BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33151_g1_i1 len=1517 path=[1495:0-1516]

Length=1517
                                                                      Score     E

ref|XP_002278351.2|  PREDICTED: salt stress-induced hydrophobic p...  94.7    7e-20   Vitis vinifera
ref|XP_010067264.1|  PREDICTED: low temperature-induced protein l...  93.6    9e-20   
ref|XP_008789047.1|  PREDICTED: salt stress-induced hydrophobic p...  92.4    2e-19   
ref|XP_008445856.1|  PREDICTED: low temperature-induced protein l...  92.0    4e-19   
ref|XP_004143609.1|  PREDICTED: hydrophobic protein RCI2A-like        92.0    4e-19   
ref|NP_565897.1|  Low temperature and salt responsive protein         92.0    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380674.1|  PREDICTED: salt stress-induced hydrophobic p...  91.7    5e-19   
ref|XP_009141770.1|  PREDICTED: salt stress-induced hydrophobic p...  91.3    6e-19   
ref|XP_006436212.1|  hypothetical protein CICLE_v10033283mg           91.3    7e-19   
ref|XP_011077044.1|  PREDICTED: salt stress-induced hydrophobic p...  90.9    9e-19   
ref|XP_009614515.1|  PREDICTED: salt stress-induced hydrophobic p...  90.5    1e-18   
ref|XP_009133311.1|  PREDICTED: low temperature-induced protein l...  90.5    1e-18   
ref|XP_010253524.1|  PREDICTED: low temperature-induced protein l...  90.5    1e-18   
ref|XP_003524635.1|  PREDICTED: salt stress-induced hydrophobic p...  90.5    1e-18   
gb|ACG48459.1|  hypothetical protein                                  90.1    2e-18   Zea mays [maize]
ref|XP_007151809.1|  hypothetical protein PHAVU_004G076700g           89.7    2e-18   
ref|XP_002311114.1|  hydrophobic family protein                       89.7    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004237520.1|  PREDICTED: salt stress-induced hydrophobic p...  89.4    3e-18   
gb|KEH25679.1|  low temperature and salt responsive family protein    89.0    4e-18   
ref|XP_002440508.1|  hypothetical protein SORBIDRAFT_09g002150        89.0    5e-18   Sorghum bicolor [broomcorn]
ref|XP_008233373.1|  PREDICTED: low temperature-induced protein l...  88.6    5e-18   
ref|XP_008792165.1|  PREDICTED: low temperature-induced protein l...  88.2    7e-18   
ref|XP_003550093.1|  PREDICTED: hydrophobic protein RCI2A-like        88.2    7e-18   
gb|EMT05681.1|  Low temperature-induced protein                       88.2    7e-18   
ref|XP_004489845.1|  PREDICTED: hydrophobic protein RCI2A-like        88.2    7e-18   
gb|EPS71255.1|  stress-induced hydrophobic peptide                    88.2    8e-18   
ref|XP_008362678.1|  PREDICTED: low temperature-induced protein l...  87.8    9e-18   
gb|KDP46158.1|  hypothetical protein JCGZ_06669                       87.8    1e-17   
ref|XP_002277985.1|  PREDICTED: low temperature-induced protein l...  87.8    1e-17   Vitis vinifera
ref|XP_008369468.1|  PREDICTED: low temperature-induced protein l...  87.4    2e-17   
gb|ACG26760.1|  hypothetical protein                                  87.0    2e-17   Zea mays [maize]
ref|XP_008355643.1|  PREDICTED: salt stress-induced hydrophobic p...  86.7    3e-17   
ref|XP_002465426.1|  hypothetical protein SORBIDRAFT_01g038670        86.3    3e-17   Sorghum bicolor [broomcorn]
ref|XP_004984830.1|  PREDICTED: low temperature-induced protein l...  85.9    5e-17   
gb|ADC67798.1|  hypothetical protein POPTRDRAFT_563785                85.9    5e-17   Populus balsamifera [balsam poplar]
ref|XP_010667244.1|  PREDICTED: low temperature-induced protein l...  85.5    8e-17   
ref|XP_009409551.1|  PREDICTED: salt stress-induced hydrophobic p...  85.1    1e-16   
ref|XP_004307420.1|  PREDICTED: low temperature-induced protein l...  84.3    2e-16   
ref|XP_010244973.1|  PREDICTED: low temperature-induced protein l...  84.0    2e-16   
ref|XP_008442650.1|  PREDICTED: low temperature-induced protein l...  84.3    3e-16   
ref|XP_008376314.1|  PREDICTED: salt stress-induced hydrophobic p...  83.6    3e-16   
ref|XP_004137807.1|  PREDICTED: low temperature-induced protein l...  83.6    5e-16   
ref|NP_001049776.1|  Os03g0286900                                     83.2    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006843259.1|  hypothetical protein AMTR_s00080p00112800        83.6    5e-16   
ref|XP_003558174.1|  PREDICTED: low temperature-induced protein l...  82.8    6e-16   
ref|NP_187239.1|  Hydrophobic protein RCI2A                           82.8    8e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AFK81273.1|  rare cold-inducible protein 2A                        82.0    1e-15   
ref|XP_002318921.1|  hypothetical protein POPTR_0013s00340g           81.6    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008347209.1|  PREDICTED: salt stress-induced hydrophobic p...  81.6    2e-15   
gb|AFK38849.1|  unknown                                               81.6    2e-15   
ref|XP_009333742.1|  PREDICTED: salt stress-induced hydrophobic p...  81.6    2e-15   
ref|XP_002964158.1|  hypothetical protein SELMODRAFT_227480           81.3    2e-15   
sp|Q9ARD5.1|LT02_HORVU  RecName: Full=Low temperature-induced pro...  81.3    3e-15   Hordeum vulgare [barley]
ref|XP_002993150.1|  hypothetical protein SELMODRAFT_229736           80.5    4e-15   
ref|XP_009134856.1|  PREDICTED: hydrophobic protein RCI2A-like        80.1    6e-15   
sp|P68178.1|ESI3_THIEL  RecName: Full=Salt stress-induced hydroph...  80.1    7e-15   Elymus elongatus [tall wheatgrass]
gb|AER00467.1|  BLT101                                                79.7    7e-15   
gb|ADK27677.1|  plasma membrane protein 3-2                           79.7    7e-15   
gb|ABK96638.1|  unknown                                               79.7    8e-15   Populus trichocarpa x Populus deltoides
ref|XP_006408015.1|  hypothetical protein EUTSA_v10021802mg           81.3    9e-15   
emb|CDY49985.1|  BnaC03g34420D                                        79.7    9e-15   
ref|XP_002884538.1|  predicted protein                                79.3    1e-14   
gb|EYU19377.1|  hypothetical protein MIMGU_mgv1a0175922mg             79.3    1e-14   
ref|XP_004494505.1|  PREDICTED: hydrophobic protein LTI6B-like        79.0    1e-14   
gb|AHL20265.1|  stress-induced protein                                79.0    2e-14   
ref|XP_009417776.1|  PREDICTED: hydrophobic protein LTI6B             78.6    2e-14   
ref|XP_001765492.1|  predicted protein                                78.6    2e-14   
gb|EMT15831.1|  Low temperature-induced protein                       78.6    2e-14   
ref|XP_001764858.1|  predicted protein                                78.6    2e-14   
ref|XP_003626132.1|  Hydrophobic protein LTI6A                        78.6    2e-14   
gb|AAQ84111.1|  Clt1                                                  78.2    3e-14   Citrus trifoliata [hardy orange]
gb|AFI47457.1|  low temperature and salt responsive protein           78.2    3e-14   
ref|XP_007206183.1|  hypothetical protein PRUPE_ppa013857mg           79.0    4e-14   
ref|XP_006382256.1|  hypothetical protein POPTR_0005s00390g           77.8    5e-14   
ref|XP_010674472.1|  PREDICTED: hydrophobic protein RCI2B             77.8    5e-14   
ref|XP_004302326.1|  PREDICTED: hydrophobic protein RCI2A-like        77.8    5e-14   
ref|XP_007207409.1|  hypothetical protein PRUPE_ppa014548mg           77.8    5e-14   
ref|XP_008370336.1|  PREDICTED: hydrophobic protein RCI2A-like        77.8    5e-14   
gb|AEJ20974.1|  cold-inducible protein                                77.4    6e-14   
ref|XP_006428345.1|  hypothetical protein CICLE_v10013710mg           78.6    7e-14   
ref|XP_004302327.1|  PREDICTED: hydrophobic protein RCI2A-like        77.0    7e-14   
ref|XP_011087564.1|  PREDICTED: hydrophobic protein RCI2B             77.0    8e-14   
ref|XP_003555775.2|  PREDICTED: hydrophobic protein LTI6A             78.2    8e-14   
ref|XP_008246327.1|  PREDICTED: hydrophobic protein RCI2B             77.0    8e-14   
gb|EYU35366.1|  hypothetical protein MIMGU_mgv1a017610mg              77.0    9e-14   
ref|XP_008246326.1|  PREDICTED: hydrophobic protein LTI6B-like        76.6    1e-13   
gb|AAF26091.1|AC012393_17  low temperature and salt responsive pr...  77.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414164.1|  PREDICTED: hydrophobic protein LTI6B-like        76.6    1e-13   
ref|NP_001107634.1|  LOC100135422                                     76.6    1e-13   Zea mays [maize]
ref|XP_002884539.1|  low temperature and salt responsive protein ...  77.0    1e-13   
dbj|BAD34658.1|  plasma membrane protein 3                            76.6    1e-13   Leymus chinensis
ref|NP_187240.1|  Hydrophobic protein RCI2B                           76.3    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ACN26849.1|  unknown                                               76.6    1e-13   Zea mays [maize]
ref|XP_007163285.1|  hypothetical protein PHAVU_001G221700g           76.6    1e-13   
ref|XP_010271058.1|  PREDICTED: hydrophobic protein RCI2B             76.3    1e-13   
ref|XP_008350586.1|  PREDICTED: hydrophobic protein RCI2B-like        75.9    2e-13   
gb|EPS73096.1|  stress-induced hydrophobic peptide                    76.3    2e-13   
gb|ACV50425.1|  cold induced plasma membrane protein                  76.3    2e-13   Jatropha curcas
ref|XP_002512586.1|  Hydrophobic protein LTI6A, putative              75.9    2e-13   Ricinus communis
ref|XP_006428346.1|  hypothetical protein CICLE_v10013304mg           76.3    2e-13   
gb|ACU14699.1|  unknown                                               75.9    2e-13   Glycine max [soybeans]
ref|XP_009365454.1|  PREDICTED: hydrophobic protein RCI2B-like        75.5    2e-13   
ref|XP_003536025.1|  PREDICTED: hydrophobic protein LTI6A-like        75.5    3e-13   
gb|ACU14681.1|  unknown                                               75.5    3e-13   Glycine max [soybeans]
gb|ACU14391.1|  unknown                                               75.5    3e-13   Glycine max [soybeans]
ref|XP_008776670.1|  PREDICTED: hydrophobic protein LTI6B             75.5    3e-13   
ref|XP_006480341.1|  PREDICTED: hydrophobic protein LTI6B-like is...  75.1    4e-13   
ref|XP_009366018.1|  PREDICTED: hydrophobic protein RCI2A-like        75.1    4e-13   
ref|XP_001751863.1|  predicted protein                                75.1    4e-13   
gb|ABK22915.1|  unknown                                               75.1    4e-13   Picea sitchensis
ref|XP_002993149.1|  hypothetical protein SELMODRAFT_136629           75.1    4e-13   
ref|XP_009365456.1|  PREDICTED: hydrophobic protein RCI2B-like        75.1    4e-13   
ref|XP_010070102.1|  PREDICTED: hydrophobic protein LTI6A-like        75.1    4e-13   
gb|ACH60980.1|  rare cold inducible protein                           75.1    5e-13   Pseudotsuga menziesii
gb|EAY96485.1|  hypothetical protein OsI_18385                        75.9    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010094907.1|  Hydrophobic protein LTI6A                        74.7    6e-13   
ref|NP_001232820.1|  hydrophobic protein LTI6A                        74.7    6e-13   
ref|XP_008370335.1|  PREDICTED: hydrophobic protein RCI2A             74.3    6e-13   
ref|XP_007031274.1|  Stress-induced hydrophobic peptide               74.7    6e-13   
ref|XP_009366021.1|  PREDICTED: hydrophobic protein RCI2B             74.3    6e-13   
ref|NP_001054591.1|  Os05g0138300                                     74.3    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568974.1|  PREDICTED: hydrophobic protein LTI6B             74.3    6e-13   
ref|XP_003554596.1|  PREDICTED: hydrophobic protein LTI6A-like        74.3    7e-13   
ref|XP_008339336.1|  PREDICTED: hydrophobic protein RCI2B-like        74.3    8e-13   
ref|XP_003626131.1|  Hydrophobic protein RCI2B                        73.9    9e-13   
gb|ACH61000.1|  rare cold inducible protein                           74.3    9e-13   Pseudotsuga macrocarpa
ref|XP_009412350.1|  PREDICTED: hydrophobic protein RCI2B             73.9    1e-12   
gb|ACH60977.1|  rare cold inducible protein                           73.9    1e-12   Pseudotsuga menziesii
gb|EMS45020.1|  Hydrophobic protein OSR8                              74.3    1e-12   
gb|AFP99877.1|  plasma membrane protein Am244                         73.6    1e-12   
gb|ADC45381.1|  stress-induced hydrophobic peptide                    73.6    2e-12   
gb|KHG20782.1|  Hydrophobic RCI2B -like protein                       73.2    2e-12   
ref|XP_004967634.1|  PREDICTED: hydrophobic protein LTI6B-like is...  73.2    2e-12   
ref|XP_002440557.1|  hypothetical protein SORBIDRAFT_09g003060        72.8    2e-12   Sorghum bicolor [broomcorn]
gb|ACA66247.1|  cold-induced plasma membrane protein                  72.8    2e-12   Musa ABB Group [cooking banana]
emb|CDY71166.1|  BnaCnng71680D                                        72.8    2e-12   
gb|ADE77881.1|  unknown                                               72.8    2e-12   
ref|NP_001152633.1|  hydrophobic protein LTI6A                        72.8    2e-12   Zea mays [maize]
ref|XP_001776246.1|  predicted protein                                72.8    3e-12   
ref|XP_003626135.1|  Hydrophobic protein LTI6B                        73.2    3e-12   
gb|KCW44804.1|  hypothetical protein EUGRSUZ_L01633                   73.9    3e-12   
ref|XP_010040901.1|  PREDICTED: hydrophobic protein LTI6B-like        72.4    3e-12   
ref|XP_004967637.1|  PREDICTED: hydrophobic protein LTI6B-like is...  72.4    4e-12   
gb|ABQ41924.1|  low temperature and salt responsive protein           72.0    4e-12   Sonneratia alba
gb|AFC41201.1|  PM-YC3.6-Lti6b                                        79.0    4e-12   
gb|ABD33207.2|  Protein of unknown function UPF0057                   72.0    4e-12   Medicago truncatula
gb|KCW82305.1|  hypothetical protein EUGRSUZ_C03713                   74.3    4e-12   
ref|XP_002440556.1|  hypothetical protein SORBIDRAFT_09g003050        72.0    4e-12   Sorghum bicolor [broomcorn]
ref|XP_004960430.1|  PREDICTED: hydrophobic protein LTI6B-like        72.0    5e-12   
ref|NP_001151840.1|  hydrophobic protein LTI6B                        72.0    5e-12   Zea mays [maize]
ref|XP_009616085.1|  PREDICTED: hydrophobic protein LTI6A-like        71.6    6e-12   
ref|XP_009122968.1|  PREDICTED: UPF0057 membrane protein At1g5755...  71.6    6e-12   
gb|KFK40947.1|  hypothetical protein AALP_AA2G064700                  71.6    6e-12   
ref|XP_004967635.1|  PREDICTED: hydrophobic protein LTI6B-like is...  71.6    6e-12   
ref|XP_009799132.1|  PREDICTED: hydrophobic protein LTI6A-like        71.6    7e-12   
ref|XP_010273656.1|  PREDICTED: hydrophobic protein OSR8-like         72.0    7e-12   
ref|NP_001147403.1|  hydrophobic protein LTI6A                        71.6    7e-12   Zea mays [maize]
emb|CDX80578.1|  BnaC07g28660D                                        71.6    7e-12   
ref|XP_004958446.1|  PREDICTED: hydrophobic protein LTI6A-like        71.2    8e-12   
dbj|BAG54794.1|  plasma membrance protein3                            71.2    8e-12   Puccinellia tenuiflora
ref|XP_010035796.1|  PREDICTED: hydrophobic protein RCI2B             71.2    8e-12   
ref|XP_009774465.1|  PREDICTED: hydrophobic protein RCI2B             71.2    9e-12   
ref|XP_010694119.1|  PREDICTED: hydrophobic protein LTI6A             71.2    9e-12   
ref|NP_001147508.1|  LOC100281117                                     71.2    1e-11   Zea mays [maize]
gb|EAY73580.1|  hypothetical protein OsI_01464                        70.9    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_003578630.1|  PREDICTED: hydrophobic protein OSR8              71.2    1e-11   
tpg|DAA41564.1|  TPA: hypothetical protein ZEAMMB73_862570            70.9    1e-11   
ref|XP_004306234.1|  PREDICTED: hydrophobic protein LTI6A-like        70.9    1e-11   
ref|XP_011092211.1|  PREDICTED: hydrophobic protein RCI2A-like is...  70.9    1e-11   
tpg|DAA41563.1|  TPA: hypothetical protein ZEAMMB73_862570            70.9    1e-11   
ref|XP_010040900.1|  PREDICTED: hydrophobic protein LTI6B-like        70.5    1e-11   
gb|EMT25386.1|  Hydrophobic protein OSR8                              70.9    1e-11   
ref|XP_008776672.1|  PREDICTED: hydrophobic protein RCI2B-like        70.5    1e-11   
ref|XP_011092210.1|  PREDICTED: hydrophobic protein RCI2A-like is...  71.2    2e-11   
emb|CDY31781.1|  BnaC01g27370D                                        70.5    2e-11   
ref|XP_009113358.1|  PREDICTED: UPF0057 membrane protein At1g57550    70.5    2e-11   
ref|NP_001063909.1|  Os09g0558100                                     70.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ45644.1|  hypothetical protein OsJ_30312                        70.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90014.1|  predicted protein                                    70.9    2e-11   
gb|AAV88601.1|  low temperature and salt responsive protein           70.1    2e-11   Cenchrus americanus [bulrush millet]
ref|XP_002460652.1|  hypothetical protein SORBIDRAFT_02g032580        70.1    3e-11   Sorghum bicolor [broomcorn]
ref|NP_001060390.1|  Os07g0635900                                     69.7    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054506.1|  Os05g0122700                                     69.7    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009611658.1|  PREDICTED: hydrophobic protein RCI2B-like        69.7    3e-11   
ref|XP_003557909.1|  PREDICTED: hydrophobic protein LTI6A             69.7    3e-11   
ref|XP_004960342.1|  PREDICTED: low temperature-induced protein l...  69.7    3e-11   
gb|EYU35348.1|  hypothetical protein MIMGU_mgv1a017511mg              70.1    3e-11   
gb|KDO59494.1|  hypothetical protein CISIN_1g034455mg                 70.5    4e-11   
ref|XP_004230367.1|  PREDICTED: hydrophobic protein LTI6A             68.9    5e-11   
ref|XP_009589212.1|  PREDICTED: hydrophobic protein LTI6A-like is...  68.9    6e-11   
ref|XP_002279333.3|  PREDICTED: hydrophobic protein LTI6A             68.6    7e-11   Vitis vinifera
gb|ACJ09630.1|  putative early drought-induced protein                69.7    7e-11   Cupressus sempervirens
ref|XP_002529408.1|  Hydrophobic protein OSR8, putative               69.3    7e-11   Ricinus communis
gb|ACG26755.1|  hypothetical protein                                  68.9    7e-11   Zea mays [maize]
dbj|BAG54793.1|  plasma membrance protein3                            68.6    7e-11   Puccinellia tenuiflora
ref|XP_006453590.1|  hypothetical protein CICLE_v10010088mg           69.3    7e-11   
ref|NP_001050200.1|  Os03g0370600                                     68.9    8e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010047066.1|  PREDICTED: UPF0057 membrane protein At4g3066...  68.9    8e-11   
gb|ADV02768.1|  putative low temperature and salt responsive prot...  68.6    8e-11   
ref|XP_006658870.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    9e-11   
gb|AAV88602.1|  low temperature and salt responsive protein           68.9    1e-10   Cenchrus americanus [bulrush millet]
gb|KDP38695.1|  hypothetical protein JCGZ_04048                       68.6    1e-10   
ref|XP_004230366.1|  PREDICTED: hydrophobic protein LTI6A             68.2    1e-10   
gb|EMT24455.1|  Hydrophobic protein OSR8                              68.6    1e-10   
ref|NP_176067.1|  Low temperature and salt responsive protein         67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927948.1|  PREDICTED: hydrophobic protein OSR8-like         68.2    1e-10   
gb|ABK28441.1|  unknown                                               67.8    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006474017.1|  PREDICTED: UPF0057 membrane protein At4g3066...  68.2    2e-10   
ref|XP_006358521.1|  PREDICTED: hydrophobic protein LTI6A-like        67.4    2e-10   
ref|XP_007408476.1|  hypothetical protein MELLADRAFT_55694            67.4    2e-10   
ref|XP_009122970.1|  PREDICTED: UPF0057 membrane protein At1g5755...  67.0    2e-10   
ref|XP_010694118.1|  PREDICTED: hydrophobic protein RCI2B-like        67.0    3e-10   
ref|XP_010668344.1|  PREDICTED: salt stress-induced hydrophobic p...  67.0    3e-10   
emb|CDY49984.1|  BnaC03g34410D                                        67.0    3e-10   
emb|CDI50937.1|  conserved hypothetical protein                       66.6    4e-10   
ref|XP_009366197.1|  PREDICTED: UPF0057 membrane protein At4g3066...  67.0    4e-10   
ref|XP_002277561.1|  PREDICTED: UPF0057 membrane protein At4g30650    67.0    4e-10   Vitis vinifera
ref|XP_008384300.1|  PREDICTED: UPF0057 membrane protein At4g3066...  67.0    5e-10   
ref|XP_010086890.1|  UPF0057 membrane protein                         67.0    5e-10   
dbj|BAD34659.1|  plasma membrane protein 3                            66.2    6e-10   Leymus chinensis
ref|XP_009123629.1|  PREDICTED: hydrophobic protein RCI2A             66.2    6e-10   
ref|XP_009631086.1|  PREDICTED: low temperature-induced protein l...  66.2    6e-10   
ref|XP_004957619.1|  PREDICTED: hydrophobic protein OSR8-like         66.2    7e-10   
gb|EHK39638.1|  hypothetical protein TRIATDRAFT_253690                65.9    8e-10   
ref|XP_009134854.1|  PREDICTED: hydrophobic protein RCI2A-like        65.9    8e-10   
gb|EGU82857.1|  hypothetical protein FOXB_06660                       65.9    8e-10   
gb|EAY90184.1|  hypothetical protein OsI_11748                        65.9    8e-10   Oryza sativa Indica Group [Indian rice]
emb|CBQ67374.1|  conserved hypothetical protein                       65.5    9e-10   
ref|XP_009771603.1|  PREDICTED: UPF0057 membrane protein At4g3066...  65.9    9e-10   
ref|XP_008022303.1|  hypothetical protein SETTUDRAFT_102512           65.9    9e-10   
ref|XP_011018049.1|  PREDICTED: UPF0057 membrane protein At4g3066...  65.9    1e-09   
ref|XP_006404901.1|  hypothetical protein EUTSA_v10000507mg           66.6    1e-09   
ref|XP_011079386.1|  PREDICTED: UPF0057 membrane protein At2g2404...  65.5    1e-09   
emb|CDM82662.1|  unnamed protein product                              65.5    1e-09   
ref|WP_036563643.1|  membrane protein                                 65.1    1e-09   
emb|CDY20271.1|  BnaC04g36850D                                        65.5    2e-09   
gb|EMS19696.1|  stress response RCI peptide, putative                 64.7    2e-09   
gb|KFK29642.1|  hypothetical protein AALP_AA7G160000                  65.1    2e-09   
sp|Q4HXT6.2|PMP3_GIBZE  RecName: Full=Plasma membrane proteolipid 3   64.7    2e-09   Fusarium graminearum
ref|XP_007687864.1|  hypothetical protein COCMIDRAFT_5223             64.7    2e-09   
ref|XP_006375710.1|  hypothetical protein POPTR_0013s00340g           64.7    2e-09   
ref|XP_006968507.1|  predicted protein                                64.7    2e-09   
ref|XP_006412679.1|  hypothetical protein EUTSA_v10026723mg           65.1    2e-09   
ref|XP_010525782.1|  PREDICTED: UPF0057 membrane protein At2g2404...  65.1    2e-09   
ref|XP_010687613.1|  PREDICTED: hydrophobic protein OSR8-like         64.7    2e-09   
ref|XP_006295361.1|  hypothetical protein CARUB_v10024453mg           64.7    2e-09   
ref|XP_390398.1|  hypothetical protein FG10222.1                      64.7    2e-09   Fusarium graminearum PH-1
gb|KFA66992.1|  hypothetical protein S40285_06252                     64.3    2e-09   
ref|XP_003675890.1|  hypothetical protein NCAS_0C05360                64.3    3e-09   
dbj|GAA94872.1|  hypothetical protein E5Q_01526                       65.5    3e-09   
ref|XP_009127679.1|  PREDICTED: UPF0057 membrane protein At4g30650    64.7    3e-09   
gb|KHG08315.1|  hypothetical protein F383_35429                       64.7    3e-09   
ref|XP_007202919.1|  hypothetical protein PRUPE_ppa016228mg           64.7    3e-09   
ref|NP_194794.1|  putative low temperature and salt responsive pr...  64.3    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68682.1|  BnaC01g07710D                                        64.3    3e-09   
ref|XP_003332609.1|  plasma membrane proteolipid 3                    63.9    3e-09   
ref|XP_003050880.1|  predicted protein                                63.9    4e-09   
ref|WP_015820305.1|  hypothetical protein                             63.9    4e-09   
ref|XP_008443846.1|  PREDICTED: UPF0057 membrane protein At4g3066...  64.3    4e-09   
ref|XP_004146673.1|  PREDICTED: UPF0057 membrane protein At4g3066...  64.3    4e-09   
emb|CDP10252.1|  unnamed protein product                              64.3    4e-09   
ref|XP_009140515.1|  PREDICTED: UPF0057 membrane protein At2g24040    64.3    4e-09   
gb|ADR71296.1|  stress-induced hydrophobic peptide 1                  64.3    4e-09   
gb|EFQ35058.1|  hypothetical protein GLRG_10202                       63.9    4e-09   
ref|XP_008243011.1|  PREDICTED: UPF0057 membrane protein At4g3066...  63.9    4e-09   
ref|XP_008794365.1|  PREDICTED: hydrophobic protein OSR8-like iso...  63.9    4e-09   
ref|XP_007011899.1|  Low temperature and salt responsive protein ...  63.9    5e-09   
gb|ELR05278.1|  plasma membrane proteolipid 3                         63.5    5e-09   
ref|XP_002878715.1|  hypothetical protein ARALYDRAFT_481262           63.9    5e-09   
ref|XP_006408016.1|  hypothetical protein EUTSA_v10021895mg           63.5    5e-09   
ref|XP_010447688.1|  PREDICTED: UPF0057 membrane protein At4g3066...  63.9    5e-09   
ref|XP_008795214.1|  PREDICTED: hydrophobic protein OSR8-like         63.9    5e-09   
gb|KDE06194.1|  hypothetical protein MVLG_03475                       65.1    5e-09   
dbj|BAK07288.1|  predicted protein                                    64.3    5e-09   
ref|NP_001056997.1|  Os06g0184800                                     63.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010429357.1|  PREDICTED: UPF0057 membrane protein At2g24040    63.9    5e-09   
ref|XP_002308410.2|  hypothetical protein POPTR_0006s19630g           63.9    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007598233.1|  plasma membrane proteolipid 3                    63.2    6e-09   
gb|EXA31012.1|  plasma membrane proteolipid 3                         63.2    6e-09   
ref|XP_007875754.1|  hypothetical protein PFL1_00066                  63.2    6e-09   
ref|NP_179982.1|  Low temperature and salt responsive protein         63.5    6e-09   
ref|XP_009144188.1|  PREDICTED: UPF0057 membrane protein At2g24040    63.9    6e-09   
gb|KFA45948.1|  hypothetical protein S40293_07299                     63.9    6e-09   
gb|EPS69583.1|  hypothetical protein M569_05184                       63.2    7e-09   
ref|WP_018275194.1|  hypothetical protein                             63.2    7e-09   
ref|XP_004507750.1|  PREDICTED: UPF0057 membrane protein At4g3066...  63.5    7e-09   
gb|KDO59496.1|  hypothetical protein CISIN_1g034455mg                 63.9    7e-09   
gb|EYU34336.1|  hypothetical protein MIMGU_mgv1a017457mg              63.5    7e-09   
gb|EMS50605.1|  Hydrophobic protein LTI6A                             64.3    7e-09   
ref|XP_006282769.1|  hypothetical protein CARUB_v10006168mg           63.5    7e-09   
gb|KDN52400.1|  UPF0057-domain-containing protein                     62.8    8e-09   
ref|XP_008452728.1|  PREDICTED: UPF0057 membrane protein At4g30660    63.5    8e-09   
ref|XP_010432959.1|  PREDICTED: UPF0057 membrane protein At4g3066...  63.2    8e-09   
ref|XP_010438147.1|  PREDICTED: UPF0057 membrane protein At4g30660    63.2    8e-09   
ref|XP_004965708.1|  PREDICTED: hydrophobic protein OSR8-like         63.2    8e-09   
ref|XP_001800835.1|  hypothetical protein SNOG_10569                  62.8    9e-09   
ref|WP_035575124.1|  membrane protein                                 62.8    9e-09   
gb|AEH76325.1|  RCI2E                                                 63.2    9e-09   
ref|XP_003610298.1|  hypothetical protein MTR_4g130660                63.2    9e-09   
ref|XP_004163984.1|  PREDICTED: UPF0057 membrane protein At2g2404...  63.2    9e-09   
ref|XP_006453589.1|  hypothetical protein CICLE_v10010088mg           63.2    9e-09   
ref|WP_015826670.1|  hypothetical protein                             62.8    9e-09   
gb|EMT01854.1|  Hydrophobic protein OSR8                              63.2    1e-08   
ref|XP_008731138.1|  plasma membrane proteolipid 3                    63.2    1e-08   
ref|XP_002869366.1|  hypothetical protein ARALYDRAFT_913410           63.2    1e-08   
ref|WP_012137981.1|  MULTISPECIES: hypothetical protein               62.4    1e-08   
gb|KFK29643.1|  hypothetical protein AALP_AA7G160100                  63.2    1e-08   
gb|ADK27676.1|  plasma membrane protein 3-1                           62.4    1e-08   
ref|WP_014132399.1|  hypothetical protein                             62.8    1e-08   
ref|XP_007725861.1|  plasma membrane proteolipid 3                    62.8    1e-08   
ref|WP_034658916.1|  membrane protein                                 62.4    1e-08   
ref|XP_010447687.1|  PREDICTED: UPF0057 membrane protein At4g3066...  62.8    1e-08   
ref|WP_035485317.1|  membrane protein                                 62.4    1e-08   
ref|XP_007761856.1|  plasma membrane proteolipid 3                    62.8    1e-08   
ref|WP_011582777.1|  hypothetical protein                             62.4    1e-08   
gb|ACT32395.1|  hypothetical protein                                  62.4    1e-08   
gb|AAN06944.1|  putative low temperature and salt responsive protein  62.4    1e-08   
ref|XP_002869365.1|  hypothetical protein ARALYDRAFT_913409           62.8    1e-08   
ref|XP_007738636.1|  plasma membrane proteolipid 3                    62.4    1e-08   
ref|XP_006282768.1|  hypothetical protein CARUB_v10006167mg           62.4    1e-08   
ref|XP_009124957.1|  PREDICTED: hydrophobic protein RCI2B-like        62.0    2e-08   
ref|XP_008036532.1|  UPF0057-domain-containing protein                62.0    2e-08   
gb|AFK35826.1|  unknown                                               62.4    2e-08   
ref|XP_011126137.1|  hypothetical protein AOL_s00173g93               62.0    2e-08   
ref|NP_974629.1|  Low temperature and salt responsive protein         62.4    2e-08   
ref|XP_003564192.1|  PREDICTED: hydrophobic protein OSR8-like         62.4    2e-08   
ref|XP_007746200.1|  plasma membrane proteolipid 3                    62.0    2e-08   
ref|XP_010526316.1|  PREDICTED: UPF0057 membrane protein At4g3066...  62.4    2e-08   
gb|ACJ09619.1|  putative low temperature and salt responsive protein  62.4    2e-08   
gb|EYU35347.1|  hypothetical protein MIMGU_mgv1a021982mg              62.4    2e-08   
gb|AAV35467.1|  cold and salt response protein                        62.0    2e-08   
gb|AFK81277.1|  rare cold-inducible protein 2E-b                      62.0    2e-08   
ref|WP_032096492.1|  MULTISPECIES: membrane protein                   61.6    2e-08   
ref|WP_008248520.1|  hypothetical protein                             61.6    2e-08   
ref|XP_003610299.1|  Stress-induced hydrophobic peptide               64.7    2e-08   
ref|WP_007254450.1|  hypothetical protein                             61.6    2e-08   
ref|XP_004986964.1|  PREDICTED: hydrophobic protein LTI6A-like        61.6    2e-08   
ref|XP_003519155.1|  PREDICTED: UPF0057 membrane protein At4g30660    62.0    2e-08   
ref|XP_006412678.1|  hypothetical protein EUTSA_v10026719mg           62.0    2e-08   
ref|WP_015164535.1|  hypothetical protein                             61.6    2e-08   
ref|XP_007263965.1|  UPF0057-domain-containing protein                61.6    3e-08   
ref|XP_006956685.1|  plasma membrane proteolipid Pmp3                 61.6    3e-08   
ref|WP_017516589.1|  hypothetical protein                             61.2    3e-08   
ref|XP_008083600.1|  hypothetical protein GLAREA_00651                61.2    3e-08   
ref|WP_014423048.1|  MULTISPECIES: hypothetical protein               61.2    3e-08   
ref|WP_011390272.1|  hypothetical protein                             60.8    3e-08   
gb|EMT12999.1|  Hydrophobic protein OSR8                              61.6    3e-08   
ref|WP_038278255.1|  membrane protein                                 60.8    4e-08   
ref|WP_021819908.1|  hypothetical protein                             60.8    4e-08   
ref|WP_012654247.1|  hypothetical protein                             60.8    4e-08   
ref|XP_003192603.1|  cation transport-related protein                 60.8    4e-08   
ref|WP_022665134.1|  hypothetical protein                             60.8    4e-08   
ref|XP_002437373.1|  hypothetical protein SORBIDRAFT_10g025810        61.2    4e-08   
ref|XP_007338654.1|  UPF0057-domain-containing protein                60.8    4e-08   
ref|WP_036181668.1|  membrane protein                                 60.8    4e-08   
ref|XP_009137957.1|  PREDICTED: UPF0057 membrane protein At4g30660    61.2    4e-08   
gb|AFW88281.1|  hypothetical protein ZEAMMB73_701475                  60.8    4e-08   
ref|XP_009606754.1|  PREDICTED: UPF0057 membrane protein At4g3066...  61.2    4e-08   
ref|XP_004287140.1|  PREDICTED: UPF0057 membrane protein At2g2404...  61.2    5e-08   
ref|NP_194795.1|  putative low temperature and salt responsive pr...  61.2    5e-08   
ref|WP_035154314.1|  membrane protein                                 60.5    5e-08   
ref|WP_007155136.1|  MULTISPECIES: hypothetical protein               60.5    5e-08   
ref|WP_023433826.1|  Stress induced hydrophobic peptide               60.8    5e-08   
ref|XP_003035201.1|  hypothetical protein SCHCODRAFT_50913            60.5    5e-08   
gb|AFK37112.1|  unknown                                               61.2    5e-08   
dbj|BAK03743.1|  predicted protein                                    60.8    5e-08   
emb|CEJ91660.1|  Putative Plasma membrane proteolipid 3               60.5    5e-08   
gb|AFK40038.1|  unknown                                               60.8    5e-08   
ref|WP_016710088.1|  hypothetical protein                             60.5    5e-08   
ref|XP_006412994.1|  hypothetical protein EUTSA_v10027289mg           60.8    5e-08   
ref|XP_001755971.1|  predicted protein                                60.5    6e-08   
ref|WP_035707406.1|  membrane protein                                 60.5    6e-08   
ref|WP_011367682.1|  hypothetical protein                             60.5    6e-08   
dbj|BAH19935.1|  AT4G30660                                            60.8    6e-08   
ref|WP_003177654.1|  MULTISPECIES: hypothetical protein               60.5    6e-08   
ref|XP_006298933.1|  hypothetical protein CARUB_v10015055mg           60.1    7e-08   
ref|WP_036193635.1|  membrane protein                                 60.1    7e-08   
ref|WP_023852579.1|  hypothetical protein                             60.1    7e-08   
ref|WP_013220629.1|  hypothetical protein                             60.1    7e-08   
gb|KEH32619.1|  low temperature and salt responsive family protein    61.6    7e-08   
ref|XP_006826656.1|  hypothetical protein AMTR_s00137p00015950        60.5    7e-08   
ref|XP_009127669.1|  PREDICTED: UPF0057 membrane protein At4g3066...  60.5    7e-08   
ref|WP_037174046.1|  membrane protein                                 60.1    7e-08   
ref|WP_006791179.1|  MULTISPECIES: hypothetical protein               60.1    7e-08   
gb|KEF57475.1|  plasma membrane proteolipid 3                         60.1    7e-08   
gb|KDR81525.1|  hypothetical protein GALMADRAFT_239530                60.1    7e-08   
ref|WP_013324061.1|  hypothetical protein                             60.1    8e-08   
gb|EWC44170.1|  plasma membrane proteolipid 3                         60.1    8e-08   
ref|WP_012566897.1|  hypothetical protein                             59.7    9e-08   
ref|XP_008715450.1|  plasma membrane proteolipid 3                    59.7    9e-08   
ref|XP_002465219.1|  hypothetical protein SORBIDRAFT_01g034350        60.1    9e-08   
ref|WP_011787205.1|  hypothetical protein                             59.7    9e-08   
ref|WP_018497180.1|  hypothetical protein                             59.7    9e-08   
ref|XP_009410191.1|  PREDICTED: UPF0057 membrane protein At4g3066...  60.1    9e-08   
ref|WP_037072161.1|  membrane protein                                 59.7    1e-07   
ref|XP_002638152.1|  Hypothetical protein CBG17085                    59.7    1e-07   
gb|ETX30701.1|  hypothetical protein RISW2_07795                      59.7    1e-07   
emb|CDX72260.1|  BnaC07g42820D                                        60.1    1e-07   
ref|WP_037257610.1|  membrane protein                                 59.7    1e-07   
ref|XP_006665500.1|  stress response RCI peptide, putative            59.7    1e-07   
ref|WP_007800413.1|  hypothetical protein                             59.7    1e-07   
gb|AIC30368.1|  proteolipid membrane potential modulator protein      59.7    1e-07   
ref|WP_007120519.1|  hypothetical protein                             59.3    1e-07   
emb|CCK75913.1|  conserved hypothetical protein                       59.3    1e-07   
ref|XP_002621662.1|  stress response RCI peptide                      59.7    1e-07   
ref|XP_009589211.1|  PREDICTED: hydrophobic protein LTI6A-like is...  60.1    1e-07   
ref|WP_003503579.1|  hypothetical protein                             59.3    1e-07   
ref|XP_003661311.1|  hypothetical protein MYCTH_2314489               59.3    1e-07   
ref|WP_038650423.1|  membrane protein                                 59.3    1e-07   
ref|XP_009106572.1|  PREDICTED: UPF0057 membrane protein At2g2404...  59.7    1e-07   
ref|WP_021762320.1|  hypothetical protein                             59.3    1e-07   
ref|WP_006310667.1|  MULTISPECIES: hypothetical protein               59.3    1e-07   
ref|WP_038682662.1|  membrane protein                                 59.3    1e-07   
ref|WP_020186423.1|  hypothetical protein                             59.3    1e-07   
emb|CCA68482.1|  probable RIC1 protein                                59.3    1e-07   
ref|WP_024090373.1|  hypothetical protein                             59.3    1e-07   
ref|XP_009542596.1|  putative stress-induced hydrophobic peptide      59.3    1e-07   
ref|XP_002562011.1|  Pc18g01670                                       59.3    1e-07   
ref|WP_002957822.1|  MULTISPECIES: hypothetical protein               59.3    1e-07   
gb|EIE76530.1|  plasma membrane proteolipid 3                         59.3    2e-07   
ref|WP_002808819.1|  hypothetical protein                             59.3    2e-07   
ref|WP_020040189.1|  hypothetical protein                             59.3    2e-07   
ref|WP_011563682.1|  hypothetical protein                             58.9    2e-07   
ref|WP_037171141.1|  membrane protein                                 58.9    2e-07   
ref|WP_012187301.1|  hypothetical protein                             59.3    2e-07   
ref|WP_004070730.1|  hypothetical protein                             58.9    2e-07   
ref|WP_039728595.1|  membrane protein                                 58.9    2e-07   
ref|WP_032610758.1|  membrane protein                                 58.9    2e-07   
ref|WP_013717416.1|  MULTISPECIES: hypothetical protein               58.9    2e-07   
ref|WP_008166086.1|  hypothetical protein                             58.9    2e-07   
ref|XP_002152869.1|  stress response RCI peptide, putative            58.9    2e-07   
ref|WP_019488807.1|  hypothetical protein                             58.9    2e-07   
ref|WP_036766515.1|  membrane protein                                 58.9    2e-07   
ref|WP_003547831.1|  hypothetical protein                             58.9    2e-07   
ref|WP_020875613.1|  protein of unknown function UPF0057              58.9    2e-07   
gb|AJE47365.1|  hypothetical protein P73_2650                         58.9    2e-07   
ref|WP_036365010.1|  membrane protein                                 58.9    2e-07   
ref|WP_035449617.1|  membrane protein                                 58.9    2e-07   
ref|WP_007947822.1|  hypothetical protein                             58.9    2e-07   
ref|XP_008601865.1|  plasma membrane proteolipid 3                    58.9    2e-07   
ref|WP_013032596.1|  hypothetical protein                             58.9    2e-07   
ref|WP_035223654.1|  membrane protein                                 58.9    2e-07   
ref|WP_037068153.1|  membrane protein                                 58.5    2e-07   
ref|WP_004654752.1|  MULTISPECIES: hypothetical protein               58.9    2e-07   
ref|XP_001539523.1|  conserved hypothetical protein                   58.9    2e-07   
ref|WP_037142322.1|  membrane protein                                 58.5    2e-07   
dbj|GAK70345.1|  hypothetical protein RRU01S_10_01840                 58.5    2e-07   
gb|EWY84253.1|  plasma membrane proteolipid 3                         58.9    2e-07   
ref|WP_003493670.1|  hypothetical protein                             58.5    2e-07   
ref|WP_004880105.1|  hypothetical protein                             58.5    2e-07   
ref|WP_004439740.1|  MULTISPECIES: hypothetical protein               58.5    2e-07   
ref|XP_002486625.1|  stress response RCI peptide, putative            58.5    2e-07   
ref|XP_007779373.1|  plasma membrane proteolipid 3                    58.5    2e-07   
ref|WP_020811433.1|  MULTISPECIES: hypothetical protein               58.5    3e-07   
emb|CCC12470.1|  unnamed protein product                              58.5    3e-07   
emb|CDX77737.1|  BnaC07g19910D                                        60.5    3e-07   
ref|WP_017958027.1|  hypothetical protein                             58.5    3e-07   
ref|WP_035238998.1|  membrane protein                                 58.5    3e-07   
ref|WP_015154571.1|  hypothetical protein                             58.5    3e-07   
ref|WP_033727371.1|  MULTISPECIES: membrane protein                   58.5    3e-07   
ref|WP_003514897.1|  MULTISPECIES: hypothetical protein               58.2    3e-07   
ref|WP_008466367.1|  MULTISPECIES: hypothetical protein               58.2    3e-07   
ref|WP_018896533.1|  MULTISPECIES: hypothetical protein               58.2    3e-07   
ref|WP_033419851.1|  membrane protein                                 58.2    3e-07   
ref|WP_008114841.1|  hypothetical protein                             58.2    3e-07   
ref|WP_011327039.1|  hypothetical protein                             58.2    3e-07   
ref|WP_017929876.1|  hypothetical protein                             58.2    3e-07   
ref|WP_009547411.1|  hypothetical protein                             58.2    3e-07   
ref|WP_039711593.1|  membrane protein                                 58.2    3e-07   
ref|WP_036255757.1|  membrane protein                                 58.2    3e-07   
ref|WP_022958730.1|  hypothetical protein                             58.2    3e-07   
ref|WP_003228885.1|  MULTISPECIES: hypothetical protein               58.2    3e-07   
gb|EMT13000.1|  Hydrophobic protein OSR8                              58.5    3e-07   
ref|WP_036973230.1|  membrane protein                                 58.2    4e-07   
dbj|GAK34286.1|  hypothetical protein AQ1_02184                       58.2    4e-07   
ref|WP_012362025.1|  hypothetical protein                             58.2    4e-07   
ref|WP_039753086.1|  membrane protein                                 58.2    4e-07   
ref|XP_008658714.1|  PREDICTED: hydrophobic protein LTI6B isoform X1  58.5    4e-07   
gb|AJD45064.1|  proteolipid membrane stress induced protein           58.2    4e-07   
gb|AHI28047.1|  hypothetical protein AU14_03695                       58.2    4e-07   
ref|WP_011495264.1|  hypothetical protein                             58.2    4e-07   
ref|WP_020587147.1|  hypothetical protein                             58.2    4e-07   
ref|XP_007843695.1|  plasma membrane proteolipid 3                    58.2    4e-07   
ref|WP_008553983.1|  MULTISPECIES: hypothetical protein               58.2    4e-07   
ref|WP_035992709.1|  membrane protein                                 58.2    4e-07   
ref|WP_006964620.1|  MULTISPECIES: hypothetical protein, Pmp3-lik...  58.2    4e-07   
ref|WP_008365129.1|  hypothetical protein                             58.2    4e-07   
ref|WP_037256452.1|  membrane protein                                 57.8    4e-07   
ref|WP_009801025.1|  hypothetical protein                             58.2    4e-07   
gb|EMT06579.1|  Hydrophobic protein OSR8                              58.5    4e-07   
ref|WP_015114871.1|  hypothetical protein                             57.8    4e-07   
ref|WP_008253263.1|  hypothetical protein                             57.8    4e-07   
gb|KDN49348.1|  Plasma membrane proteolipid 3                         58.2    4e-07   
gb|EYE94240.1|  UPF0057-domain-containing protein                     57.8    4e-07   
ref|WP_009804783.1|  hypothetical protein                             57.8    4e-07   
ref|WP_008274964.1|  hypothetical protein                             57.8    5e-07   
ref|XP_007385752.1|  UPF0057-domain-containing protein                57.8    5e-07   
ref|WP_034578786.1|  membrane protein                                 57.8    5e-07   
ref|WP_033024301.1|  membrane protein                                 57.8    5e-07   
ref|WP_008561339.1|  hypothetical protein                             57.8    5e-07   



>ref|XP_002278351.2| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Vitis 
vinifera]
Length=81

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +3

Query  108  IMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            IMGSETF+EI+LAILLPPVGVFLRYGCG+EFWI LLLTILGYIPGIIYAIY
Sbjct  27   IMGSETFLEIILAILLPPVGVFLRYGCGIEFWIDLLLTILGYIPGIIYAIY  77



>ref|XP_010067264.1| PREDICTED: low temperature-induced protein lt101.2 [Eucalyptus 
grandis]
Length=54

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETFVEI+LAILLPPVGVFLRYGCGVEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGSETFVEIILAILLPPVGVFLRYGCGVEFWITLLLTILGYIPGIIYAIY  50



>ref|XP_008789047.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Phoenix 
dactylifera]
Length=54

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E+LLAILLPPVGVFLRYGCGVEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGSETFLEVLLAILLPPVGVFLRYGCGVEFWIDLLLTILGYIPGIIYAIY  50



>ref|XP_008445856.1| PREDICTED: low temperature-induced protein lt101.2 [Cucumis melo]
Length=54

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETFVEI+LAILLPP+GVFLRYGCGVEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGSETFVEIILAILLPPLGVFLRYGCGVEFWICLLLTILGYIPGIIYAIY  50



>ref|XP_004143609.1| PREDICTED: hydrophobic protein RCI2A-like [Cucumis sativus]
 ref|XP_004171541.1| PREDICTED: hydrophobic protein RCI2A-like [Cucumis sativus]
 gb|KGN50466.1| hypothetical protein Csa_5G175890 [Cucumis sativus]
Length=54

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETFVEI+LAILLPP+GVFLRYGCGVEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGSETFVEIILAILLPPLGVFLRYGCGVEFWICLLLTILGYIPGIIYAIY  50



>ref|NP_565897.1| Low temperature and salt responsive protein [Arabidopsis thaliana]
 ref|XP_002881622.1| hypothetical protein ARALYDRAFT_482911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AAK97701.1| unknown protein [Arabidopsis thaliana]
 gb|AAL31117.1| At2g38901/At2g38901 [Arabidopsis thaliana]
 gb|AAM15078.1| Expressed protein [Arabidopsis thaliana]
 gb|EFH57881.1| hypothetical protein ARALYDRAFT_482911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC09610.1| Low temperature and salt responsive protein [Arabidopsis thaliana]
Length=54

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+EI+LAILLPPVGVFLRYGCGVEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGSETFLEIILAILLPPVGVFLRYGCGVEFWICLLLTILGYIPGIIYAIY  50



>ref|XP_009380674.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Musa 
acuminata subsp. malaccensis]
Length=54

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVEFWIDLLLTILGYIPGIIYAIY  50



>ref|XP_009141770.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Brassica 
rapa]
 emb|CDY18362.1| BnaA04g22250D [Brassica napus]
 emb|CDX93294.1| BnaC04g46020D [Brassica napus]
Length=54

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI LLLT+LGYIPGIIYAIY
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIY  50



>ref|XP_006436212.1| hypothetical protein CICLE_v10033283mg [Citrus clementina]
 ref|XP_006485929.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Citrus sinensis]
 gb|ESR49452.1| hypothetical protein CICLE_v10033283mg [Citrus clementina]
 gb|KDO44594.1| hypothetical protein CISIN_1g038161mg [Citrus sinensis]
 gb|KFK36794.1| hypothetical protein AALP_AA4G171900 [Arabis alpina]
Length=54

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI LLLT+LGYIPGIIYAIY
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTVLGYIPGIIYAIY  50



>ref|XP_011077044.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Sesamum indicum]
Length=54

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVEFWIDLLLTILGYIPGIIYALY  50



>ref|XP_009614515.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Nicotiana 
tomentosiformis]
 ref|XP_009769750.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Nicotiana 
sylvestris]
Length=54

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E+LLAI+LPPVGVFLRYGCGVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVLLAIILPPVGVFLRYGCGVEFWICLLLTILGYIPGIIYALY  50



>ref|XP_009133311.1| PREDICTED: low temperature-induced protein lt101.2 [Brassica 
rapa]
 ref|XP_009133312.1| PREDICTED: low temperature-induced protein lt101.2 [Brassica 
rapa]
 emb|CDY14420.1| BnaC03g21750D [Brassica napus]
 emb|CDY07689.1| BnaA03g18220D [Brassica napus]
Length=54

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI LLLT+LGYIPGIIYAIY
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTLLGYIPGIIYAIY  50



>ref|XP_010253524.1| PREDICTED: low temperature-induced protein lt101.2-like [Nelumbo 
nucifera]
Length=54

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCG+EFWI LLLT+LGYIPGIIYAIY
Sbjct  1    MGSETFIEVVLAILLPPVGVFLRYGCGIEFWIDLLLTLLGYIPGIIYAIY  50



>ref|XP_003524635.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Glycine max]
 gb|KHN30978.1| Low temperature-induced protein [Glycine soja]
Length=54

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI L+LTILGYIPGIIYAIY
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVEFWIDLVLTILGYIPGIIYAIY  50



>gb|ACG48459.1| hypothetical protein [Zea mays]
Length=54

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETFVEILLAILLPPVGVFLRYG GVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFVEILLAILLPPVGVFLRYGIGVEFWICLLLTILGYIPGIIYAVY  50



>ref|XP_007151809.1| hypothetical protein PHAVU_004G076700g [Phaseolus vulgaris]
 gb|ESW23803.1| hypothetical protein PHAVU_004G076700g [Phaseolus vulgaris]
Length=54

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI L+LT+LGY+PGIIYAIY
Sbjct  1    MGSETFIEVILAILLPPVGVFLRYGCGVEFWIDLVLTLLGYLPGIIYAIY  50



>ref|XP_002311114.1| hydrophobic family protein, partial [Populus trichocarpa]
 gb|EEE88481.1| hydrophobic family protein, partial [Populus trichocarpa]
 gb|ADC67795.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67796.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67797.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67799.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67801.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67802.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67805.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67806.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67808.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67809.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67810.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67811.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67812.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67813.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67814.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67815.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67816.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67817.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67818.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67819.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67820.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67821.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67822.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67823.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67824.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67825.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67827.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67828.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67829.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67830.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67831.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67832.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67833.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67834.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67835.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67836.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67837.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67838.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67839.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67840.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67841.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67842.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67843.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67844.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67845.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67846.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67847.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67848.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67849.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67850.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67851.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67852.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67853.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67854.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67855.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67856.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67857.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67858.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67859.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67860.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67861.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67862.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67863.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67864.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67865.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67866.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67867.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67868.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67869.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67870.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67871.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67872.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67874.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67875.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67876.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67877.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67878.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67879.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67880.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67881.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67882.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67883.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67884.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67885.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67886.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
Length=54

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAI+LPPVGVFLRYGCGVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAIILPPVGVFLRYGCGVEFWICLLLTILGYIPGIIYALY  50



>ref|XP_004237520.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Solanum 
lycopersicum]
 ref|XP_006340457.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Solanum tuberosum]
Length=54

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVEFWI +LLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVEFWICVLLTILGYIPGIIYALY  50



>gb|KEH25679.1| low temperature and salt responsive family protein [Medicago 
truncatula]
Length=54

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETFVE++LAILLPP+GVFLRYGCGVEFWI ++LT+LGYIPGIIYAIY
Sbjct  1    MGSETFVEVILAILLPPIGVFLRYGCGVEFWIDVVLTLLGYIPGIIYAIY  50



>ref|XP_002440508.1| hypothetical protein SORBIDRAFT_09g002150 [Sorghum bicolor]
 gb|EES18938.1| hypothetical protein SORBIDRAFT_09g002150 [Sorghum bicolor]
Length=54

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+EILLAILLPPVGVFLRYG GVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEILLAILLPPVGVFLRYGIGVEFWICLLLTILGYIPGIIYAVY  50



>ref|XP_008233373.1| PREDICTED: low temperature-induced protein lt101.2 [Prunus mume]
Length=54

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAI+LPPVGVFLRYGCGVEFWI LLLT+LGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAIILPPVGVFLRYGCGVEFWICLLLTLLGYIPGIIYALY  50



>ref|XP_008792165.1| PREDICTED: low temperature-induced protein lt101.2 [Phoenix dactylifera]
Length=54

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS TF+E++LAILLPP+GVFLRYGCGVEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGSATFLEVVLAILLPPLGVFLRYGCGVEFWIDLLLTILGYIPGIIYAIY  50



>ref|XP_003550093.1| PREDICTED: hydrophobic protein RCI2A-like [Glycine max]
 gb|KHN19643.1| Hydrophobic protein RCI2A [Glycine soja]
Length=54

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPPVGVFLRYGCGVE WI L+LTILGYIPGIIYAIY
Sbjct  1    MGSETFLEVILAILLPPVGVFLRYGCGVELWIDLVLTILGYIPGIIYAIY  50



>gb|EMT05681.1| Low temperature-induced protein [Aegilops tauschii]
Length=54

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETFVEILLAILLPPVGVFLRYG GVEFWI LLLT+LGYIPGIIYAI+
Sbjct  1    MGSETFVEILLAILLPPVGVFLRYGIGVEFWICLLLTLLGYIPGIIYAIF  50



>ref|XP_004489845.1| PREDICTED: hydrophobic protein RCI2A-like [Cicer arietinum]
Length=54

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ETFVE++LAILLPPVGVFLRYGCG+EFWI L+LT LGYIPGI+YAIY
Sbjct  1    MGTETFVEVILAILLPPVGVFLRYGCGIEFWIDLVLTFLGYIPGIVYAIY  50



>gb|EPS71255.1| stress-induced hydrophobic peptide, partial [Genlisea aurea]
Length=53

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAILLPP+GVFLRYGCG EFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAILLPPLGVFLRYGCGAEFWICLLLTILGYIPGIIYALY  50



>ref|XP_008362678.1| PREDICTED: low temperature-induced protein lt101.2 [Malus domestica]
 ref|XP_009378121.1| PREDICTED: low temperature-induced protein lt101.2 [Pyrus x bretschneideri]
Length=54

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAI+LPPVGVFLRYGC VEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAIILPPVGVFLRYGCAVEFWICLLLTILGYIPGIIYALY  50



>gb|KDP46158.1| hypothetical protein JCGZ_06669 [Jatropha curcas]
Length=54

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAIL+PPVGVFLRYGCGVEFWI LLLTILGYIPG++YAI+
Sbjct  1    MGSETFLEVILAILVPPVGVFLRYGCGVEFWIDLLLTILGYIPGMVYAIF  50



>ref|XP_002277985.1| PREDICTED: low temperature-induced protein lt101.2 [Vitis vinifera]
 emb|CAN63686.1| hypothetical protein VITISV_034114 [Vitis vinifera]
 emb|CAN63348.1| hypothetical protein VITISV_024444 [Vitis vinifera]
 emb|CBI32669.3| unnamed protein product [Vitis vinifera]
Length=55

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TF+E+LLAILLPPVGVFLRYGCGVEFWI LLLTILGYIPGI+YA+Y
Sbjct  1    MGTATFLEVLLAILLPPVGVFLRYGCGVEFWIDLLLTILGYIPGILYALY  50



>ref|XP_008369468.1| PREDICTED: low temperature-induced protein lt101.2 [Malus domestica]
Length=54

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAI LPPVGVFLRYGC VEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAIXLPPVGVFLRYGCAVEFWICLLLTILGYIPGIIYALY  50



>gb|ACG26760.1| hypothetical protein [Zea mays]
 gb|ACG26805.1| hypothetical protein [Zea mays]
 gb|ACG26851.1| hypothetical protein [Zea mays]
 gb|ACG27700.1| hypothetical protein [Zea mays]
 gb|ACG33455.1| hypothetical protein [Zea mays]
 tpg|DAA44810.1| TPA: hypothetical protein ZEAMMB73_772098 [Zea mays]
Length=54

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S TF+E+LLAI LPPVGVFLRYGCGVEFWI LLLT+LGYIPGIIYA+Y
Sbjct  1    MASATFLEVLLAIFLPPVGVFLRYGCGVEFWIDLLLTVLGYIPGIIYAVY  50



>ref|XP_008355643.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Malus domestica]
 ref|XP_009358176.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Pyrus x bretschneideri]
Length=54

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E+L AI LPPVGVF+RYGCGVEFWIA+LLT+ GYIPGIIYA+Y
Sbjct  1    MGSETFLEVLCAIFLPPVGVFIRYGCGVEFWIAVLLTLFGYIPGIIYAVY  50



>ref|XP_002465426.1| hypothetical protein SORBIDRAFT_01g038670 [Sorghum bicolor]
 gb|EER92424.1| hypothetical protein SORBIDRAFT_01g038670 [Sorghum bicolor]
Length=54

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S TF+E+LLAI LPPVGVFLRYGCGVEFWI LLLT+LGYIPGIIYA+Y
Sbjct  1    MASATFLEVLLAIFLPPVGVFLRYGCGVEFWIDLLLTVLGYIPGIIYALY  50



>ref|XP_004984830.1| PREDICTED: low temperature-induced protein lt101.2-like [Setaria 
italica]
Length=54

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TFVE+LLAI LPPVGVFLRYGCG+EFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MATATFVEVLLAIFLPPVGVFLRYGCGMEFWIDLLLTILGYIPGIIYALY  50



>gb|ADC67798.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67800.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67803.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67804.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67807.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67826.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67873.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
Length=54

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAI+LPPVGVFLRYGCGVEF I LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEVILAIILPPVGVFLRYGCGVEFXICLLLTILGYIPGIIYALY  50



>ref|XP_010667244.1| PREDICTED: low temperature-induced protein lt101.2 [Beta vulgaris 
subsp. vulgaris]
Length=54

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETFVE++LAILLPP+GVFLRYG  VEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFVEVILAILLPPLGVFLRYGIAVEFWICLLLTILGYIPGIIYALY  50



>ref|XP_009409551.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Musa 
acuminata subsp. malaccensis]
Length=54

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS TF+E++LAILLPPVGVFLRYG GVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSATFLEVILAILLPPVGVFLRYGIGVEFWIDLLLTILGYIPGIIYALY  50



>ref|XP_004307420.1| PREDICTED: low temperature-induced protein lt101.2-like [Fragaria 
vesca subsp. vesca]
Length=54

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+E++LAI+LPPVGVFLRYGCGVEF I L LTILGY+PGIIYAIY
Sbjct  1    MGSETFLEVILAIILPPVGVFLRYGCGVEFLICLCLTILGYLPGIIYAIY  50



>ref|XP_010244973.1| PREDICTED: low temperature-induced protein lt101.2 [Nelumbo nucifera]
Length=53

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TF+E++LAI LPPVGVFLRYGC VEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MAAATFLEVILAIFLPPVGVFLRYGCAVEFWIDLLLTILGYIPGIIYAIY  50



>ref|XP_008442650.1| PREDICTED: low temperature-induced protein lt101.2-like [Cucumis 
melo]
Length=69

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +3

Query  87   INRIEREIMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            ++RI +  MGS TFVE+LLAI +PPVGVFLRYG G+EFWI L+LT  GYIPGI+YA+Y
Sbjct  7    VDRIPKR-MGSATFVEVLLAIFIPPVGVFLRYGIGIEFWIDLVLTFFGYIPGIVYAVY  63



>ref|XP_008376314.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Malus 
domestica]
Length=54

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAI  257
            MGSETF E++LAI+LPPVGVFLR+ CGVEFWI LLLTILGYIPGIIYA+
Sbjct  1    MGSETFPEVILAIILPPVGVFLRFSCGVEFWICLLLTILGYIPGIIYAL  49



>ref|XP_004137807.1| PREDICTED: low temperature-induced protein lt101.2-like [Cucumis 
sativus]
 ref|XP_004166364.1| PREDICTED: low temperature-induced protein lt101.2-like [Cucumis 
sativus]
 gb|KGN58938.1| hypothetical protein Csa_3G736860 [Cucumis sativus]
Length=69

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +3

Query  87   INRIEREIMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            ++RI +  MGS TF+E+LLAI +PPVGVFLRYG G+EFWI L+LT  GYIPGIIYA+Y
Sbjct  7    VDRIPKR-MGSATFIEVLLAIFIPPVGVFLRYGIGIEFWIDLVLTFFGYIPGIIYAVY  63



>ref|NP_001049776.1| Os03g0286900 [Oryza sativa Japonica Group]
 gb|AAO16991.1| Putative low-temperature induced protein [Oryza sativa Japonica 
Group]
 gb|ABF95363.1| hypothetical protein LOC_Os03g17790 [Oryza sativa Japonica Group]
 dbj|BAF11690.1| Os03g0286900 [Oryza sativa Japonica Group]
 gb|EAY89548.1| hypothetical protein OsI_11082 [Oryza sativa Indica Group]
 gb|EAZ26526.1| hypothetical protein OsJ_10421 [Oryza sativa Japonica Group]
 gb|EAZ26527.1| hypothetical protein OsJ_10422 [Oryza sativa Japonica Group]
 dbj|BAG92185.1| unnamed protein product [Oryza sativa Japonica Group]
Length=54

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S TF+E+LLAI LPPVGVFLRYG G+EFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MASATFLEVLLAIFLPPVGVFLRYGLGIEFWIDLLLTILGYIPGIIYAVY  50



>ref|XP_006843259.1| hypothetical protein AMTR_s00080p00112800 [Amborella trichopoda]
 gb|ERN04934.1| hypothetical protein AMTR_s00080p00112800 [Amborella trichopoda]
Length=76

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPG  242
            MGSETF+E+LLAILLPPVGVFLRYGCGVEFWI LLLTILGYIPG
Sbjct  1    MGSETFLEVLLAILLPPVGVFLRYGCGVEFWIDLLLTILGYIPG  44



>ref|XP_003558174.1| PREDICTED: low temperature-induced protein lt101.2 [Brachypodium 
distachyon]
Length=54

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S TF+E++LAI+LPPVGVFLRYG GVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MASATFLEVILAIILPPVGVFLRYGLGVEFWICLLLTILGYIPGIIYAVY  50



>ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana]
 sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature 
and salt-responsive protein LTI6A [Arabidopsis thaliana]
 gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis 
thaliana]
 gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana]
 gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis 
thaliana]
 gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana]
 gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana]
 gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana]
 gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana]
 gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana]
Length=54

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TFV+I++AILLPP+GVFLR+GCGVEFWI L+LT+LGYIPGIIYAIY
Sbjct  1    MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIY  50



>gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa]
 gb|AFK81275.1| rare cold-inducible protein 2A [Camelina sativa]
Length=54

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TFV+I++A+LLPP+GVFLR+GCGVEFWI L+LT+LGYIPGIIYAIY
Sbjct  1    MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIY  50



>ref|XP_002318921.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 ref|XP_006375707.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 ref|XP_006375708.1| Hydrophobic protein RCI2A [Populus trichocarpa]
 ref|XP_006375709.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|EEE94844.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|ERP53504.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|ERP53505.1| Hydrophobic protein RCI2A [Populus trichocarpa]
 gb|ERP53506.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
Length=54

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S  F++ILLAI+LPP+GVFL++GCG EFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MSSTNFIDILLAIILPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVY  50



>ref|XP_008347209.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Malus domestica]
Length=64

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGII  248
            MGSETF+E++LAI+LPPVGVFLR+GCGVEFWI LLLTILGYIPGII
Sbjct  1    MGSETFLEVILAIILPPVGVFLRFGCGVEFWICLLLTILGYIPGII  46



>gb|AFK38849.1| unknown [Lotus japonicus]
 gb|AFK49304.1| unknown [Lotus japonicus]
Length=54

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T V+I+LAI+LPP+GVFLR+GC VEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIY  50



>ref|XP_009333742.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Pyrus x bretschneideri]
Length=58

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 4/53 (8%)
 Frame = +3

Query  111  MGSETFVEILLAILLP----PVGVFLRYGCGVEFWIALLLTILGYIPGIIYAI  257
            MGSETF+E++LAI+LP    PVGVFLR+GCGVEFWI LLLTILGYIPGIIYA+
Sbjct  1    MGSETFLEVILAIILPTSVTPVGVFLRFGCGVEFWICLLLTILGYIPGIIYAL  53



>ref|XP_002964158.1| hypothetical protein SELMODRAFT_227480 [Selaginella moellendorffii]
 gb|EFJ34491.1| hypothetical protein SELMODRAFT_227480 [Selaginella moellendorffii]
Length=54

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M   TF+++LLAI+LPP+GVFLR+GC VEFWI LLLTILGYIPGIIYAIY
Sbjct  1    MAGATFIDVLLAIILPPLGVFLRFGCAVEFWICLLLTILGYIPGIIYAIY  50



>sp|Q9ARD5.1|LT02_HORVU RecName: Full=Low temperature-induced protein lt101.2 [Hordeum 
vulgare]
 emb|CAC37082.1| putative membrane protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87033.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=54

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S TF+E++LAI+LPPVGVFLRYG  VEFWI LLLT+LGYIPGIIYA+Y
Sbjct  1    MASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVY  50



>ref|XP_002993150.1| hypothetical protein SELMODRAFT_229736 [Selaginella moellendorffii]
 gb|EFJ05790.1| hypothetical protein SELMODRAFT_229736 [Selaginella moellendorffii]
Length=54

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M   TF+++LLAI+LPP+GVFLR+GC +EFWI LLLTILGYIPGIIYAIY
Sbjct  1    MAGATFIDVLLAIILPPLGVFLRFGCAIEFWICLLLTILGYIPGIIYAIY  50



>ref|XP_009134856.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa]
 emb|CDX74126.1| BnaA03g29210D [Brassica napus]
Length=55

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T VEIL+AILLPP+GVFL++GC VEFWI L+LT+LGYIPGIIYA+Y
Sbjct  1    MGAATVVEILIAILLPPLGVFLKFGCSVEFWICLILTLLGYIPGIIYAVY  50



>sp|P68178.1|ESI3_THIEL RecName: Full=Salt stress-induced hydrophobic peptide ESI3 [Lophopyrum 
elongatum]
 sp|P68179.1|LT01_HORVU RecName: Full=Low temperature-induced protein lt101.1; AltName: 
Full=Blt101.1; Short=Blt101 [Hordeum vulgare]
 emb|CAA80984.1| 54 amino acids [Hordeum vulgare subsp. vulgare]
 gb|AAA21847.1| salt-stress induced hydrophobic peptide [Lophopyrum elongatum]
 dbj|BAB03288.1| hydrophobic polypeptide [Triticum aestivum]
 emb|CAC37081.1| putative membrane protein [Hordeum vulgare subsp. vulgare]
 dbj|BAE07207.1| plasma membrane protein [Triticum aestivum]
 dbj|BAJ85904.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT15832.1| Low temperature-induced protein [Aegilops tauschii]
Length=54

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS T +E++LAI+LPPVGVFLRY  GVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVY  50



>gb|AER00467.1| BLT101 [Dasypyrum villosum]
 gb|AER00468.1| BLT101 [Dasypyrum villosum]
Length=54

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS T +E++LAI+LPPVGVFLRY  GVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVY  50



>gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza]
Length=54

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TF++I++AILLPP+GVFL++GCG EFWI L+LT+ GYIPGIIYAIY
Sbjct  1    MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLFGYIPGIIYAIY  50



>gb|ABK96638.1| unknown [Populus trichocarpa x Populus deltoides]
Length=54

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S  FV+ILLAI+LPP+GVFL++GCG EFWI LLLTILGYIP IIYA+Y
Sbjct  1    MSSTNFVDILLAIILPPLGVFLKFGCGAEFWICLLLTILGYIPEIIYAVY  50



>ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum]
 gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum]
Length=111

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TFVEI+LAI+LPP+GVFL++GC +EFWI L+LT+LGY+PGIIYA+Y
Sbjct  57   MGTATFVEIILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYALY  106



>emb|CDY49985.1| BnaC03g34420D [Brassica napus]
Length=55

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T VEIL+AILLPP+GVFL++GC VEFW+ L+LT+LGYIPGIIYA+Y
Sbjct  1    MGAATVVEILIAILLPPLGVFLKFGCSVEFWVCLILTLLGYIPGIIYAVY  50



>ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=54

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T V+I++AILLPP+GVFLR+GCGVEFWI L+LT+LGYIPGI+YA+Y
Sbjct  1    MGTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGILYALY  50



>gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata]
Length=54

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS TFV+I++AILLPP+GVFL++GC VEFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIY  50



>ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum]
Length=54

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T V+I+LAI+LPP+GVFL++GC VEFWI L+LTILGY+PGIIYAIY
Sbjct  1    MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIY  50



>gb|AHL20265.1| stress-induced protein [Olea europaea]
Length=58

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++I++AILLPP+GVFLRYGC VEFWI LLLTILGY+PGIIYA+Y
Sbjct  5    GTATCIDIIVAILLPPLGVFLRYGCKVEFWICLLLTILGYLPGIIYAVY  53



>ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis]
 ref|XP_009417777.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis]
Length=54

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++IL+AI+LPP+GVFL++GC VEFW+ LLLTILGYIPGIIYAIY
Sbjct  1    MGTATCIDILVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPGIIYAIY  50



>ref|XP_001765492.1| predicted protein [Physcomitrella patens]
 gb|AAR87656.1| small hydrophobic protein 2 [Physcomitrella patens]
 gb|EDQ69753.1| predicted protein [Physcomitrella patens]
Length=58

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            + TF E+LLAILLPP+GVFLRY CG+EFWI LLLTILGYIPGI+YA+Y
Sbjct  7    TATFCEVLLAILLPPLGVFLRYACGLEFWICLLLTILGYIPGILYALY  54



>gb|EMT15831.1| Low temperature-induced protein [Aegilops tauschii]
Length=54

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S TF+E++LAI+LPPVGVFLR G  VEFWI LLLT+LGYIPGIIYA+Y
Sbjct  1    MASATFIEVILAIILPPVGVFLRSGLAVEFWICLLLTLLGYIPGIIYAVY  50



>ref|XP_001764858.1| predicted protein [Physcomitrella patens]
 gb|EDQ70300.1| predicted protein [Physcomitrella patens]
Length=54

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TFVEI+LAI LPP+GVFLRY  G EFWI LLLTILGYIPGI+YA+Y
Sbjct  1    MGAATFVEIILAIFLPPLGVFLRYSIGAEFWICLLLTILGYIPGILYALY  50



>ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatula]
 gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula]
 gb|AES82350.1| low temperature and salt responsive family protein [Medicago 
truncatula]
 gb|AFK36815.1| unknown [Medicago truncatula]
Length=54

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I+LAI+LPP+GVFL++GC VEFWI L+LTILGY+PGIIYAIY
Sbjct  1    MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIY  50



>gb|AAQ84111.1| Clt1 [Citrus trifoliata]
Length=54

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T V+I+LA++LPP+GVFL++GC  EFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVY  50



>gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa]
Length=54

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T V+I+LAI+LPP+GVFL++GC VEFWI L+LTILGY+PGI+YAIY
Sbjct  1    MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAIY  50



>ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica]
 gb|EMJ07382.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica]
Length=93

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TFV+I++AILLPP+GVFL++GC  EFWI L+LT+ GY+PGIIYAIY
Sbjct  40   MGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIY  89



>ref|XP_006382256.1| hypothetical protein POPTR_0005s00390g [Populus trichocarpa]
 gb|ERP60053.1| hypothetical protein POPTR_0005s00390g [Populus trichocarpa]
Length=55

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++IL+AI+LPP+GVFLR+GCGVEFWI LLLTILGYIPGIIYA+Y
Sbjct  3    GAVKCIDILIAIILPPLGVFLRFGCGVEFWICLLLTILGYIPGIIYAVY  51



>ref|XP_010674472.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris]
 ref|XP_010674473.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris]
Length=54

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TF++I+LAI+LPP+GVFL+YGC VEFWI L+LT+LGY+PGIIYAI+
Sbjct  1    MSTATFIDIILAIILPPLGVFLKYGCKVEFWICLVLTLLGYLPGIIYAIW  50



>ref|XP_004302326.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. 
vesca]
Length=54

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T V+I++AILLPP+GVFLR+GCGVEFWI L+LT+ GY+PGIIYAI+
Sbjct  1    MGAATCVDIIIAILLPPLGVFLRFGCGVEFWICLILTLCGYLPGIIYAIW  50



>ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica]
 gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica]
Length=57

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+  F++IL+AILLPP+GVFL++GC VEFWI LLLTI GYIPGIIYA+Y
Sbjct  5    GTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVY  53



>ref|XP_008370336.1| PREDICTED: hydrophobic protein RCI2A-like [Malus domestica]
Length=57

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+  FV+IL+AILLPP+GVFL++GC VEFWI LLLTI GYIPGIIYAIY
Sbjct  5    GTLNFVDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIY  53



>gb|AEJ20974.1| cold-inducible protein [Caragana jubata]
Length=54

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I+LAI+LPP+GVFL++GC VEFWI L+LTILGYIPGI+YA+Y
Sbjct  1    MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLVLTILGYIPGILYALY  50



>ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina]
 gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina]
Length=104

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +3

Query  90   NRIEREIMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            N+ +     + T V+ILLA++LPP+GVFL++GC  EFWI LLLTILGYIPGIIYA+Y
Sbjct  43   NQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVY  99



>ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. 
vesca]
Length=57

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+  F++I++AILLPP+GVFL++GC VEFWI LLLTI GYIPGIIYAIY
Sbjct  5    GTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIY  53



>ref|XP_011087564.1| PREDICTED: hydrophobic protein RCI2B [Sesamum indicum]
Length=57

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++ILLAI+LPP+GVFL++GC VEFWI LLLTI GYIPGIIYAIY
Sbjct  4    GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAIY  52



>ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max]
Length=104

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 4/60 (7%)
 Frame = +3

Query  93   RIEREIM----GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            R  RE      G+ T ++ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  41   RKSRETKMAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVY  100



>ref|XP_008246327.1| PREDICTED: hydrophobic protein RCI2B [Prunus mume]
Length=54

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TFV+I++AILLPP+GVFL++GC  EFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIY  50



>gb|EYU35366.1| hypothetical protein MIMGU_mgv1a017610mg [Erythranthe guttata]
Length=56

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + TF++IL+AI+LPP+GVFLR+GCG+EFWI L+LT+ GY+PGIIYA+Y
Sbjct  4    NTATFIDILVAIILPPLGVFLRFGCGIEFWICLILTLFGYVPGIIYAVY  52



>ref|XP_008246326.1| PREDICTED: hydrophobic protein LTI6B-like [Prunus mume]
Length=57

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+  FV+IL+AILLPP+GVFL++GC VEFWI LLLT  GYIPGIIYA+Y
Sbjct  5    GTANFVDILIAILLPPLGVFLKFGCHVEFWICLLLTFFGYIPGIIYAVY  53



>gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
Length=67

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TFVEI+LAI+LPP+GVFL++GC VEFWI L+LT+ GY+PGI+YA+Y
Sbjct  1    MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALY  50



>ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. 
malaccensis]
Length=54

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T +++L+AI+LPP+GVFL++GC VEFW+ LLLTILGYIPGIIYA+Y
Sbjct  1    MGTATCLDLLVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPGIIYAVY  50



>ref|NP_001107634.1| LOC100135422 [Zea mays]
 gb|ABY71210.1| early drought induced protein [Zea mays]
 gb|ACG26762.1| hydrophobic protein LTI6B [Zea mays]
 gb|ACG33537.1| hydrophobic protein LTI6B [Zea mays]
Length=58

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   V+IL+AI+LPP+GVFL+YGCG EFWI LLLT LGYIPGIIYAIY
Sbjct  4    GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLTFLGYIPGIIYAIY  52



>ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
lyrata subsp. lyrata]
Length=67

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TFVEI+LAI+LPP+GVFL++GC VEFWI L+LT+ GY+PGI+YA+Y
Sbjct  1    MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALY  50



>dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis]
Length=54

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+   ++I+LAI+LPP+GVFL++GCG EFWI LLLT LGYIPGIIYAIY
Sbjct  1    MGTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIY  50



>ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana]
 sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature 
and salt-responsive protein LTI6B [Arabidopsis thaliana]
 gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis 
thaliana]
 gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana]
 gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
 gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana]
 gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive 
protein LTI6B) [Arabidopsis thaliana]
 dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
 gb|ABG25095.1| At3g05890 [Arabidopsis thaliana]
 dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
 gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana]
Length=54

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TFVEI+LAI+LPP+GVFL++GC VEFWI L+LT+ GY+PGI+YA+Y
Sbjct  1    MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALY  50



>gb|ACN26849.1| unknown [Zea mays]
 gb|AFW57543.1| naCl stress protein1 [Zea mays]
Length=58

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   V+IL+AI+LPP+GVFL+YGCG EFWI LLLT LGYIPGIIYAIY
Sbjct  4    GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLTFLGYIPGIIYAIY  52



>ref|XP_007163285.1| hypothetical protein PHAVU_001G221700g [Phaseolus vulgaris]
 gb|ESW35279.1| hypothetical protein PHAVU_001G221700g [Phaseolus vulgaris]
Length=57

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T ++ILLAI+LPP+GVFL++GC VEFWI LLLTILGYIPGIIYA+Y
Sbjct  5    STATCIDILLAIILPPLGVFLKHGCKVEFWICLLLTILGYIPGIIYAVY  53



>ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera]
Length=57

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++ILLAI+LPP+GVFL++GC VEFWI LLLT+ GYIPGIIYAIY
Sbjct  5    GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYIPGIIYAIY  53



>ref|XP_008350586.1| PREDICTED: hydrophobic protein RCI2B-like [Malus domestica]
Length=54

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS TF++I++AILLPP+GVFL+Y C  EFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGSATFIDIIIAILLPPLGVFLKYECRAEFWICLVLTLFGYLPGIIYAIY  50



>gb|EPS73096.1| stress-induced hydrophobic peptide [Genlisea aurea]
Length=57

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++IL+AI+LPP+GVFL+YGCG+EFWI+L+LT+ GY+PGIIYA+Y
Sbjct  5    GTATCIDILVAIILPPLGVFLKYGCGIEFWISLILTLFGYLPGIIYAVY  53



>gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas]
 gb|KDP23328.1| hypothetical protein JCGZ_23161 [Jatropha curcas]
Length=57

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++ILLA++LPP+GVFL++GC  EFWI LLLTILGYIPGIIYA+Y
Sbjct  5    GTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVY  53



>ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis]
 gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis]
Length=56

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  4    GAATCIDILLAIILPPLGVFLKYGCKVEFWICLILTLFGYIPGIIYAVY  52



>ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis]
 gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 gb|KDO56401.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis]
 gb|KDO56402.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis]
Length=58

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++I+LAI+LPP+GVFL++GC VEFWI LLLTI GYIPGIIYA+Y
Sbjct  5    GTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVY  53



>gb|ACU14699.1| unknown [Glycine max]
Length=57

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T+++ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  5    STATYIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVY  53



>ref|XP_009365454.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
 ref|XP_009335545.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
Length=54

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG  TF+EI+LAILLPP+GVFL+Y C  EFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGRATFLEIILAILLPPLGVFLKYECRAEFWICLVLTLFGYLPGIIYAIY  50



>ref|XP_003536025.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max]
 gb|KHN24195.1| Hydrophobic protein LTI6A [Glycine soja]
Length=57

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  5    GAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVY  53



>gb|ACU14681.1| unknown [Glycine max]
Length=57

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  5    GAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVY  53



>gb|ACU14391.1| unknown [Glycine max]
 gb|KHN26202.1| Hydrophobic protein LTI6A [Glycine soja]
Length=57

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  5    GAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVY  53



>ref|XP_008776670.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera]
 ref|XP_008776671.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera]
Length=57

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++IL+AI+LPP+GVFL++GC  EFWI LLLTILGYIPGIIYA+Y
Sbjct  5    GTATCLDILIAIILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVY  53



>ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480342.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Citrus 
sinensis]
 gb|KDO56403.1| hypothetical protein CISIN_1g035437mg [Citrus sinensis]
 gb|KDO56404.1| hypothetical protein CISIN_1g035437mg [Citrus sinensis]
Length=58

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T V+ILLA++LPP+GVFL++GC  EFWI LLLTILGYIPGIIYA+Y
Sbjct  5    STATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVY  53



>ref|XP_009366018.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri]
 ref|XP_009366019.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri]
Length=54

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T V+I++AILLPP+GVFLR+GC  EFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIY  50



>ref|XP_001751863.1| predicted protein [Physcomitrella patens]
 gb|EDQ83298.1| predicted protein [Physcomitrella patens]
Length=58

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            + T  EILLAI LPP+GVF +Y CGVEFWI LLLTILGYIPGIIYA+Y
Sbjct  7    AATLCEILLAIFLPPLGVFFKYNCGVEFWICLLLTILGYIPGIIYALY  54



>gb|ABK22915.1| unknown [Picea sitchensis]
 gb|ABK25743.1| unknown [Picea sitchensis]
 gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis]
Length=59

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   V+I+LAI+LPPVGVFL++GC  EFWI LLLTILGY+PGI+YAIY
Sbjct  4    GTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLTILGYLPGIVYAIY  52



>ref|XP_002993149.1| hypothetical protein SELMODRAFT_136629 [Selaginella moellendorffii]
 gb|EFJ05789.1| hypothetical protein SELMODRAFT_136629 [Selaginella moellendorffii]
Length=58

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            + T +EILLAILLPPVGVF +YGC +EFWI LLLT+ GYIPGIIYA+Y
Sbjct  6    TATCLEILLAILLPPVGVFFKYGCEIEFWICLLLTVFGYIPGIIYAVY  53



>ref|XP_009365456.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
 ref|XP_009335547.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
Length=54

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TF++I++AILLPP+GVFL+Y C  EFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGTATFIDIIIAILLPPLGVFLKYECRAEFWICLVLTLFGYLPGIIYAIY  50



>ref|XP_010070102.1| PREDICTED: hydrophobic protein LTI6A-like [Eucalyptus grandis]
Length=57

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 2/52 (4%)
 Frame = +3

Query  111  MGSETF--VEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M   TF  ++IL+AILLPP+GVFL+YGC +EFWI LLLTILGY+PGIIYAI+
Sbjct  1    MSDSTFTCIDILVAILLPPLGVFLKYGCKIEFWICLLLTILGYLPGIIYAIW  52



>gb|ACH60980.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60983.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60991.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60995.1| rare cold inducible protein [Pseudotsuga menziesii]
Length=62

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +3

Query  96   IEREIMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            I RE  G+ TF++ILLAI+LPP+GVFL+Y C  EFW+ LLLT+ GY+PGIIYAIY
Sbjct  4    IMRE--GTATFIDILLAIILPPLGVFLKYECHAEFWLCLLLTLFGYLPGIIYAIY  56



>gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indica Group]
 gb|EEE62260.1| hypothetical protein OsJ_17047 [Oryza sativa Japonica Group]
Length=92

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++IL+AI+LPP+GVFL++GCG EFWI LLLT LGYIPGIIYAIY
Sbjct  3    GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIY  51



>ref|XP_010094907.1| Hydrophobic protein LTI6A [Morus notabilis]
 gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis]
Length=57

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             GS T V+ILLAI+LPP+GVFL++GC  EFWI LLLT+ GY+PGIIYA+Y
Sbjct  4    QGSATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVY  53



>ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG30991.1| hydrophobic protein LTI6A [Zea mays]
Length=56

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ TF++I+LAI+LPP+GVF ++GCGVEFWI L+LT  GY+PGIIYA++
Sbjct  4    GTATFIDIILAIILPPLGVFFKFGCGVEFWICLILTFFGYLPGIIYAVW  52



>ref|XP_008370335.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica]
 ref|XP_008345581.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica]
Length=54

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I++AILLPP+GVFLR+GC  EFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIY  50



>ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobroma cacao]
 gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao]
Length=58

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T V+ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  5    STATCVDILLAIILPPLGVFLKYGCEVEFWICLVLTLFGYIPGIIYAVY  53



>ref|XP_009366021.1| PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri]
 ref|XP_009366022.1| PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri]
Length=54

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I+LAILLPP+GVFLR+GC  EFWI L+LT+ GYIPGI+YA+Y
Sbjct  1    MGTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLTLFGYIPGILYALY  50



>ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group]
 sp|Q0DKW8.1|LTI6B_ORYSJ RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced 
protein 6B [Oryza sativa Japonica Group]
 sp|A2Y075.2|LTI6B_ORYSI RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced 
protein 6B [Oryza sativa Indica Group]
 gb|AAM46894.1|AF503583_1 early drought induced protein [Oryza sativa Indica Group]
 gb|AAS72306.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group]
 gb|AAT37942.1| low temperature-induced low molecular weight integral membrane 
protein LTI6b [Oryza sativa Japonica Group]
 dbj|BAF16505.1| Os05g0138300 [Oryza sativa Japonica Group]
Length=55

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++IL+AI+LPP+GVFL++GCG EFWI LLLT LGYIPGIIYAIY
Sbjct  3    GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIY  51



>ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B [Brachypodium distachyon]
 dbj|BAK03378.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48019.1| Hydrophobic protein LTI6B [Triticum urartu]
Length=55

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++I+LAI+LPP+GVFL++GCG EFWI LLLT LGYIPGIIYAIY
Sbjct  3    GTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIY  51



>ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max]
 gb|KHN14207.1| Hydrophobic protein LTI6A [Glycine soja]
Length=57

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T ++ILLAI+LPP+GVFL+YGC VEFWI L+LT+ GYIPGIIYA+Y
Sbjct  5    STATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVY  53



>ref|XP_008339336.1| PREDICTED: hydrophobic protein RCI2B-like [Malus domestica]
Length=54

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG  TF+EI+LAILLPP+GVFL+Y C  EFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGRATFLEIVLAILLPPLGVFLQYECREEFWICLVLTLFGYLPGIIYAIY  50



>ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatula]
 gb|ABD33189.1| Protein of unknown function UPF0057; Bacterial extracellular 
solute-binding protein, family 3 [Medicago truncatula]
 gb|AES82349.1| low temperature and salt responsive family protein [Medicago 
truncatula]
Length=54

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TFV+I+L+ILLPP+GVFL++G  VEFWI L+LT+ GY+PGIIYAIY
Sbjct  1    MGTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLFGYLPGIIYAIY  50



>gb|ACH61000.1| rare cold inducible protein [Pseudotsuga macrocarpa]
Length=62

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +3

Query  96   IEREIMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            I RE  G+ TF++ILLAI+LPP+GVFL+Y C  EFW+ LLLT+ GY+PGIIYA+Y
Sbjct  4    IMRE--GTATFIDILLAIILPPLGVFLKYECHAEFWLCLLLTMFGYLPGIIYALY  56



>ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa acuminata subsp. malaccensis]
Length=57

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             G+   +EILLAI+LPP+GVFL++GC VEFWI LLLT+ GY+PGIIYA+Y
Sbjct  4    QGTARCIEILLAIILPPLGVFLKFGCKVEFWICLLLTLFGYLPGIIYAVY  53



>gb|ACH60977.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60978.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60979.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60981.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60982.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60984.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60985.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60986.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60987.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60988.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60989.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60990.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60992.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60993.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60994.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60996.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60997.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60998.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60999.1| rare cold inducible protein [Pseudotsuga menziesii]
Length=62

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +3

Query  96   IEREIMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            I RE  G+ TF++ILLAI+LPP+GVFL+Y C  EFW+ LLLT+ GY+PGIIYA+Y
Sbjct  4    IMRE--GTATFIDILLAIILPPLGVFLKYECHAEFWLCLLLTLFGYLPGIIYALY  56



>gb|EMS45020.1| Hydrophobic protein OSR8 [Triticum urartu]
Length=73

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            S TFVEILLA++LPP+GVFLRYGC  +EF I LLLTILGYIPGIIYAIY
Sbjct  5    SCTFVEILLAVILPPLGVFLRYGCCSMEFLICLLLTILGYIPGIIYAIY  53



>gb|AFP99877.1| plasma membrane protein Am244 [Avicennia marina]
 gb|AGI62243.1| plasma membrane protein [Avicennia marina]
Length=57

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++I++AILLPP+GVFL+YGC  EFWI LLLTILGYIPGIIYA++
Sbjct  4    GTATCIDIVVAILLPPLGVFLKYGCKGEFWICLLLTILGYIPGIIYAVW  52



>gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes songorica]
Length=57

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ + ++IL+AI+LPP+GVFL++GCG EFWI LLLT LGY+PGIIYA+Y
Sbjct  5    GTASCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYLPGIIYAVY  53



>gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum]
Length=57

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T ++ILLAI+LPP+GVFL++GC VEFWI L+LT+ GYIPGIIYAIY
Sbjct  5    STATCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLFGYIPGIIYAIY  53



>ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria 
italica]
Length=57

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   V+IL+AI+LPP+GVFL++GC VEFW+ LLLT LGY+PGIIYAIY
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLGYLPGIIYAIY  52



>ref|XP_002440557.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor]
 gb|EES18987.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor]
Length=57

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   V+IL+AI+LPP+GVFL++GCG +FWI LLLT LGY+PGIIYA+Y
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCGHQFWICLLLTFLGYLPGIIYAVY  52



>gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group]
Length=57

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++ILLAI+LPP+GVFL++GC +EFWI LLLT+ GYIPGIIYA+Y
Sbjct  5    GTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVY  53



>emb|CDY71166.1| BnaCnng71680D [Brassica napus]
Length=52

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+EIL AI +PPVGVFLR+GCG+EFW++LLLT LG++PG++YAI+
Sbjct  1    MGS--FIEILCAIFMPPVGVFLRFGCGLEFWLSLLLTFLGFVPGMVYAIW  48



>gb|ADE77881.1| unknown [Picea sitchensis]
Length=53

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +   ++ILLAI+LPP+GVFL++GC  EFWI LLLTILGYIPGIIYA+Y
Sbjct  2    AANCLDILLAIILPPLGVFLKFGCNAEFWICLLLTILGYIPGIIYAVY  49



>ref|NP_001152633.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACF80942.1| unknown [Zea mays]
 gb|ACG25252.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG48645.1| hydrophobic protein LTI6A [Zea mays]
 tpg|DAA63802.1| TPA: hydrophobic protein LTI6A [Zea mays]
Length=56

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++I+LAI+LPP+GVF ++GCGVEFWI L+LT LGY+PGIIYA++
Sbjct  4    GTATCIDIILAIILPPLGVFFKFGCGVEFWICLILTFLGYLPGIIYAVW  52



>ref|XP_001776246.1| predicted protein [Physcomitrella patens]
 gb|AAR87655.1| small hydrophobic protein 1 [Physcomitrella patens]
 gb|EDQ58879.1| predicted protein [Physcomitrella patens]
Length=59

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ TFV++LLAI+LPP+GVFL+YG   EFWI L+LTILGY+PGIIYAIY
Sbjct  7    GAYTFVDVLLAIILPPLGVFLKYGLQSEFWICLVLTILGYLPGIIYAIY  55



>ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatula]
Length=83

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I++AI+LPP+GVFL++GC VEFW+ L+LT+ GY+PGI+YAIY
Sbjct  1    MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIY  50



>gb|KCW44804.1| hypothetical protein EUGRSUZ_L01633, partial [Eucalyptus grandis]
Length=117

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 19/99 (19%)
 Frame = +3

Query  3    TSPLPLPLFINI------HAVDKGYCSLRFQLR*INRIEREI-------MGSETFVEILL  143
            + PLP PL  ++       +  K  CS          ++RE         G+   ++ILL
Sbjct  21   SCPLPFPLDFSVFLSIFSSSFRKRICST------FTSVKREKGTGKMADEGTMNCIDILL  74

Query  144  AILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            AI+LPP+GVFL++GC VEFWI L+LT+ G+IPGIIYA+Y
Sbjct  75   AIILPPLGVFLKFGCQVEFWICLVLTLFGWIPGIIYAVY  113



>ref|XP_010040901.1| PREDICTED: hydrophobic protein LTI6B-like [Eucalyptus grandis]
Length=57

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             +   V+ILLAI+LPP+GVFL++GC VEFWI +LLTILG+IPGIIYAIY
Sbjct  5    STMNCVDILLAIILPPLGVFLKFGCQVEFWICVLLTILGWIPGIIYAIY  53



>ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria 
italica]
Length=56

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   V+IL+AI+LPP+GVFL++GC  EFWI LLLT LGY+PGIIYAIY
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIY  52



>gb|ABQ41924.1| low temperature and salt responsive protein [Sonneratia alba]
 gb|ABQ41925.1| low temperature and salt responsive protein [Sonneratia caseolaris]
 gb|ABQ41926.1| low temperature and salt responsive protein [Sonneratia ovata]
Length=45

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAI  257
            T ++ILLAI+LPP+GVFL+YGC  EFWI LLLTILGYIPGIIYA+
Sbjct  1    TCIDILLAIILPPLGVFLKYGCKAEFWICLLLTILGYIPGIIYAV  45



>gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b]
Length=726

 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M + TFVEI+LAI+LPP+GVFL++GC VEFWI L+LT+ GY+PGI+YA+Y
Sbjct  673  MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALY  722



>gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago truncatula]
 gb|AES82353.2| low temperature and salt responsive family protein [Medicago 
truncatula]
Length=54

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I++AI+LPP+GVFL++GC VEFW+ L+LT+ GY+PGI+YAIY
Sbjct  1    MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIY  50



>gb|KCW82305.1| hypothetical protein EUGRSUZ_C03713 [Eucalyptus grandis]
Length=142

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 19/99 (19%)
 Frame = +3

Query  3    TSPLPLPL----FINI--HAVDKGYCSLRFQLR*INRIEREI-------MGSETFVEILL  143
            + PLP PL    F++I   +  K  CS          ++RE         G+   ++ILL
Sbjct  46   SCPLPFPLDFSVFLSIFSSSFRKRICST------FTSVKREKGTGKMADEGTMNCIDILL  99

Query  144  AILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            AI+LPP+GVFL++GC VEFWI L+LT+ G+IPGIIYA+Y
Sbjct  100  AIILPPLGVFLKFGCQVEFWICLVLTLFGWIPGIIYAVY  138



>ref|XP_002440556.1| hypothetical protein SORBIDRAFT_09g003050 [Sorghum bicolor]
 gb|EES18986.1| hypothetical protein SORBIDRAFT_09g003050 [Sorghum bicolor]
Length=53

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            S   V+IL+AI+LPP+GVFL++GCG +FWI LLLT LGY+PGIIYA+Y
Sbjct  2    SANCVDILIAIILPPLGVFLKFGCGHQFWICLLLTFLGYLPGIIYAVY  49



>ref|XP_004960430.1| PREDICTED: hydrophobic protein LTI6B-like [Setaria italica]
Length=56

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +   V+IL+AI+LPP+GVFL++GCG EFWI LLLT LGY+PGIIYAIY
Sbjct  5    TANCVDILIAIILPPLGVFLKHGCGHEFWICLLLTFLGYLPGIIYAIY  52



>ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays]
 ref|NP_001152948.1| hydrophobic protein LTI6B [Zea mays]
 gb|ACG43609.1| hydrophobic protein LTI6B [Zea mays]
 gb|ACG44549.1| hydrophobic protein LTI6B [Zea mays]
 tpg|DAA54255.1| TPA: hydrophobic protein LTI6B [Zea mays]
Length=57

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   V+IL+AI+LPP+GVFL++GC VEFW+ LLLT L Y+PGIIYAIY
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLAYLPGIIYAIY  52



>ref|XP_009616085.1| PREDICTED: hydrophobic protein LTI6A-like [Nicotiana tomentosiformis]
Length=56

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++ILLAI+LPP+GVFL++GC  EFWI  LLT+ G++PGIIYAI+
Sbjct  1    MGAMTCIDILLAIILPPLGVFLKFGCKCEFWICCLLTLFGWLPGIIYAIW  50



>ref|XP_009122968.1| PREDICTED: UPF0057 membrane protein At1g57550-like [Brassica 
rapa]
 emb|CDY23796.1| BnaA01g21470D [Brassica napus]
Length=52

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+EIL A+L+PPVGVFLR+GCG+EFW++LLLT  G+IPG++YAI+
Sbjct  1    MGS--FLEILCAVLIPPVGVFLRFGCGLEFWLSLLLTFFGFIPGMVYAIW  48



>gb|KFK40947.1| hypothetical protein AALP_AA2G064700 [Arabis alpina]
Length=52

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+EIL A+L+PPVGVFLR+G G+EFWI+LLLT LGYIPG+IYAI+
Sbjct  1    MGS--FIEILCAVLIPPVGVFLRFGFGLEFWISLLLTFLGYIPGMIYAIW  48



>ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria 
italica]
 ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria 
italica]
Length=56

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++IL+AI+LPP+GVFL++GC  EFWI LLLT LGY+PGIIYAIY
Sbjct  4    GTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIY  52



>ref|XP_009799132.1| PREDICTED: hydrophobic protein LTI6A-like [Nicotiana sylvestris]
Length=56

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++ILLAI+LPP+GVFL++GC  EFWI  LLT+ G++PGIIYAI+
Sbjct  1    MGAMTCIDILLAIILPPLGVFLKFGCKCEFWICCLLTLFGWLPGIIYAIW  50



>ref|XP_010273656.1| PREDICTED: hydrophobic protein OSR8-like [Nelumbo nucifera]
Length=72

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            +E F EIL+AILLPP+GVFLR+GC  VEF I LLLT+LGYIPGIIYAIY
Sbjct  5    TEMFCEILIAILLPPLGVFLRHGCCSVEFCICLLLTMLGYIPGIIYAIY  53



>ref|NP_001147403.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG27364.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG47392.1| hydrophobic protein LTI6A [Zea mays]
Length=56

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++I+LAI+LPP+GVF ++GCGVEFWI L+LT  GY+PGIIYA++
Sbjct  4    GTATCIDIILAIILPPLGVFFKFGCGVEFWICLILTFFGYLPGIIYAVW  52



>emb|CDX80578.1| BnaC07g28660D [Brassica napus]
Length=66

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +   ++I+LAILLPP+GVFL++GC VEFWI L LT LGYIPGIIYAIY
Sbjct  14   TANCIDIVLAILLPPLGVFLKFGCHVEFWICLALTFLGYIPGIIYAIY  61



>ref|XP_004958446.1| PREDICTED: hydrophobic protein LTI6A-like [Setaria italica]
Length=56

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T ++I+LAI+LPP+GVF ++GCGVEFWI L+LT  GY+PGIIYA++
Sbjct  4    GTATCIDIILAIILPPLGVFFKFGCGVEFWICLVLTFFGYLPGIIYAVW  52



>dbj|BAG54794.1| plasma membrance protein3 [Puccinellia tenuiflora]
Length=54

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I+LAI+LPP+GVF ++G G++FWI LLLTILG+IPGI+YA+Y
Sbjct  1    MGTATCMQIILAIILPPLGVFFKHGLGIQFWICLLLTILGFIPGILYALY  50



>ref|XP_010035796.1| PREDICTED: hydrophobic protein RCI2B [Eucalyptus grandis]
Length=58

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + TF++I+LAI+LPP+GVFL++GC VEFWI L+LT+ G++PGIIYA+Y
Sbjct  5    STMTFIDIILAIILPPLGVFLKFGCQVEFWICLVLTLFGWLPGIIYAVY  53



>ref|XP_009774465.1| PREDICTED: hydrophobic protein RCI2B [Nicotiana sylvestris]
Length=56

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + TF++ILLAI+LPP+GVFL++GC  EFWI LLLT+ G++PGI+YAIY
Sbjct  4    STLTFIDILLAIILPPLGVFLKFGCEAEFWICLLLTLFGWLPGIVYAIY  52



>ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta vulgaris subsp. vulgaris]
Length=56

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T ++ILLAI+LPP+GVFL++GC VEFWI L+LT  GY+PGIIYA+Y
Sbjct  4    STATCIDILLAIILPPLGVFLKFGCKVEFWICLVLTFFGYLPGIIYAVY  52



>ref|NP_001147508.1| LOC100281117 [Zea mays]
 gb|ACG27760.1| hydrophobic protein LTI6B [Zea mays]
 gb|AFW79486.1| hydrophobic protein LTI6B [Zea mays]
Length=57

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++IL+AI+LPP+GVFL++GC VEFW+ LLLT L Y+PGIIYAIY
Sbjct  4    GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLAYLPGIIYAIY  52



>gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group]
 gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group]
Length=56

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++IL+AI+LPP+GVFL++GC VEFW+ LLLT  GY+PGIIYA+Y
Sbjct  4    GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFFGYLPGIIYAVY  52



>ref|XP_003578630.1| PREDICTED: hydrophobic protein OSR8 [Brachypodium distachyon]
Length=72

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            G  TF+EILLAI LPP+GVFL YGC  +EF I LLLTILGYIPGIIYAIY
Sbjct  5    GCCTFLEILLAIFLPPLGVFLHYGCCSMEFCICLLLTILGYIPGIIYAIY  54



>tpg|DAA41564.1| TPA: hypothetical protein ZEAMMB73_862570 [Zea mays]
Length=56

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T V+I+LAI+LPP+GVF ++GCG EFWI L+LT  GY+PGIIYA++
Sbjct  4    GTATCVDIILAIILPPLGVFFKFGCGAEFWICLILTFFGYLPGIIYAVW  52



>ref|XP_004306234.1| PREDICTED: hydrophobic protein LTI6A-like [Fragaria vesca subsp. 
vesca]
Length=55

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAI  257
               T  E+LLA+ LPP+GV +RYGCGVEFWI LLLTI GY+PGIIYA+
Sbjct  3    ACATCCELLLAVFLPPLGVVIRYGCGVEFWICLLLTICGYLPGIIYAV  50



>ref|XP_011092211.1| PREDICTED: hydrophobic protein RCI2A-like isoform X2 [Sesamum 
indicum]
Length=57

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + TF++I++AI +PP+GVFL++ CG+EFWI LLLT   YIPGI+YA+Y
Sbjct  5    STATFIDIVVAIFVPPLGVFLKFACGIEFWICLLLTFFAYIPGIVYAVY  53



>tpg|DAA41563.1| TPA: hypothetical protein ZEAMMB73_862570 [Zea mays]
Length=59

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+ T V+I+LAI+LPP+GVF ++GCG EFWI L+LT  GY+PGIIYA++
Sbjct  4    GTATCVDIILAIILPPLGVFFKFGCGAEFWICLILTFFGYLPGIIYAVW  52



>ref|XP_010040900.1| PREDICTED: hydrophobic protein LTI6B-like [Eucalyptus grandis]
Length=55

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++I+LAI+LPP+GVFL++GC VEFWI L+LT+ G+IPGIIYAIY
Sbjct  3    GTMNCIDIILAIILPPLGVFLKFGCQVEFWICLVLTLFGWIPGIIYAIY  51



>gb|EMT25386.1| Hydrophobic protein OSR8 [Aegilops tauschii]
Length=71

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            S TF+EILLAI+LPP+GVFL YGC  +EF I LLLTILGYIPGIIYA+Y
Sbjct  5    SCTFLEILLAIILPPLGVFLHYGCCSMEFCICLLLTILGYIPGIIYAVY  53



>ref|XP_008776672.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera]
 ref|XP_008776673.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera]
Length=57

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++ILLAI+LPP+GVFL++GC VEFW+ L+LT+ GY+PGIIYAIY
Sbjct  5    GTVNCIDILLAIILPPLGVFLKFGCKVEFWLCLVLTLFGYLPGIIYAIY  53



>ref|XP_011092210.1| PREDICTED: hydrophobic protein RCI2A-like isoform X1 [Sesamum 
indicum]
Length=76

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + TF++I++AI +PP+GVFL++ CG+EFWI LLLT   YIPGI+YA+Y
Sbjct  5    STATFIDIVVAIFVPPLGVFLKFACGIEFWICLLLTFFAYIPGIVYAVY  53



>emb|CDY31781.1| BnaC01g27370D [Brassica napus]
Length=52

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+EIL A+L+PP+GVFLR+GCG+EFW++LLLT  G+IPG++YAI+
Sbjct  1    MGS--FLEILCAVLIPPLGVFLRFGCGLEFWLSLLLTFFGFIPGMVYAIW  48



>ref|XP_009113358.1| PREDICTED: UPF0057 membrane protein At1g57550 [Brassica rapa]
 emb|CDY71498.1| BnaAnng37700D [Brassica napus]
Length=52

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+EIL AI +PPVGVFL++GCG+EFW++LLLT  G++PG++YAI+
Sbjct  1    MGS--FIEILCAIFIPPVGVFLKFGCGLEFWLSLLLTFFGFVPGVVYAIW  48



>ref|NP_001063909.1| Os09g0558100 [Oryza sativa Japonica Group]
 sp|Q9LRI7.1|OSR8_ORYSJ RecName: Full=Hydrophobic protein OSR8 [Oryza sativa Japonica 
Group]
 dbj|BAB03289.1| hydrophobic polypeptide [Oryza sativa]
 dbj|BAD45939.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25823.1| Os09g0558100 [Oryza sativa Japonica Group]
 gb|EAZ10060.1| hypothetical protein OsI_32364 [Oryza sativa Indica Group]
 dbj|BAG88303.1| unnamed protein product [Oryza sativa Japonica Group]
Length=72

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            TF+EILLAI+LPP+GVFLR+GC  +EF I LLLTILGY+PGIIYA+Y
Sbjct  8    TFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVY  54



>gb|EAZ45644.1| hypothetical protein OsJ_30312 [Oryza sativa Japonica Group]
Length=72

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            TF+EILLAI+LPP+GVFLR+GC  +EF I LLLTILGY+PGIIYA+Y
Sbjct  8    TFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVY  54



>dbj|BAJ90014.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87210.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=71

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            S TF+EIL AI+LPP+GVFLR+GC  +EF I LLLTILGYIPGIIYA+Y
Sbjct  5    SCTFLEILFAIILPPLGVFLRFGCCSMEFCICLLLTILGYIPGIIYAVY  53



>gb|AAV88601.1| low temperature and salt responsive protein [Cenchrus americanus]
Length=56

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++I+LAI+LPP+GVF ++GCGVEFWI L+LT  GY+PGIIYA++
Sbjct  4    GTANCIDIILAIILPPLGVFFKFGCGVEFWICLVLTFFGYLPGIIYAVW  52



>ref|XP_002460652.1| hypothetical protein SORBIDRAFT_02g032580 [Sorghum bicolor]
 gb|EER97173.1| hypothetical protein SORBIDRAFT_02g032580 [Sorghum bicolor]
Length=72

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 1/47 (2%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            TF+EILLAI+LPP+GVFLR+GC  +EF I LLLTILGYIPG+IYAIY
Sbjct  8    TFLEILLAIILPPLGVFLRFGCCRIEFCICLLLTILGYIPGMIYAIY  54



>ref|NP_001060390.1| Os07g0635900 [Oryza sativa Japonica Group]
 sp|Q8H5T6.1|LTI6A_ORYSJ RecName: Full=Hydrophobic protein LTI6A; AltName: Full=Low temperature-induced 
protein 6A [Oryza sativa Japonica Group]
 dbj|BAC16385.1| putative low temperature and salt responsive protein [Oryza sativa 
Japonica Group]
 gb|AAS72305.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group]
 gb|AAT37941.1| low temperature-induced low molecular weight integral membrane 
protein LTI6a [Oryza sativa Japonica Group]
 dbj|BAF22304.1| Os07g0635900 [Oryza sativa Japonica Group]
 gb|EAZ04833.1| hypothetical protein OsI_27011 [Oryza sativa Indica Group]
 gb|EAZ40796.1| hypothetical protein OsJ_25274 [Oryza sativa Japonica Group]
 gb|ABR25530.1| hydrophobic protein lti6b [Oryza sativa Indica Group]
 dbj|BAH00311.1| unnamed protein product [Oryza sativa Japonica Group]
Length=56

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T ++I+LAI+LPP+GVF ++GCG+EFWI LLLT  GY+PGIIYA++
Sbjct  4    STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVW  52



>ref|NP_001054506.1| Os05g0122700 [Oryza sativa Japonica Group]
 gb|AAS72368.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF16420.1| Os05g0122700 [Oryza sativa Japonica Group]
 gb|EAY96358.1| hypothetical protein OsI_18257 [Oryza sativa Indica Group]
 dbj|BAH01075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62155.1| hypothetical protein OsJ_16942 [Oryza sativa Japonica Group]
Length=54

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+EILLAILLPP+GVFLRYG G+EFWIALLLTILGY+PGIIYA+Y
Sbjct  1    MGSETFLEILLAILLPPLGVFLRYGIGMEFWIALLLTILGYLPGIIYAVY  50



>ref|XP_009611658.1| PREDICTED: hydrophobic protein RCI2B-like [Nicotiana tomentosiformis]
Length=56

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            TF++ILLAI+LPP+GVFL++GC  EFWI +LLT+ G++PGI+YAIY
Sbjct  7    TFIDILLAIILPPLGVFLKFGCEAEFWICVLLTLFGWLPGIVYAIY  52



>ref|XP_003557909.1| PREDICTED: hydrophobic protein LTI6A [Brachypodium distachyon]
Length=56

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + TF++++LAI+LPP+GVFL+YGC +EFWI L+L+  GY+PGIIYA++
Sbjct  4    NTATFIDLILAIILPPLGVFLKYGCEIEFWICLVLSFFGYLPGIIYAVW  52



>ref|XP_004960342.1| PREDICTED: low temperature-induced protein lt101.2-like [Setaria 
italica]
Length=54

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGSETF+EILLAILLPP+GVFLRYG GVEFWI LLLTILGYIPGIIYA+Y
Sbjct  1    MGSETFLEILLAILLPPLGVFLRYGIGVEFWICLLLTILGYIPGIIYAVY  50



>gb|EYU35348.1| hypothetical protein MIMGU_mgv1a017511mg [Erythranthe guttata]
Length=70

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            G  TF EIL+AILLPP+GV LR+GC  VEF I L+LTILGYIPGIIYA+Y
Sbjct  3    GCATFCEILIAILLPPLGVCLRHGCCSVEFCICLVLTILGYIPGIIYALY  52



>gb|KDO59494.1| hypothetical protein CISIN_1g034455mg [Citrus sinensis]
Length=94

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +3

Query  120  ETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            E F EILLA+LLPPVGV LR+GC  VEF I LLLTILGY+PGIIYA+Y
Sbjct  6    EIFCEILLAVLLPPVGVCLRHGCCSVEFCICLLLTILGYVPGIIYALY  53



>ref|XP_004230367.1| PREDICTED: hydrophobic protein LTI6A [Solanum lycopersicum]
 ref|XP_006358520.1| PREDICTED: hydrophobic protein LTI6A-like [Solanum tuberosum]
 dbj|BAC23051.1| low temperature and salt responsive protein [Solanum tuberosum]
Length=56

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 2/52 (4%)
 Frame = +3

Query  111  MGSETF--VEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG  T   V+ILLAI+LPP+GVFL++GC VEFWI +LLT+ G++PGI+YA++
Sbjct  1    MGDSTMTCVDILLAIILPPLGVFLKFGCKVEFWICVLLTLFGWLPGIVYAVW  52



>ref|XP_009589212.1| PREDICTED: hydrophobic protein LTI6A-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009774466.1| PREDICTED: hydrophobic protein LTI6A-like [Nicotiana sylvestris]
Length=56

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 2/52 (4%)
 Frame = +3

Query  111  MGSETF--VEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG  T   V+ILLAI+LPP+GVFL++GC VEFWI +LLT+ G++PGI+YA++
Sbjct  1    MGDSTMTCVDILLAIILPPLGVFLKFGCQVEFWICVLLTLFGWLPGIVYAVW  52



>ref|XP_002279333.3| PREDICTED: hydrophobic protein LTI6A [Vitis vinifera]
 ref|XP_010659763.1| PREDICTED: hydrophobic protein LTI6A [Vitis vinifera]
Length=53

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            + T ++ILLAI+LPP+GVFL++GC  EFWI L+LT  GY+PGI+YA+Y
Sbjct  2    AATCIDILLAIILPPLGVFLKFGCQAEFWICLVLTFFGYLPGIVYAVY  49



>gb|ACJ09630.1| putative early drought-induced protein [Cupressus sempervirens]
Length=96

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  135  ILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            IL+AI+LPP+ VFL+YGCG EFWI LLLT LGYIPGIIYAIY
Sbjct  29   ILIAIILPPLAVFLKYGCGHEFWICLLLTFLGYIPGIIYAIY  70



>ref|XP_002529408.1| Hydrophobic protein OSR8, putative [Ricinus communis]
 gb|EEF33004.1| Hydrophobic protein OSR8, putative [Ricinus communis]
Length=75

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
              E   EIL+AILLPP+GV LR+GC  VEFWI LLLTILGY+PGIIYA+Y
Sbjct  4    KCEILCEILIAILLPPLGVCLRHGCCSVEFWICLLLTILGYVPGIIYALY  53



>gb|ACG26755.1| hypothetical protein [Zea mays]
 gb|ACG31120.1| hypothetical protein [Zea mays]
 tpg|DAA40746.1| TPA: hypothetical protein ZEAMMB73_679573 [Zea mays]
Length=72

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 1/47 (2%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            TF+EIL AI+LPP+GVFLR+GC  +EF I LLLTILGY+PGIIYAIY
Sbjct  8    TFLEILFAIILPPLGVFLRFGCCRIEFCICLLLTILGYVPGIIYAIY  54



>dbj|BAG54793.1| plasma membrance protein3 [Puccinellia tenuiflora]
 dbj|BAJ88867.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS46527.1| Hydrophobic protein LTI6A [Triticum urartu]
 gb|EMT07358.1| Hydrophobic protein LTI6A [Aegilops tauschii]
Length=57

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++I+LAI+LPP+GVF ++ CG+EFWI LLLT  GY+PGIIYA++
Sbjct  5    GTANCIDIILAIILPPLGVFFKFACGIEFWICLLLTFFGYLPGIIYAVW  53



>ref|XP_006453590.1| hypothetical protein CICLE_v10010088mg [Citrus clementina]
 gb|ESR66830.1| hypothetical protein CICLE_v10010088mg [Citrus clementina]
 gb|KDO59495.1| hypothetical protein CISIN_1g034455mg [Citrus sinensis]
Length=76

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F EILLA+LLPPVGV LR+GC  VEF I LLLTILGY+PGIIYA+Y
Sbjct  5    CEIFCEILLAVLLPPVGVCLRHGCCSVEFCICLLLTILGYVPGIIYALY  53



>ref|NP_001050200.1| Os03g0370600 [Oryza sativa Japonica Group]
 gb|AAG46140.1|AC082644_22 putative low temperature and salt responsive protein [Oryza sativa 
Japonica Group]
 gb|ABF96175.1| Hydrophobic protein LTI6B, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12114.1| Os03g0370600 [Oryza sativa Japonica Group]
 gb|EAY90185.1| hypothetical protein OsI_11749 [Oryza sativa Indica Group]
 gb|EAY90188.1| hypothetical protein OsI_11752 [Oryza sativa Indica Group]
 gb|EAZ27072.1| hypothetical protein OsJ_11001 [Oryza sativa Japonica Group]
Length=64

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            + TFV++++AI+LPP+GVFL+ GC +EFWI LLLT LGY PGIIYA++
Sbjct  12   TATFVDLVIAIILPPLGVFLKVGCEIEFWICLLLTFLGYFPGIIYAVW  59



>ref|XP_010047066.1| PREDICTED: UPF0057 membrane protein At4g30660-like [Eucalyptus 
grandis]
 gb|KCW78820.1| hypothetical protein EUGRSUZ_C00250 [Eucalyptus grandis]
Length=75

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            G   F EIL+AILLPP+GV  R+GC  VEFWI +LLTILGYIPGIIYA+Y
Sbjct  4    GCAIFCEILIAILLPPLGVCFRHGCCSVEFWICVLLTILGYIPGIIYALY  53



>gb|ADV02768.1| putative low temperature and salt responsive protein isoform 
1 [Ipomoea batatas]
 gb|ADV02769.1| putative low temperature and salt responsive protein isoform 
2 [Ipomoea batatas]
Length=57

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             + T ++ILLAI+LPP+GVFL++GC VEFWI  LLT+ G++PGI+YAI+
Sbjct  5    STATCIDILLAIILPPLGVFLKFGCQVEFWICCLLTLFGWLPGIVYAIW  53



>ref|XP_006658870.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like 
[Oryza brachyantha]
Length=678

 Score = 74.7 bits (182),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  99   EREIMGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            E+    + T ++I+LAI+LPP+GVF ++GCG+EFWI LLLT  GY+PGIIYA++
Sbjct  621  EKMADSTATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVW  674



>gb|AAV88602.1| low temperature and salt responsive protein [Cenchrus americanus]
Length=83

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = +3

Query  126  FVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            F+EILLAI+LPP+GVFLR+GC  +EF I LLLTILGYIPG+IYAIY
Sbjct  9    FLEILLAIVLPPLGVFLRFGCCSMEFCICLLLTILGYIPGMIYAIY  54



>gb|KDP38695.1| hypothetical protein JCGZ_04048 [Jatropha curcas]
Length=75

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
              E F EIL+A+LLPP+GV LR+GC  VEFW+ +LLTILGY+PGIIYA+Y
Sbjct  4    KCEIFCEILIAVLLPPLGVCLRHGCCSVEFWLCVLLTILGYVPGIIYALY  53



>ref|XP_004230366.1| PREDICTED: hydrophobic protein LTI6A [Solanum lycopersicum]
Length=56

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 2/52 (4%)
 Frame = +3

Query  111  MGSETF--VEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG  T   ++ILLAI+LPP+GVFL++ C VEFWI +LLT+ G++PGIIYAI+
Sbjct  1    MGDNTMTCIDILLAIILPPLGVFLKFNCQVEFWICVLLTLFGWLPGIIYAIW  52



>gb|EMT24455.1| Hydrophobic protein OSR8 [Aegilops tauschii]
Length=73

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCG-VEFWIALLLTILGYIPGIIYAIY  260
            S TF+EILLA++LPP+GVFLRYG G +EF I LLLTILGYIPGIIYA+Y
Sbjct  5    SCTFLEILLAVILPPLGVFLRYGWGRMEFLICLLLTILGYIPGIIYAVY  53



>ref|NP_176067.1| Low temperature and salt responsive protein [Arabidopsis thaliana]
 sp|Q9FE70.1|RC21_ARATH RecName: Full=UPF0057 membrane protein At1g57550 [Arabidopsis 
thaliana]
 gb|AAG09091.1|AC009323_2 Similar to low temperature and salt responsive polypeptides [Arabidopsis 
thaliana]
 gb|AAG50736.1|AC079733_4 salt-stress induced hydrophobic peptide, putative [Arabidopsis 
thaliana]
 gb|ABE65718.1| hydrophobic protein/low temperature and salt responsive protein 
[Arabidopsis thaliana]
 gb|AEE33434.1| Low temperature and salt responsive protein [Arabidopsis thaliana]
Length=52

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+E+L AI +PPVGVFLRYG G+EFW+ LLLT+  +IPG+IYAIY
Sbjct  1    MGS--FLEVLCAIFIPPVGVFLRYGLGLEFWVCLLLTLFAFIPGLIYAIY  48



>ref|XP_010927948.1| PREDICTED: hydrophobic protein OSR8-like [Elaeis guineensis]
 ref|XP_010927949.1| PREDICTED: hydrophobic protein OSR8-like [Elaeis guineensis]
 ref|XP_010927950.1| PREDICTED: hydrophobic protein OSR8-like [Elaeis guineensis]
 ref|XP_010927951.1| PREDICTED: hydrophobic protein OSR8-like [Elaeis guineensis]
Length=75

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 4/54 (7%)
 Frame = +3

Query  111  MGSET---FVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            M SE    F+EIL+AILLPP+GVFLR+GC  +EF I LLLTI GY+PGIIYAIY
Sbjct  1    MASERCCLFLEILVAILLPPLGVFLRHGCCSLEFCICLLLTIFGYVPGIIYAIY  54



>gb|ABK28441.1| unknown [Arabidopsis thaliana]
Length=53

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+E+L AI +PPVGVFLRYG G+EFW+ LLLT+  +IPG+IYAIY
Sbjct  1    MGS--FLEVLCAIFIPPVGVFLRYGLGLEFWVCLLLTLFAFIPGLIYAIY  48



>ref|XP_006474017.1| PREDICTED: UPF0057 membrane protein At4g30660-like isoform X2 
[Citrus sinensis]
Length=76

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F EIL+A+LLPPVGV LR+GC  VEF I LLLTILGY+PGIIYA+Y
Sbjct  5    CEIFCEILIAVLLPPVGVCLRHGCCSVEFCICLLLTILGYVPGIIYALY  53



>ref|XP_006358521.1| PREDICTED: hydrophobic protein LTI6A-like [Solanum tuberosum]
Length=56

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 2/52 (4%)
 Frame = +3

Query  111  MGSETF--VEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG  T   ++ILLAI+LPP+GVFL++ C VEFWI +LLT+ G++PGIIYAI+
Sbjct  1    MGDSTMTCIDILLAIILPPLGVFLKFKCQVEFWICVLLTLFGWLPGIIYAIW  52



>ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 
98AG31]
 gb|EGG08278.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 
98AG31]
Length=57

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +ILLAI+LPP+GVFL  GCG +FWI +LLTILGYIPGII+A+Y
Sbjct  5    ASDICKILLAIVLPPLGVFLERGCGADFWINILLTILGYIPGIIHALY  52



>ref|XP_009122970.1| PREDICTED: UPF0057 membrane protein At1g57550-like [Brassica 
rapa]
 emb|CDY48407.1| BnaAnng09760D [Brassica napus]
Length=52

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 2/50 (4%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MGS  F+EIL A+L+PPVGVFLR+G G+EFW++LLLT  G+ PG+IYAI+
Sbjct  1    MGS--FIEILCAVLIPPVGVFLRFGLGLEFWLSLLLTFFGFFPGLIYAIW  48



>ref|XP_010694118.1| PREDICTED: hydrophobic protein RCI2B-like [Beta vulgaris subsp. 
vulgaris]
Length=54

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M   TF++I+LAI+LPP+GVFL++G   EFWI ++ T  GY+PGIIYA+Y
Sbjct  1    MSDSTFIDIILAIILPPLGVFLKFGIETEFWICVVCTFFGYLPGIIYAVY  50



>ref|XP_010668344.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Beta vulgaris subsp. vulgaris]
Length=54

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAI  257
            MG +T +E++L+I +PP+GVFLRYG  VEFWI L+LT+ GY+PGI+YA+
Sbjct  1    MGLQTVLELVLSIFVPPIGVFLRYGIKVEFWICLVLTLCGYLPGIVYAV  49



>emb|CDY49984.1| BnaC03g34410D [Brassica napus]
Length=54

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TF++ILLAILLPP+GVFLRYGCGVEFWI L+LT+LGY+PGIIYA+Y
Sbjct  1    MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALY  50



>emb|CDI50937.1| conserved hypothetical protein [Melanopsichium pennsylvanicum 
4]
Length=57

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  120  ETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
               V+I+LAI LPP+GVFL  GCG +FWI +LLTILGYIPGII+A+Y
Sbjct  6    SDIVKIILAIFLPPLGVFLERGCGADFWINVLLTILGYIPGIIHALY  52



>ref|XP_009366197.1| PREDICTED: UPF0057 membrane protein At4g30660-like [Pyrus x bretschneideri]
Length=77

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F EIL+AILLPP+GV LR+GC  VEF I LLLT+LGYIPGIIYA+Y
Sbjct  5    CEIFCEILIAILLPPLGVCLRHGCCTVEFCICLLLTLLGYIPGIIYALY  53



>ref|XP_002277561.1| PREDICTED: UPF0057 membrane protein At4g30650 [Vitis vinifera]
 emb|CAN64139.1| hypothetical protein VITISV_004807 [Vitis vinifera]
 emb|CAN73911.1| hypothetical protein VITISV_002031 [Vitis vinifera]
 emb|CBI36543.3| unnamed protein product [Vitis vinifera]
Length=72

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F EIL+AILLPPVGV  R+GC  VEF I LLLT+LGYIPGIIYA+Y
Sbjct  5    CEIFCEILIAILLPPVGVCFRHGCCSVEFCICLLLTLLGYIPGIIYALY  53



>ref|XP_008384300.1| PREDICTED: UPF0057 membrane protein At4g30660-like [Malus domestica]
Length=77

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F EIL+AILLPP+GV LR+GC  VEF I LLLT+LGYIPGIIYA+Y
Sbjct  5    CEIFCEILIAILLPPLGVCLRHGCCTVEFCICLLLTLLGYIPGIIYALY  53



>ref|XP_010086890.1| UPF0057 membrane protein [Morus notabilis]
 gb|EXB24588.1| UPF0057 membrane protein [Morus notabilis]
Length=74

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E   EIL+AILLPP+GV  R+GC  VEFWI LLLT+LGYIPGIIYA+Y
Sbjct  5    CEICCEILIAILLPPLGVCFRHGCCSVEFWICLLLTLLGYIPGIIYALY  53



>dbj|BAD34659.1| plasma membrane protein 3 [Leymus chinensis]
Length=54

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ T ++I++AI+LPP+GVFL++GCG EFWI LLLT LG+IPGIIYAIY
Sbjct  1    MGTATCIDIIIAIILPPLGVFLKFGCGHEFWICLLLTFLGFIPGIIYAIY  50



>ref|XP_009123629.1| PREDICTED: hydrophobic protein RCI2A [Brassica rapa]
 emb|CDY05209.1| BnaC05g45940D [Brassica napus]
Length=54

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TF++ILLAILLPP+GVFLRYGCGVEFWI L+LT+LGY+PGI+YA+Y
Sbjct  1    MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGILYALY  50



>ref|XP_009631086.1| PREDICTED: low temperature-induced protein lt101.2-like [Nicotiana 
tomentosiformis]
Length=71

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F+EILLAIL+PP+GVF R+GC   EF I L+LT+LGY+PGIIYAIY
Sbjct  5    CEVFLEILLAILVPPLGVFFRHGCCSCEFLICLILTLLGYVPGIIYAIY  53



>ref|XP_004957619.1| PREDICTED: hydrophobic protein OSR8-like [Setaria italica]
Length=72

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             F+EIL AI+LPP+GVFLR+GC  +EF I LLLTILGY+PG+IYAIY
Sbjct  8    RFLEILFAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGMIYAIY  54



>gb|EHK39638.1| hypothetical protein TRIATDRAFT_253690 [Trichoderma atroviride 
IMI 206040]
Length=57

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            S    +I++AILLPPVGVFL  GCG +F I +LLTILGYIPGII+A+Y
Sbjct  5    SSDVAKIIVAILLPPVGVFLERGCGADFLINILLTILGYIPGIIHALY  52



>ref|XP_009134854.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa]
 ref|XP_009134855.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa]
Length=54

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            MG+ TF++ILLAILLPP+GVFLRYGCGVEFWI L+LT+LGY+PGIIYA++
Sbjct  1    MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALF  50



>gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxysporum Fo5176]
 emb|CCT69344.1| probable RIC1 protein [Fusarium fujikuroi IMI 58289]
 gb|EWG40705.1| plasma membrane proteolipid 3 [Fusarium verticillioides 7600]
 gb|EWY90391.1| plasma membrane proteolipid 3 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ36997.1| plasma membrane proteolipid 3 [Fusarium oxysporum Fo47]
 gb|EWZ90340.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA44574.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK39032.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK90524.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL56464.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL85065.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM01996.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM33089.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=57

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +ILLAI+LPPVGVFL  GCG +F+I +LLTILGYIPGII+A+Y
Sbjct  5    ASDICKILLAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHALY  52



>gb|EAY90184.1| hypothetical protein OsI_11748 [Oryza sativa Indica Group]
Length=57

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            + TFV++++AI+LPP+GVFL+ GC ++FWI LLL+  GY+PGIIYA++
Sbjct  5    TATFVDLVIAIILPPLGVFLKVGCEIKFWICLLLSFFGYLPGIIYAVW  52



>emb|CBQ67374.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
 emb|CCF53699.1| uncharacterized protein UHOR_00047 [Ustilago hordei]
Length=57

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  120  ETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
               V+I+LAI LPP+GVFL  GCG +FWI +LLTILGY+PGII+A+Y
Sbjct  6    SDIVKIILAIFLPPLGVFLERGCGADFWINVLLTILGYLPGIIHALY  52



>ref|XP_009771603.1| PREDICTED: UPF0057 membrane protein At4g30660-like [Nicotiana 
sylvestris]
Length=63

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F+EILLAIL+PP+GVF R+GC   EF I L+LT+LGY+PGIIY IY
Sbjct  5    CEVFLEILLAILVPPLGVFFRHGCCSCEFLICLILTLLGYVPGIIYTIY  53



>ref|XP_008022303.1| hypothetical protein SETTUDRAFT_102512 [Setosphaeria turcica 
Et28A]
 gb|EOA90468.1| hypothetical protein SETTUDRAFT_102512 [Setosphaeria turcica 
Et28A]
Length=63

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            S    +ILLAI+LPP+GVFL  GCG +F I +LLTILGYIPGII+A+Y
Sbjct  5    SSDICKILLAIILPPLGVFLERGCGADFLINILLTILGYIPGIIHALY  52



>ref|XP_011018049.1| PREDICTED: UPF0057 membrane protein At4g30660-like [Populus euphratica]
 ref|XP_011016417.1| PREDICTED: UPF0057 membrane protein At4g30660-like [Populus euphratica]
Length=77

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E   EI +AILLPP+GV  R+GC  VEFWI LLLTILGY+PGIIYA+Y
Sbjct  5    CEICCEIFIAILLPPLGVCFRHGCCSVEFWICLLLTILGYVPGIIYALY  53



>ref|XP_006404901.1| hypothetical protein EUTSA_v10000507mg [Eutrema salsugineum]
 gb|ESQ46354.1| hypothetical protein EUTSA_v10000507mg [Eutrema salsugineum]
Length=107

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = +3

Query  105  EIMGS--ETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            E+M S  E   EIL+AILLPPVGV LR+GC  VEF+I L+LT LGY+PGIIYAIY
Sbjct  35   ELMASSCELCCEILIAILLPPVGVCLRHGCCTVEFFICLILTCLGYLPGIIYAIY  89



>ref|XP_011079386.1| PREDICTED: UPF0057 membrane protein At2g24040-like [Sesamum indicum]
Length=71

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E   EILLAIL+PP+GV LR+GC  VEF+I L+LTILGY+PGIIYA+Y
Sbjct  5    CEILCEILLAILIPPLGVCLRHGCCSVEFFICLVLTILGYVPGIIYALY  53



>emb|CDM82662.1| unnamed protein product [Triticum aestivum]
Length=70

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            G+   ++I+LA++LPP+GVF ++ CG+EFWI LLLT  GY+P I+YA++
Sbjct  5    GTANCIDIILAVILPPLGVFFKFACGIEFWICLLLTFFGYLPDIVYAVW  53



>ref|WP_036563643.1| membrane protein [Oceanicola sp. HL-35]
Length=57

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  123  TFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
             FV I++AILLPP+GVFL+ G G  FWI +LLTILGYIPGI++A+Y
Sbjct  2    DFVRIVIAILLPPLGVFLQEGLGKHFWINILLTILGYIPGIVHAVY  47



>emb|CDY20271.1| BnaC04g36850D [Brassica napus]
Length=75

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +3

Query  108  IMGSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            +   E   EIL+AILLPPVGV LR+GC  VEF+I L+LT LGY+PGIIYAIY
Sbjct  2    VSSCELCCEILIAILLPPVGVCLRHGCCTVEFFICLVLTCLGYLPGIIYAIY  53



>gb|EMS19696.1| stress response RCI peptide, putative [Rhodosporidium toruloides 
NP11]
 emb|CDR36273.1| RHTO0S01e18030g1_1 [Rhodosporidium toruloides]
Length=57

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +I+LAI+LPP+GVFL  GC  +FWI +LLTILGYIPGII+A+Y
Sbjct  5    ASDICKIILAIILPPLGVFLERGCNADFWINVLLTILGYIPGIIHALY  52



>gb|KFK29642.1| hypothetical protein AALP_AA7G160000 [Arabis alpina]
Length=74

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +3

Query  120  ETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            E F EIL+AILLPP+GV L+ GC  VEF I L+LTILGYIPGIIYA+Y
Sbjct  6    EVFCEILIAILLPPLGVCLKKGCCTVEFLICLVLTILGYIPGIIYALY  53



>sp|Q4HXT6.2|PMP3_GIBZE RecName: Full=Plasma membrane proteolipid 3 [Fusarium graminearum 
PH-1]
 gb|ESU16907.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1]
 gb|EYB25849.1| hypothetical protein FG05_10222 [Fusarium graminearum]
 emb|CEF75592.1| unnamed protein product [Fusarium graminearum]
Length=57

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +I+LAI+LPPVGVFL  GCG +F+I +LLTILGYIPGII+A+Y
Sbjct  5    ASDICKIILAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHALY  52



>ref|XP_007687864.1| hypothetical protein COCMIDRAFT_5223 [Bipolaris oryzae ATCC 44560]
 ref|XP_007712610.1| hypothetical protein COCCADRAFT_5327 [Bipolaris zeicola 26-R-13]
 gb|EUC33038.1| hypothetical protein COCCADRAFT_5327 [Bipolaris zeicola 26-R-13]
 gb|EUC45599.1| hypothetical protein COCMIDRAFT_5223 [Bipolaris oryzae ATCC 44560]
 gb|EUN22110.1| hypothetical protein COCVIDRAFT_30797 [Bipolaris victoriae FI3]
Length=57

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +ILLAI+LPPVGVFL  GCG +F I +LLTILGYIPGII+A+Y
Sbjct  5    ASDICKILLAIILPPVGVFLERGCGADFLINILLTILGYIPGIIHALY  52



>ref|XP_006375710.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|ERP53507.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
Length=56

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGY  233
            M S  F++ILLAI+LPP+GVFL++GCG EFWI LLLTILG+
Sbjct  1    MSSTNFIDILLAIILPPLGVFLKFGCGAEFWICLLLTILGW  41



>ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR45581.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETR98847.1| UPF0057-domain-containing protein [Trichoderma reesei RUT C-30]
Length=57

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +ILLAI+LPPVGVFL  GCG +F I +LLTILGYIPGII+A+Y
Sbjct  5    ASDICKILLAIILPPVGVFLERGCGADFLINILLTILGYIPGIIHALY  52



>ref|XP_006412679.1| hypothetical protein EUTSA_v10026723mg [Eutrema salsugineum]
 gb|ESQ54132.1| hypothetical protein EUTSA_v10026723mg [Eutrema salsugineum]
Length=74

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +3

Query  120  ETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
            E F EIL+AILLPP+GV L+ GC  VEF I L+LTILGYIPGIIYA+Y
Sbjct  6    EVFCEILIAILLPPLGVCLKRGCCTVEFLICLILTILGYIPGIIYALY  53



>ref|XP_010525782.1| PREDICTED: UPF0057 membrane protein At2g24040-like [Tarenaya 
hassleriana]
Length=74

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
              E F EIL+AILLPP+GV LR+GC  VEF I LLLT LGY+PGIIYA+Y
Sbjct  4    KCEIFCEILIAILLPPLGVCLRHGCCTVEFVICLLLTCLGYVPGIIYALY  53



>ref|XP_010687613.1| PREDICTED: hydrophobic protein OSR8-like [Beta vulgaris subsp. 
vulgaris]
Length=74

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
             E F EI+ A+LLPP+GVF R+GC  +EF I L+LTILGYIPG+IYAIY
Sbjct  5    CEIFCEIICALLLPPLGVFFRHGCCSLEFCICLVLTILGYIPGMIYAIY  53



>ref|XP_006295361.1| hypothetical protein CARUB_v10024453mg [Capsella rubella]
 gb|EOA28259.1| hypothetical protein CARUB_v10024453mg [Capsella rubella]
Length=75

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +3

Query  114  GSETFVEILLAILLPPVGVFLRYGC-GVEFWIALLLTILGYIPGIIYAIY  260
              E   EIL+AILLPPVGV LR+GC  VEF+I L+LT LGY+PGIIYAIY
Sbjct  4    SCELCCEILIAILLPPVGVCLRHGCCTVEFFICLVLTCLGYLPGIIYAIY  53



>ref|XP_390398.1| hypothetical protein FG10222.1 [Fusarium graminearum PH-1]
Length=67

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +3

Query  132  EILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +I+LAI+LPPVGVFL  GCG +F+I +LLTILGYIPGII+A+Y
Sbjct  20   KIILAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHALY  62



>gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys chlorohalonata 
IBT 40285]
Length=57

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +I+LA+LLPPVGVFL  GCG +F+I +LLTILGY+PGII+A+Y
Sbjct  5    ASDICKIILAVLLPPVGVFLERGCGADFFINILLTILGYLPGIIHALY  52



>ref|XP_003675890.1| hypothetical protein NCAS_0C05360 [Naumovozyma castellii CBS 
4309]
 emb|CCC69526.1| hypothetical protein NCAS_0C05360 [Naumovozyma castellii CBS 
4309]
Length=55

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  111  MGSETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            M S+  V ILLAI LPP+GVFL+ G GVEFW+ L+LT+L + PG++YA+Y
Sbjct  1    MDSQKIVAILLAIFLPPLGVFLQCGLGVEFWLDLVLTLLAFFPGMLYALY  50



>dbj|GAA94872.1| hypothetical protein E5Q_01526 [Mixia osmundae IAM 14324]
Length=111

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  117  SETFVEILLAILLPPVGVFLRYGCGVEFWIALLLTILGYIPGIIYAIY  260
            +    +I+LAI +PP+GVFL  GC  +FWI +LLTILGYIPGII+A+Y
Sbjct  5    ASDICKIILAIFVPPLGVFLERGCNADFWINVLLTILGYIPGIIHALY  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4152661970184