNGGLDLD  VFNQLDTNGQG AQGHLT
Sbjct  87   LLVTNQATGARQTVRIIDQCSNGGLDLDQGVFNQLDTNGQGYAQGHLT  134



>gb|AEW12795.1| pathogenesis-related protein 4 [Vitis pseudoreticulata]
Length=143

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  57   MESRvacclvvvvalvagaaaQSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLS  236
            ME R  C +VV+++LVA AAAQSA+NVRATY+ YNP    WD    S +C+TWDA KPL+
Sbjct  1    MERRGICKVVVLLSLVACAAAQSASNVRATYHYYNPAQNGWDLNAVSAYCSTWDASKPLA  60

Query  237  WRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQL  416
            WR KYGWTAFCGP GPTGQA+CG+CL VTNTAT  Q TVRIVDQCSNGGLDLD  VFNQL
Sbjct  61   WRSKYGWTAFCGPSGPTGQAACGKCLSVTNTATGTQATVRIVDQCSNGGLDLDSGVFNQL  120

Query  417  DTNGQGVAQGHL  452
            DTNG G AQGHL
Sbjct  121  DTNGAGYAQGHL  132



>emb|CAN80017.1| hypothetical protein VITISV_026189 [Vitis vinifera]
 emb|CBI35209.3| unnamed protein product [Vitis vinifera]
Length=143

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  57   MESRvacclvvvvalvagaaaQSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLS  236
            ME ++   + V+++LVA AAAQ A+NVRATY+ YNP+   WD    S +CATWDA+K L+
Sbjct  1    MEGKIIYMVAVLLSLVACAAAQHASNVRATYHYYNPEQHGWDLNAVSAYCATWDANKSLA  60

Query  237  WRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQL  416
            WR KYGWTAFCGP GPTGQA+CG+CL+VTNT T  Q TVRIVDQCSNGGLDLDV VFNQL
Sbjct  61   WRSKYGWTAFCGPAGPTGQAACGKCLKVTNTGTGTQATVRIVDQCSNGGLDLDVAVFNQL  120

Query  417  DTNGQGVAQGHL  452
            DTNG G  QGHL
Sbjct  121  DTNGVGYLQGHL  132



>ref|XP_002449459.1| hypothetical protein SORBIDRAFT_05g014060 [Sorghum bicolor]
 gb|EES08447.1| hypothetical protein SORBIDRAFT_05g014060 [Sorghum bicolor]
Length=149

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A  V ATYN YNPQ INWD RTAS FCATWDAD PL+WRQ+YGWTAFCGP G  G+ S
Sbjct  28   QQAHGVLATYNLYNPQKINWDMRTASTFCATWDADMPLAWRQRYGWTAFCGPAGDHGEPS  87

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCL+VTN AT A    R+VDQC NGGLDLD++VF Q+DT+G G+A GHL+
Sbjct  88   CGRCLQVTNRATGASTVARVVDQCDNGGLDLDISVFKQIDTDGGGMANGHLS  139



>gb|EMT07303.1| Wheatwin-1 [Aegilops tauschii]
 gb|AHE76182.1| wheatwin-1-like protein [Triticum aestivum]
Length=145

 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATYN Y+P+ INWD   AS +CATWDA    +WR KYGWTAFCGP GPTGQAS
Sbjct  22   QSASNVRATYNYYSPEKINWDLNAASAYCATWDAGMSYAWRSKYGWTAFCGPAGPTGQAS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CG+CL VTNTAT AQ+T RIVDQCSNGGLDLD + VF+++DT+GQGVAQGHLT
Sbjct  82   CGKCLLVTNTATGAQITARIVDQCSNGGLDLDFDTVFSKIDTDGQGVAQGHLT  134



>ref|XP_008355821.1| PREDICTED: pathogenesis-related protein PR-4B-like [Malus domestica]
Length=151

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVR+TY+ YNP+ I W    A  +CATWDA+KPL WR+K+GWTAFCGPVGP GQAS
Sbjct  30   QSASNVRSTYHIYNPEKIGWSLNAAGAYCATWDANKPLEWRRKFGWTAFCGPVGPRGQAS  89

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTN  T AQ  VRIVDQCSNGGLDLD  VF +LDT+G+G AQGHL
Sbjct  90   CGKCLRVTNVRTGAQAKVRIVDQCSNGGLDLDEGVFKRLDTDGKGYAQGHL  140



>ref|XP_004959105.1| PREDICTED: pathogenesis-related protein PR-4A-like [Setaria italica]
Length=151

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+ V ATYN YNP  INWD R AS FCATWDAD PLSWRQ YGWT+FCGP G  G+ S
Sbjct  30   QQASGVVATYNMYNPAQINWDLRAASTFCATWDADMPLSWRQHYGWTSFCGPAGAHGEPS  89

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCL+VTNTAT AQ   R+VDQCSNGGLDLD++VF Q+DT+G G+A GHL
Sbjct  90   CGRCLQVTNTATGAQTVARVVDQCSNGGLDLDISVFQQIDTDGGGMAHGHL  140



>ref|XP_008778929.1| PREDICTED: pathogenesis-related protein PR-4-like [Phoenix dactylifera]
Length=143

 Score =   160 bits (404),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            N+RATY+ YNP   NWD    S +C+TWDA+KPL+WRQKYGWTAFCGPVGP GQA+CG+C
Sbjct  28   NMRATYHEYNPAQHNWDLNAVSAYCSTWDANKPLAWRQKYGWTAFCGPVGPRGQAACGKC  87

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRV NTAT AQ TVRIVDQC+NGGLDLD  VF++LDTNGQG AQGHL
Sbjct  88   LRVKNTATGAQATVRIVDQCANGGLDLDHGVFSKLDTNGQGYAQGHL  134



>dbj|BAD11073.1| pathogenesis-related protein 4b [Capsicum chinense]
Length=203

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA NVRATY+ YNPQN+ WD    S +C+TWDA+KPL+WR KYGWTAFCGPVGP GQASC
Sbjct  70   SAQNVRATYHLYNPQNVGWDLNAVSAYCSTWDANKPLAWRSKYGWTAFCGPVGPRGQASC  129

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVTN  T AQ TVRIVDQCSNGGLDLD+NVF Q+DT+G G  QGHL
Sbjct  130  GKCLRVTNRRTRAQTTVRIVDQCSNGGLDLDINVFRQIDTDGVGNQQGHL  179



>emb|CAB62537.1| pseudo-hevein [Hevea brasiliensis]
Length=188

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NVRATY+ YNPQ   WD    S +C+TWDA+KP SWR KYGWTAFCGPVGP GQASC
Sbjct  53   SASNVRATYHLYNPQQHGWDLNAVSAYCSTWDANKPYSWRSKYGWTAFCGPVGPHGQASC  112

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            G+CLRVTNT T A+ TVRIVDQCSNGGLDLDVNVF +LDT+G+G  QGHLT
Sbjct  113  GKCLRVTNTRTGAKTTVRIVDQCSNGGLDLDVNVFRKLDTDGKGYEQGHLT  163



>ref|XP_010102286.1| Pathogenesis-related protein P2 [Morus notabilis]
 gb|EXB93229.1| Pathogenesis-related protein P2 [Morus notabilis]
Length=144

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNPQ  NWD    S FCATWDA+K   WR KYGWTAFCGP GPTGQA+
Sbjct  23   QSATNVRATYHLYNPQQNNWDLNAVSAFCATWDANKSYEWRSKYGWTAFCGPSGPTGQAA  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL+VTNT T + VTVRIVDQCSNGGLDLDVNVFN++DT+ +G  +GHL
Sbjct  83   CGKCLKVTNTGTGSAVTVRIVDQCSNGGLDLDVNVFNKIDTDKKGYERGHL  133



>ref|XP_010917599.1| PREDICTED: pathogenesis-related protein PR-4-like [Elaeis guineensis]
Length=143

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP   NWD    S +C+TWDADKPL+WR+KYGWTAFCGPVGP GQA+CG+C
Sbjct  28   NVRATYHEYNPAQHNWDLNAVSAYCSTWDADKPLAWRKKYGWTAFCGPVGPRGQAACGKC  87

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            L+VTNTAT AQ TVRIVDQC+NGGLDLD  VF++LDTNGQG AQGHL
Sbjct  88   LQVTNTATGAQATVRIVDQCANGGLDLDHGVFSKLDTNGQGYAQGHL  134



>ref|XP_006347743.1| PREDICTED: wound-induced protein WIN1-like [Solanum tuberosum]
 sp|P09761.1|WIN1_SOLTU RecName: Full=Wound-induced protein WIN1; Flags: Precursor [Solanum 
tuberosum]
 emb|CAA31851.1| WIN1 protein [Solanum tuberosum]
Length=200

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA NVRATY+ YNPQN+ WD    S +C+TWDA+KPLSWR+KYGWTAFCGPVGP G+ SC
Sbjct  79   SAQNVRATYHIYNPQNVGWDLNAVSAYCSTWDANKPLSWRKKYGWTAFCGPVGPRGRDSC  138

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T AQ TVRIVDQCSNGGLDLDVNVF Q+DT+G G  QGHL
Sbjct  139  GKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDVNVFRQIDTDGNGNHQGHL  188



>ref|XP_002531285.1| Wound-induced protein WIN1 precursor, putative [Ricinus communis]
 gb|EEF31098.1| Wound-induced protein WIN1 precursor, putative [Ricinus communis]
Length=142

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QS +NVRATY+ YNP  INWD R AS +CATWDADKPL+WR+KYGWTAFC PVG  GQA+
Sbjct  22   QSGSNVRATYHFYNPAKINWDLRAASAYCATWDADKPLAWRRKYGWTAFCHPVGQ-GQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T AQVTVRIVDQCSNGGLDLD  VF Q+DT+G+G A+GHL
Sbjct  81   CGRCLRVTNTGTRAQVTVRIVDQCSNGGLDLDEGVFRQIDTDGKGYARGHL  131



>gb|AAB94514.1| pathogenesis-related protein-4 [Dioscorea bulbifera]
Length=151

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+NVRATY+ YN    NWD R  S FCATWDADKPL+WRQKYGWTAFCGP GPTGQ +
Sbjct  30   QQASNVRATYHYYNAAQNNWDLRAVSAFCATWDADKPLAWRQKYGWTAFCGPAGPTGQDA  89

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTNT TNAQ TVRIVDQCSNGGLDLD +VF Q+DT+  G AQGHL
Sbjct  90   CGKCLLVTNTKTNAQATVRIVDQCSNGGLDLDWSVFEQIDTDKSGYAQGHL  140



>emb|CAA87070.1| pathogenesis-related protein PR-4 type [Sambucus nigra]
Length=140

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNPQ INWDY  ASV+CATWDA++PL WR++YGWTAFCGPVGP G+ S
Sbjct  19   QSASNVRATYHIYNPQQINWDYNRASVYCATWDANRPLEWRRRYGWTAFCGPVGPRGRDS  78

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T    TVRIVDQC+NGGLDL+  VF +LDT+G+G A+G+L
Sbjct  79   CGRCLRVTNTGTGTSETVRIVDQCANGGLDLEQGVFQRLDTDGRGYARGNL  129



>ref|XP_002884464.1| hypothetical protein ARALYDRAFT_477741 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60723.1| hypothetical protein ARALYDRAFT_477741 [Arabidopsis lyrata subsp. 
lyrata]
Length=212

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP   NWD R  S FC+TWDADKP +WR KYGWTAFCGP GP GQAS
Sbjct  72   ESASNVRATYHFYNPAQNNWDLRAVSAFCSTWDADKPYAWRSKYGWTAFCGPAGPRGQAS  131

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FNQ+DT+G G  QGHL
Sbjct  132  CGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHL  182



>gb|AAS78779.1| pathogenesis-related protein precursor [Triticum aestivum]
Length=145

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+ V ATYN YNP+ INWD R ASV+CATWDADKPL+WRQ++GWTAFCGP G  GQ+S
Sbjct  24   QRASGVAATYNLYNPEKINWDLRVASVYCATWDADKPLAWRQRFGWTAFCGPAGAHGQSS  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCL+VTN  T A+   R+VDQC NGGLDLD  VF ++DT+G GVA GHL
Sbjct  84   CGRCLKVTNRTTGARTVARVVDQCDNGGLDLDAAVFRRIDTDGGGVANGHL  134



>ref|XP_007023212.1| Pathogenesis-related protein PR-4B [Theobroma cacao]
 gb|EOY25834.1| Pathogenesis-related protein PR-4B [Theobroma cacao]
Length=199

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP    WD    S +C+TWDA+KPL+WRQKYGWTAFCGPVGP GQAS
Sbjct  78   ESASNVRATYHFYNPPQNGWDLNAVSAYCSTWDANKPLAWRQKYGWTAFCGPVGPRGQAS  137

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTN  T A+  VRIVDQCSNGGLDLD  VF Q+DT+G+G AQGHL
Sbjct  138  CGRCLRVTNRGTRAEAIVRIVDQCSNGGLDLDAAVFQQIDTDGRGYAQGHL  188



>ref|XP_003577406.1| PREDICTED: pathogenesis-related protein PR-4-like [Brachypodium 
distachyon]
Length=147

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+ V ATYN YNP+ INWD RTA V+CATWDAD PL+WRQ+YGWTAFCGP G  G+A+
Sbjct  26   QKASGVAATYNLYNPEKINWDLRTAGVYCATWDADMPLAWRQRYGWTAFCGPAGAHGEAA  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCL+VTN+AT A+ T R+VDQC NGGLDLD+ VF Q+DT+G G+  GHL 
Sbjct  86   CGRCLQVTNSATGARTTARVVDQCDNGGLDLDIAVFRQIDTDGHGLGNGHLV  137



>gb|KFK37886.1| hypothetical protein AALP_AA3G042000 [Arabis alpina]
Length=211

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP+  NWD R  S +C+TWDADKP +WR KYGWTAFCGP GP GQAS
Sbjct  73   ESASNVRATYHYYNPEQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQAS  132

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FN++DT+G G  QGHL
Sbjct  133  CGKCLRVRNTRTNAAVTVRIVDQCSNGGLDLDVAMFNRIDTDGNGYQQGHL  183



>ref|NP_001235941.1| uncharacterized protein LOC100526916 precursor [Glycine max]
 gb|ACU15937.1| unknown [Glycine max]
 gb|KHN31466.1| Hevein-like protein [Glycine soja]
Length=142

 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ Y P+  NWD    S +C+TWDADK L+WR KYGWTAFCGP GP GQ S
Sbjct  21   QSATNVRATYHLYQPEQHNWDLLAVSAYCSTWDADKSLAWRSKYGWTAFCGPSGPQGQQS  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT TNAQ TVRIVDQCSNGGLDLD+  F +LDT+G G+AQGHL
Sbjct  81   CGRCLRVTNTRTNAQETVRIVDQCSNGGLDLDIGPFQKLDTDGNGIAQGHL  131



>ref|XP_006408160.1| hypothetical protein EUTSA_v10021503mg [Eutrema salsugineum]
 dbj|BAJ33708.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49613.1| hypothetical protein EUTSA_v10021503mg [Eutrema salsugineum]
Length=214

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP+  NWD R  S +C+TWDADKP +WR KYGWTAFCGP GP GQAS
Sbjct  73   ESASNVRATYHFYNPEQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQAS  132

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FN+LDT+G G  QGHL
Sbjct  133  CGKCLRVRNTRTNAVVTVRIVDQCSNGGLDLDVAMFNRLDTDGVGYQQGHL  183



>ref|NP_187123.1| pathogenesis-related 4 [Arabidopsis thaliana]
 sp|P43082.1|HEVL_ARATH RecName: Full=Hevein-like preproprotein; Contains: RecName: Full=CB-HEL; 
Contains: RecName: Full=CD-HEL; AltName: Full=RNase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF04912.1|AC011437_27 hevein-like protein precursor [Arabidopsis thaliana]
 gb|AAK48963.1|AF370536_1 hevein-like protein precursor [Arabidopsis thaliana]
 gb|AAA20642.1| pre-hevein-like protein [Arabidopsis thaliana]
 gb|AAM66966.1| hevein-like protein precursor PR-4 [Arabidopsis thaliana]
 gb|AAN15365.1| hevein-like protein precursor [Arabidopsis thaliana]
 gb|AEE74125.1| pathogenesis-related 4 [Arabidopsis thaliana]
Length=212

 Score =   159 bits (403),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP   NWD R  S +C+TWDADKP +WR KYGWTAFCGP GP GQAS
Sbjct  72   ESASNVRATYHFYNPAQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQAS  131

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FNQ+DT+G G  QGHL
Sbjct  132  CGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHL  182



>gb|AAC33732.1| PR-4 type protein [Vitis vinifera]
 gb|ADG35965.1| pathogenesis-related protein 4 [Vitis hybrid cultivar]
Length=143

 Score =   157 bits (396),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +3

Query  57   MESRvacclvvvvalvagaaaQSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLS  236
            ME R  C +VV+++LVA AAAQSA+NVRATY+ YNP+   WD    S +C+TWDA +PL+
Sbjct  1    MERRGICKVVVLLSLVACAAAQSASNVRATYHYYNPEQNGWDLNAVSAYCSTWDASQPLA  60

Query  237  WRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQL  416
            WR KYGWTAFCGP GPTGQA+CG+CL VTNTAT  Q TVRIVDQCSNGGLDLD  VFN+L
Sbjct  61   WRSKYGWTAFCGPSGPTGQAACGKCLSVTNTATGTQATVRIVDQCSNGGLDLDSGVFNKL  120

Query  417  DTNGQGVAQGHL  452
            DTNG G  QGHL
Sbjct  121  DTNGAGYNQGHL  132



>ref|XP_009134785.1| PREDICTED: hevein-like preproprotein [Brassica rapa]
 emb|CDX74169.1| BnaA03g28780D [Brassica napus]
Length=214

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SAT VRATY+ YNP   NWD R  S +C+TWDADKP SWR KYGWTAFCGP GP GQAS
Sbjct  73   ESATGVRATYHYYNPAQNNWDLRAVSAYCSTWDADKPYSWRSKYGWTAFCGPAGPRGQAS  132

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FNQ+DT+G G  +GHL
Sbjct  133  CGKCLRVRNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGDGYRKGHL  183



>gb|AIE39008.1| pathogenesis-related protein 4, partial [Vaccinium virgatum]
Length=138

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+NYNP+ + WD    S +C+TWDA+KPL WR+KYGWTAFCGPVG  GQAS
Sbjct  30   ESASNVRATYHNYNPEQVGWDLNAVSAYCSTWDANKPLEWRKKYGWTAFCGPVGARGQAS  89

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQG  446
            CG+CLRVTNT T AQ TVRIVDQCSNGGLDLD  VF QLDTNG+G A+G
Sbjct  90   CGKCLRVTNTWTGAQTTVRIVDQCSNGGLDLDAGVFKQLDTNGRGNAEG  138



>gb|KEH43010.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=141

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSAT V++T+N YNP+  NWD R  S FCATWDAD+PLSWR KYGWTAFCGPVGP GQAS
Sbjct  21   QSAT-VQSTFNLYNPEQHNWDLRAVSAFCATWDADQPLSWRSKYGWTAFCGPVGPQGQAS  79

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q   RI+DQC NGGLDLDV VF +LD++  G AQGHL
Sbjct  80   CGRCLRVTNTKTGDQQIARIIDQCHNGGLDLDVGVFQRLDSDRSGNAQGHL  130



>emb|CDY40674.1| BnaC03g33900D [Brassica napus]
Length=214

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SAT VRATY+ YNP   NWD R  S +C+TWDADKP SWR KYGWTAFCGP GP GQAS
Sbjct  73   ESATGVRATYHYYNPAQNNWDLRAVSAYCSTWDADKPYSWRSKYGWTAFCGPAGPRGQAS  132

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FNQ+DT+G G  +GHL
Sbjct  133  CGKCLRVRNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGDGYRKGHL  183



>ref|XP_006838866.1| hypothetical protein AMTR_s00002p00266700 [Amborella trichopoda]
 gb|ERN01435.1| hypothetical protein AMTR_s00002p00266700 [Amborella trichopoda]
Length=143

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVRATY+ YNP+   WD    S +CATWDA K L+WR KY WTAFCGPVGP GQAS
Sbjct  22   QSATNVRATYHVYNPEQNGWDLTRVSAYCATWDAGKSLAWRSKYRWTAFCGPVGPRGQAS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCL VTN  T  Q TVRIVDQCSNGGLDL+  VF QLDTNG+G+AQGHL
Sbjct  82   CGRCLTVTNRGTGTQRTVRIVDQCSNGGLDLEEGVFRQLDTNGRGIAQGHL  132



>ref|XP_011032398.1| PREDICTED: pathogenesis-related protein PR-4-like [Populus euphratica]
Length=201

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP+   WD    S +C+TWDA+KPL+WR++YGWTAFCGPVGP GQAS
Sbjct  82   ESASNVRATYHFYNPEQNGWDLNAVSAYCSTWDANKPLAWRRQYGWTAFCGPVGPRGQAS  141

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+G+G AQGHL
Sbjct  142  CGRCLRVTNTGTGAQATVRIVDQCSNGGLDLDAGVFRQIDTDGRGNAQGHL  192



>ref|XP_004980477.1| PREDICTED: pathogenesis-related protein PR-4A-like [Setaria italica]
Length=147

 Score =   155 bits (393),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A  V ATYN YNP+ INWD RTAS FCATW+AD PL+WR+ YGWTAFCGP G  GQ S
Sbjct  26   QEAHGVLATYNLYNPERINWDMRTASTFCATWNADMPLAWRKHYGWTAFCGPAGAHGQPS  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCL VTN AT A+   R+VDQC NGGLDLD++VF QLDT+G G+  GHL+
Sbjct  86   CGRCLLVTNMATGAKTVARVVDQCDNGGLDLDISVFRQLDTDGGGMFNGHLS  137



>ref|XP_006387539.1| hypothetical protein POPTR_0876s00200g [Populus trichocarpa]
 gb|ERP46453.1| hypothetical protein POPTR_0876s00200g [Populus trichocarpa]
Length=188

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP+   WD      +C+TWDA+KPL+WR++YGWTAFCGPVGP GQAS
Sbjct  69   ESASNVRATYHFYNPEQNGWDLNAVRAYCSTWDANKPLAWRRQYGWTAFCGPVGPRGQAS  128

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T AQ T+RIVDQCSNGGLDLD   F QLDT+G+G AQGHL
Sbjct  129  CGRCLRVTNTGTRAQATMRIVDQCSNGGLDLDAGAFRQLDTDGRGNAQGHL  179



>ref|XP_006487793.1| PREDICTED: pathogenesis-related protein PR-4A [Citrus sinensis]
Length=143

 Score =   155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ Y+P+ I WD   AS FCATWDA KPL+WRQKYGWTAFC   GP GQA+
Sbjct  22   QSASNVRATYHLYHPEQIGWDLTAASAFCATWDASKPLAWRQKYGWTAFCHSGGPIGQAA  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTN+ T AQ  VRIVDQC+NGGLDLD  VF +LDTNG G  QG LT
Sbjct  82   CGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLT  133



>ref|XP_010042120.1| PREDICTED: wound-induced protein WIN1-like [Eucalyptus grandis]
Length=133

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NV+ATY+ Y P++  WD      +C+TWDA+KPL+WR+KYGWT+FCGPVGP GQAS
Sbjct  14   QSASNVKATYHYYYPEHSGWDLNAQHAYCSTWDANKPLAWRKKYGWTSFCGPVGPRGQAS  73

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTNT T AQ TVRI+DQCSNGGLDLD  VF +LDT+G G AQGHL 
Sbjct  74   CGRCLRVTNTRTGAQATVRIIDQCSNGGLDLDAGVFRRLDTDGNGNAQGHLV  125



>gb|ABK63195.1| hevein-like [Populus tremula x Populus alba]
Length=205

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNPQ+  WD    S +C+TWDA KP SWR KYGWTAFCGP GP GQAS
Sbjct  69   ESASNVRATYHLYNPQDHGWDLNAVSAYCSTWDASKPYSWRSKYGWTAFCGPAGPRGQAS  128

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQ T RIVDQCSNGGLDLDVNVF  +DT+G G A+GHL
Sbjct  129  CGKCLRVTNTRTGAQTTARIVDQCSNGGLDLDVNVFRTIDTDGDGYAKGHL  179



>ref|XP_002531287.1| Wound-induced protein WIN2 precursor, putative [Ricinus communis]
 gb|EEF31100.1| Wound-induced protein WIN2 precursor, putative [Ricinus communis]
Length=202

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNPQ   WD    S +C+TWDA+KP SWR KYGWTAFCGP GP GQ S
Sbjct  69   ESASNVRATYHFYNPQQHGWDLNAVSAYCSTWDANKPYSWRSKYGWTAFCGPAGPRGQTS  128

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T A  TVRIVDQCSNGGLDLDVNVF QLDT+G G  QGHL
Sbjct  129  CGKCLRVTNTRTGAATTVRIVDQCSNGGLDLDVNVFRQLDTDGIGYQQGHL  179



>ref|XP_004230092.1| PREDICTED: wound-induced protein WIN1 [Solanum lycopersicum]
Length=199

 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            A N+RATY+ YNPQN+ WD    S +C+TWDA+KP SWR+KYGWTAFCGPVGP G+ SCG
Sbjct  79   AQNIRATYHIYNPQNVGWDLNAVSAYCSTWDANKPYSWRKKYGWTAFCGPVGPRGRDSCG  138

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            +CLRVTNT T AQ TVRIVDQCSNGGLDLDVNVF Q+DT+G G  QGHL
Sbjct  139  KCLRVTNTRTRAQTTVRIVDQCSNGGLDLDVNVFRQIDTDGNGNHQGHL  187



>ref|XP_006424015.1| hypothetical protein CICLE_v10029328mg [Citrus clementina]
 gb|ESR37255.1| hypothetical protein CICLE_v10029328mg [Citrus clementina]
Length=193

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP+   WD    S +C+TWDA+KPLSWR+KYGWTAFCGPVGP GQASCG+C
Sbjct  76   NVRATYHFYNPEQNGWDLNAVSAYCSTWDANKPLSWRRKYGWTAFCGPVGPRGQASCGKC  135

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTN AT AQ TVRIVDQCSNGGLDLD  VF QLDT+G+G AQGHL
Sbjct  136  LRVTNRATRAQATVRIVDQCSNGGLDLDAGVFRQLDTDGRGNAQGHL  182



>ref|XP_006487791.1| PREDICTED: hevein-like preproprotein-like [Citrus sinensis]
 ref|XP_006487792.1| PREDICTED: hevein-like preproprotein-like [Citrus sinensis]
Length=193

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP+   WD    S +C+TWDA+KPLSWR+KYGWTAFCGPVGP GQASCG+C
Sbjct  76   NVRATYHFYNPEQNGWDLNAVSAYCSTWDANKPLSWRRKYGWTAFCGPVGPRGQASCGKC  135

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTN AT AQ TVRIVDQCSNGGLDLD  VF QLDT+G+G AQGHL
Sbjct  136  LRVTNRATRAQATVRIVDQCSNGGLDLDAGVFRQLDTDGRGNAQGHL  182



>ref|XP_002319076.1| HEV1.2 family protein [Populus trichocarpa]
 gb|EEE94999.1| HEV1.2 family protein [Populus trichocarpa]
Length=204

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNPQ+  WD    S +C+TWDA KP SWR KYGWTAFCGP GP GQAS
Sbjct  68   ESASNVRATYHLYNPQDHGWDLNAVSAYCSTWDAGKPYSWRSKYGWTAFCGPAGPRGQAS  127

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQ T RIVDQCSNGGLDLDVNVF  +DT+G G A+GHL
Sbjct  128  CGKCLRVTNTRTGAQTTARIVDQCSNGGLDLDVNVFRTIDTDGDGYAKGHL  178



>ref|XP_006487790.1| PREDICTED: hevein-like preproprotein-like [Citrus sinensis]
Length=193

 Score =   156 bits (394),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP+   WD    S +C+TWDA+KPLSWR+KYGWTAFCGPVGP GQASCG+C
Sbjct  76   NVRATYHFYNPEQNGWDLNAVSAYCSTWDANKPLSWRRKYGWTAFCGPVGPRGQASCGKC  135

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTN AT AQ TVRIVDQCSNGGLDLD  VF QLDT+G+G AQGHL
Sbjct  136  LRVTNRATRAQATVRIVDQCSNGGLDLDAGVFRQLDTDGRGNAQGHL  182



>ref|XP_011038564.1| PREDICTED: pro-hevein-like [Populus euphratica]
Length=204

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNPQ   WD    S +C+TWDA KP SWR KYGWTAFCGP GP GQAS
Sbjct  68   ESASNVRATYHLYNPQEHGWDLNAVSAYCSTWDASKPYSWRSKYGWTAFCGPAGPRGQAS  127

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQ TVRIVDQCSNGGLDLDVNVF  +DT+G G A+GHL
Sbjct  128  CGKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDVNVFRTIDTDGDGYAKGHL  178



>gb|AAB29959.2| pathogen- and wound-inducible antifungal protein CBP20 precursor 
[Nicotiana tabacum]
Length=211

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            +A NVRATY+ YNPQN+ WD    S +C+TWD +KPL+WR+KYGWTAFCGPVGP G+ SC
Sbjct  79   AAQNVRATYHIYNPQNVGWDLYAVSAYCSTWDGNKPLAWRRKYGWTAFCGPVGPRGRDSC  138

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T AQ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHL
Sbjct  139  GKCLRVTNTGTGAQTTVRIVDQCSNGGLDLDVNVFRQLDTDGRGNQRGHL  188



>gb|AAT67050.1| pathogenesis-related protein 4 [Triticum monococcum]
Length=145

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATYN Y+P+ INWD   AS +CATWDA    +WR KYGWTAFCGP GPTGQASCG+C
Sbjct  26   NVRATYNYYSPEKINWDLNAASAYCATWDAGMSYAWRSKYGWTAFCGPAGPTGQASCGKC  85

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            L VTNTAT AQ+T RIVDQCSNGGLDLD + VF+++DT+GQGVAQGHLT
Sbjct  86   LLVTNTATGAQITARIVDQCSNGGLDLDFDTVFSKIDTDGQGVAQGHLT  134



>ref|XP_002264647.1| PREDICTED: pathogenesis-related protein PR-4 [Vitis vinifera]
Length=197

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP+   WD    S +CATWDA+K L+WR KYGWTAFCGP GPTGQA+CG+C
Sbjct  80   NVRATYHYYNPEQHGWDLNAVSAYCATWDANKSLAWRSKYGWTAFCGPAGPTGQAACGKC  139

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            L+VTNT T  Q TVRIVDQCSNGGLDLDV VFNQLDTNG G  QGHL
Sbjct  140  LKVTNTGTGTQATVRIVDQCSNGGLDLDVAVFNQLDTNGVGYLQGHL  186



>ref|XP_004494704.1| PREDICTED: hevein-like preproprotein-like [Cicer arietinum]
Length=208

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ Y P+   WD    S +C+TWDA KP SWR KYGWTAFCGPVGP GQAS
Sbjct  73   ESASNVRATYHYYQPEQHGWDLNAVSAYCSTWDASKPYSWRSKYGWTAFCGPVGPRGQAS  132

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQ TVRIVDQCSNGGLDLDV VFN++DT+G+G  QGHL
Sbjct  133  CGKCLRVTNTGTGAQETVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHL  183



>ref|XP_009793591.1| PREDICTED: wound-induced protein WIN1-like [Nicotiana sylvestris]
Length=211

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            +A NVRATY+ YNPQN+ WD    S +C+TWD +KPL+WR+KYGWTAFCGPVGP G+ SC
Sbjct  79   AAQNVRATYHIYNPQNVGWDLYAVSAYCSTWDGNKPLAWRRKYGWTAFCGPVGPRGRDSC  138

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T AQ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHL
Sbjct  139  GKCLRVTNTGTGAQTTVRIVDQCSNGGLDLDVNVFRQLDTDGRGNQRGHL  188



>ref|XP_010524916.1| PREDICTED: hevein-like preproprotein [Tarenaya hassleriana]
Length=216

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+N+RATY+ YNP+  NWD R  S +C+TWDA KP +WR KYGWTA CGPVGP GQAS
Sbjct  77   ESASNIRATYHYYNPEQHNWDLRAVSAYCSTWDAKKPYTWRSKYGWTALCGPVGPRGQAS  136

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLR+TNT T AQVT RIVDQC NGGLD+DV VFN+LDT+G G  QGHL
Sbjct  137  CGKCLRITNTRTRAQVTARIVDQCGNGGLDMDVGVFNRLDTDGVGYQQGHL  187



>ref|XP_009407234.1| PREDICTED: pathogenesis-related protein PR-4-like [Musa acuminata 
subsp. malaccensis]
Length=143

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ Y P   NWD    S +CATWDAD+PL+WRQKYGWTAFCGP GPTGQA+CG+
Sbjct  25   SNVRATYHYYYPAQNNWDLNAVSAYCATWDADEPLAWRQKYGWTAFCGPAGPTGQAACGK  84

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CL VTNTAT  Q TVRIVDQC+NGGLDLD  VF+QLDT+G G AQGHL
Sbjct  85   CLLVTNTATGTQATVRIVDQCANGGLDLDQGVFSQLDTDGTGYAQGHL  132



>pdb|4JP7|A Chain A, High Resolution Structure Of A Papaya Barwin-like Protein 
(crystal Form 2)
 pdb|4JP7|B Chain B, High Resolution Structure Of A Papaya Barwin-like Protein 
(crystal Form 2)
 pdb|4JP6|A Chain A, High Resolution Structure Of A Papaya Barwin-like Protein
Length=122

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NVRATY+ YN Q   WD R  S +CATWDADKP SWR KYGWTAFCGPVGP G+A+C
Sbjct  2    SASNVRATYHFYNAQQNGWDLRKVSAYCATWDADKPYSWRSKYGWTAFCGPVGPHGRAAC  61

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T A+ TVRIVDQCSNGGLDLD +VF +LDT+G G  +GHL
Sbjct  62   GKCLRVTNTKTRAETTVRIVDQCSNGGLDLDWSVFKKLDTDGSGYLRGHL  111



>ref|XP_008456027.1| PREDICTED: pathogenesis-related protein PR-4-like [Cucumis melo]
Length=142

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNV ATY+ YNPQ INWDY  A+V+CATWDA+KP  WR +YGWTAFCGPVGP GQAS
Sbjct  23   QSATNVTATYHLYNPQIINWDYTKANVYCATWDANKPFEWRSRYGWTAFCGPVGPHGQAS  82

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRC +VTN  T A   VRIVD+CS GG DLDV VF +LDT+G G   G +
Sbjct  83   CGRCTKVTNAETKASTIVRIVDECSYGGFDLDVGVFMRLDTDGIGSTNGFI  133



>ref|NP_001275628.1| wound-induced protein WIN2 precursor [Solanum tuberosum]
 sp|P09762.1|WIN2_SOLTU RecName: Full=Wound-induced protein WIN2; Flags: Precursor [Solanum 
tuberosum]
 emb|CAA31852.1| WIN2 protein [Solanum tuberosum]
 gb|AFW90614.1| wound-induced protein WIN1 [Solanum tuberosum]
Length=211

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA NVRATY+ YNPQN+ WD    S +C+TWDA+KP +WR KYGWTAFCGPVGP G+ SC
Sbjct  78   SAQNVRATYHIYNPQNVGWDLNAVSAYCSTWDANKPYAWRSKYGWTAFCGPVGPRGRDSC  137

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T AQ TVRIVDQCSNGGLDLD+NVF Q+DT+G G  QGHL
Sbjct  138  GKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDINVFQQIDTDGVGNQQGHL  187



>ref|XP_010551191.1| PREDICTED: pathogenesis-related protein PR-4-like [Tarenaya hassleriana]
Length=148

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    WD    S FC+TWD  KPL WRQ+Y WTAFCGPVGP G+ S
Sbjct  29   QSASNVRATYHFYNPSQNGWDLYRVSAFCSTWDGTKPLEWRQRYSWTAFCGPVGPRGRDS  88

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNTAT  Q TVRIVDQCSNGGLDLD  VF QLD+NGQG A+GHL
Sbjct  89   CGKCLRVTNTATGTQATVRIVDQCSNGGLDLDEGVFRQLDSNGQGYARGHL  139



>ref|XP_010027183.1| PREDICTED: pathogenesis-related protein PR-4-like [Eucalyptus 
grandis]
 gb|KCW61592.1| hypothetical protein EUGRSUZ_H04326 [Eucalyptus grandis]
Length=141

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NV ATYN+YNP+  +WD      FC+TWDA  PL+WR++YGWTAFCGPVGP G+AS
Sbjct  22   QSASNVLATYNDYNPEQNHWDLNAVHAFCSTWDASMPLAWREEYGWTAFCGPVGPHGEAS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTN  T AQ TVRI+DQCSNGGLDLD  +F  LDT+G G AQGHL
Sbjct  82   CGQCLSVTNMRTGAQATVRIIDQCSNGGLDLDAGMFQALDTDGSGNAQGHL  132



>gb|AAB29960.1| CBP20, partial [Nicotiana tabacum]
Length=208

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            A NVRATY+ YNPQN+ WD    S +C+TWD +KPL+WR+KYGWTAFCGPVGP G+ SCG
Sbjct  77   AQNVRATYHIYNPQNVGWDLYAVSAYCSTWDGNKPLAWRRKYGWTAFCGPVGPRGRDSCG  136

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            +CLRVTNT T AQ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHL
Sbjct  137  KCLRVTNTGTGAQTTVRIVDQCSNGGLDLDVNVFRQLDTDGRGNQRGHL  185



>ref|XP_009610436.1| PREDICTED: wound-induced protein WIN1-like [Nicotiana tomentosiformis]
Length=208

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            A NVRATY+ YNPQN+ WD    S +C+TWD +KPL+WR+KYGWTAFCGPVGP G+ SCG
Sbjct  77   AQNVRATYHIYNPQNVGWDLYAVSAYCSTWDGNKPLAWRRKYGWTAFCGPVGPRGRDSCG  136

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            +CLRVTNT T AQ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHL
Sbjct  137  KCLRVTNTGTGAQTTVRIVDQCSNGGLDLDVNVFRQLDTDGRGNQRGHL  185



>emb|CAC81819.1| pi1 [Solanum lycopersicum]
Length=137

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  135  VRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            VRATY+ YNPQN+ WD    S +C+TWDA+KP SWR KYGWTAFCGPVGP G+ SCG+CL
Sbjct  8    VRATYHIYNPQNVGWDLNAVSAYCSTWDANKPYSWRSKYGWTAFCGPVGPRGRDSCGKCL  67

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            RVTNT T AQ TVRIVDQCSNGGLDLD+NVF Q+DT+G G  QGHL
Sbjct  68   RVTNTRTGAQTTVRIVDQCSNGGLDLDINVFRQIDTDGVGNQQGHL  113



>ref|XP_011038567.1| PREDICTED: pathogenesis-related protein PR-4-like isoform X3 
[Populus euphratica]
Length=192

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP    WD    S +C+TWDA+KPL WR+KYGWTAFCGPVGP+GQASCGRC
Sbjct  75   NVRATYHYYNPDQNGWDLNAVSAYCSTWDANKPLEWRRKYGWTAFCGPVGPSGQASCGRC  134

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+G+G AQGHL
Sbjct  135  LRVTNTGTGAQATVRIVDQCSNGGLDLDAGVFQQIDTDGRGNAQGHL  181



>ref|XP_004979597.1| PREDICTED: wheatwin-2-like [Setaria italica]
Length=146

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    WD    S +CATWDA+KPLSWRQKYGWTAFCGP GP GQAS
Sbjct  26   QSASNVRATYHLYNPAQNGWDLNRVSAYCATWDANKPLSWRQKYGWTAFCGPSGPRGQAS  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+C++VTN AT A    RIVDQCSNGGLDLD   VF ++DTNGQG   GHL
Sbjct  86   CGKCIKVTNRATGASTVARIVDQCSNGGLDLDFETVFKKIDTNGQGYQMGHL  137



>ref|XP_011038565.1| PREDICTED: pathogenesis-related protein PR-4-like isoform X1 
[Populus euphratica]
Length=196

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP    WD    S +C+TWDA+KPL WR+KYGWTAFCGPVGP+GQASCGRC
Sbjct  79   NVRATYHYYNPDQNGWDLNAVSAYCSTWDANKPLEWRRKYGWTAFCGPVGPSGQASCGRC  138

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+G+G AQGHL
Sbjct  139  LRVTNTGTGAQATVRIVDQCSNGGLDLDAGVFQQIDTDGRGNAQGHL  185



>ref|XP_011038566.1| PREDICTED: pathogenesis-related protein PR-4-like isoform X2 
[Populus euphratica]
Length=192

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP    WD    S +C+TWDA+KPL WR+KYGWTAFCGPVGP+GQASCGRC
Sbjct  75   NVRATYHYYNPDQNGWDLNAVSAYCSTWDANKPLEWRRKYGWTAFCGPVGPSGQASCGRC  134

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+G+G AQGHL
Sbjct  135  LRVTNTGTGAQATVRIVDQCSNGGLDLDAGVFQQIDTDGRGNAQGHL  181



>ref|XP_010418259.1| PREDICTED: hevein-like preproprotein [Camelina sativa]
Length=193

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            A NVRATY+ YNP   NWD R  S +C+TWDADKP +WR KYGWTAFCGP GP GQASCG
Sbjct  74   AKNVRATYHIYNPAQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQASCG  133

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            +CLRV NT TNA VTVRIVDQCSNGGLDLDV +FNQ+DT+  G  QGHL
Sbjct  134  KCLRVRNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDRNGYQQGHL  182



>ref|XP_006298619.1| hypothetical protein CARUB_v10014707mg [Capsella rubella]
 gb|EOA31517.1| hypothetical protein CARUB_v10014707mg [Capsella rubella]
Length=193

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA NVRATY+ YNP   NWD R  S +C+TWDADK  +WR KYGWTAFCGP GP GQAS
Sbjct  72   ESAKNVRATYHIYNPAQNNWDLRAVSAYCSTWDADKSYAWRSKYGWTAFCGPAGPRGQAS  131

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FNQ+DT+  G  QGHL
Sbjct  132  CGKCLRVRNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDRNGYQQGHL  182



>gb|ABR13276.1| putative pathogenesis-related protein class 4 [Prunus dulcis]
Length=99

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  189  TASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQ  368
            TASVFCATWDADKPLSWR KYGWTAFCGPVGPTGQ SCG+CL VTNT T A+VTVRIVDQ
Sbjct  1    TASVFCATWDADKPLSWRSKYGWTAFCGPVGPTGQDSCGKCLLVTNTGTGAKVTVRIVDQ  60

Query  369  CSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CSNGGLDLDVNVFNQ+DTNGQG+AQGHL
Sbjct  61   CSNGGLDLDVNVFNQIDTNGQGIAQGHL  88



>ref|XP_006424014.1| hypothetical protein CICLE_v10029327mg [Citrus clementina]
 gb|ESR37254.1| hypothetical protein CICLE_v10029327mg [Citrus clementina]
Length=193

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP+   WD    S +C+TWDA+KPLSWR+KYGWTAFCGPVGP GQASCG+C
Sbjct  76   NVRATYHFYNPEQNGWDLNAVSAYCSTWDANKPLSWRRKYGWTAFCGPVGPRGQASCGKC  135

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTN AT AQ TVRIVDQCSNGGLDLD  VF QLDT+ +G AQGHL
Sbjct  136  LRVTNRATRAQATVRIVDQCSNGGLDLDAGVFRQLDTDRRGNAQGHL  182



>gb|KDP23668.1| hypothetical protein JCGZ_23501 [Jatropha curcas]
Length=149

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    WD    S FC+TWDA KPL+WRQKYGWTAFCGPVGP GQA+
Sbjct  24   QSASNVRATYHYYNPAQNGWDLNAVSAFCSTWDAGKPLAWRQKYGWTAFCGPVGPRGQAA  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQVT RIVDQCSNGGLDLD   VF  LDT+G G  QGHL
Sbjct  84   CGKCLRVTNTRTGAQVTARIVDQCSNGGLDLDYEGVFRPLDTDGNGYNQGHL  135



>ref|XP_010042121.1| PREDICTED: pathogenesis-related protein PR-4-like [Eucalyptus 
grandis]
Length=141

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NV ATYN+YNP+  +WD      FC+TWDA  PL+WR++YGWTAFCGPVGP G+AS
Sbjct  22   QSASNVLATYNDYNPEQNHWDLNAVHAFCSTWDASMPLAWREEYGWTAFCGPVGPHGEAS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTNT T AQ TVRI+DQCSNGGLDLD  VF  LDT+G G AQG+L
Sbjct  82   CGQCLSVTNTRTGAQATVRIIDQCSNGGLDLDAGVFQALDTDGSGNAQGYL  132



>ref|XP_004139240.1| PREDICTED: wound-induced protein WIN1-like [Cucumis sativus]
Length=143

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QS +NVRAT+N YN   INWD    S FC+TWDA++PL WR +YGWTAFCGP+GP GQ S
Sbjct  24   QSGSNVRATFNLYNAPQINWDLNAVSAFCSTWDANQPLEWRSQYGWTAFCGPLGPLGQHS  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG CL VTN  T AQ TVRIVDQCSNGGLDLDV VF  LDT+G G+A G LT
Sbjct  84   CGLCLLVTNVQTGAQQTVRIVDQCSNGGLDLDVGVFQSLDTDGNGIANGFLT  135



>gb|KFK37885.1| hypothetical protein AALP_AA3G041900 [Arabis alpina]
Length=141

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVR+TY+ YNP   NWD    S +C+TWD ++PL WRQ+YGWTAFCGPVGP G+ SCGR
Sbjct  25   SNVRSTYHIYNPAQNNWDLYRVSAYCSTWDGNQPLEWRQRYGWTAFCGPVGPRGRDSCGR  84

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CLRVTNT T +Q TVRIVDQCSNGGLDL+  VF QLDTNGQG+A+GHL
Sbjct  85   CLRVTNTGTGSQATVRIVDQCSNGGLDLEEGVFRQLDTNGQGIARGHL  132



>gb|AGV54773.1| pro-hevein [Phaseolus vulgaris]
Length=203

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NVRATY+ Y P+   WD    S +C+TWDA K  +WR KYGWTAFCGPVGPTG+ SC
Sbjct  67   SASNVRATYHYYQPEQHGWDLNAVSAYCSTWDAGKSYAWRSKYGWTAFCGPVGPTGRDSC  126

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            GRCLRVTNT T AQ TVRIVDQCSNGGLDLDV VFN+LDTNGQG  +GHL
Sbjct  127  GRCLRVTNTGTGAQTTVRIVDQCSNGGLDLDVGVFNRLDTNGQGYQRGHL  176



>ref|XP_007147175.1| hypothetical protein PHAVU_006G102200g [Phaseolus vulgaris]
 gb|ESW19169.1| hypothetical protein PHAVU_006G102200g [Phaseolus vulgaris]
Length=197

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NVRATY+ Y P+   WD    S +C+TWDA K  +WR KYGWTAFCGPVGPTG+ SC
Sbjct  67   SASNVRATYHYYQPEQHGWDLNAVSAYCSTWDAGKSYAWRSKYGWTAFCGPVGPTGRDSC  126

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            GRCLRVTNT T AQ TVRIVDQCSNGGLDLDV VFN+LDTNGQG  +GHL
Sbjct  127  GRCLRVTNTGTGAQTTVRIVDQCSNGGLDLDVGVFNRLDTNGQGYQRGHL  176



>ref|XP_004230091.1| PREDICTED: wound-induced protein WIN2 [Solanum lycopersicum]
Length=212

 Score =   152 bits (385),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  135  VRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            VRATY+ YNPQN+ WD    S +C+TWDA+KP SWR KYGWTAFCGPVGP G+ SCG+CL
Sbjct  83   VRATYHIYNPQNVGWDLNAVSAYCSTWDANKPYSWRSKYGWTAFCGPVGPRGRDSCGKCL  142

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            RVTNT T AQ TVRIVDQCSNGGLDLD+NVF Q+DT+G G  QGHL
Sbjct  143  RVTNTRTGAQTTVRIVDQCSNGGLDLDINVFRQIDTDGVGNQQGHL  188



>ref|XP_010043257.1| PREDICTED: barwin-like [Eucalyptus grandis]
 gb|KCW85276.1| hypothetical protein EUGRSUZ_B02122 [Eucalyptus grandis]
Length=144

 Score =   150 bits (379),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    W+    S +CATWDA+KPL+WR+KYGWTAFCGPVGP GQ +
Sbjct  22   QSASNVRATYHYYNPDQNGWNLNAVSAYCATWDANKPLAWRKKYGWTAFCGPVGPRGQEA  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CG+CLR+TNT TNAQ+T RIVDQCSNGGLDLD N +F  LDT+G G  QGHLT
Sbjct  82   CGKCLRITNTRTNAQITARIVDQCSNGGLDLDYNTIFRPLDTDGNGYNQGHLT  134



>ref|XP_002319077.1| class 4 pathogenesis-related family protein [Populus trichocarpa]
 gb|ABK95810.1| unknown [Populus trichocarpa]
 gb|EEE95000.1| class 4 pathogenesis-related family protein [Populus trichocarpa]
Length=196

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP    WD    S +C+TWDA+KPL+WR+KYGWTAFCGPVGP GQASCG+C
Sbjct  79   NVRATYHYYNPDQNGWDLNAVSAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQASCGKC  138

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNT T AQVTVRIVDQCSNGGLDLD  VF Q+DT+G+G AQGHL
Sbjct  139  LRVTNTGTGAQVTVRIVDQCSNGGLDLDAGVFRQIDTDGRGNAQGHL  185



>gb|KGN60798.1| hypothetical protein Csa_2G010340 [Cucumis sativus]
Length=124

 Score =   149 bits (376),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QS +NVRAT+N YN   INWD    S FC+TWDA++PL WR +YGWTAFCGP+GP GQ S
Sbjct  5    QSGSNVRATFNLYNAPQINWDLNAVSAFCSTWDANQPLEWRSQYGWTAFCGPLGPLGQHS  64

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG CL VTN  T AQ TVRIVDQCSNGGLDLDV VF  LDT+G G+A G LT
Sbjct  65   CGLCLLVTNVQTGAQQTVRIVDQCSNGGLDLDVGVFQSLDTDGNGIANGFLT  116



>gb|AAB49688.1| wound-induced protein [Solanum lycopersicum]
Length=201

 Score =   152 bits (383),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +3

Query  135  VRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            VRATY+ YNPQN+ WD    S +C+TWDA+KP SWR KYGWTAFCGPVGP G+ SCG+CL
Sbjct  72   VRATYHIYNPQNVGWDLNAVSAYCSTWDANKPYSWRSKYGWTAFCGPVGPRGRDSCGKCL  131

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            RVTNT T AQ TVRIVDQCSNGGLDLD+NVF Q+DT+G G  QGHL
Sbjct  132  RVTNTRTGAQTTVRIVDQCSNGGLDLDINVFRQIDTDGVGNQQGHL  177



>gb|EMT08280.1| Pathogenesis-related protein PR-4B [Aegilops tauschii]
Length=157

 Score =   150 bits (379),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+ V ATYN YNP+ INWD R ASVFCATWDAD PL+ RQ+YGWTAFCGP G  GQ S
Sbjct  36   QQASGVAATYNLYNPEKINWDLRAASVFCATWDADMPLAGRQRYGWTAFCGPAGAHGQPS  95

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCL+VTN AT A+   R+VDQC+NGGLDL   VF Q+DT+  G A GHL 
Sbjct  96   CGRCLQVTNRATGARTVARVVDQCANGGLDLGAAVFQQIDTDRGGAANGHLV  147



>ref|XP_002884463.1| PR4-type protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60722.1| PR4-type protein [Arabidopsis lyrata subsp. lyrata]
Length=141

 Score =   149 bits (377),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ YNP   NWD    S +C+TWD ++PL WRQ+YGWTAFCGPVGP G+ SCGRC
Sbjct  26   NVRATYHIYNPAQNNWDLYRVSAYCSTWDGNQPLEWRQRYGWTAFCGPVGPRGRDSCGRC  85

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNTAT  Q TVRIVDQCSNGGLDLD  VF QLDTNGQG A+GHL
Sbjct  86   LRVTNTATGTQATVRIVDQCSNGGLDLDEGVFRQLDTNGQGNARGHL  132



>ref|XP_009402990.1| PREDICTED: pathogenesis-related protein PR-4-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score =   149 bits (377),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ Y P   NWD    S +CATWDA+KPL+WR+KYGWTAFCGPVGPTG+ SCG+C
Sbjct  28   NVRATYHYYYPAQNNWDLNRVSAYCATWDANKPLAWRKKYGWTAFCGPVGPTGRDSCGKC  87

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTN AT  Q TVRIVDQC+NGGLDLD  VF+QLDT+G G  QGHL
Sbjct  88   LRVTNKATGTQATVRIVDQCANGGLDLDQGVFSQLDTDGGGYKQGHL  134



>ref|XP_010278163.1| PREDICTED: pathogenesis-related protein PR-4-like [Nelumbo nucifera]
Length=148

 Score =   149 bits (377),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NV A+Y+ Y P+   WD    S +C+TWDADKPLSWR KYGWTAFCGPVGPT Q +
Sbjct  27   QSASNVYASYHYYQPEQHAWDLNAVSAYCSTWDADKPLSWRSKYGWTAFCGPVGPTAQDA  86

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTNTAT+AQ TVRIVDQC NGGLDLD  VF QLDT+G G  QGHLT
Sbjct  87   CGKCLLVTNTATDAQATVRIVDQCGNGGLDLDWGVFQQLDTDGNGYNQGHLT  138



>ref|XP_006663016.1| PREDICTED: pathogenesis-related protein PR-4A-like [Oryza brachyantha]
Length=148

 Score =   149 bits (377),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  135  VRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            V AT+N YNP +I WD R  S FC+TWDAD PL+WRQ+YGWTAFCGP G  G+ SCGRCL
Sbjct  32   VVATFNMYNPGSIGWDLRAVSAFCSTWDADMPLAWRQRYGWTAFCGPAGAHGEPSCGRCL  91

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            +VTNTAT A+   R+VDQCSNGGLDLDV VF Q+DT+G G+A GHL 
Sbjct  92   QVTNTATGARTVARVVDQCSNGGLDLDVAVFRQIDTDGGGMANGHLV  138



>ref|XP_003554709.1| PREDICTED: wound-induced protein WIN2-like [Glycine max]
Length=194

 Score =   151 bits (381),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+NY P+   WD    S +C+TWDA KP SWR KYGWTAFCGPVGP G+ +
Sbjct  73   ESASNVRATYHNYLPEQHGWDLNAVSAYCSTWDAAKPYSWRSKYGWTAFCGPVGPRGRDA  132

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T A + VRIVDQCSNGGLDLDV VFN++DT+G+G  QGHL
Sbjct  133  CGKCLRVTNTGTGANIIVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHL  183



>gb|AFP66573.1| pathogenesis response protein PR [Citrus sinensis]
Length=143

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ Y+P+ I WD   AS FCATWDA KPL+WRQKYGWTAFC   GP GQA+CGRC
Sbjct  26   NVRATYHLYHPEQIGWDLTAASAFCATWDASKPLAWRQKYGWTAFCHSGGPIGQAACGRC  85

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            LR  N+ T AQ  VRIVDQC+NGGLDLD  VF +LDTNG G  QG LT
Sbjct  86   LRAANSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLT  133



>ref|XP_004156469.1| PREDICTED: wound-induced protein WIN1-like [Cucumis sativus]
Length=143

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QS +NVRAT+N YN   INWD    S FC+TWDA++PL WR +YGWTAFCGP+GP GQ S
Sbjct  24   QSGSNVRATFNLYNAPQINWDLNAVSAFCSTWDANQPLEWRSQYGWTAFCGPLGPLGQHS  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG CL VTN  T AQ TVRIVDQCSNGGLDLDV VF  LDT+G G+A G L
Sbjct  84   CGLCLLVTNVQTGAQQTVRIVDQCSNGGLDLDVGVFQSLDTDGNGIANGFL  134



>gb|ACU14858.1| unknown [Glycine max]
Length=204

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ Y P+   WD    S +C+TWDA KP SWR KYGWTAFCGPVGP G+ S
Sbjct  68   ESASNVRATYHYYEPEQHGWDLNAVSAYCSTWDASKPYSWRSKYGWTAFCGPVGPRGRDS  127

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T A   VRIVDQCSNGGLDLDV VFN++DT+G+G  QGHL
Sbjct  128  CGKCLRVTNTGTGANTIVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHL  178



>gb|AFX67005.1| wound-induced protein WIN2 [Solanum tuberosum]
Length=211

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA NVRATY+ YNPQN+ WD    S +C+TWDA+KP +WR KYGWTAFCGPVGP G+ SC
Sbjct  78   SAQNVRATYHIYNPQNVGWDLNAVSAYCSTWDANKPYAWRSKYGWTAFCGPVGPRGRDSC  137

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T AQ TVRIVDQ SNGGLDLD+NVF Q+DT+G G  QGHL
Sbjct  138  GKCLRVTNTRTGAQTTVRIVDQYSNGGLDLDINVFRQIDTDGVGNQQGHL  187



>ref|XP_006424016.1| hypothetical protein CICLE_v10029528mg [Citrus clementina]
 gb|ESR37256.1| hypothetical protein CICLE_v10029528mg [Citrus clementina]
 gb|AHL84104.1| pathogenesis response protein [Citrus reticulata]
 gb|KDO54389.1| hypothetical protein CISIN_1g032285mg [Citrus sinensis]
Length=143

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ Y+P+ I WD   AS FCATWDA+KPL+WRQKYGWTAFC   GP GQA+CGRC
Sbjct  26   NVRATYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRC  85

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            LRVTN+ T AQ  VRIVDQC+NGGLDLD  VF +LDTNG G  QG LT
Sbjct  86   LRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLT  133



>ref|NP_001130495.1| uncharacterized protein LOC100191593 precursor [Zea mays]
 gb|ACF78729.1| unknown [Zea mays]
 gb|ACF84998.1| unknown [Zea mays]
 gb|AFW60486.1| hypothetical protein ZEAMMB73_991757 [Zea mays]
Length=149

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            + VRATYN YNPQ  NWD    S +CATWDA KPLSWR KYGWTAFCGP GPTGQA+CG+
Sbjct  29   SGVRATYNFYNPQQNNWDLNAVSAYCATWDASKPLSWRMKYGWTAFCGPAGPTGQAACGQ  88

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CL VTNTAT A +TVRIVDQCSNGGLDLD +  F  +DTNGQG   GHLT
Sbjct  89   CLLVTNTATGASITVRIVDQCSNGGLDLDYDTAFKPIDTNGQGFQAGHLT  138



>ref|XP_003554704.1| PREDICTED: pro-hevein [Glycine max]
Length=211

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ Y P+   WD    S +C+TWDA KP SWR KYGWTAFCGPVGP G+ S
Sbjct  75   ESASNVRATYHYYEPEQHGWDLNAVSAYCSTWDASKPYSWRSKYGWTAFCGPVGPRGRDS  134

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T A   VRIVDQCSNGGLDLDV VFN++DT+G+G  QGHL
Sbjct  135  CGKCLRVTNTGTGANTIVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHL  185



>ref|XP_008678014.1| PREDICTED: barwin-like [Zea mays]
 gb|ACF84916.1| unknown [Zea mays]
 gb|ACG40412.1| win2 precursor [Zea mays]
 gb|AFW60487.1| Win2 [Zea mays]
Length=150

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            + VRATYN YNPQ  NWD    S +CATWDA KPLSWR KYGWTAFCGP GPTGQA+CG+
Sbjct  30   SGVRATYNFYNPQQNNWDLNAVSAYCATWDASKPLSWRMKYGWTAFCGPAGPTGQAACGQ  89

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CL VTNTAT A +TVRIVDQCSNGGLDLD +  F  +DTNGQG   GHLT
Sbjct  90   CLLVTNTATGASITVRIVDQCSNGGLDLDYDTAFKPIDTNGQGFQAGHLT  139



>emb|CAA05978.1| prohevein [Hevea brasiliensis]
Length=187

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NV ATY+ YN Q+  WD   AS +C+TWDA+KP SWR KYGWTAFCGPVG  GQ SC
Sbjct  52   SASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQPSC  111

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            G+CL VTNT T A+ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHLT
Sbjct  112  GKCLSVTNTGTGAKATVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHLT  162



>gb|KEH24556.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=202

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ Y P    WD    S +C+TWDA KP SWR KYGWTAFCGPVGP GQASCG+C
Sbjct  69   NVRATYHYYQPDQHGWDLNAVSAYCSTWDASKPYSWRSKYGWTAFCGPVGPRGQASCGKC  128

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTN+ T AQ TVRIVDQCSNGGLDLDV VFN++DT+G+G  QGHL
Sbjct  129  LRVTNSGTGAQETVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHL  175



>sp|P02877.2|HEVE_HEVBR RecName: Full=Pro-hevein; AltName: Full=Major hevein; Contains: 
RecName: Full=Hevein; AltName: Allergen=Hev b 6; Contains: 
RecName: Full=Win-like protein; Flags: Precursor [Hevea brasiliensis]
 gb|AAA33357.1| hevein (HEV1) precursor [Hevea brasiliensis]
Length=204

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NV ATY+ YN Q+  WD   AS +C+TWDA+KP SWR KYGWTAFCGPVG  GQ+SC
Sbjct  69   SASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSC  128

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            G+CL VTNT T A+ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GH+T
Sbjct  129  GKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHIT  179



>gb|AFK37675.1| unknown [Medicago truncatula]
Length=202

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ Y P    WD    S +C+TWDA KP SWR KYGWTAFCGPVGP GQASCG+C
Sbjct  69   NVRATYHYYQPDQHGWDLNAVSAYCSTWDASKPYSWRSKYGWTAFCGPVGPRGQASCGKC  128

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTN+ T AQ TVRIVDQCSNGGLDLDV VFN++DT+G+G  QGHL
Sbjct  129  LRVTNSGTGAQETVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHL  175



>gb|AAO63574.1| HEV2.2 [Hevea brasiliensis]
 gb|ABW34946.1| hevein [Hevea brasiliensis]
Length=204

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NV ATY+ YN Q+  WD   AS +C+TWDA+KP SWR KYGWTAFCGPVG  GQ SC
Sbjct  69   SASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQPSC  128

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            G+CL VTNT T A+ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHLT
Sbjct  129  GKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHLT  179



>gb|AAO63573.1| HEV2.1 [Hevea brasiliensis]
Length=204

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA+NV ATY+ YN Q+  WD   AS +C+TWDA+KP SWR KYGWTAFCGPVG  GQ SC
Sbjct  69   SASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQPSC  128

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            G+CL VTNT T A+ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHLT
Sbjct  129  GKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHLT  179



>gb|EAY81551.1| hypothetical protein OsI_36717 [Oryza sativa Indica Group]
Length=146

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+NVRATY+ YNPQ  NWD    S +CATWDA+KPLSWRQKYGWTAFCGP GP G+ S
Sbjct  26   QEASNVRATYHYYNPQQNNWDLNKVSAYCATWDANKPLSWRQKYGWTAFCGPAGPRGRDS  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+C++V N  T A +  RIVDQCSNGGLDLD   +F ++DT+G+G   GHL
Sbjct  86   CGKCIQVKNRGTGATIIARIVDQCSNGGLDLDYETIFKKIDTDGRGYQMGHL  137



>ref|XP_010524917.1| PREDICTED: pathogenesis-related protein PR-4-like [Tarenaya hassleriana]
Length=143

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA++VRATY+ YNP    WD    S FC+TWD ++PL WR++YGWTAFCGP GP G+ +
Sbjct  24   QSASSVRATYHFYNPAQNGWDLFRVSAFCSTWDGNQPLEWRRRYGWTAFCGPAGPRGRDA  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T AQ TVRIVDQCSNGGLDLD  VF QLDT+GQG A+GHL
Sbjct  84   CGRCLRVTNTGTGAQATVRIVDQCSNGGLDLDEGVFRQLDTDGQGYARGHL  134



>gb|AAO63572.1| HEV1.2 [Hevea brasiliensis]
Length=206

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            A+NV ATY+ YNPQ   WD    S +C+TWDA+KP SWR KYGWTAFCGPVG  GQ SCG
Sbjct  72   ASNVLATYHLYNPQQHGWDLNAVSAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQPSCG  131

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            +CL VTNT T A+ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHLT
Sbjct  132  KCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHLT  181



>gb|AAR97870.1| proteinase inhibitor [Capsicum annuum]
Length=103

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  171  INWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvt  350
            INWD RTAS +CATWDADKPL WRQ+YGWTAFCGP GPTGQA+CG CLRVTNT T  Q T
Sbjct  1    INWDLRTASAYCATWDADKPLEWRQRYGWTAFCGPAGPTGQAACGICLRVTNTGTGTQAT  60

Query  351  vRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            VRIVDQC NGGLDLDVNVFNQLDT+ +G  QGHL
Sbjct  61   VRIVDQCXNGGLDLDVNVFNQLDTDRRGYQQGHL  94



>gb|AAO63571.1| HEV1.1 [Hevea brasiliensis]
Length=204

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            + A +VRATY+ YNPQ+  WD    S +C+TWDA+KP SWR KYGWTAFCGPVG  GQ S
Sbjct  68   EIAYDVRATYHLYNPQDHGWDLNAVSAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQPS  127

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTNT T A+ TVR+VDQCSNGGLDLDVNVF QLDT+G+G  +GHLT
Sbjct  128  CGKCLSVTNTGTGAKTTVRVVDQCSNGGLDLDVNVFRQLDTDGKGYERGHLT  179



>ref|XP_010485856.1| PREDICTED: pathogenesis-related protein PR-4-like [Camelina sativa]
Length=142

 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            +VRATY+ YNP   NWD    S +C+TWD ++PL WRQ+YGWTAFCGPVGPTG  SCG+C
Sbjct  27   SVRATYHFYNPAQNNWDLYRVSAYCSTWDGNQPLEWRQRYGWTAFCGPVGPTGGDSCGKC  86

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNTAT AQ TVRIVDQCSNGGLDLD  VF QLDT+GQG A+GHL
Sbjct  87   LRVTNTATRAQATVRIVDQCSNGGLDLDDGVFKQLDTDGQGYARGHL  133



>gb|ADT91689.1| hevein-1 [Nicotiana attenuata]
Length=126

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  144  TYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCLRvt  323
            TY+ YNPQN+ WD    S +C+TWD +KPL+WR+KYGWTAFCGPVGP G+ SCG+CLRVT
Sbjct  1    TYHIYNPQNVGWDLYAVSAYCSTWDGNKPLAWRRKYGWTAFCGPVGPRGRDSCGKCLRVT  60

Query  324  ntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            NT T AQ TVRIVDQCSNGGLDLDVNVF QLDT+G+G  +GHL
Sbjct  61   NTGTGAQTTVRIVDQCSNGGLDLDVNVFRQLDTDGRGNQRGHL  103



>gb|AGT16000.1| hypothetical protein SHCRBa_135_C14_R_40 [Saccharum hybrid cultivar 
R570]
 gb|AGT17441.1| vacuolar defense protein [Saccharum hybrid cultivar R570]
Length=146

 Score =   147 bits (371),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNPQ  NW+    S +CATWDADKP SWRQ+YGWTAFCGP+GP GQA+CG+
Sbjct  29   SNVRATYHLYNPQQNNWNLNAVSAYCATWDADKPASWRQQYGWTAFCGPLGPRGQAACGK  88

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN  T A  T RIVDQCSNGGLDLD   VF ++DT+G+G   GHL
Sbjct  89   CIRVTNRETGASTTARIVDQCSNGGLDLDFETVFKKIDTDGRGYQMGHL  137



>ref|XP_007147176.1| hypothetical protein PHAVU_006G102300g [Phaseolus vulgaris]
 gb|ESW19170.1| hypothetical protein PHAVU_006G102300g [Phaseolus vulgaris]
Length=147

 Score =   147 bits (371),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ Y P+  NWD    S +C+TWDA K L+WR KY WTAFCGP GP GQ S
Sbjct  26   QSASNVRATYHLYQPEQHNWDLLAVSAYCSTWDAGKSLAWRSKYPWTAFCGPSGPRGQES  85

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CLRVTNT TNAQ+TVRIVDQC NGGLDLD++ F ++DT+G G AQGHLT
Sbjct  86   CGKCLRVTNTRTNAQITVRIVDQCRNGGLDLDISPFQKIDTDGNGYAQGHLT  137



>emb|CDY40673.1| BnaC03g33890D [Brassica napus]
Length=141

 Score =   147 bits (370),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NVRATY+ YNP    WD    S +C+TWD ++PL WRQ+YGWTAFCGP GP G+ S
Sbjct  22   QSANNVRATYHFYNPAQNGWDLYRVSAYCSTWDGNQPLEWRQRYGWTAFCGPAGPRGRDS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+GQG A+G+L
Sbjct  82   CGRCLRVTNTGTQAQATVRIVDQCSNGGLDLDEAVFKQIDTDGQGYARGNL  132



>ref|XP_002449771.1| hypothetical protein SORBIDRAFT_05g022950 [Sorghum bicolor]
 gb|EES08759.1| hypothetical protein SORBIDRAFT_05g022950 [Sorghum bicolor]
Length=151

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNPQ  NW+    S +CATWDA KP SWRQ+YGWTAFCGP GPTGQA+CGR
Sbjct  34   SNVRATYHLYNPQQNNWNLNAVSAYCATWDAGKPASWRQQYGWTAFCGPSGPTGQAACGR  93

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN  T A  T RIVDQCSNGGLDLD   VF ++DT+G+G   GHL
Sbjct  94   CIRVTNRGTGASTTARIVDQCSNGGLDLDFETVFKKIDTDGRGYQMGHL  142



>gb|AGT16081.1| hypothetical protein SHCRBa_087_K22_F_230 [Saccharum hybrid cultivar 
R570]
Length=146

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNPQ  NW+    S +CATWDADKP SWRQ+YGWTAFCGP+GP GQA+CG+
Sbjct  29   SNVRATYHLYNPQQNNWNLNAVSAYCATWDADKPASWRQQYGWTAFCGPLGPRGQAACGK  88

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN  T A  T RIVDQCSNGGLDLD   VF ++DT+G+G   GHL
Sbjct  89   CIRVTNRGTGASTTARIVDQCSNGGLDLDFETVFKKIDTDGRGYQMGHL  137



>ref|XP_010042554.1| PREDICTED: barwin-like [Eucalyptus grandis]
Length=144

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    WD    S +C+TWDA KPL+WRQKYGWTAFCGPVGP GQ S
Sbjct  22   QSASNVRATYHYYNPAQNGWDLNAVSAYCSTWDASKPLAWRQKYGWTAFCGPVGPQGQES  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+CLR+TNT TN Q+T RIVDQCSNGGLDLD + +F  LDT+G G  QG+L
Sbjct  82   CGKCLRITNTRTNTQITARIVDQCSNGGLDLDYDTIFRPLDTDGNGYNQGNL  133



>ref|XP_006298770.1| hypothetical protein CARUB_v10014871mg [Capsella rubella]
 gb|EOA31668.1| hypothetical protein CARUB_v10014871mg [Capsella rubella]
Length=141

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q+A+NVRATY+ Y+P+   WD    S +C+TW  + P+ WR+KYGWTAFCGP GP G+ S
Sbjct  22   QTASNVRATYHYYHPEQNGWDLYKVSAYCSTWKGNLPIEWRRKYGWTAFCGPTGPRGRDS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNTAT  Q TVRIVDQCSNGGLDLD  VF +LDTNGQG A+GHL
Sbjct  82   CGRCLRVTNTATGTQATVRIVDQCSNGGLDLDDGVFKRLDTNGQGYARGHL  132



>ref|XP_010278164.1| PREDICTED: pathogenesis-related protein PR-4-like [Nelumbo nucifera]
Length=165

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA NV A+Y+ YNPQ   WD    S +C+TWDA+KP SWR KYGWTAFCGPVGP GQA+
Sbjct  37   QSANNVYASYHYYNPQQNGWDLNAVSAYCSTWDANKPFSWRSKYGWTAFCGPVGPRGQAA  96

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTN  T A+VTVRIVDQC NGGLDLD  VF Q+DT+G G   GHLT
Sbjct  97   CGKCLLVTNVRTGARVTVRIVDQCGNGGLDLDWGVFQQIDTDGSGYNAGHLT  148



>gb|ADO24163.1| class I pathogenesis-related protein 4 [Ficus pumila var. awkeotsang]
Length=205

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA N+RATY+ YNP+   WD    S +C+TWDA KP SWR KYGWTAFCGP GPTGQASC
Sbjct  70   SANNIRATYHYYNPEQNGWDLNAVSAYCSTWDAGKPYSWRSKYGWTAFCGPAGPTGQASC  129

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T AQ+TVRIVDQCSNGGLDLD N  F +LDT+G+G  QGHL
Sbjct  130  GKCLRVTNTYTQAQLTVRIVDQCSNGGLDLDYNTAFRKLDTDGRGYQQGHL  180



>ref|XP_004302058.1| PREDICTED: pathogenesis-related protein PR-4B-like [Fragaria 
vesca subsp. vesca]
Length=145

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVR+TY+ YNPQ+ NWD      FCAT+D D+P  WR +YGWTAFCGP GP G  +
Sbjct  24   QSASNVRSTYHLYNPQDNNWDLLAVGAFCATFDEDQPFEWRSRYGWTAFCGPNGPQGADA  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CG+CL VTN  T AQ TVRI+DQC+NGGLDLDVNVFN++DT+G+G AQG L 
Sbjct  84   CGKCLLVTNMGTGAQETVRIIDQCNNGGLDLDVNVFNEIDTDGRGYAQGDLV  135



>gb|KDP23670.1| hypothetical protein JCGZ_23503 [Jatropha curcas]
Length=167

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ +NP    WD    S +CA WDADKPL+WRQKYGWTAFCGPVGP GQA+
Sbjct  24   QSASNVRATYHYFNPAQNGWDLNAVSAYCAPWDADKPLAWRQKYGWTAFCGPVGPQGQAA  83

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+CLR+TN  T A+VTVRIVDQCSNGGLDLD   VF  LDT+G+G  +G+L
Sbjct  84   CGKCLRLTNAETGAEVTVRIVDQCSNGGLDLDYEGVFRPLDTDGRGYNRGNL  135



>ref|XP_009134783.1| PREDICTED: pathogenesis-related protein PR-4-like [Brassica rapa]
 emb|CDX74171.1| BnaA03g28760D [Brassica napus]
Length=141

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q+A+NVRATY+ Y PQ   WD    S +C+TW  ++PL WR+KYGWTAFCGPVGP G+ S
Sbjct  22   QTASNVRATYHYYYPQQNGWDLYKVSAYCSTWKGNQPLEWRRKYGWTAFCGPVGPRGRDS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNTAT AQ TVRIVDQCSNGGLDLD  VF QLDTNG+G A+G++
Sbjct  82   CGRCLRVTNTATGAQATVRIVDQCSNGGLDLDDGVFKQLDTNGRGYARGNM  132



>ref|XP_006408161.1| hypothetical protein EUTSA_v10021723mg [Eutrema salsugineum]
 gb|ESQ49614.1| hypothetical protein EUTSA_v10021723mg [Eutrema salsugineum]
Length=141

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSATNVR+TY+ YNP    WD    S +C+TWD ++ L WRQ+YGWTAFCGPVGP G+ S
Sbjct  22   QSATNVRSTYHFYNPAQNGWDLYRVSAYCSTWDGNQSLEWRQRYGWTAFCGPVGPRGRDS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNTAT  Q TVRIVDQC+NGGLDLD  VF QLDTNG G A+G+L
Sbjct  82   CGRCLRVTNTATGTQATVRIVDQCNNGGLDLDEGVFRQLDTNGMGYARGNL  132



>ref|XP_004979595.1| PREDICTED: wheatwin-2-like [Setaria italica]
Length=153

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            + VRATYN Y PQNINWD   AS +CATWDA K  +WR KYGWTAFCGP GPTGQASCG+
Sbjct  32   SGVRATYNYYRPQNINWDLNAASAYCATWDAGKSYAWRSKYGWTAFCGPAGPTGQASCGQ  91

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CL VTN+AT A  TVRIVDQCSNGGLDLD +  F+++D NGQGV  GHLT
Sbjct  92   CLLVTNSATGASTTVRIVDQCSNGGLDLDYDTAFSKID-NGQGVNDGHLT  140



>ref|XP_009402992.1| PREDICTED: pathogenesis-related protein PR-4-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NVRATY+ Y P   NWD    S +CATWDA+KPL WR+KYGWTAFCGPVGPTG+ +CG+C
Sbjct  28   NVRATYHYYYPAQNNWDLNRVSAYCATWDANKPLEWRKKYGWTAFCGPVGPTGRDACGKC  87

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            LRVTNTAT  Q TVRIVDQC+NGGLDLD  VF+QLDT+G G  +GHL
Sbjct  88   LRVTNTATGTQATVRIVDQCANGGLDLDQGVFSQLDTDGGGYNRGHL  134



>gb|AGT17287.1| hypothetical protein SHCRBa_160_O06_R_40 [Saccharum hybrid cultivar 
R570]
Length=146

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNPQ  NW+    S +CATWDADKP SWRQ+YGWTAFCGP GP GQA+CG+
Sbjct  29   SNVRATYHLYNPQQNNWNLNAVSAYCATWDADKPASWRQQYGWTAFCGPSGPRGQAACGK  88

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN  T A  T RIVDQCSNGGLDLD   VF ++DT+G+G   GHL
Sbjct  89   CIRVTNRGTGASTTARIVDQCSNGGLDLDFETVFKKIDTDGRGYQMGHL  137



>ref|XP_003536124.1| PREDICTED: pathogenesis-related protein PR-4B-like [Glycine max]
 gb|KHN22080.1| Wound-induced protein WIN1 [Glycine soja]
Length=141

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA  V++TY+ Y P+  NWD    S +CATWDA++P SWR KYGWTAFCGP GP GQ S
Sbjct  21   QSAI-VQSTYHLYQPEQHNWDLLAVSAYCATWDANQPFSWRSKYGWTAFCGPAGPQGQPS  79

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T  Q   RIVDQC NGGLDLDV+VF +LD++G G AQGHL
Sbjct  80   CGRCLRVTNTRTGDQQIARIVDQCKNGGLDLDVSVFQRLDSDGSGNAQGHL  130



>ref|XP_010043258.1| PREDICTED: barwin-like [Eucalyptus grandis]
 gb|KCW85278.1| hypothetical protein EUGRSUZ_B02124 [Eucalyptus grandis]
Length=144

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    WD    S +C+TWDA KPL+WRQKYGWTAFCGPVGP GQ S
Sbjct  22   QSASNVRATYHYYNPAQNGWDLNAVSAYCSTWDASKPLAWRQKYGWTAFCGPVGPQGQES  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+CLR+TNT TN Q+T RIVDQCSNGGLDLD + +F  LDT+G G  QG+L
Sbjct  82   CGKCLRITNTRTNTQITARIVDQCSNGGLDLDYDTIFRPLDTDGIGYNQGNL  133



>ref|XP_010027182.1| PREDICTED: wound-induced protein WIN1-like [Eucalyptus grandis]
 gb|KCW61591.1| hypothetical protein EUGRSUZ_H04325 [Eucalyptus grandis]
Length=134

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            NV+ATY+ Y P++  WD      +C+TWDA+KPL+WR+KYGWT+FCGP GP GQASCGRC
Sbjct  18   NVKATYHYYYPEHSGWDLNAQHAYCSTWDANKPLAWRKKYGWTSFCGPFGPRGQASCGRC  77

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            LRVTNT T AQ TVRI+DQCSNGGLDLD  VF +LDT+G G AQGHL 
Sbjct  78   LRVTNTRTGAQATVRIIDQCSNGGLDLDAGVFCRLDTDGNGNAQGHLV  125



>ref|XP_002449772.1| hypothetical protein SORBIDRAFT_05g022960 [Sorghum bicolor]
 gb|EES08760.1| hypothetical protein SORBIDRAFT_05g022960 [Sorghum bicolor]
Length=151

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNPQ  NW+    S +C+TWDA KPL+WRQKYGWTAFCGP G  GQA+CG+
Sbjct  34   SNVRATYHYYNPQQNNWNLNAVSAYCSTWDAGKPLAWRQKYGWTAFCGPAGQKGQAACGK  93

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN AT A +T RIVDQCSNGGLDLD   VF ++DTNGQG   GHL
Sbjct  94   CIRVTNRATGAAITARIVDQCSNGGLDLDYETVFKKIDTNGQGYQMGHL  142



>ref|XP_007030564.1| Pathogenesis-related protein PR-4B [Theobroma cacao]
 gb|EOY11066.1| Pathogenesis-related protein PR-4B [Theobroma cacao]
Length=207

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +3

Query  135  VRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            V +TY+ YNP+   WD    S +C+TWDA KP SWR KYGWTAFCGPVGPT  A+CGRCL
Sbjct  76   VTSTYHFYNPEQHGWDLMAVSAYCSTWDASKPFSWRSKYGWTAFCGPVGPTFPAACGRCL  135

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            RVTNT TNAQ  VRIVD+CSNGGLDLDV VFN+LDT+G G AQGHLT
Sbjct  136  RVTNTRTNAQEIVRIVDRCSNGGLDLDVGVFNRLDTDGVGYAQGHLT  182



>ref|XP_008678011.1| PREDICTED: barwin-like [Zea mays]
 ref|XP_008678012.1| PREDICTED: barwin-like [Zea mays]
 ref|XP_008678013.1| PREDICTED: barwin-like [Zea mays]
 gb|ACG24145.1| win1 precursor [Zea mays]
 gb|AFW60481.1| win1 isoform 1 [Zea mays]
 gb|AFW60482.1| win1 isoform 2 [Zea mays]
 gb|AFW60483.1| win1 isoform 3 [Zea mays]
Length=152

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNP    WD    S +CATWDADKPLSWRQK+GWTAFCGP G  GQA+CG+
Sbjct  35   SNVRATYHLYNPAQNGWDLNRVSAYCATWDADKPLSWRQKHGWTAFCGPAGQKGQAACGK  94

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RV N AT A +  RIVDQCSNGGLDLD   VF ++DTNGQG   GHL
Sbjct  95   CIRVKNRATGASIVARIVDQCSNGGLDLDYETVFKKIDTNGQGYQMGHL  143



>ref|XP_007144830.1| hypothetical protein PHAVU_007G187700g [Phaseolus vulgaris]
 gb|ESW16824.1| hypothetical protein PHAVU_007G187700g [Phaseolus vulgaris]
Length=141

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA  V +TY+ Y P+  NWD    S +CATWDA++P SWR KYGWTAFCGP GP G+AS
Sbjct  21   QSAV-VESTYHLYQPEQHNWDLLAVSAYCATWDANQPFSWRSKYGWTAFCGPEGPQGEAS  79

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T  +   RIVDQC NGGLDLDV+VF +LD++G G AQGHL
Sbjct  80   CGKCLRVTNTRTGDEQMARIVDQCQNGGLDLDVSVFQRLDSDGNGNAQGHL  130



>gb|AFW60484.1| win1 [Zea mays]
Length=219

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNP    WD    S +CATWDADKPLSWRQK+GWTAFCGP G  GQA+CG+
Sbjct  102  SNVRATYHLYNPAQNGWDLNRVSAYCATWDADKPLSWRQKHGWTAFCGPAGQKGQAACGK  161

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RV N AT A +  RIVDQCSNGGLDLD   VF ++DTNGQG   GHL
Sbjct  162  CIRVKNRATGASIVARIVDQCSNGGLDLDYETVFKKIDTNGQGYQMGHL  210



>ref|XP_009364594.1| PREDICTED: pathogenesis-related protein PR-4 [Pyrus x bretschneideri]
Length=171

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSAT V +TY+ YNP  IN+D R  S FC+TWDAD+   WR KYGWTAFCGP GP+G+  
Sbjct  51   QSAT-VGSTYHLYNPAQINYDLRAVSAFCSTWDADQSYEWRSKYGWTAFCGPAGPSGEDV  109

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTNT T AQ  VRI+DQCSNGGLDLDVN+FNQ+DT+G G A GHL
Sbjct  110  CGKCLLVTNTGTGAQTVVRIIDQCSNGGLDLDVNMFNQIDTDGSGYASGHL  160



>gb|KDP23669.1| hypothetical protein JCGZ_23502 [Jatropha curcas]
Length=147

 Score =   144 bits (364),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    WD    S +CA  D DKPL+WRQKYGWTAFCGPVGP GQA+
Sbjct  25   QSASNVRATYHYYNPAQNGWDLNAVSAYCAPGDPDKPLAWRQKYGWTAFCGPVGPQGQAA  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T  Q TVRIVDQCSNGGLDLD   VF  LDT+G+G AQG+L
Sbjct  85   CGKCLRVTNTGTGDQQTVRIVDQCSNGGLDLDYEGVFRPLDTDGRGYAQGNL  136



>ref|XP_004495613.1| PREDICTED: pathogenesis-related protein PR-4B-like [Cicer arietinum]
Length=141

 Score =   144 bits (363),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSAT V +T+  Y P+  NWD    S FCATWDAD+PLSWR KY WTAFCGPVGP G  S
Sbjct  21   QSAT-VTSTFQLYQPEQHNWDLLAVSAFCATWDADQPLSWRSKYAWTAFCGPVGPQGPDS  79

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CGRCLRVTNT T      RIVD+C NGGLDLD++VF +LD++G G A+GHL
Sbjct  80   CGRCLRVTNTKTGDNEIARIVDECQNGGLDLDISVFQRLDSDGSGNAEGHL  130



>ref|NP_001068190.1| Os11g0592200 [Oryza sativa Japonica Group]
 gb|AAL11444.1| pathogenesis-related protein [Oryza sativa Japonica Group]
 gb|ABA94532.1| win1 precursor, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF28553.1| Os11g0592200 [Oryza sativa Japonica Group]
 gb|EAZ18946.1| hypothetical protein OsJ_34485 [Oryza sativa Japonica Group]
 dbj|BAH00331.1| unnamed protein product [Oryza sativa Japonica Group]
Length=146

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNPQ  NWD    S +CATWDA+KPLSWRQKYGWTAFCGP GP G+ SCG+
Sbjct  29   SNVRATYHYYNPQQNNWDLNKVSAYCATWDANKPLSWRQKYGWTAFCGPAGPRGRDSCGK  88

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C++V N  T A +  RIVDQCSNGGLDLD   +F ++DT+G+G   GHL
Sbjct  89   CIQVKNRGTGATIIARIVDQCSNGGLDLDYETIFKKIDTDGRGYQMGHL  137



>ref|NP_001068188.1| Os11g0592000 [Oryza sativa Japonica Group]
 gb|ABA94530.1| Barwin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF28551.1| Os11g0592000 [Oryza sativa Japonica Group]
 dbj|BAH00298.1| unnamed protein product [Oryza sativa Japonica Group]
Length=150

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            Q A+NVRATY+ Y P   NWD    +V  +CATWDA+KPLSWRQKYGWTAFCGPVGP GQ
Sbjct  25   QEASNVRATYHYYRPAQNNWDLGAPAVSAYCATWDANKPLSWRQKYGWTAFCGPVGPRGQ  84

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            A+CG+CL VTNTAT AQ+T RIVDQC+NGGLDLD + VF ++DT+GQG  +GHL
Sbjct  85   AACGKCLLVTNTATGAQITARIVDQCANGGLDLDWDTVFTKIDTDGQGYQKGHL  138



>gb|EAY81553.1| hypothetical protein OsI_36719 [Oryza sativa Indica Group]
 gb|EAZ18949.1| hypothetical protein OsJ_34487 [Oryza sativa Japonica Group]
Length=148

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            Q A+NVRATY+ Y P   NWD    +V  +CATWDA+KPLSWRQKYGWTAFCGPVGP GQ
Sbjct  23   QEASNVRATYHYYRPAQNNWDLGAPAVSAYCATWDANKPLSWRQKYGWTAFCGPVGPRGQ  82

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            A+CG+CL VTNTAT AQ+T RIVDQC+NGGLDLD + VF ++DT+GQG  +GHL
Sbjct  83   AACGKCLLVTNTATGAQITARIVDQCANGGLDLDWDTVFTKIDTDGQGYQKGHL  136



>gb|AAN60254.1| unknown [Arabidopsis thaliana]
Length=171

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NVRATY+ YNP   NWD R  S +C+TWDADKP +WR KYGWTAFCGP GP GQAS
Sbjct  72   ESASNVRATYHFYNPAQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQAS  131

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQL  416
            CG+CLRV NT TNA VTVRIVDQCSNGGLDLD+++FNQ+
Sbjct  132  CGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDISMFNQI  170



>ref|XP_010463959.1| PREDICTED: pathogenesis-related protein PR-4-like [Camelina sativa]
 ref|XP_010485855.1| PREDICTED: pathogenesis-related protein PR-4-like [Camelina sativa]
Length=141

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            TNVRATY+ Y P+   WD    S +C+TW  + P+ WR+KYGWTAFCGPVGP G+ SCGR
Sbjct  25   TNVRATYHYYYPEQNGWDLYKVSAYCSTWKGNLPIEWRRKYGWTAFCGPVGPRGRDSCGR  84

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CLRVTNTAT  Q TVRIVDQCSNGGLDLD  VF +LDTNGQG A+GHL
Sbjct  85   CLRVTNTATGTQATVRIVDQCSNGGLDLDDGVFRRLDTNGQGYARGHL  132



>ref|XP_006663017.1| PREDICTED: wheatwin-2-like [Oryza brachyantha]
Length=150

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 89/111 (80%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            +NVRATY+ Y P   NWD    +V  +CATWDADKPL WRQKYGWTAFCGPVGPTGQ +C
Sbjct  28   SNVRATYHYYRPAENNWDLGAPAVSAYCATWDADKPLEWRQKYGWTAFCGPVGPTGQDAC  87

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            GRCL +TNTAT  Q+T RIVDQC+NGGLDLD + VF+Q+DT+GQG   GHL
Sbjct  88   GRCLLITNTATGDQITARIVDQCANGGLDLDWDTVFSQIDTDGQGYQNGHL  138



>ref|XP_010102289.1| hypothetical protein L484_024571 [Morus notabilis]
 gb|EXB93232.1| hypothetical protein L484_024571 [Morus notabilis]
Length=207

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SATNVRATY+ YNP+   WD    S +C+TWDA KP SWR KYGWTAFCGP G  GQASC
Sbjct  74   SATNVRATYHYYNPEQNRWDLNAVSAYCSTWDAGKPYSWRSKYGWTAFCGPAGAHGQASC  133

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            G+CLRVTNT T AQ+TVRIVDQCSNGGLDLD N  F +LDT+G+G  QGHL
Sbjct  134  GKCLRVTNTGTGAQLTVRIVDQCSNGGLDLDYNTAFRKLDTDGRGYQQGHL  184



>gb|EAY81552.1| hypothetical protein OsI_36718 [Oryza sativa Indica Group]
 gb|EAZ18948.1| hypothetical protein OsJ_34486 [Oryza sativa Japonica Group]
Length=149

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            Q A+NVRATY+ Y P   NWD    +V  +CATWDADKPL WRQKYGWTAFCGPVGPTGQ
Sbjct  24   QEASNVRATYHYYRPAENNWDLGAPAVSAYCATWDADKPLEWRQKYGWTAFCGPVGPTGQ  83

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
             +CG+CL VTNTAT  Q+T RIVDQC+NGGLDLD + VF+++D++GQG   GHL
Sbjct  84   DACGKCLSVTNTATGDQITARIVDQCANGGLDLDWDTVFSKIDSDGQGYQNGHL  137



>gb|KFK37884.1| hypothetical protein AALP_AA3G041800 [Arabis alpina]
Length=141

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ Y P+   WD    S +C+TW  + PL WR+KYGWTAFCGPVGP G+ SCGR
Sbjct  25   SNVRATYHYYYPEQNGWDLYKVSAYCSTWKGNLPLEWRRKYGWTAFCGPVGPRGRDSCGR  84

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CLRVTNTAT AQ TVRIVDQCSNGGLDLD  VF Q+DTNGQG A+GHL
Sbjct  85   CLRVTNTATGAQATVRIVDQCSNGGLDLDDGVFRQIDTNGQGYARGHL  132



>ref|NP_001068189.1| Os11g0592100 [Oryza sativa Japonica Group]
 gb|ABA94531.1| Barwin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF28552.1| Os11g0592100 [Oryza sativa Japonica Group]
 dbj|BAG88604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=152

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            Q A+NVRATY+ Y P   NWD    +V  +CATWDADKPL WRQKYGWTAFCGPVGPTGQ
Sbjct  27   QEASNVRATYHYYRPAENNWDLGAPAVSAYCATWDADKPLEWRQKYGWTAFCGPVGPTGQ  86

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
             +CG+CL VTNTAT  Q+T RIVDQC+NGGLDLD + VF+++D++GQG   GHL
Sbjct  87   DACGKCLSVTNTATGDQITARIVDQCANGGLDLDWDTVFSKIDSDGQGYQNGHL  140



>gb|AAR08364.1| pathogenesis-related protein 4b [Oryza sativa Indica Group]
Length=151

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            Q A+NVRATY+ Y P   NWD    +V  +CATWDADKPL WRQKYGWTAFCGPVGPTGQ
Sbjct  26   QEASNVRATYHYYRPAENNWDLGAPAVSAYCATWDADKPLEWRQKYGWTAFCGPVGPTGQ  85

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
             +CG+CL VTNTAT  Q+T RIVDQC+NGGLDLD + VF+++D++GQG   GHL
Sbjct  86   DACGKCLSVTNTATGDQITARIVDQCANGGLDLDWDTVFSKIDSDGQGYQNGHL  139



>gb|AFK48556.1| unknown [Lotus japonicus]
Length=207

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +SA+NV A+Y+ Y P+ + WDY  +  +C TWDA K L+WR KYGWTAFCGPVGP GQAS
Sbjct  73   ESASNVYASYHYYRPEQVGWDY--SGTYCTTWDAGKSLAWRSKYGWTAFCGPVGPRGQAS  130

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHLT  455
            CGRCLRVTN+ T AQ TVRIVDQC+NGGLDLD  VF++LDT+G G  QGH+T
Sbjct  131  CGRCLRVTNSRTGAQQTVRIVDQCANGGLDLDWGVFSKLDTDGVGYQQGHMT  182



>ref|XP_009134784.1| PREDICTED: pathogenesis-related protein PR-4-like [Brassica rapa]
 gb|AAN23106.2| PR4-type protein [Brassica rapa subsp. pekinensis]
 dbj|BAG68208.1| PR4 protein [Brassica rapa subsp. chinensis]
 dbj|BAH82748.1| pathogenesis related protein 4 [Brassica rapa subsp. chinensis]
 emb|CDX74170.1| BnaA03g28770D [Brassica napus]
Length=140

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            + NVRATY+ YNP    WD    S +C+TWD ++PL WRQ+YGWTAFCGP GP G+ SCG
Sbjct  23   SANVRATYHFYNPAQNGWDLYRVSAYCSTWDGNQPLEWRQRYGWTAFCGPAGPRGRDSCG  82

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            RCLRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+GQG A+G+L
Sbjct  83   RCLRVTNTGTQAQATVRIVDQCSNGGLDLDEAVFKQIDTDGQGYARGNL  131



>gb|KCW61593.1| hypothetical protein EUGRSUZ_H04328, partial [Eucalyptus grandis]
Length=136

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +S ++V  TYN YNP+ I WD   AS +CATWDA+KPL+W  KYGWTA  G  GP GQAS
Sbjct  22   RSVSHVWTTYNYYNPEQIGWDLNAASAYCATWDANKPLAWCNKYGWTALSGLAGPCGQAS  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQ TVRI+DQCSNGGLDLD  VF +LDT+G G AQGHL
Sbjct  82   CGQCLRVTNTRTGAQATVRIIDQCSNGGLDLDAGVFQKLDTDGSGNAQGHL  132



>ref|XP_010027185.1| PREDICTED: pathogenesis-related protein PR-4-like [Eucalyptus 
grandis]
Length=133

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            +S ++V  TYN YNP+ I WD   AS +CATWDA+KPL+W  KYGWTA  G  GP GQAS
Sbjct  14   RSVSHVWTTYNYYNPEQIGWDLNAASAYCATWDANKPLAWCNKYGWTALSGLAGPCGQAS  73

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTNT T AQ TVRI+DQCSNGGLDLD  VF +LDT+G G AQGHL
Sbjct  74   CGQCLRVTNTRTGAQATVRIIDQCSNGGLDLDAGVFQKLDTDGSGNAQGHL  124



>ref|XP_002884462.1| PR4-type protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60721.1| PR4-type protein [Arabidopsis lyrata subsp. lyrata]
Length=141

 Score =   142 bits (358),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ Y P+   WD    S +C+TW  ++P+ WR+KYGWTAFCGP GP G+ SCGR
Sbjct  25   SNVRATYHYYYPEQNGWDLYKVSAYCSTWKGNQPIEWRRKYGWTAFCGPTGPRGRDSCGR  84

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CLRVTNTAT  Q TVRI+DQCSNGGLDLD  VF QLDTNGQG A+GHL
Sbjct  85   CLRVTNTATGTQATVRIIDQCSNGGLDLDDGVFRQLDTNGQGYARGHL  132



>gb|AFS89621.1| pathogenesis-related protein [Brassica juncea var. tumida]
Length=140

 Score =   142 bits (357),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            + NVRATY+ YNP    WD    S +C+TWD ++PL WRQ+YGWTAFCGP GP G+ SCG
Sbjct  23   SANVRATYHFYNPAQNGWDLYRVSAYCSTWDGNQPLEWRQRYGWTAFCGPAGPRGRDSCG  82

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            RCLRVTN  T AQ TVRIVDQCSNGGLDLD  VF Q+DT+GQG A+G+L
Sbjct  83   RCLRVTNPGTQAQATVRIVDQCSNGGLDLDEAVFKQIDTDGQGYARGNL  131



>ref|XP_006663018.1| PREDICTED: wheatwin-1-like [Oryza brachyantha]
Length=146

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRA Y+ YNPQ  NWD    S +CATWDADKPLSWRQKYGWTAFCGP G  G+ SCG+
Sbjct  29   SNVRAKYHYYNPQQNNWDLNKVSAYCATWDADKPLSWRQKYGWTAFCGPAGTRGRESCGK  88

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C++V N  T   +T RIVDQCSNGGLDLD   +F ++DT+G+G   GHL
Sbjct  89   CIQVKNRGTGETITARIVDQCSNGGLDLDYETIFKKIDTDGRGYQMGHL  137



>gb|AAF18934.1|AF112867_1 wound-induced protein CBP1 precursor [Capsicum annuum]
Length=210

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA NVRATY+ YNPQN+ WD    S +C+TWDA+KPL+WR KYG TAFC PVGP G+ SC
Sbjct  78   SAQNVRATYHLYNPQNVGWDLNAVSAYCSTWDANKPLAWRSKYGLTAFCCPVGPRGRDSC  137

Query  303  GRCLRvtntatnaqvtv--RIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CLRVT+  T        RIVDQC NGGLDLDVNVF Q+DT+G G  +GHL
Sbjct  138  GKCLRVTSANTRTGAQTIVRIVDQCGNGGLDLDVNVFRQIDTDGVGNQRGHL  189



>ref|XP_002449770.1| hypothetical protein SORBIDRAFT_05g022940 [Sorghum bicolor]
 gb|EES08758.1| hypothetical protein SORBIDRAFT_05g022940 [Sorghum bicolor]
Length=149

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            + VRATYN YNP   NW+   A  +CATWDA KPLSWR KYGWTAFCGP GPTGQASCG+
Sbjct  31   SGVRATYNYYNPAQNNWNL--AGTYCATWDASKPLSWRSKYGWTAFCGPAGPTGQASCGQ  88

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CL VTN+AT A +TVRIVDQCSNGGLDLD +  F  LDTNG G+  GHLT
Sbjct  89   CLLVTNSATGASLTVRIVDQCSNGGLDLDYDTAFKPLDTNGAGLNAGHLT  138



>gb|AGT16080.1| hypothetical protein SHCRBa_087_K22_F_200 [Saccharum hybrid cultivar 
R570]
Length=148

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            + VRATYN YNP   NWD   A  +CATWDA +PLSWR KYGWTAFCGP GPTGQA+CG+
Sbjct  30   SGVRATYNYYNPAQNNWDL--AGTYCATWDAGQPLSWRSKYGWTAFCGPAGPTGQAACGQ  87

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CL VTNTAT A +TVRIVDQCSNGGLDLD +  F  LDTNG G+  GHLT
Sbjct  88   CLLVTNTATGASLTVRIVDQCSNGGLDLDYDTAFKPLDTNGAGIQAGHLT  137



>gb|AGT17288.1| hypothetical protein SHCRBa_160_O06_R_60 [Saccharum hybrid cultivar 
R570]
Length=148

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            + VRATYN YNP   NWD   A  +CATWDA +PLSWR KYGWTAFCGP GPTGQA+CG+
Sbjct  30   SGVRATYNYYNPTQNNWDL--AGTYCATWDAGQPLSWRSKYGWTAFCGPAGPTGQAACGQ  87

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CL VTNTAT A +TVRIVDQCSNGGLDLD +  F  LDTNG G+  GHLT
Sbjct  88   CLLVTNTATGASLTVRIVDQCSNGGLDLDYDTAFKPLDTNGAGIQAGHLT  137



>ref|XP_004979596.1| PREDICTED: wheatwin-2-like [Setaria italica]
Length=147

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNP    WD      +CATWDA KPLSWRQ+YGWTAFCGP GP GQA+CG+
Sbjct  30   SNVRATYHLYNPAENGWDLNRVGAYCATWDAGKPLSWRQQYGWTAFCGPAGPRGQAACGQ  89

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN  T A +T RIVDQCSNGGLDLD   VF ++DTNG G   GHL
Sbjct  90   CIRVTNRGTGASITARIVDQCSNGGLDLDFETVFKKIDTNGLGYQMGHL  138



>ref|XP_003535368.1| PREDICTED: wound-induced protein WIN1-like [Glycine max]
Length=141

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA  V++TY+ Y P+  NWD    S +CATWDAD+P SWR KYGWTAFCGPVGP G  S
Sbjct  21   QSAI-VQSTYHLYQPEQHNWDLLAVSAYCATWDADQPFSWRSKYGWTAFCGPVGPQGPPS  79

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CL VTNT T  Q   RIVDQC+NGG +LDV+VF +LD++G G AQGHL
Sbjct  80   CGKCLMVTNTRTGDQQIARIVDQCTNGGFNLDVSVFQRLDSDGNGNAQGHL  130



>ref|XP_006424013.1| hypothetical protein CICLE_v10030085mg [Citrus clementina]
 gb|ESR37253.1| hypothetical protein CICLE_v10030085mg [Citrus clementina]
Length=140

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRAT ++YNP+   WD      +C+TWDA+KPL+WR+KYGWTAFCGPVGP GQA+
Sbjct  21   QSASNVRATSHSYNPEQHGWDLNAVGAYCSTWDANKPLAWRRKYGWTAFCGPVGPRGQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CG+CLRVTN+ T AQVTVRIVDQCSNGGLDLD +VF QL   G+G +Q  L
Sbjct  81   CGKCLRVTNSGTGAQVTVRIVDQCSNGGLDLDASVFRQLV--GRGNSQNQL  129



>ref|XP_010102288.1| hypothetical protein L484_024570 [Morus notabilis]
 gb|EXB93231.1| hypothetical protein L484_024570 [Morus notabilis]
Length=199

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SATNVRATY+ YNP+   W+    S +C+TWDA K  +WR KYGWTAFCGP GP GQASC
Sbjct  78   SATNVRATYHYYNPEQNGWNLNAVSAYCSTWDAGKSYAWRSKYGWTAFCGPSGPRGQASC  137

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            GRCL+VTNT T AQ+TVRIVDQCSNGGLDLD N  F +LDT+G+G  QGHL
Sbjct  138  GRCLKVTNTRTGAQLTVRIVDQCSNGGLDLDYNTAFRKLDTDGRGYQQGHL  188



>gb|ACG39688.1| win1 precursor [Zea mays]
Length=152

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNP    WD      +CATWDADKPLSWRQK+GWTAFCGP G  GQA+CG+
Sbjct  35   SNVRATYHLYNPAQNGWDLNRVXAYCATWDADKPLSWRQKHGWTAFCGPAGQKGQAACGK  94

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RV N AT A +  RIVDQCSNGGLDLD   VF ++DTNGQ    GHL
Sbjct  95   CIRVKNRATGASIVARIVDQCSNGGLDLDYETVFKKIDTNGQVYQMGHL  143



>emb|CDY40672.1| BnaC03g33880D [Brassica napus]
Length=141

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVR TY+ Y P+   WD    S +C+TW  ++PL WR+KYGWTAFCGPVGP G+ SCGR
Sbjct  25   SNVRTTYHYYYPEQNGWDLYKVSAYCSTWKGNQPLEWRRKYGWTAFCGPVGPRGRDSCGR  84

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CLRVTNTAT AQ TVRIVDQCSNGGLDLD  VF QLDTNGQG A+G++
Sbjct  85   CLRVTNTATGAQATVRIVDQCSNGGLDLDDGVFKQLDTNGQGYARGNM  132



>gb|KHN18059.1| Wound-induced protein WIN1, partial [Glycine soja]
Length=120

 Score =   139 bits (349),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +3

Query  135  VRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            V++TY+ Y P+  NWD    S +CATWDAD+P SWR KYGWTAFCGPVGP G  SCG+CL
Sbjct  4    VQSTYHLYQPEQHNWDLLAVSAYCATWDADQPFSWRSKYGWTAFCGPVGPQGPPSCGKCL  63

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
             VTNT T  Q   RIVDQC+NGG +LDV+VF +LD++G G AQGHL
Sbjct  64   MVTNTRTGDQQIARIVDQCTNGGFNLDVSVFQRLDSDGNGNAQGHL  109



>gb|AGT16001.1| hypothetical protein SHCRBa_135_C14_R_50 [Saccharum hybrid cultivar 
R570]
 gb|AGT17442.1| pathogenesis-related protein [Saccharum hybrid cultivar R570]
Length=148

 Score =   139 bits (351),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            + VRATYN YNP   NWD   +  +CATWDA +PLSWR KYGWTAFCGP GPTGQA+CG+
Sbjct  30   SGVRATYNYYNPTQNNWDL--SGTYCATWDAGQPLSWRSKYGWTAFCGPAGPTGQAACGQ  87

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CL VTNTAT A +TVRIVDQCSNGGLDLD +  F  LDTNG G+  GHLT
Sbjct  88   CLLVTNTATGASLTVRIVDQCSNGGLDLDYDTAFKPLDTNGAGIQAGHLT  137



>sp|P28814.1|BARW_HORVU RecName: Full=Barwin [Hordeum vulgare]
 gb|AAA03274.1| barwin=wound-induced protein homolog [barley, seeds, Peptide, 
125 aa]
Length=125

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            Q A +VRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP GP GQ
Sbjct  1    QQANDVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQ  60

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            A+CG+CLRVTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  61   AACGKCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  114



>gb|EAY81555.1| hypothetical protein OsI_36720 [Oryza sativa Indica Group]
Length=158

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A  VRATY+ Y P    WD      FC+TWDA KP  WR KYGWTAFCGPVGPTG+ S
Sbjct  27   QQAFGVRATYHFYRPAANGWDLTATGAFCSTWDAGKPFDWRSKYGWTAFCGPVGPTGRDS  86

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CG+CLRVTN AT AQ T RIVD+C+NGGLDLD + VF+++DT+GQG  +GHLT
Sbjct  87   CGKCLRVTNRATGAQTTARIVDKCANGGLDLDWDTVFSKIDTDGQGFQRGHLT  139



>prf||2209398A pathogenesis-related protein
Length=125

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            Q ATNVRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQ
Sbjct  1    QQATNVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQ  60

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            A+CG+CLRVTN AT AQ+T RIVDQC++GGLDLD + VF ++DTNG G  QGHL
Sbjct  61   AACGKCLRVTNPATGAQITARIVDQCADGGLDLDWDTVFTKIDTNGIGYQQGHL  114



>ref|XP_006663565.1| PREDICTED: wheatwin-1-like [Oryza brachyantha]
Length=154

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            +NVRATY+ Y P   NWD    +V  +CATWDA+KPLSWRQKYGWTAFCGPVGP G+ SC
Sbjct  32   SNVRATYHYYRPAQNNWDLGAPAVSAYCATWDANKPLSWRQKYGWTAFCGPVGPRGRDSC  91

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            G+CL+VTNTAT AQ+T RIVDQCSNGGLDLD + VF+++DT+GQG  +GHL
Sbjct  92   GKCLQVTNTATGAQITARIVDQCSNGGLDLDWDTVFSKIDTDGQGYQKGHL  142



>pdb|1BW3|A Chain A, Three-Dimensional Structure In Solution Of Barwin, A 
Protein From Barley Seed
 pdb|1BW4|A Chain A, Three-Dimensional Structure In Solution Of Barwin, A 
Protein From Barley Seed
Length=125

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            + A +VRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP GP GQ
Sbjct  1    EQANDVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQ  60

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            A+CG+CLRVTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  61   AACGKCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  114



>dbj|BAH82669.1| PR-4 [Brassica rapa subsp. chinensis]
Length=117

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +3

Query  126  ATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            + NVRATY+ YNP    WD    S +C+TWD ++PL WRQ+YGWTAFCGP GP G+ SCG
Sbjct  14   SANVRATYHFYNPAQNGWDLYRVSAYCSTWDGNQPLEWRQRYGWTAFCGPAGPRGRDSCG  73

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQG  434
            RCLRVTNT T AQ TVRIVDQCSNGGLDLD  VF Q+DT+GQG
Sbjct  74   RCLRVTNTGTQAQATVRIVDQCSNGGLDLDEAVFKQIDTDGQG  116



>gb|AFW74503.1| hypothetical protein ZEAMMB73_639296 [Zea mays]
Length=152

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNP    WD      +CATWDA KP SWRQ+YGWTAFCGP GP GQA+CGR
Sbjct  35   SNVRATYHLYNPAQNGWDLNRVGAYCATWDAGKPPSWRQQYGWTAFCGPSGPKGQAACGR  94

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN  T A  T R+VDQCSNGGLDLD   VF ++DT+G+G   GHL
Sbjct  95   CIRVTNRGTGASTTARVVDQCSNGGLDLDFETVFKKIDTDGRGYQMGHL  143



>ref|XP_008680122.1| PREDICTED: barwin-like [Zea mays]
 ref|XP_008650135.1| PREDICTED: barwin-like [Zea mays]
 gb|AFW60485.1| hypothetical protein ZEAMMB73_631771 [Zea mays]
Length=149

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNP    WD      +CATWDA KP SWRQ+YGWTAFCGP GP GQA+CGR
Sbjct  32   SNVRATYHLYNPAQNGWDLNRVGAYCATWDAGKPPSWRQQYGWTAFCGPSGPKGQAACGR  91

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTN  T A  T R+VDQCSNGGLDLD   VF ++DT+G+G   GHL
Sbjct  92   CIRVTNRGTGASTTARVVDQCSNGGLDLDFETVFKKIDTDGRGYQMGHL  140



>dbj|BAK04328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            NVRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP GP GQA+CG
Sbjct  26   NVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQAACG  85

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            +CLRVTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  86   KCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  135



>ref|NP_001105464.1| defence-related protein precursor [Zea mays]
 emb|CAA57674.1| defence-related protein [Zea mays]
Length=145

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A+NV+ATY+ YNP    WD    + +CATWDADKPLSWRQK+GWTAFCGP G  G   
Sbjct  26   QEASNVQATYHLYNPAQNGWDLNPGT-YCATWDADKPLSWRQKHGWTAFCGPAGQKGPGR  84

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            CG+C+RV N AT A +  RIVDQCSNGGLDLD   VF ++DTNGQG   GHL
Sbjct  85   CGKCIRVKNRATGASIVARIVDQCSNGGLDLDYETVFKKIDTNGQGYQMGHL  136



>emb|CAA71774.1| pathogenesis-related protein 4 [Hordeum vulgare]
Length=146

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            NVRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP GP GQA+CG
Sbjct  26   NVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPLGQAACG  85

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            +CLRVTN AT AQ+T RIVD+C+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  86   KCLRVTNPATGAQITARIVDKCANGGLDLDWDTVFAKIDTNGIGFQQGHL  135



>dbj|BAC16357.1| hevein-like protein [Eutrema japonicum]
Length=231

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 91/131 (69%), Gaps = 20/131 (15%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADK--------------------PLSW  239
            +SA+NVRATY+ YNP+  NWD    S +C+TW+ADK                      +W
Sbjct  72   ESASNVRATYHFYNPEQNNWDLGAVSAYCSTWNADKQNNWDLGAVSAYCSTWNADKSYAW  131

Query  240  RQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLD  419
            R KYGWTAFCGP GP GQASCG+CLRV NT TNA VTVRIVDQCSNGGLDLDV +FN+LD
Sbjct  132  RSKYGWTAFCGPAGPRGQASCGKCLRVRNTRTNAVVTVRIVDQCSNGGLDLDVAMFNRLD  191

Query  420  TNGQGVAQGHL  452
            T+G G  QGHL
Sbjct  192  TDGVGYQQGHL  202



>gb|EMS54720.1| Pathogenesis-related protein PR-4A [Triticum urartu]
Length=109

 Score =   135 bits (341),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 77/113 (68%), Gaps = 20/113 (18%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATYN YNPQ INWD   AS +CATWDA    +WR KYGWTAFCGP GPTGQAS
Sbjct  5    QSASNVRATYNFYNPQKINWDLNAASAYCATWDAGMSFAWRSKYGWTAFCGPAGPTGQAS  64

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CG+CL                    NGGLDLD + VF+++DTNG G+ QGHLT
Sbjct  65   CGKCLH-------------------NGGLDLDHDTVFSKIDTNGLGMQQGHLT  98



>emb|CAJ40963.1| putative vacuolar defense protein [Triticum aestivum]
Length=164

 Score =   137 bits (345),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ Y+P    WD    S +C+TWDA KP SWR KYGWTAFCGP GP GQASCGR
Sbjct  25   SNVRATYHYYSPAQNGWDLGAVSAYCSTWDAGKPFSWRSKYGWTAFCGPAGPRGQASCGR  84

Query  309  CLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            C+RVTNT T AQ+T RIVDQC+NGGLDLD + VF ++DT+G G  +GHL
Sbjct  85   CIRVTNTGTGAQITARIVDQCANGGLDLDWDTVFVKIDTDGMGYQRGHL  133



>ref|NP_001068187.1| Os11g0591800 [Oryza sativa Japonica Group]
 gb|ABA94529.1| Wound-induced protein WIN2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28550.1| Os11g0591800 [Oryza sativa Japonica Group]
 gb|EAZ18951.1| hypothetical protein OsJ_34488 [Oryza sativa Japonica Group]
Length=158

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            Q A  VRATY+ Y P    WD      FC+TWDA KP  WR KY WTAFCGPVGPTG+ S
Sbjct  27   QQAFGVRATYHFYRPAANGWDLTATGAFCSTWDAGKPFDWRSKYEWTAFCGPVGPTGRDS  86

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CG+CLRVTN  T AQ T RIVD+C+NGGLDLD + VF+++DT+GQG  +GHLT
Sbjct  87   CGKCLRVTNRVTGAQTTARIVDKCANGGLDLDWDTVFSKIDTDGQGFQRGHLT  139



>gb|AAB29183.1| wheatwin1=barwin homolog [Triticum aestivum=wheat, San Pastore, 
kernel, Peptide, 125 aa]
Length=125

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            + ATNVRATY+ Y P   NWD    +V  +CATWDA KPLSWR  YGWTAFCGP G  GQ
Sbjct  1    EQATNVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSGYGWTAFCGPAGAHGQ  60

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            ASCG+CL+VTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  61   ASCGKCLQVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  114



>emb|CDM86973.1| unnamed protein product [Triticum aestivum]
Length=147

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            +NVRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQA+C
Sbjct  26   SNVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAAC  85

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            G+CLRVTN AT AQVT RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  86   GKCLRVTNPATGAQVTARIVDQCANGGLDLDWDTVFTKIDTNGVGYQQGHL  136



>ref|XP_003577405.1| PREDICTED: barwin-like [Brachypodium distachyon]
Length=151

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQ  293
            QSATNVRATY+ Y P   NWD  + +V  +CATWDA KPLSWR ++GWTAFCGP GP G+
Sbjct  26   QSATNVRATYHYYRPAQNNWDLGSPAVSAYCATWDASKPLSWRSRHGWTAFCGPAGPRGR  85

Query  294  ASCGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
             SCGRC+RVTNT T A V  RIVDQCSNGGLDLD + VF ++DT+G G  +G+L
Sbjct  86   DSCGRCIRVTNTGTGANVVARIVDQCSNGGLDLDWDTVFTKIDTDGMGYQRGNL  139



>sp|O64393.1|WHW2_WHEAT RecName: Full=Wheatwin-2; AltName: Full=Pathogenesis-related 
protein 4b; Flags: Precursor [Triticum aestivum]
 emb|CAA06857.1| wheatwin2 [Triticum aestivum]
Length=148

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            NVRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQA+CG
Sbjct  28   NVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAACG  87

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            +CLRVTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  88   KCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  137



>gb|EMT05331.1| Wheatwin-2 [Aegilops tauschii]
Length=146

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            NVRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQA+CG
Sbjct  26   NVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAACG  85

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            +CLRVTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  86   KCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  135



>ref|XP_009414708.1| PREDICTED: pathogenesis-related protein PR-4-like [Musa acuminata 
subsp. malaccensis]
Length=144

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRC  311
            +VRATY+ Y P+  NWD      +C+TWDADK L WR +YGWTAFCGPVGPTG+ +CG+ 
Sbjct  23   DVRATYHYYYPEENNWDLMAVGAYCSTWDADKSLEWRARYGWTAFCGPVGPTGRDACGQM  82

Query  312  LRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            ++VTNTAT  Q TVRIVDQC NGGLDLD  VF+Q+DT+G G  +GHL
Sbjct  83   VQVTNTATGVQTTVRIVDQCGNGGLDLDWEVFSQIDTDGSGYEKGHL  129



>dbj|BAK03737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=166

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            +NVRATY+ Y P   NWD    +V  +C+TWDA KPLSWR KYGWTAFCGP GP GQASC
Sbjct  25   SNVRATYHFYRPAQNNWDLGAPAVSAYCSTWDAGKPLSWRSKYGWTAFCGPAGPRGQASC  84

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            GRC+RV NT T AQ+T RIVDQC+NGGLDLD + VF ++DT+G G  +GHL
Sbjct  85   GRCIRVANTGTGAQITARIVDQCANGGLDLDWDTVFVKIDTDGMGYQRGHL  135



>ref|XP_006487789.1| PREDICTED: wound-induced protein WIN1-like [Citrus sinensis]
 gb|KDO36305.1| hypothetical protein CISIN_1g032442mg [Citrus sinensis]
Length=140

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRAT ++YNP+   WD      +C+T DA+KPL+WR+KYGWTAFCGPVGP GQA+
Sbjct  21   QSASNVRATSHSYNPEQHGWDLNAVGAYCSTRDANKPLAWRRKYGWTAFCGPVGPRGQAA  80

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQL  416
            CG+CLRVTN  T AQVTVRIVDQCSNGGLDLD  VF QL
Sbjct  81   CGKCLRVTNRGTGAQVTVRIVDQCSNGGLDLDAGVFRQL  119



>sp|O64392.1|WHW1_WHEAT RecName: Full=Wheatwin-1; AltName: Full=Pathogenesis-related 
protein 4a; AltName: Full=Protein 0.14; AltName: Full=RNase; 
Flags: Precursor [Triticum aestivum]
 emb|CAA06856.1| wheatwin1 [Triticum aestivum]
Length=146

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  NVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCG  305
            NVRATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQASCG
Sbjct  26   NVRATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQASCG  85

Query  306  RCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            +CL+VTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  86   KCLQVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  135



>ref|XP_008456038.1| PREDICTED: pathogenesis-related protein PR-4-like [Cucumis melo]
Length=98

 Score =   132 bits (332),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  189  TASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQ  368
            TASVFCATWDA+KPL+WR+ YGWTAFCG VGPTG+ SCGRCLRV NT T  + TVRIVDQ
Sbjct  2    TASVFCATWDANKPLNWRKHYGWTAFCGSVGPTGRDSCGRCLRVRNTETGDEETVRIVDQ  61

Query  369  CSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            CSNGGLDLD +VF +LD NG G A+GHL
Sbjct  62   CSNGGLDLDYDVFKKLDNNGNGFARGHL  89



>gb|KCW85275.1| hypothetical protein EUGRSUZ_B02122 [Eucalyptus grandis]
Length=127

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 77/113 (68%), Gaps = 18/113 (16%)
 Frame = +3

Query  120  QSATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQAS  299
            QSA+NVRATY+ YNP    W+    S +CATWDA+KPL+WR+KYGWTAFCGPVGP GQ +
Sbjct  22   QSASNVRATYHYYNPDQNGWNLNAVSAYCATWDANKPLAWRKKYGWTAFCGPVGPRGQEA  81

Query  300  CGRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHLT  455
            CG+CLR                 CSNGGLDLD N +F  LDT+G G  QGHLT
Sbjct  82   CGKCLR-----------------CSNGGLDLDYNTIFRPLDTDGNGYNQGHLT  117



>gb|AAU94913.1| PR protein 4A [Arachis hypogaea]
Length=94

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  204  CATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCLRvtntatnaqvtvRIVDQCSNGG  383
            CATWDA KPL+WRQKYGWTAFCGPVGPTGQA+CG+CL+VTNT TNAQ TVRIVDQCSNGG
Sbjct  1    CATWDAGKPLAWRQKYGWTAFCGPVGPTGQAACGKCLKVTNTRTNAQQTVRIVDQCSNGG  60

Query  384  LDLDVNVFNQLDTNGQGVAQGHLT  455
            LDLD+ VF +LDT+G G AQGHLT
Sbjct  61   LDLDIGVFQKLDTDGNGNAQGHLT  84



>gb|AFW60479.1| hypothetical protein ZEAMMB73_033959 [Zea mays]
 gb|AFW60480.1| hypothetical protein ZEAMMB73_033959 [Zea mays]
Length=175

 Score =   132 bits (332),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 83/132 (63%), Gaps = 24/132 (18%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGR  308
            +NVRATY+ YNP    WD    S +CATWDADKPLSWRQK+GWTAFCGP G  GQA+CG+
Sbjct  35   SNVRATYHLYNPAQNGWDLNRVSAYCATWDADKPLSWRQKHGWTAFCGPAGQKGQAACGK  94

Query  309  CLRvtntat-----------------------naqvtvRIVDQCSNGGLDLDVN-VFNQL  416
            C+RV  +AT                        A +  RIVDQCSNGGLDLD   VF ++
Sbjct  95   CIRVCGSATFTFPPAGLSQAIVGLLQVKNRATGASIVARIVDQCSNGGLDLDYETVFKKI  154

Query  417  DTNGQGVAQGHL  452
            DTNGQG   GHL
Sbjct  155  DTNGQGYQMGHL  166



>gb|AAS78780.1| putative vacuolar defense protein [Triticum aestivum]
Length=166

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  TNVRATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            +NVRATY+ Y P    WD    +V  +C+TWDA KP SWR +YGWTAFCGP GP GQASC
Sbjct  25   SNVRATYHYYRPAQNGWDLGAPAVSAYCSTWDAGKPYSWRSRYGWTAFCGPAGPRGQASC  84

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            GRC+RVTNT T AQ+T RIVDQC+NGGLDLD + VF ++DT+G G  +GHL
Sbjct  85   GRCIRVTNTGTGAQITARIVDQCANGGLDLDWDTVFVKIDTDGMGYQRGHL  135



>gb|AAF00050.1|AF092123_1 pathogenesis-related protein 4 [Triticum aestivum]
Length=120

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +3

Query  141  ATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            ATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQA+CG+CL
Sbjct  1    ATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAACGKCL  60

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            RVTN AT AQVT RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  61   RVTNPATGAQVTARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  107



>gb|AAF02296.1|AF093007_1 PR-4 [Triticum aestivum]
Length=120

 Score =   128 bits (322),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +3

Query  141  ATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            ATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQA+CG+CL
Sbjct  1    ATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAACGKCL  60

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            RVTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  61   RVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  107



>gb|AAF02295.1| PR-4 [Triticum aestivum]
Length=120

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +3

Query  141  ATYNNYNPQNINWDYRTASV--FCATWDADKPLSWRQKYGWTAFCGPVGPTGQASCGRCL  314
            ATY+ Y P   NWD    +V  +CATWDA KPLSWR KYGWTAFCGP G  GQASCG+CL
Sbjct  1    ATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQASCGKCL  60

Query  315  RvtntatnaqvtvRIVDQCSNGGLDLDVN-VFNQLDTNGQGVAQGHL  452
            +VTN AT AQ+T RIVDQC+NGGLDLD + VF ++DTNG G  QGHL
Sbjct  61   QVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHL  107



>ref|XP_010550915.1| PREDICTED: pathogenesis-related protein PR-4-like [Tarenaya hassleriana]
Length=182

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  123  SATNVRATYNNYNPQNINWDYRTASVFCATWDADKPLSWRQKYGWTAFCGPVGPTGQASC  302
            SA  + A Y  YN   I++D  + + FCA WD+DKP  WR KYGWTAFCGPVGP GQ +C
Sbjct  47   SADTIWAEYAYYNATQIDYDLASTNAFCAQWDSDKPYWWRSKYGWTAFCGPVGPQGQEAC  106

Query  303  GRCLRvtntatnaqvtvRIVDQCSNGGLDLDVNVFNQLDTNGQGVAQGHL  452
            G+CL+VTNT T  QVTVRIVD+C  GGL LD +VF  LDT+G G+ +GHL
Sbjct  107  GKCLKVTNTDTKDQVTVRIVDECRMGGLVLDYDVFKALDTDGHGMPRGHL  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 833446309800