BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33118_g1_i1 len=1484 path=[1:0-1483]

Length=1484
                                                                      Score     E

ref|XP_009610079.1|  PREDICTED: cytokinin dehydrogenase 3               699   0.0      
ref|XP_009793978.1|  PREDICTED: cytokinin dehydrogenase 3               698   0.0      
ref|XP_004251670.1|  PREDICTED: cytokinin dehydrogenase 3               687   0.0      
ref|XP_009799177.1|  PREDICTED: cytokinin dehydrogenase 3-like          686   0.0      
ref|XP_009602355.1|  PREDICTED: cytokinin dehydrogenase 3-like          684   0.0      
ref|XP_006353538.1|  PREDICTED: cytokinin dehydrogenase 3               682   0.0      
ref|NP_001275401.1|  cytokinin oxidase/dehydrogenase 2                  681   0.0      
dbj|BAK52672.1|  cytokinin oxidase                                      677   0.0      
emb|CDP03155.1|  unnamed protein product                                657   0.0      
ref|XP_002279519.1|  PREDICTED: cytokinin dehydrogenase 3               622   0.0      Vitis vinifera
emb|CBI27904.3|  unnamed protein product                                621   0.0      
ref|XP_010262099.1|  PREDICTED: cytokinin dehydrogenase 3-like          621   0.0      
ref|XP_011009888.1|  PREDICTED: cytokinin dehydrogenase 3               615   0.0      
ref|XP_002308300.2|  Cytokinin dehydrogenase 3 precursor family p...    612   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002514119.1|  gulonolactone oxidase, putative                    607   0.0      Ricinus communis
emb|CBI37291.3|  unnamed protein product                                604   0.0      
ref|XP_002263646.1|  PREDICTED: cytokinin dehydrogenase 3               606   0.0      Vitis vinifera
ref|XP_006475463.1|  PREDICTED: cytokinin dehydrogenase 3-like          605   0.0      
gb|KDO49370.1|  hypothetical protein CISIN_1g009793mg                   605   0.0      
ref|XP_006451484.1|  hypothetical protein CICLE_v10007992mg             604   0.0      
ref|XP_007012819.1|  Cytokinin oxidase                                  603   0.0      
ref|XP_002264445.1|  PREDICTED: cytokinin dehydrogenase 3               600   0.0      Vitis vinifera
emb|CAN80714.1|  hypothetical protein VITISV_042932                     599   0.0      Vitis vinifera
ref|XP_010090055.1|  Cytokinin dehydrogenase 3                          599   0.0      
emb|CAN77185.1|  hypothetical protein VITISV_039458                     597   0.0      Vitis vinifera
gb|AGW52152.1|  CKX3                                                    597   0.0      
ref|XP_008450862.1|  PREDICTED: cytokinin dehydrogenase 3-like          596   0.0      
ref|XP_010242231.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    595   0.0      
emb|CBI37295.3|  unnamed protein product                                599   0.0      
ref|XP_004158449.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    594   0.0      
ref|XP_011093737.1|  PREDICTED: cytokinin dehydrogenase 3               594   0.0      
ref|XP_003635659.1|  PREDICTED: cytokinin dehydrogenase 3-like          588   0.0      
ref|XP_011077990.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    591   0.0      
ref|XP_009352666.1|  PREDICTED: cytokinin dehydrogenase 3-like          590   0.0      
ref|XP_007154651.1|  hypothetical protein PHAVU_003G136400g             590   0.0      
ref|XP_004508239.1|  PREDICTED: cytokinin dehydrogenase 3-like          589   0.0      
dbj|BAM74651.1|  cytokinin oxidase/dehydrogenase                        588   0.0      
ref|XP_004144003.1|  PREDICTED: cytokinin dehydrogenase 3-like          586   0.0      
ref|XP_003542331.1|  PREDICTED: cytokinin dehydrogenase 3-like          586   0.0      
ref|XP_010696503.1|  PREDICTED: cytokinin dehydrogenase 3               586   0.0      
ref|XP_007138720.1|  hypothetical protein PHAVU_009G231700g             585   0.0      
gb|ACM79256.1|  cytokinin oxidase/dehydrogenase                         584   0.0      Gossypium hirsutum [American cotton]
gb|KDP33841.1|  hypothetical protein JCGZ_07412                         584   0.0      
emb|CBI33301.3|  unnamed protein product                                579   0.0      
ref|NP_001243813.1|  cytokinin dehydrogenase 3-like                     584   0.0      
ref|XP_010242232.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    581   0.0      
ref|XP_007203595.1|  hypothetical protein PRUPE_ppb021417mg             580   0.0      
ref|XP_010047562.1|  PREDICTED: cytokinin dehydrogenase 3-like          581   0.0      
ref|XP_004288952.1|  PREDICTED: cytokinin dehydrogenase 3-like          580   0.0      
gb|KCW79507.1|  hypothetical protein EUGRSUZ_C00881                     580   0.0      
ref|XP_003547474.1|  PREDICTED: cytokinin dehydrogenase 3-like          580   0.0      
ref|XP_008367923.1|  PREDICTED: cytokinin dehydrogenase 3-like          579   0.0      
ref|XP_008242354.1|  PREDICTED: cytokinin dehydrogenase 3-like          577   0.0      
gb|KHN35852.1|  Cytokinin dehydrogenase 3                               577   0.0      
ref|XP_003534923.1|  PREDICTED: cytokinin dehydrogenase 3-like          578   0.0      
ref|XP_010047563.1|  PREDICTED: cytokinin dehydrogenase 3-like          571   0.0      
gb|EYU37164.1|  hypothetical protein MIMGU_mgv1a004294mg                568   0.0      
ref|XP_008459369.1|  PREDICTED: cytokinin dehydrogenase 3-like          568   0.0      
gb|KEH32513.1|  cytokinin oxidase/dehydrogenase-like protein            563   0.0      
gb|KHN13439.1|  Cytokinin dehydrogenase 3                               558   0.0      
ref|XP_010024208.1|  PREDICTED: cytokinin dehydrogenase 3-like          559   0.0      
ref|XP_004488057.1|  PREDICTED: cytokinin dehydrogenase 3-like          556   0.0      
ref|XP_003635626.2|  PREDICTED: cytokinin dehydrogenase 3-like          549   0.0      
ref|XP_010026881.1|  PREDICTED: cytokinin dehydrogenase 3-like          554   0.0      
emb|CBI41113.3|  unnamed protein product                                549   0.0      
ref|XP_010040366.1|  PREDICTED: cytokinin dehydrogenase 3-like          552   0.0      
gb|KCW60471.1|  hypothetical protein EUGRSUZ_H03198                     552   0.0      
ref|XP_010451653.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    551   0.0      
gb|KCW60469.1|  hypothetical protein EUGRSUZ_H03195                     551   0.0      
ref|XP_010024059.1|  PREDICTED: cytokinin dehydrogenase 3-like          551   0.0      
ref|XP_011077992.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    550   0.0      
ref|XP_010451656.1|  PREDICTED: cytokinin dehydrogenase 3-like is...    548   0.0      
ref|XP_003595184.1|  Cytokinin dehydrogenase                            548   0.0      
emb|CAN61742.1|  hypothetical protein VITISV_038638                     545   0.0      Vitis vinifera
ref|NP_200507.1|  cytokinin dehydrogenase 3                             546   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443356.1|  PREDICTED: cytokinin dehydrogenase 3               544   0.0      
ref|XP_009352704.1|  PREDICTED: cytokinin dehydrogenase 2-like          543   0.0      
ref|XP_008338887.1|  PREDICTED: cytokinin dehydrogenase 4-like          540   0.0      
ref|XP_009120210.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X2    539   0.0      
ref|XP_004173096.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    538   0.0      
gb|KCW45277.1|  hypothetical protein EUGRSUZ_L01060                     534   0.0      
ref|XP_008242393.1|  PREDICTED: cytokinin dehydrogenase 4-like          538   0.0      
ref|XP_009361720.1|  PREDICTED: cytokinin dehydrogenase 4-like          536   0.0      
ref|XP_006280310.1|  hypothetical protein CARUB_v10026233mg             535   0.0      
ref|XP_010026880.1|  PREDICTED: cytokinin dehydrogenase 3-like          536   0.0      
ref|XP_002866175.1|  hypothetical protein ARALYDRAFT_918856             535   0.0      
ref|XP_007203856.1|  hypothetical protein PRUPE_ppa021859mg             534   0.0      
gb|KCW60470.1|  hypothetical protein EUGRSUZ_H03197                     534   0.0      
ref|XP_009120209.1|  PREDICTED: cytokinin dehydrogenase 3 isoform X1    535   0.0      
ref|XP_008797779.1|  PREDICTED: cytokinin dehydrogenase 6-like          535   0.0      
ref|XP_006401261.1|  hypothetical protein EUTSA_v10013271mg             533   0.0      
ref|XP_004291832.1|  PREDICTED: cytokinin dehydrogenase 5-like          531   0.0      
ref|XP_011077993.1|  PREDICTED: cytokinin dehydrogenase 4-like          530   0.0      
gb|KFK42198.1|  hypothetical protein AALP_AA2G224300                    530   0.0      
ref|XP_009393975.1|  PREDICTED: cytokinin dehydrogenase 6-like          526   3e-179   
ref|XP_010026879.1|  PREDICTED: cytokinin dehydrogenase 3-like          525   5e-179   
ref|XP_010090054.1|  Cytokinin dehydrogenase 4                          525   1e-178   
ref|XP_010912967.1|  PREDICTED: cytokinin dehydrogenase 6               524   3e-178   
ref|XP_008451152.1|  PREDICTED: cytokinin dehydrogenase 4               521   9e-178   
emb|CDY62828.1|  BnaCnng41060D                                          521   1e-177   
gb|AES65430.2|  cytokinin oxidase/dehydrogenase-like protein            520   8e-177   
gb|AHL64253.1|  cytokinin dehydrogenase 5                               520   8e-177   
ref|XP_004288951.1|  PREDICTED: cytokinin dehydrogenase 2-like          519   1e-176   
ref|XP_010539134.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    519   2e-176   
ref|XP_009408848.1|  PREDICTED: cytokinin dehydrogenase 6-like          518   7e-176   
ref|XP_002280797.1|  PREDICTED: cytokinin dehydrogenase 5 isoform X1    516   1e-175   Vitis vinifera
ref|XP_010026877.1|  PREDICTED: cytokinin dehydrogenase 3-like          515   2e-175   
emb|CBI19763.3|  unnamed protein product                                518   3e-175   
ref|XP_008377186.1|  PREDICTED: cytokinin dehydrogenase 5-like          516   4e-175   
ref|XP_009126914.1|  PREDICTED: cytokinin dehydrogenase 3               513   3e-174   
ref|XP_003595179.1|  Cytokinin dehydrogenase                            512   9e-174   
gb|KHG00982.1|  Cytokinin dehydrogenase 5 -like protein                 511   1e-173   
gb|ABN05767.1|  FAD linked oxidase, N-terminal                          510   1e-173   Medicago truncatula
ref|XP_007221789.1|  hypothetical protein PRUPE_ppa003895mg             512   1e-173   
emb|CAN81010.1|  hypothetical protein VITISV_017949                     511   2e-173   Vitis vinifera
ref|XP_008805777.1|  PREDICTED: cytokinin dehydrogenase 6-like          511   2e-173   
gb|ABN08744.1|  FAD linked oxidase, N-terminal                          511   3e-173   Medicago truncatula
emb|CDY20702.1|  BnaA02g08420D                                          509   4e-173   
gb|KDP38564.1|  hypothetical protein JCGZ_04489                         510   6e-173   
ref|XP_011094005.1|  PREDICTED: cytokinin dehydrogenase 3-like          509   6e-173   
ref|XP_006595335.1|  PREDICTED: cytokinin dehydrogenase 3-like          509   7e-173   
ref|XP_002300742.2|  cytokinin oxidase 6 family protein                 509   9e-173   Populus trichocarpa [western balsam poplar]
ref|XP_004507936.1|  PREDICTED: cytokinin dehydrogenase 3-like          509   9e-173   
ref|XP_010254676.1|  PREDICTED: cytokinin dehydrogenase 5-like          510   1e-172   
gb|AIU94750.1|  cytokinin oxidase                                       508   1e-172   
ref|XP_006838693.1|  hypothetical protein AMTR_s00002p00248240          509   1e-172   
ref|XP_009609662.1|  PREDICTED: cytokinin dehydrogenase 5               509   1e-172   
gb|EYU32888.1|  hypothetical protein MIMGU_mgv1a004444mg                509   1e-172   
ref|XP_009398389.1|  PREDICTED: cytokinin dehydrogenase 5               508   3e-172   
ref|XP_006475551.1|  PREDICTED: cytokinin dehydrogenase 3-like          507   3e-172   
ref|XP_011094006.1|  PREDICTED: cytokinin dehydrogenase 3-like          506   4e-172   
ref|XP_010110013.1|  Cytokinin dehydrogenase 5                          509   5e-172   
ref|XP_002307681.1|  hypothetical protein POPTR_0005s25380g             508   5e-172   Populus trichocarpa [western balsam poplar]
ref|XP_009335765.1|  PREDICTED: cytokinin dehydrogenase 5               508   5e-172   
ref|XP_010907734.1|  PREDICTED: cytokinin dehydrogenase 5-like          507   8e-172   
ref|XP_008387997.1|  PREDICTED: cytokinin dehydrogenase 5-like          507   1e-171   
ref|XP_010915226.1|  PREDICTED: cytokinin dehydrogenase 6-like          507   1e-171   
ref|XP_006473567.1|  PREDICTED: cytokinin dehydrogenase 5-like          508   2e-171   
ref|XP_011048828.1|  PREDICTED: cytokinin dehydrogenase 5-like          506   2e-171   
ref|XP_002510450.1|  gulonolactone oxidase, putative                    506   2e-171   Ricinus communis
ref|XP_009761052.1|  PREDICTED: cytokinin dehydrogenase 5               505   3e-171   
ref|XP_011028922.1|  PREDICTED: cytokinin dehydrogenase 5-like          506   3e-171   
ref|XP_008796604.1|  PREDICTED: cytokinin dehydrogenase 5-like          506   3e-171   
ref|XP_006435071.1|  hypothetical protein CICLE_v10000709mg             506   5e-171   
ref|XP_003550630.1|  PREDICTED: cytokinin dehydrogenase 3-like          505   9e-171   
ref|XP_010275527.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    504   1e-170   
ref|XP_011083611.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    504   1e-170   
ref|XP_006475550.1|  PREDICTED: cytokinin dehydrogenase 3-like          505   1e-170   
ref|XP_006451487.1|  hypothetical protein CICLE_v10010516mg             504   1e-170   
gb|EYU29892.1|  hypothetical protein MIMGU_mgv1a007407mg                498   6e-170   
ref|XP_006577980.1|  PREDICTED: cytokinin dehydrogenase 5-like          502   6e-170   
ref|XP_008221343.1|  PREDICTED: cytokinin dehydrogenase 5               503   7e-170   
ref|XP_004144113.1|  PREDICTED: cytokinin dehydrogenase 4-like          501   1e-169   
ref|XP_010932835.1|  PREDICTED: cytokinin dehydrogenase 5-like          500   3e-169   
ref|XP_009124316.1|  PREDICTED: cytokinin dehydrogenase 2-like          499   5e-169   
ref|XP_007017645.1|  Cytokinin oxidase 5                                499   2e-168   
ref|XP_006451486.1|  hypothetical protein CICLE_v10010713mg             495   5e-168   
gb|KDO40371.1|  hypothetical protein CISIN_1g044784mg                   495   7e-168   
emb|CAC17752.1|  cytokinin oxidase                                      497   8e-168   
ref|XP_004488074.1|  PREDICTED: cytokinin dehydrogenase 3-like          496   8e-168   
dbj|BAM74648.1|  cytokinin oxidase/dehydrogenase                        496   1e-167   
ref|XP_008804537.1|  PREDICTED: cytokinin dehydrogenase 5-like          496   3e-167   
ref|XP_010254443.1|  PREDICTED: cytokinin dehydrogenase 3-like          494   4e-167   
ref|XP_006412813.1|  hypothetical protein EUTSA_v10024918mg             494   5e-167   
gb|AAG30907.1|AF303980_1  cytokinin oxidase                             494   8e-167   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194703.1|  cytokinin dehydrogenase 4                             494   9e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136628.1|  hypothetical protein PHAVU_009G060200g             494   1e-166   
ref|NP_001274957.1|  cytokinin oxidase/dehydrogenase precursor          493   2e-166   
ref|NP_001266251.1|  cytokinin oxidase/dehydrogenase-like precursor     493   2e-166   
ref|XP_009402032.1|  PREDICTED: cytokinin dehydrogenase 6-like          492   4e-166   
ref|XP_007138721.1|  hypothetical protein PHAVU_009G231800g             492   5e-166   
emb|CDP07468.1|  unnamed protein product                                492   5e-166   
ref|XP_006409043.1|  hypothetical protein EUTSA_v10023158mg             491   8e-166   
ref|XP_002869416.1|  predicted protein                                  491   1e-165   
ref|XP_006294012.1|  hypothetical protein CARUB_v10023000mg             490   2e-165   
ref|XP_010447814.1|  PREDICTED: cytokinin dehydrogenase 4-like          490   2e-165   
emb|CDY30204.1|  BnaA03g49660D                                          489   4e-165   
ref|NP_565455.1|  cytokinin oxidase 2                                   488   1e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433070.1|  PREDICTED: cytokinin dehydrogenase 4               488   1e-164   
gb|KCW60467.1|  hypothetical protein EUGRSUZ_H03190                     486   1e-164   
ref|XP_010438272.1|  PREDICTED: cytokinin dehydrogenase 4-like          488   2e-164   
ref|XP_003527677.1|  PREDICTED: cytokinin dehydrogenase 5-like          489   2e-164   
ref|XP_006390301.1|  hypothetical protein EUTSA_v10018378mg             488   2e-164   
ref|XP_002889026.1|  hypothetical protein ARALYDRAFT_476695             488   3e-164   
ref|XP_009137860.1|  PREDICTED: cytokinin dehydrogenase 4               487   3e-164   
gb|KHN45882.1|  Cytokinin dehydrogenase 5                               483   5e-164   
ref|XP_009112608.1|  PREDICTED: cytokinin dehydrogenase 2               486   6e-164   
ref|XP_004488073.1|  PREDICTED: cytokinin dehydrogenase 3-like          486   7e-164   
gb|KCW60664.1|  hypothetical protein EUGRSUZ_H03393                     484   8e-164   
ref|XP_006297443.1|  hypothetical protein CARUB_v10013466mg             485   1e-163   
gb|KFK41981.1|  hypothetical protein AALP_AA2G196900                    486   2e-163   
ref|XP_010672675.1|  PREDICTED: cytokinin dehydrogenase 5               485   2e-163   
gb|AAG30905.1|AF303978_1  cytokinin oxidase                             484   2e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061263.1|  PREDICTED: cytokinin dehydrogenase 5               485   3e-163   
ref|XP_002883987.1|  hypothetical protein ARALYDRAFT_480522             484   4e-163   
gb|KFK29530.1|  hypothetical protein AALP_AA7G146300                    484   5e-163   
ref|XP_009106198.1|  PREDICTED: cytokinin dehydrogenase 5               484   8e-163   
emb|CDY47521.1|  BnaAnng09190D                                          484   1e-162   
ref|XP_009408782.1|  PREDICTED: cytokinin dehydrogenase 5-like          484   1e-162   
gb|KEH32514.1|  cytokinin oxidase/dehydrogenase-like protein            483   1e-162   
ref|NP_177678.2|  cytokinin dehydrogenase 5                             484   1e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002513399.1|  gulonolactone oxidase, putative                    483   1e-162   Ricinus communis
gb|ABM98099.2|  cytokinin oxidase                                       483   2e-162   Dendrobium huoshanense
emb|CDY54283.1|  BnaC07g50850D                                          483   2e-162   
ref|XP_010415434.1|  PREDICTED: cytokinin dehydrogenase 2               481   4e-162   
gb|KEH36208.1|  cytokinin oxidase/dehydrogenase-like protein            482   5e-162   
gb|AAG30909.1|AF303982_1  cytokinin oxidase                             482   9e-162   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73174.1|  BnaC06g36220D                                          481   1e-161   
ref|XP_010467897.1|  PREDICTED: cytokinin dehydrogenase 2-like          479   2e-161   
ref|NP_001185402.1|  cytokinin dehydrogenase 5                          479   7e-161   
ref|XP_008444755.1|  PREDICTED: cytokinin dehydrogenase 5               478   2e-160   
gb|KHN06617.1|  Cytokinin dehydrogenase 3                               476   5e-160   
gb|KFK40311.1|  hypothetical protein AALP_AA3G358400                    475   9e-160   
emb|CDY67088.1|  BnaA09g52930D                                          474   1e-159   
ref|XP_009381235.1|  PREDICTED: cytokinin dehydrogenase 6-like          475   1e-159   
ref|XP_004970152.1|  PREDICTED: cytokinin dehydrogenase 5-like          476   1e-159   
gb|AFK48435.1|  unknown                                                 475   2e-159   
ref|XP_010533263.1|  PREDICTED: cytokinin dehydrogenase 5               475   3e-159   
ref|XP_003534915.2|  PREDICTED: cytokinin dehydrogenase 3-like          474   4e-159   
gb|AFK79779.1|  cytokinin oxidase/dehydrogenase                         474   5e-159   
ref|XP_004500976.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    474   7e-159   
ref|XP_006843486.1|  hypothetical protein AMTR_s00053p00208790          473   8e-159   
ref|XP_008672378.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    471   2e-157   
ref|XP_011015952.1|  PREDICTED: cytokinin dehydrogenase 3-like          469   3e-157   
ref|XP_011015519.1|  PREDICTED: cytokinin dehydrogenase 3-like          469   4e-157   
ref|XP_003599606.1|  Cytokinin dehydrogenase                            470   4e-157   
gb|ADP38079.1|  cytokinin dehydrogenase 4                               469   5e-157   
ref|XP_009389713.1|  PREDICTED: cytokinin dehydrogenase 6-like          468   1e-156   
emb|CDY50467.1|  BnaA10g28940D                                          466   1e-156   
emb|CDY60734.1|  BnaA07g35940D                                          476   2e-156   
dbj|BAG16379.1|  cytokinin oxidase family protein                       468   2e-156   Brassica rapa var. perviridis [kabuna]
gb|EAY85042.1|  hypothetical protein OsI_06399                          468   2e-156   Oryza sativa Indica Group [Indian rice]
ref|XP_002458582.1|  hypothetical protein SORBIDRAFT_03g036160          468   2e-156   Sorghum bicolor [broomcorn]
emb|CDY51023.1|  BnaC09g33450D                                          466   2e-156   
emb|CDX79932.1|  BnaA05g02240D                                          468   2e-156   
ref|XP_003571719.1|  PREDICTED: cytokinin dehydrogenase 7-like          468   2e-156   
ref|XP_009142753.1|  PREDICTED: cytokinin dehydrogenase 1-like          466   7e-156   
ref|XP_002310104.2|  hypothetical protein POPTR_0007s08360g             466   8e-156   Populus trichocarpa [western balsam poplar]
ref|XP_004295395.1|  PREDICTED: cytokinin dehydrogenase 6-like          464   1e-155   
gb|KDO84681.1|  hypothetical protein CISIN_1g042782mg                   464   3e-155   
gb|KHN17673.1|  Cytokinin dehydrogenase 3                               458   8e-155   
dbj|BAG16373.1|  cytokinin oxidase family protein                       463   1e-154   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_010505935.1|  PREDICTED: cytokinin dehydrogenase 1               465   1e-154   
gb|AFW84922.1|  hypothetical protein ZEAMMB73_083779                    463   2e-154   
gb|EMT16465.1|  Cytokinin dehydrogenase 1                               462   2e-154   
ref|NP_181682.1|  cytokinin dehydrogenase 1                             464   2e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796239.1|  PREDICTED: cytokinin dehydrogenase 9-like          462   2e-154   
ref|XP_010428567.1|  PREDICTED: cytokinin dehydrogenase 5 isoform X1    462   2e-154   
ref|XP_006293839.1|  hypothetical protein CARUB_v10022823mg             465   3e-154   
gb|KHN06618.1|  Cytokinin dehydrogenase 3                               457   7e-154   
ref|XP_004303072.1|  PREDICTED: cytokinin dehydrogenase 6-like          461   9e-154   
ref|XP_010471656.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    461   9e-154   
ref|XP_002879935.1|  ATCKX1/CKX1                                        462   1e-153   
ref|XP_010416431.1|  PREDICTED: cytokinin dehydrogenase 5-like is...    461   1e-153   
ref|XP_008349298.1|  PREDICTED: cytokinin dehydrogenase 6-like          461   1e-153   
ref|XP_009141995.1|  PREDICTED: cytokinin dehydrogenase 1-like          461   1e-153   
sp|Q6YW50.1|CKX7_ORYSJ  RecName: Full=Cytokinin dehydrogenase 7; ...    460   2e-153   Oryza sativa Japonica Group [Japonica rice]
gb|KFK36997.1|  hypothetical protein AALP_AA4G199000                    461   2e-153   
ref|XP_002453544.1|  hypothetical protein SORBIDRAFT_04g007730          460   2e-153   Sorghum bicolor [broomcorn]
ref|XP_006438909.1|  hypothetical protein CICLE_v10031210mg             460   2e-153   
gb|KHN11723.1|  Cytokinin dehydrogenase 6                               460   3e-153   
gb|KDP25108.1|  hypothetical protein JCGZ_22643                         459   3e-153   
ref|XP_002284560.2|  PREDICTED: cytokinin dehydrogenase 1-like          460   3e-153   Vitis vinifera
ref|XP_009409596.1|  PREDICTED: cytokinin dehydrogenase 7-like          459   4e-153   
ref|XP_007131444.1|  hypothetical protein PHAVU_011G014000g             459   5e-153   
ref|NP_001044409.1|  Os01g0775400                                       459   6e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006411418.1|  hypothetical protein EUTSA_v10016470mg             459   7e-153   
gb|ADB45880.1|  cytokinin oxidase/dehydrogenase                         458   7e-153   Bambusa oldhamii
ref|NP_001185960.1|  cytokinin dehydrogenase 4b precursor               458   1e-152   
gb|AEV76973.1|  cytokinin oxidase/dehydrogenase 8                       458   1e-152   
ref|XP_006482960.1|  PREDICTED: cytokinin dehydrogenase 6-like          458   1e-152   
dbj|BAL04493.1|  cytokinin oxidase                                      458   1e-152   
emb|CDY23844.1|  BnaC04g01930D                                          460   2e-152   
gb|KDO83251.1|  hypothetical protein CISIN_1g008291mg                   459   2e-152   
ref|XP_008445865.1|  PREDICTED: cytokinin dehydrogenase 6               458   2e-152   
ref|XP_004514814.1|  PREDICTED: cytokinin dehydrogenase 6-like          458   2e-152   
ref|XP_002304773.1|  FAD-binding domain-containing family protein       457   2e-152   Populus trichocarpa [western balsam poplar]
ref|XP_006302113.1|  hypothetical protein CARUB_v10020114mg             457   3e-152   
sp|Q6YW51.1|CKX6_ORYSJ  RecName: Full=Cytokinin dehydrogenase 6; ...    457   3e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391556.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    456   3e-152   
ref|XP_003534375.1|  PREDICTED: cytokinin dehydrogenase 6-like          457   3e-152   
ref|XP_004143695.1|  PREDICTED: cytokinin dehydrogenase 6-like          457   4e-152   
gb|AEV76972.1|  cytokinin oxidase/dehydrogenase 7                       457   4e-152   
ref|XP_003539919.1|  PREDICTED: cytokinin dehydrogenase 6-like          456   6e-152   
ref|XP_009354403.1|  PREDICTED: cytokinin dehydrogenase 6-like          456   7e-152   
gb|KGN66247.1|  hypothetical protein Csa_1G588560                       451   1e-151   
ref|XP_008375236.1|  PREDICTED: cytokinin dehydrogenase 6-like          455   1e-151   
ref|XP_004141168.1|  PREDICTED: uncharacterized protein LOC101212791    466   2e-151   
ref|XP_010106427.1|  Cytokinin dehydrogenase 1                          454   2e-151   
emb|CDY14777.1|  BnaC04g47740D                                          455   2e-151   
dbj|BAM74647.1|  cytokinin oxidase/dehydrogenase                        455   2e-151   
ref|XP_008679837.1|  PREDICTED: cytokinin dehydrogenase 7-like          454   3e-151   
gb|ADB45878.1|  cytokinin oxidase/dehydrogenase                         454   3e-151   
ref|XP_007219000.1|  hypothetical protein PRUPE_ppa004120mg             454   4e-151   
ref|XP_002534458.1|  gulonolactone oxidase, putative                    454   5e-151   
ref|XP_010938664.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X1    454   5e-151   
ref|XP_011042115.1|  PREDICTED: cytokinin dehydrogenase 6-like          453   6e-151   
ref|XP_010517646.1|  PREDICTED: cytokinin dehydrogenase 1-like          455   7e-151   
gb|EEE56570.1|  hypothetical protein OsJ_05919                          452   7e-151   
ref|XP_004951450.1|  PREDICTED: cytokinin dehydrogenase 7-like          454   7e-151   
ref|NP_001185809.1|  cytokinin dehydrogenase 8 precursor                454   9e-151   
ref|XP_006421171.1|  hypothetical protein CICLE_v10006491mg             454   1e-150   
ref|XP_006654329.1|  PREDICTED: cytokinin dehydrogenase 9-like          452   1e-150   
ref|XP_009133497.1|  PREDICTED: cytokinin dehydrogenase 1-like          453   2e-150   
emb|CDP13849.1|  unnamed protein product                                449   2e-150   
ref|XP_011088157.1|  PREDICTED: cytokinin dehydrogenase 6-like          452   2e-150   
ref|XP_003605865.1|  Cytokinin oxidase                                  452   2e-150   
gb|AEV76971.1|  cytokinin oxidase/dehydrogenase 2                       453   3e-150   
ref|XP_009417944.1|  PREDICTED: cytokinin dehydrogenase 4-like          451   4e-150   
gb|KHN39533.1|  Cytokinin dehydrogenase 6                               451   5e-150   
ref|XP_002513118.1|  Cytokinin dehydrogenase, putative                  451   5e-150   
ref|XP_006368582.1|  FAD-binding domain-containing family protein       451   6e-150   
ref|XP_010508710.1|  PREDICTED: cytokinin dehydrogenase 1-like          452   8e-150   
ref|XP_009368087.1|  PREDICTED: cytokinin dehydrogenase 6-like          451   8e-150   
ref|XP_003538221.1|  PREDICTED: cytokinin dehydrogenase 6               451   9e-150   
emb|CDY35410.1|  BnaA03g19500D                                          451   9e-150   
gb|EPS70157.1|  hypothetical protein M569_04602                         450   9e-150   
gb|ADB45879.1|  cytokinin oxidase/dehydrogenase                         450   1e-149   
ref|XP_010547318.1|  PREDICTED: cytokinin dehydrogenase 6-like          450   1e-149   
ref|XP_002308930.2|  hypothetical protein POPTR_0006s04650g             451   1e-149   
emb|CDM84390.1|  unnamed protein product                                450   1e-149   
ref|XP_010090224.1|  Cytokinin dehydrogenase 1                          451   1e-149   
ref|XP_011037797.1|  PREDICTED: cytokinin dehydrogenase 6-like          450   1e-149   
ref|XP_007149023.1|  hypothetical protein PHAVU_005G034000g             451   1e-149   
ref|XP_002988125.1|  hypothetical protein SELMODRAFT_127173             451   1e-149   
ref|XP_010672924.1|  PREDICTED: cytokinin dehydrogenase 1-like          451   2e-149   
ref|XP_008464594.1|  PREDICTED: cytokinin dehydrogenase 1 isoform X1    450   2e-149   
ref|XP_004142714.1|  PREDICTED: cytokinin dehydrogenase 1-like          450   2e-149   
gb|KDP40485.1|  hypothetical protein JCGZ_24484                         449   2e-149   
ref|XP_003632404.1|  PREDICTED: cytokinin dehydrogenase 3-like          447   2e-149   
ref|XP_002876723.1|  predicted protein                                  449   2e-149   
ref|XP_007162153.1|  hypothetical protein PHAVU_001G128800g             451   2e-149   
gb|EEC72755.1|  hypothetical protein OsI_06398                          449   3e-149   
ref|XP_008811766.1|  PREDICTED: cytokinin dehydrogenase 4-like          449   3e-149   
ref|XP_010523651.1|  PREDICTED: cytokinin dehydrogenase 1               449   4e-149   
dbj|BAM74650.1|  cytokinin oxidase/dehydrogenase                        450   5e-149   
ref|XP_002451780.1|  hypothetical protein SORBIDRAFT_04g007740          449   5e-149   
ref|XP_007008757.1|  Cytokinin oxidase/dehydrogenase 6 isoform 1        449   6e-149   
ref|XP_010067774.1|  PREDICTED: cytokinin dehydrogenase 6-like          449   7e-149   
ref|XP_010938665.1|  PREDICTED: cytokinin dehydrogenase 4 isoform X2    448   7e-149   
dbj|BAK52671.1|  cytokinin oxidase                                      449   9e-149   
ref|XP_004968471.1|  PREDICTED: cytokinin dehydrogenase 1-like          447   1e-148   
ref|XP_010227585.1|  PREDICTED: cytokinin dehydrogenase 10-like         448   1e-148   
gb|KHN32384.1|  Cytokinin dehydrogenase 6                               448   1e-148   
gb|AEC33261.1|  cytokinin oxidase/dehydrogenase                         448   1e-148   
gb|AFK79773.1|  cytokinin oxidase/dehydrogenase                         448   1e-148   
ref|XP_009609443.1|  PREDICTED: cytokinin dehydrogenase 1-like          448   1e-148   
ref|XP_006491496.1|  PREDICTED: cytokinin dehydrogenase 1-like          448   2e-148   
ref|XP_007028626.1|  Cytokinin oxidase/dehydrogenase 1 isoform 1        447   2e-148   
ref|XP_009767664.1|  PREDICTED: cytokinin dehydrogenase 1-like          447   3e-148   
ref|NP_001055371.2|  Os05g0374200                                       446   3e-148   
ref|XP_009784170.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    447   3e-148   
gb|EAY97807.1|  hypothetical protein OsI_19727                          446   3e-148   
ref|XP_011048092.1|  PREDICTED: cytokinin dehydrogenase 1               447   3e-148   
ref|XP_006292397.1|  hypothetical protein CARUB_v10018610mg             447   4e-148   
ref|XP_002972678.1|  hypothetical protein SELMODRAFT_98722              446   8e-148   
ref|XP_010523657.1|  PREDICTED: cytokinin dehydrogenase 6               445   9e-148   
ref|XP_002323274.1|  hypothetical protein POPTR_0016s04340g             446   1e-147   
gb|ADG57789.1|  cytokinin oxidase 2                                     446   1e-147   
gb|EPS70139.1|  hypothetical protein M569_04624                         443   1e-147   
ref|XP_010670377.1|  PREDICTED: cytokinin dehydrogenase 6-like          445   2e-147   
ref|XP_002270841.2|  PREDICTED: cytokinin dehydrogenase 9               445   2e-147   
ref|XP_003565050.1|  PREDICTED: cytokinin dehydrogenase 4               444   2e-147   
ref|XP_010279585.1|  PREDICTED: cytokinin dehydrogenase 9-like          445   2e-147   
ref|XP_006598397.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    442   3e-147   
ref|XP_007008758.1|  Cytokinin oxidase/dehydrogenase 6 isoform 2        444   3e-147   
dbj|BAK01307.1|  predicted protein                                      444   4e-147   
gb|AEK84310.1|  cytokinin oxidase/dehydrogenase                         444   4e-147   
ref|XP_011075363.1|  PREDICTED: cytokinin dehydrogenase 1               444   5e-147   
ref|XP_002439706.1|  hypothetical protein SORBIDRAFT_09g018640          443   5e-147   
emb|CBI28611.3|  unnamed protein product                                446   8e-147   
gb|EAZ22265.1|  hypothetical protein OsJ_05920                          442   1e-146   
gb|AAG13068.1|AC023754_6  Similar to cytokinin oxidase                  442   1e-146   
ref|XP_010921880.1|  PREDICTED: cytokinin dehydrogenase 9-like          442   2e-146   
ref|XP_003553393.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    443   2e-146   
ref|NP_001244907.1|  cytokinin oxidase/dehydrogenase-like 5 precu...    442   3e-146   
ref|XP_007154653.1|  hypothetical protein PHAVU_003G1365000g            439   3e-146   
ref|XP_010418548.1|  PREDICTED: cytokinin dehydrogenase 6               442   3e-146   
ref|XP_009336587.1|  PREDICTED: cytokinin dehydrogenase 1-like          442   3e-146   
gb|AFW83998.1|  cytokinin oxidase 3, mRNA                               441   3e-146   
ref|XP_009784168.1|  PREDICTED: cytokinin dehydrogenase 6-like is...    442   3e-146   
ref|XP_009590336.1|  PREDICTED: cytokinin dehydrogenase 6-like          441   3e-146   
ref|XP_011033192.1|  PREDICTED: cytokinin dehydrogenase 1-like          442   4e-146   
ref|XP_010269658.1|  PREDICTED: cytokinin dehydrogenase 1-like          442   4e-146   
ref|XP_003569936.1|  PREDICTED: cytokinin dehydrogenase 5               442   4e-146   
sp|Q5Z620.1|CKX10_ORYSJ  RecName: Full=Cytokinin dehydrogenase 10...    442   4e-146   
gb|KHN14944.1|  Cytokinin dehydrogenase 1                               442   4e-146   
gb|AFW83999.1|  LOW QUALITY PROTEIN: cytokinin oxidase 3                441   6e-146   
ref|XP_004513273.1|  PREDICTED: cytokinin dehydrogenase 6-like          445   6e-146   
dbj|BAH47540.1|  cytokinin oxidase                                      441   6e-146   
gb|ADG57787.1|  cytokinin oxidase 2                                     441   8e-146   
gb|AII20187.1|  cytokinin oxidase/dehydrogenase-like 7                  441   1e-145   
ref|XP_004152677.1|  PREDICTED: cytokinin dehydrogenase 5-like          440   1e-145   
ref|XP_008443336.1|  PREDICTED: cytokinin dehydrogenase 1-like          441   1e-145   
gb|AFK79784.1|  cytokinin oxidase/dehydrogenase                         441   1e-145   
ref|XP_010468848.1|  PREDICTED: cytokinin dehydrogenase 6-like          440   1e-145   
gb|AFW87013.1|  hypothetical protein ZEAMMB73_853322                    441   2e-145   
gb|EEC80843.1|  hypothetical protein OsI_23446                          439   2e-145   
ref|XP_004136791.1|  PREDICTED: cytokinin dehydrogenase 1-like          441   2e-145   
emb|CDM81697.1|  unnamed protein product                                439   2e-145   
ref|XP_004159659.1|  PREDICTED: cytokinin dehydrogenase 1-like          441   2e-145   
ref|XP_004962256.1|  PREDICTED: cytokinin dehydrogenase 9-like          439   2e-145   
ref|XP_008660924.1|  PREDICTED: cytokinin dehydrogenase 10-like         440   2e-145   
ref|XP_009391555.1|  PREDICTED: cytokinin dehydrogenase 4-like is...    440   2e-145   
emb|CAE55201.1|  cytokinin oxidase 3                                    439   3e-145   
gb|AFK79777.1|  cytokinin oxidase/dehydrogenase                         437   5e-145   
gb|EMT30248.1|  Cytokinin dehydrogenase 1                               438   6e-145   
ref|NP_001105163.1|  cytokinin oxidase 3 precursor                      438   7e-145   
ref|XP_002456917.1|  hypothetical protein SORBIDRAFT_03g045410          438   7e-145   
ref|XP_004971217.1|  PREDICTED: cytokinin dehydrogenase 4-like          437   9e-145   
ref|XP_008392337.1|  PREDICTED: cytokinin dehydrogenase 1-like          438   1e-144   
ref|XP_004493454.1|  PREDICTED: cytokinin dehydrogenase 1-like          438   1e-144   
pdb|3S1D|A  Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseD...    437   1e-144   
ref|NP_001105526.1|  cytokinin oxidase 2 precursor                      437   1e-144   
ref|XP_007203158.1|  hypothetical protein PRUPE_ppa024442mg             438   1e-144   
ref|XP_003625100.1|  Cytokinin oxidase                                  437   2e-144   
gb|ADG57788.1|  cytokinin oxidase 2                                     438   2e-144   
gb|EYU20769.1|  hypothetical protein MIMGU_mgv1a022053mg                437   2e-144   
ref|XP_011078924.1|  PREDICTED: cytokinin dehydrogenase 1-like          437   3e-144   
pdb|2QKN|A  Chain A, Crystal Structure Of Maize Cytokinin Oxidase...    436   3e-144   
ref|XP_010231472.1|  PREDICTED: cytokinin dehydrogenase 9               436   4e-144   
ref|XP_002455033.1|  hypothetical protein SORBIDRAFT_03g003280          436   4e-144   
ref|NP_001275006.1|  cytokinin oxidase/dehydrogenase                    436   4e-144   
ref|XP_008244287.1|  PREDICTED: cytokinin dehydrogenase 1               437   4e-144   
ref|XP_008360505.1|  PREDICTED: cytokinin dehydrogenase 1-like          437   4e-144   
ref|NP_001105591.1|  cytokinin dehydrogenase 1 precursor                436   4e-144   
ref|XP_006645310.1|  PREDICTED: cytokinin dehydrogenase 4-like          436   6e-144   
emb|CDY22528.1|  BnaC03g23380D                                          436   6e-144   
ref|NP_001244909.1|  cytokinin oxidase/dehydrogenase-like 2             435   1e-143   
pdb|1W1O|A  Chain A, Native Cytokinin Dehydrogenase                     435   1e-143   
pdb|3S1F|A  Chain A, Asp169glu Mutant Of Maize Cytokinin OxidaseD...    434   2e-143   
ref|XP_004305707.1|  PREDICTED: cytokinin dehydrogenase 1-like          435   2e-143   
ref|XP_003564990.2|  PREDICTED: cytokinin dehydrogenase 2-like          435   2e-143   
gb|AAN16383.1|  cytokinin dehydrogenase 2                               434   2e-143   
gb|EYU27005.1|  hypothetical protein MIMGU_mgv1a004144mg                435   2e-143   
pdb|2QPM|A  Chain A, Leu492ala Mutant Of Maize Cytokinin OxidaseD...    434   2e-143   
ref|XP_006646382.1|  PREDICTED: cytokinin dehydrogenase 5-like          432   3e-143   
ref|XP_010036309.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    433   5e-143   
ref|XP_006657073.1|  PREDICTED: LOW QUALITY PROTEIN: cytokinin de...    434   6e-143   
ref|NP_191903.3|  cytokinin oxidase/dehydrogenase 6                     433   6e-143   
gb|AFK79770.1|  cytokinin oxidase/dehydrogenase                         434   7e-143   
ref|XP_006604338.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    433   7e-143   
sp|Q9T0N8.2|CKX1_MAIZE  RecName: Full=Cytokinin dehydrogenase 1; ...    433   8e-143   
ref|XP_009363232.1|  PREDICTED: cytokinin dehydrogenase 1-like          433   8e-143   
ref|XP_004971745.1|  PREDICTED: cytokinin dehydrogenase 2-like          434   9e-143   
ref|XP_010036308.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    433   1e-142   
pdb|3S1E|A  Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseD...    432   1e-142   
gb|AAM08400.2|AF490591_1  cytokinin dehydrogenase 2                     432   1e-142   
dbj|BAK05047.1|  predicted protein                                      433   2e-142   
ref|XP_006351290.1|  PREDICTED: cytokinin dehydrogenase 1-like          432   2e-142   
dbj|BAF00384.1|  cytokinin oxidase -like protein                        431   2e-142   
ref|XP_009782890.1|  PREDICTED: cytokinin dehydrogenase 1-like          432   2e-142   
gb|AFM10539.1|  cytokinin oxidase                                       432   3e-142   
ref|NP_001244203.1|  cytokinin dehydrogenase 1-like                     432   3e-142   
gb|AEK84309.1|  cytokinin oxidase/dehydrogenase                         432   3e-142   
gb|ACV04939.1|  cytokinin oxidase/dehydrogenase                         431   7e-142   
ref|NP_001244908.1|  cytokinin oxidase/dehydrogenase-like 7 precu...    430   1e-141   
ref|XP_006402274.1|  hypothetical protein EUTSA_v10005878mg             430   1e-141   
emb|CDP14175.1|  unnamed protein product                                426   1e-141   
ref|XP_004967225.1|  PREDICTED: cytokinin dehydrogenase 10-like         431   2e-141   
gb|ADK56162.1|  cytokinin oxidase/dehydrogenase                         429   3e-141   
gb|AAO50082.1|  cytokinin dehydrogenase 3                               427   9e-141   
ref|NP_001045353.1|  Os01g0940000                                       427   2e-140   
gb|EAY77168.1|  hypothetical protein OsI_05138                          426   2e-140   
ref|XP_009630860.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    425   4e-140   
ref|XP_008368095.1|  PREDICTED: cytokinin dehydrogenase 4-like          420   4e-140   
gb|AFK79768.1|  cytokinin oxidase/dehydrogenase                         427   4e-140   
ref|XP_009630800.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    425   1e-139   
ref|XP_003565448.1|  PREDICTED: cytokinin dehydrogenase 1-like          424   1e-139   
gb|EEC70112.1|  hypothetical protein OsI_00771                          426   2e-139   
gb|EMS64767.1|  Cytokinin dehydrogenase 9                               425   2e-139   
ref|XP_006576244.1|  PREDICTED: cytokinin dehydrogenase 1-like is...    423   8e-139   
gb|AEV76970.1|  cytokinin oxidase/dehydrogenase 1                       421   1e-138   
gb|AFK79785.1|  cytokinin oxidase/dehydrogenase                         423   1e-138   
emb|CDY11474.1|  BnaA09g40400D                                          419   1e-138   
ref|XP_009116997.1|  PREDICTED: cytokinin dehydrogenase 6               421   4e-138   
ref|XP_002438603.1|  hypothetical protein SORBIDRAFT_10g022590          420   1e-137   
ref|NP_001275030.1|  cytokinin oxidase/dehydrogenase 1 precursor        420   1e-137   
dbj|BAB56095.1|  putative cytokinin oxidase                             420   2e-137   
sp|Q4ADV8.1|CKX2_ORYSJ  RecName: Full=Cytokinin dehydrogenase 2; ...    420   3e-137   
ref|XP_010236336.1|  PREDICTED: cytokinin dehydrogenase 7-like          417   7e-137   
ref|XP_010420976.1|  PREDICTED: cytokinin dehydrogenase 7               416   1e-136   
emb|CDX76698.1|  BnaC08g32840D                                          417   1e-136   
ref|XP_001777489.1|  predicted protein                                  415   2e-136   
gb|EMS67590.1|  Cytokinin dehydrogenase 4                               412   2e-136   
gb|ABH07114.1|  cytokinin oxidase/dehydrogenase 1                       414   9e-136   
gb|EYU29893.1|  hypothetical protein MIMGU_mgv1a023414mg                410   3e-135   
ref|XP_010454451.1|  PREDICTED: cytokinin dehydrogenase 7-like          412   6e-135   
gb|EAY72836.1|  hypothetical protein OsI_00707                          412   6e-135   
gb|AFW80325.1|  hypothetical protein ZEAMMB73_057649                    414   9e-135   
sp|Q0JQ12.2|CKX1_ORYSJ  RecName: Full=Cytokinin dehydrogenase 1; ...    412   1e-134   
ref|NP_850863.1|  cytokinin dehydrogenase 7                             411   2e-134   
ref|NP_001185958.1|  cytokinin dehydrogenase 5 precursor                413   2e-134   
gb|EPS64605.1|  cytokinin oxidase                                       409   3e-134   
gb|EMS46287.1|  Cytokinin dehydrogenase 2                               410   3e-134   
ref|XP_010493247.1|  PREDICTED: cytokinin dehydrogenase 7-like          410   4e-134   
gb|KFK26358.1|  hypothetical protein AALP_AA8G238000                    410   5e-134   
ref|XP_002455003.1|  hypothetical protein SORBIDRAFT_03g002810          411   7e-134   
gb|EAZ14789.1|  hypothetical protein OsJ_04719                          405   8e-134   
ref|XP_006287493.1|  hypothetical protein CARUB_v10000702mg             409   1e-133   



>ref|XP_009610079.1| PREDICTED: cytokinin dehydrogenase 3 [Nicotiana tomentosiformis]
Length=534

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/436 (75%), Positives = 381/436 (87%), Gaps = 15/436 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR--------------IRVSWSESLGFYADV  1345
             ARGHGHS RGQA  ++GVVVEM+SL  N                 IRVSW  SLGFYADV
Sbjct  100   ARGHGHSIRGQAMTQNGVVVEMNSLNNNNNNNNNNNNNNNNGNGGIRVSWDSSLGFYADV  159

Query  1344  GGHELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVI  1165
             GG +LW+DVLRA+L HGL+PV+WTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV EMD+I
Sbjct  160   GGEQLWIDVLRATLEHGLSPVTWTDYLYLTVGGTLSNAGISGQTFRHGPQISNVHEMDII  219

Query  1164  TGKGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTR  985
             TGKGE +TCSKH NSELFFAVLGGLGQFG+ITRARIVLDKAPTRVKWVRMLY DF+KFT+
Sbjct  220   TGKGEFVTCSKHKNSELFFAVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYADFSKFTK  279

Query  984   DQEHLISIDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKY  805
             DQEHLISID GLDYVEGSL+M Q   NNWRSSFFSPS+Q++IASL+S +GIIY LE+VKY
Sbjct  280   DQEHLISID-GLDYVEGSLMMEQRSLNNWRSSFFSPSNQTKIASLLSQNGIIYCLEMVKY  338

Query  804   YDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPW  625
             YDD+TA+T+DEEL+++ KGL+F+ G +F+KDV+F DFLNRVR GE++L+ KG WDVPHPW
Sbjct  339   YDDQTASTVDEELKKLVKGLNFLPGFIFKKDVTFVDFLNRVRRGELELKSKGQWDVPHPW  398

Query  624   LNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG  445
             LNLFVPKS I+DFN GVFVDIILRQNKT+GPILVYPT++ +WDDRMSAV+PEEETFYCVG
Sbjct  399   LNLFVPKSNIMDFNAGVFVDIILRQNKTTGPILVYPTSRKKWDDRMSAVIPEEETFYCVG  458

Query  444   LLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
             LLHSS  N+W+ L +QNEEIL YCD+AG+KIKQYLPHYKT+EDW KHFGKKW IFQQRK+
Sbjct  459   LLHSSGFNDWKSLDDQNEEILNYCDKAGLKIKQYLPHYKTKEDWIKHFGKKWNIFQQRKS  518

Query  264   LFDPKLILSPGQRIFS  217
              FDPK+ILSPGQRIF+
Sbjct  519   QFDPKMILSPGQRIFN  534



>ref|XP_009793978.1| PREDICTED: cytokinin dehydrogenase 3 [Nicotiana sylvestris]
Length=533

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/435 (76%), Positives = 382/435 (88%), Gaps = 14/435 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR-------------NGGRIRVSWSESLGFYADVG  1342
             ARGHGHS RGQA A++GVVVEM+SL                   IRVSW  SLGFYADVG
Sbjct  100   ARGHGHSIRGQAMAQNGVVVEMNSLNNNNNNNNNINNNKNGSCGIRVSWDSSLGFYADVG  159

Query  1341  GHELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVIT  1162
             G +LW+DVLRA+L HGL+PVSWTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV EMDVIT
Sbjct  160   GEQLWIDVLRATLEHGLSPVSWTDYLYLTVGGTLSNAGISGQTFRHGPQISNVHEMDVIT  219

Query  1161  GKGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRD  982
             GKGE +TCSKH NSELFFAVLGGLGQFG+ITRARIVLDKAPTRVKWVRMLY DF+KFT+D
Sbjct  220   GKGEFVTCSKHKNSELFFAVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYADFSKFTKD  279

Query  981   QEHLISIDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             QEHLISID GLDYVEGSL+M QS  NNWRSSFFSPS+Q++IASL+S +GIIY LE+VKYY
Sbjct  280   QEHLISID-GLDYVEGSLMMEQSSLNNWRSSFFSPSNQTKIASLLSQNGIIYCLEMVKYY  338

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
             DD+TA T+DEEL+++ KGL+F+ G +F+KDV+F DFLNRVRSGE++L+ KG WDVPHPWL
Sbjct  339   DDQTANTVDEELKKLVKGLNFLPGFIFKKDVTFVDFLNRVRSGELELQSKGQWDVPHPWL  398

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLFVPKS I+DFN GVFVDIILRQNKT+GPILVYPT++ +WD+R+SAV+PEEETFYCVGL
Sbjct  399   NLFVPKSNIMDFNAGVFVDIILRQNKTTGPILVYPTSRKKWDERISAVIPEEETFYCVGL  458

Query  441   LHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKAL  262
             LHSS  N+W+ L +QNEEIL YCD+AG+KIKQYLPHYKT+EDW KHFGKKW IFQQRK+ 
Sbjct  459   LHSSGFNDWKNLDDQNEEILNYCDKAGLKIKQYLPHYKTKEDWIKHFGKKWNIFQQRKSQ  518

Query  261   FDPKLILSPGQRIFS  217
             FDPK+ILSPGQRIF+
Sbjct  519   FDPKMILSPGQRIFN  533



>ref|XP_004251670.1| PREDICTED: cytokinin dehydrogenase 3 [Solanum lycopersicum]
Length=527

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/427 (76%), Positives = 376/427 (88%), Gaps = 5/427 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR---IRVSWSESLGFYADVGGHELWVDVLR  1312
             A+GHGHS RGQA AK+GV+VEMSSL  N      +RVSW   LGFYADVGG +LW+DVL 
Sbjct  101   AKGHGHSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDSDLGFYADVGGEQLWIDVLH  160

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
              +L +GLAPVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV EMDVITGKGEL+TCSK
Sbjct  161   NTLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVHEMDVITGKGELMTCSK  220

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-DD  955
              +NSELFF VLGGLGQFG+ITRARIVLDKAPTRVKWVRMLYDDF+KFT+DQEHLISI ++
Sbjct  221   DMNSELFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYDDFSKFTKDQEHLISIHNN  280

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             GLDYVEGSL+M QS  NNWRSSF+SPS+Q++IASL+S + I+Y LE+VKYYDD+ A TID
Sbjct  281   GLDYVEGSLMMEQSSLNNWRSSFYSPSNQTKIASLLSKNKIMYCLEIVKYYDDQNANTID  340

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +EL+++ KGL ++GG +F+KDVSF +FLNRVRSGE++L+ KGMWDVPHPWLNLFVPKS I
Sbjct  341   KELKKLVKGLKYVGGFMFKKDVSFVEFLNRVRSGELELQSKGMWDVPHPWLNLFVPKSSI  400

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR-VNE  418
             + FN  VFVDIILRQNKT+GPILVYPT++ RWDDRMSA++PEEETFYCVGLLHSS   NE
Sbjct  401   MHFNAAVFVDIILRQNKTNGPILVYPTSRKRWDDRMSAIIPEEETFYCVGLLHSSSGYNE  460

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
              + L NQNEEIL YCD+ G+ IKQYLPHYKT+EDW KHFGKKW IFQQRK LFDPK+ILS
Sbjct  461   CKILDNQNEEILNYCDKVGLNIKQYLPHYKTKEDWIKHFGKKWNIFQQRKDLFDPKMILS  520

Query  237   PGQRIFS  217
             PGQRIF+
Sbjct  521   PGQRIFN  527



>ref|XP_009799177.1| PREDICTED: cytokinin dehydrogenase 3-like [Nicotiana sylvestris]
Length=520

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/423 (74%), Positives = 373/423 (88%), Gaps = 2/423 (0%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNG-GRIRVSWSESLGFY-ADVGGHELWVDVLRA  1309
             ARGHGHS RGQA + +GVVV MSSLK N  G+IRV W   LGFY ADVGG +LW+DVL A
Sbjct  97    ARGHGHSVRGQAMSPNGVVVVMSSLKNNNNGKIRVFWESFLGFYYADVGGEQLWIDVLHA  156

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYL+VGGTLSNAGISGQ+F+YGPQI+NV+EMDVITGKG+L+TCSK 
Sbjct  157   TLEHGLAPVSWTDYLYLSVGGTLSNAGISGQTFKYGPQISNVLEMDVITGKGQLVTCSKQ  216

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+ITRARIV++KAPTRVKWVR+ Y DF+KFT+DQE LISI++G+
Sbjct  217   TNSELFFAVLGGLGQFGIITRARIVVEKAPTRVKWVRVFYSDFSKFTKDQEKLISINNGM  276

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DYVEGSL+M QSP NNWRSSFFS S+QS+I SLIS +GIIY LE+VKYYDD+ A T+D+E
Sbjct  277   DYVEGSLMMNQSPPNNWRSSFFSTSNQSKIISLISKYGIIYCLEMVKYYDDQCANTVDKE  336

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQ+M +GL+F+ G +F+KD +F  FLNRVRSGE++L+ KGMWDVPHPWLNLFVPKS I+D
Sbjct  337   LQKMMRGLNFLSGHIFKKDTTFVHFLNRVRSGELRLQSKGMWDVPHPWLNLFVPKSSIMD  396

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FNVGVF+DIILRQNKT+GPILVYPT + +WDDRMS V+PEE+TFYCVGLLHSS  N+WE 
Sbjct  397   FNVGVFLDIILRQNKTTGPILVYPTTRKKWDDRMSVVIPEEDTFYCVGLLHSSGFNDWEV  456

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L  QNEEI+ YC++AG+ IKQYLPHYK++E W  HFGKKW+IFQQRK+ FDPK+ILSPGQ
Sbjct  457   LDGQNEEIINYCEKAGLNIKQYLPHYKSKEAWMNHFGKKWKIFQQRKSQFDPKMILSPGQ  516

Query  228   RIF  220
             +IF
Sbjct  517   KIF  519



>ref|XP_009602355.1| PREDICTED: cytokinin dehydrogenase 3-like [Nicotiana tomentosiformis]
Length=525

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/428 (75%), Positives = 372/428 (87%), Gaps = 7/428 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNG------GRIRVSWSESLGFY-ADVGGHELWV  1324
             ARGHGHS RGQA + +GVVV MSSL  N       G+IRV W  SLGFY ADVGG +LW+
Sbjct  97    ARGHGHSVRGQAMSPNGVVVVMSSLNNNNNNNNNNGKIRVFWESSLGFYYADVGGEQLWI  156

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVL A+L HGLAPVSWTDYLYL+VGGTLSNAGISGQ+F+YGPQI+NV+EMDVITGKGEL+
Sbjct  157   DVLHATLEHGLAPVSWTDYLYLSVGGTLSNAGISGQTFKYGPQISNVLEMDVITGKGELV  216

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCSK  NSELFFAVLG LGQFG+I RARIVL+KAPTRVKWVR+LY DF+KFTRDQE LIS
Sbjct  217   TCSKRTNSELFFAVLGSLGQFGIIIRARIVLEKAPTRVKWVRVLYSDFSKFTRDQEKLIS  276

Query  963   IDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
             I+DG+DYVEGSL+M QSP NNWRSSFFS S+QS+I SLIS +GIIY LE+VKYYDD+TA 
Sbjct  277   INDGMDYVEGSLMMNQSPPNNWRSSFFSTSNQSKILSLISKYGIIYCLEMVKYYDDQTAN  336

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             T+D+ELQ+M +GL+F+ G +F+KD +F  FLNRVRSGE+ L+ KGMWDVPHPWLNLFVPK
Sbjct  337   TVDKELQKMMRGLNFVFGHIFKKDTAFVHFLNRVRSGELMLQSKGMWDVPHPWLNLFVPK  396

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             S I+DFNVGVF+DIILRQNK++GPILVYPT + RWDDRMS V+PEE+TFYCVGLLHSSR 
Sbjct  397   SSIMDFNVGVFLDIILRQNKSTGPILVYPTTRKRWDDRMSVVIPEEDTFYCVGLLHSSRF  456

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             N+WE L  QNEEI+  C++AG+ +KQYLPHYKT+E W  HFGKKW+IFQQRK+ FDPK+I
Sbjct  457   NDWEVLDGQNEEIINCCEKAGLNVKQYLPHYKTKEAWMNHFGKKWKIFQQRKSQFDPKMI  516

Query  243   LSPGQRIF  220
             LSPGQ+IF
Sbjct  517   LSPGQKIF  524



>ref|XP_006353538.1| PREDICTED: cytokinin dehydrogenase 3 [Solanum tuberosum]
Length=527

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/427 (76%), Positives = 374/427 (88%), Gaps = 5/427 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR---IRVSWSESLGFYADVGGHELWVDVLR  1312
             A+GHGHS RGQA AK+GV+VEMSSL  N      +RVSW   LGFYADVGG +LW+DVLR
Sbjct  101   AKGHGHSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDSGLGFYADVGGEQLWIDVLR  160

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             ++L +GLAPVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV EMDVITGKGEL+TCSK
Sbjct  161   STLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVHEMDVITGKGELVTCSK  220

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-D  955
              +NSELFF VLGGLGQFG+ITRARIVLDKAPTRVKWVRMLYDDF+KFT+DQEHLISI  +
Sbjct  221   DMNSELFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYDDFSKFTKDQEHLISIHHN  280

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             GLDYVEGSL+M QS  NNWRSSFFSPS+Q++IASL+S + I+Y LE+VKYYDD+ A TID
Sbjct  281   GLDYVEGSLMMEQSSLNNWRSSFFSPSNQTKIASLLSKNKIMYCLEIVKYYDDQNANTID  340

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             EEL+++ KGL ++GG +F+KDVSF +FLNRVRSGE++L+ KG WDVPHPWLNLFVPKS I
Sbjct  341   EELKKLVKGLKYLGGFMFKKDVSFVEFLNRVRSGELELQSKGKWDVPHPWLNLFVPKSSI  400

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR-VNE  418
             + F+  VFVDIILRQNKT+GPILVYPT++ RWDDRMS ++PEEETFYCVGLLHSS    E
Sbjct  401   MHFHAAVFVDIILRQNKTTGPILVYPTSRKRWDDRMSTMIPEEETFYCVGLLHSSSGYKE  460

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
              + L NQNEEIL YCD+ G+ IKQYLPHYKT+EDW KHFGKKW IFQQRK LFDPK+ILS
Sbjct  461   CKILDNQNEEILNYCDKVGLNIKQYLPHYKTKEDWIKHFGKKWNIFQQRKDLFDPKMILS  520

Query  237   PGQRIFS  217
             PGQRIF+
Sbjct  521   PGQRIFN  527



>ref|NP_001275401.1| cytokinin oxidase/dehydrogenase 2 [Solanum tuberosum]
 gb|ACN65409.1| cytokinin oxidase/dehydrogenase 2 [Solanum tuberosum]
Length=527

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/427 (76%), Positives = 374/427 (88%), Gaps = 5/427 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR---IRVSWSESLGFYADVGGHELWVDVLR  1312
             A+GHGHS RGQA AK+GV+VEMSSL  N      +RVSW   LGFYADVGG +LW+DVLR
Sbjct  101   AKGHGHSIRGQAMAKNGVIVEMSSLNNNNNENCGVRVSWDLGLGFYADVGGEQLWIDVLR  160

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             +++ +GLAPVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV EMDVITGKGEL+TCSK
Sbjct  161   STIEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVHEMDVITGKGELVTCSK  220

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-D  955
              +NSELFF VLGGLGQFG+ITRARIVLDKAPTRVKWVRMLYDDF+KFT+DQEHLISI  +
Sbjct  221   DMNSELFFGVLGGLGQFGIITRARIVLDKAPTRVKWVRMLYDDFSKFTKDQEHLISIHHN  280

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             GLDYVEGSL+M QS  NNWRSSFFSPS+Q++IASL+S + I+Y LE+VKYYDD+ A TID
Sbjct  281   GLDYVEGSLMMEQSSLNNWRSSFFSPSNQTEIASLLSKNKIMYCLEIVKYYDDQNANTID  340

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             EEL+++ KGL ++GG +F+KDVSF +FLNRVRSGE++L+ KG WDVPHPWLNLFVPKS I
Sbjct  341   EELKQLVKGLKYLGGFMFKKDVSFVEFLNRVRSGELELQSKGKWDVPHPWLNLFVPKSSI  400

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR-VNE  418
             + F+  VFVDIILRQNKT+GPILVYPT++ RWDDRMS V+PEEETFYCVGLLHSS    E
Sbjct  401   MHFHAAVFVDIILRQNKTTGPILVYPTSRKRWDDRMSTVIPEEETFYCVGLLHSSSGYKE  460

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
              + L NQNEEIL YCD+ G+ IKQYLPHYKT+EDW KHFGKKW IFQQRK LFDPK+ILS
Sbjct  461   CKILDNQNEEILNYCDKVGLNIKQYLPHYKTKEDWIKHFGKKWNIFQQRKDLFDPKMILS  520

Query  237   PGQRIFS  217
             PGQRIF+
Sbjct  521   PGQRIFN  527



>dbj|BAK52672.1| cytokinin oxidase [Petunia x hybrida]
Length=535

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/440 (75%), Positives = 383/440 (87%), Gaps = 21/440 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR------------------NGGRIRVSWSESLGF  1357
             ARGHGHS RGQA A+DGVVVEM+SLK                   NG  IRVSW  SLG+
Sbjct  99    ARGHGHSIRGQAMAQDGVVVEMNSLKNNNNNNNNNNNNNNKNGIYNG--IRVSWDSSLGY  156

Query  1356  YADVGGHELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIE  1177
             YADVGG +LW+DVLRA+L HGLAPVSWTDYLYLTVGGTLSNAGISGQ+F++GPQI+NV E
Sbjct  157   YADVGGEQLWIDVLRATLEHGLAPVSWTDYLYLTVGGTLSNAGISGQTFKHGPQISNVHE  216

Query  1176  MDVITGKGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFT  997
             MDVITGKGEL+TCSKH+NSELFFAVLGGLGQFG+ITRARIVLDKAPTRVKWVR+LY DF+
Sbjct  217   MDVITGKGELVTCSKHMNSELFFAVLGGLGQFGIITRARIVLDKAPTRVKWVRILYADFS  276

Query  996   KFTRDQEHLISIDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLE  817
             KFT+DQEHLISID GLDYVEGSL+M QSP NNWRSSFFSPS+Q++IASL+S +GIIY LE
Sbjct  277   KFTKDQEHLISID-GLDYVEGSLMMKQSPLNNWRSSFFSPSNQTKIASLLSENGIIYCLE  335

Query  816   LVKYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDV  637
             +VKYYDD+++ TID+EL+++ KGL+ + G +F+KD ++ DFLNRVRSGE++L+ KG+WDV
Sbjct  336   MVKYYDDQSSNTIDKELKKLLKGLNNLPGFIFKKDATYVDFLNRVRSGELELQSKGLWDV  395

Query  636   PHPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETF  457
             PHPWLNLFVPKS I+DFN GVFVDIIL+QN T+GPILVYPT++ +WDDRMSAV+PEEETF
Sbjct  396   PHPWLNLFVPKSSIMDFNAGVFVDIILKQNMTAGPILVYPTSRKKWDDRMSAVIPEEETF  455

Query  456   YCVGLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQ  277
             YCVGLLHSS  N+W+ L  QNEEILKYCD+AG+KIKQYLPHYK +EDW KHF KKW IFQ
Sbjct  456   YCVGLLHSSGFNDWQTLDEQNEEILKYCDKAGLKIKQYLPHYKRKEDWIKHFSKKWNIFQ  515

Query  276   QRKALFDPKLILSPGQRIFS  217
             QRK  FDPK++LSPGQRIF+
Sbjct  516   QRKTQFDPKMLLSPGQRIFN  535



>emb|CDP03155.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/426 (72%), Positives = 374/426 (88%), Gaps = 4/426 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK---RNGGRIRVSWSESLGFYADVGGHELWVDVLR  1312
             ARGHGHS RGQA A +GVV+EMSSL     NG +I+VSWS SLG+YADVGG +LW+DVLR
Sbjct  100   ARGHGHSIRGQAMAPNGVVIEMSSLSDYTSNGTKIKVSWSPSLGYYADVGGEQLWIDVLR  159

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
              +L +GLAPVSWTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV E+DVITGKGE ITCSK
Sbjct  160   TTLDYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRHGPQISNVHELDVITGKGEFITCSK  219

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD-  955
             H+NSEL++AVLGGLGQFG+ITRARIVLDKAPTRVKW+R++YDDF+ FTRDQE+LISI+D 
Sbjct  220   HMNSELYYAVLGGLGQFGIITRARIVLDKAPTRVKWLRIMYDDFSSFTRDQEYLISINDN  279

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             GLDYVEGSLI+ QS  NNWRSSFFS SHQS+I+SL++  GI+Y +E+VKYYDD TA T+D
Sbjct  280   GLDYVEGSLILQQSSPNNWRSSFFSASHQSKISSLLTERGILYCMEVVKYYDDNTAATVD  339

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +EL+ + +GL +I G +F+KD SF  FLNRVRSGE++L+ KG+WDVPHPWLNLFVPKSRI
Sbjct  340   QELELLLEGLHYIPGFLFKKDDSFVGFLNRVRSGELELQSKGLWDVPHPWLNLFVPKSRI  399

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
             +DFN GVFVDI+L+QNK +GPILVYPT+K  WD+RMSAVVP+E+TFYCVGLLHS  +++W
Sbjct  400   MDFNAGVFVDILLKQNKATGPILVYPTSKKMWDERMSAVVPDEDTFYCVGLLHSGTLDDW  459

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             + L +QN E+L++CD+ GI+IKQYLPHYKT +DW  HFG KW  FQ+RKA FDPK+ILSP
Sbjct  460   KNLDDQNNELLEFCDKNGIEIKQYLPHYKTRQDWMNHFGSKWSTFQERKARFDPKVILSP  519

Query  234   GQRIFS  217
             GQ+IF+
Sbjct  520   GQKIFN  525



>ref|XP_002279519.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=521

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/424 (70%), Positives = 355/424 (84%), Gaps = 3/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRI--RVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A +GVVV+M+SLK +G  I  +V+ +   G YADVGGH+LW+DVL+A
Sbjct  97    ARGRGHSLGGQAMAPNGVVVDMTSLKNSGAGIGIKVTKNPVSGSYADVGGHQLWIDVLQA  156

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLTVGGTLSNAG SGQ+FR+GPQI+NV EMD+ITGKGEL+TCSK 
Sbjct  157   TLEHGLAPVSWTDYLYLTVGGTLSNAGGSGQTFRHGPQISNVHEMDIITGKGELVTCSKE  216

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NS+LF+AVLGGLGQFG+ITRARI L+ AP RVKWVRMLYDDF+ F+ DQEHLISI+ GL
Sbjct  217   TNSDLFYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYDDFSTFSEDQEHLISIN-GL  275

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSLI  QSP NNWRSSFFS S    I+SL++ +GIIYS+E+VKYYDD T+ T+DEE
Sbjct  276   DYLEGSLITKQSPPNNWRSSFFSKSQYPIISSLLTKNGIIYSIEVVKYYDDLTSHTVDEE  335

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQE+FKGL F+ GLVF KDV+  DFL+RV +GE++L+ KG+WDVPHPWLNLFVPKSRI D
Sbjct  336   LQELFKGLRFLPGLVFTKDVTLVDFLDRVHNGELQLQAKGLWDVPHPWLNLFVPKSRISD  395

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DIIL+ N+T GP+LVYP  + +WD+ MSA +P+E+ FY +GLLHSS  ++WE 
Sbjct  396   FNSGVFRDIILKTNQTVGPLLVYPMIRNKWDNGMSAAIPDEDIFYSIGLLHSSGADDWEP  455

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EILK+CD+AGIKIKQYLP Y T+ DW  HFG KW+IF+ RKA FDPK ILSPGQ
Sbjct  456   LENQNKEILKFCDKAGIKIKQYLPRYTTKADWMNHFGPKWKIFEDRKAQFDPKNILSPGQ  515

Query  228   RIFS  217
             RIF+
Sbjct  516   RIFN  519



>emb|CBI27904.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/424 (70%), Positives = 355/424 (84%), Gaps = 3/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRI--RVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A +GVVV+M+SLK +G  I  +V+ +   G YADVGGH+LW+DVL+A
Sbjct  70    ARGRGHSLGGQAMAPNGVVVDMTSLKNSGAGIGIKVTKNPVSGSYADVGGHQLWIDVLQA  129

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLTVGGTLSNAG SGQ+FR+GPQI+NV EMD+ITGKGEL+TCSK 
Sbjct  130   TLEHGLAPVSWTDYLYLTVGGTLSNAGGSGQTFRHGPQISNVHEMDIITGKGELVTCSKE  189

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NS+LF+AVLGGLGQFG+ITRARI L+ AP RVKWVRMLYDDF+ F+ DQEHLISI+ GL
Sbjct  190   TNSDLFYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYDDFSTFSEDQEHLISIN-GL  248

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSLI  QSP NNWRSSFFS S    I+SL++ +GIIYS+E+VKYYDD T+ T+DEE
Sbjct  249   DYLEGSLITKQSPPNNWRSSFFSKSQYPIISSLLTKNGIIYSIEVVKYYDDLTSHTVDEE  308

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQE+FKGL F+ GLVF KDV+  DFL+RV +GE++L+ KG+WDVPHPWLNLFVPKSRI D
Sbjct  309   LQELFKGLRFLPGLVFTKDVTLVDFLDRVHNGELQLQAKGLWDVPHPWLNLFVPKSRISD  368

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DIIL+ N+T GP+LVYP  + +WD+ MSA +P+E+ FY +GLLHSS  ++WE 
Sbjct  369   FNSGVFRDIILKTNQTVGPLLVYPMIRNKWDNGMSAAIPDEDIFYSIGLLHSSGADDWEP  428

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EILK+CD+AGIKIKQYLP Y T+ DW  HFG KW+IF+ RKA FDPK ILSPGQ
Sbjct  429   LENQNKEILKFCDKAGIKIKQYLPRYTTKADWMNHFGPKWKIFEDRKAQFDPKNILSPGQ  488

Query  228   RIFS  217
             RIF+
Sbjct  489   RIFN  492



>ref|XP_010262099.1| PREDICTED: cytokinin dehydrogenase 3-like [Nelumbo nucifera]
Length=529

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/429 (69%), Positives = 357/429 (83%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A +GVVV+M SL    NG RI V+ S SLG+YADVGG +LW+DVL A
Sbjct  100   ARGRGHSVRGQAMAHNGVVVDMRSLNNDSNGNRINVARSSSLGWYADVGGEQLWIDVLLA  159

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYLTVGGTLSNAGISGQSFR+GPQI+NV EMDVITG+GEL+ CS++
Sbjct  160   TLEHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVFEMDVITGRGELVRCSRN  219

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+AVLGGLGQFG+ITRARI L+ APT+V+WVRMLY DF+ FTRDQEHLISI    
Sbjct  220   TNSELFYAVLGGLGQFGIITRARIALELAPTKVRWVRMLYHDFSAFTRDQEHLISIHGGI  279

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
              GLDYVEGSL+M QSPANNWRSSFFS +  S+IASL + +GI+YSLE+ KYYDD TA  +
Sbjct  280   KGLDYVEGSLVMPQSPANNWRSSFFSSADHSRIASLANQYGILYSLEVAKYYDDLTADGV  339

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D EL+ + KGLSFI GL+F KDVS+ DFLNRVRSGE+KL+ +G+WDVPHPWLNLFVP+SR
Sbjct  340   DGELESLLKGLSFIPGLIFAKDVSYVDFLNRVRSGELKLQSQGLWDVPHPWLNLFVPRSR  399

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE--EETFYCVGLLHSSRV  424
             I DF+ GVF  I+ +QNKTSGPILVYP N+++WDDRMSAV+P+  ++ FY VGLL SS +
Sbjct  400   IFDFDSGVFRGILKKQNKTSGPILVYPMNRSKWDDRMSAVIPDDVDDIFYSVGLLQSSGM  459

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             ++WE L NQN+EIL +C++AGIK+KQYLPHY+++ +W  H G KW+ F+  K  FDPK I
Sbjct  460   HDWEYLENQNKEILMFCEKAGIKVKQYLPHYRSKAEWVNHLGPKWETFKAWKNKFDPKAI  519

Query  243   LSPGQRIFS  217
             LSPGQRIF+
Sbjct  520   LSPGQRIFT  528



>ref|XP_011009888.1| PREDICTED: cytokinin dehydrogenase 3 [Populus euphratica]
Length=529

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/429 (67%), Positives = 349/429 (81%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA A +GVVV+M SL+  +NG  I VS   SLGFYADVGG +LW+DVL +
Sbjct  99    ARGHGHSVGGQAMASNGVVVDMMSLRNHKNGTGITVSKCPSLGFYADVGGEQLWIDVLHS  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             ++ HG APVSWTDYLYL+VGGTLSNAGISG +F+YGPQI+NV EMDV+TGKGEL+TCS H
Sbjct  159   TMEHGFAPVSWTDYLYLSVGGTLSNAGISGTTFQYGPQISNVYEMDVVTGKGELVTCSSH  218

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+AVLGGLGQFG+ITRARI L+ AP RVKWVRMLY DF+ FTRDQE LISI+   
Sbjct  219   TNSELFYAVLGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSAFTRDQELLISINGWK  278

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LDY+EGSL+M Q P NNWRSSFF  S   +I SL++ H IIY LE+ KYYDD T  
Sbjct  279   QKNALDYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHAIIYCLEVAKYYDDGTRH  338

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             T+D++LQ++FKGLSF+ G  FEKDVSF DFLNRVRSGE KL  +G+WDVPHPWLNLF+PK
Sbjct  339   TVDKDLQQLFKGLSFVAGFKFEKDVSFVDFLNRVRSGEQKLHSQGLWDVPHPWLNLFLPK  398

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRILDFN GVF D++L++N T+G +L YP N+ +WDD+MSAV+PEE+ FY VG LHSS  
Sbjct  399   SRILDFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVIPEEDIFYTVGFLHSSGF  458

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             N+W+   +QN++ILK+CD  GI+IKQYLPHY + ++W  HFG KW+ F++RKA FDPK++
Sbjct  459   NDWQAYDHQNKDILKFCDRNGIEIKQYLPHYNSNKEWINHFGSKWRNFRERKAQFDPKMM  518

Query  243   LSPGQRIFS  217
             LSPGQRIF+
Sbjct  519   LSPGQRIFN  527



>ref|XP_002308300.2| Cytokinin dehydrogenase 3 precursor family protein [Populus trichocarpa]
 gb|EEE91823.2| Cytokinin dehydrogenase 3 precursor family protein [Populus trichocarpa]
Length=529

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/429 (66%), Positives = 350/429 (82%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA A +GVVV+M+SL+  +NG  I VS   SLGFYADVGG +LW+DVL +
Sbjct  99    ARGHGHSVGGQAMASNGVVVDMTSLRNHKNGTGITVSKCPSLGFYADVGGEQLWIDVLHS  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             ++ HG APVSWTDYLYL+VGGTLSNAGISG +FRYGPQI+NV EMDV+TGKGEL+TCS H
Sbjct  159   TMEHGFAPVSWTDYLYLSVGGTLSNAGISGTTFRYGPQISNVYEMDVVTGKGELVTCSSH  218

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+AVLGGLGQFG+ITRARI L+ AP RVKWVR+LY DF+ FTRDQE LISI+   
Sbjct  219   TNSELFYAVLGGLGQFGIITRARIALEPAPKRVKWVRILYSDFSAFTRDQERLISINGRK  278

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LDY+EGSL+M Q P NNWRSSFF  S   +I SL++ H IIY LE+ KYYDD T  
Sbjct  279   QKNALDYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHAIIYCLEVAKYYDDGTRH  338

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D++LQ++ KGLSF+ G +FEKDVSF DFLNRVRSGE KL  +G+WDVPHPWLNLF+PK
Sbjct  339   IVDKDLQQLLKGLSFVAGFMFEKDVSFVDFLNRVRSGEQKLHSQGLWDVPHPWLNLFLPK  398

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRIL+FN GVF D++L++N T+G +L YP N+ +WDD+MSAV+PEE+ FY VG LHSS  
Sbjct  399   SRILEFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVIPEEDIFYTVGFLHSSGF  458

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             N+W+   +QN++ILK+CD+AGI+IKQYLP Y + ++W  HFG KW+ F++RKA FDPK++
Sbjct  459   NDWQAYDHQNKDILKFCDKAGIEIKQYLPLYNSNKEWINHFGSKWRNFRERKAQFDPKMM  518

Query  243   LSPGQRIFS  217
             LSPGQRIF+
Sbjct  519   LSPGQRIFN  527



>ref|XP_002514119.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF48073.1| gulonolactone oxidase, putative [Ricinus communis]
Length=529

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/432 (66%), Positives = 345/432 (80%), Gaps = 11/432 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSL-----KRNGGRIRVSWSESLGFYADVGGHELWVDV  1318
             ARG  HS  GQA A DGVVV+M  L     K NGG + VS    LGFYADVGG +LW+DV
Sbjct  99    ARGRSHSINGQAMAPDGVVVDMMHLRSIIEKTNGG-VTVSKDPLLGFYADVGGEQLWIDV  157

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L A++ HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQI+NV EMDV+TG+GEL+TC
Sbjct  158   LNATIEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVYEMDVVTGRGELVTC  217

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S H NS+LF+AVLGGLGQFG+ITRARI L+ AP +VKWVRMLY DF++FT+DQE LISI+
Sbjct  218   SGHRNSDLFYAVLGGLGQFGIITRARIALEPAPKKVKWVRMLYSDFSEFTKDQERLISIN  277

Query  957   -----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  + LDYVEGSL+M Q P NNWRSSFF  S   +I SL++ HGIIY LE+ KYYDD 
Sbjct  278   GRKQSNALDYVEGSLLMNQGPPNNWRSSFFPSSDIPRIMSLVTQHGIIYCLEVAKYYDDA  337

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T  ++  ELQ MFKGLSF  G +FEKDV + DFL+RVRSGE+KL+ +G+WDVPHPWLNLF
Sbjct  338   TQHSMSMELQLMFKGLSFADGFMFEKDVPYVDFLDRVRSGEIKLQSQGLWDVPHPWLNLF  397

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             +PKS I DFN GVF DI+L++N T+GP+LVYP N+ +WDDR SAV+P+E+ FY VG LHS
Sbjct  398   LPKSSISDFNSGVFRDIVLKRNVTTGPVLVYPMNRNKWDDRTSAVIPDEDVFYTVGFLHS  457

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             S  ++W+   +QN+++L YCD+AGIK+KQY PHY T+E+W  HFG KW+ F +RKA FDP
Sbjct  458   SGFDDWQTYDDQNKDLLNYCDKAGIKVKQYFPHYTTKEEWTDHFGSKWRTFVERKAKFDP  517

Query  252   KLILSPGQRIFS  217
             K +LSPGQRIF+
Sbjct  518   KRMLSPGQRIFN  529



>emb|CBI37291.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/424 (69%), Positives = 347/424 (82%), Gaps = 4/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN--GGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+ +   G YADVGG + W+DVL+A
Sbjct  44    ARGQGHSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGSYADVGGEQQWIDVLQA  103

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK 
Sbjct  104   TLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKD  163

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+ITRARI L+ AP RVKW++MLYDDF+ F+RDQEHLISI+ GL
Sbjct  164   TNSELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFSRDQEHLISIN-GL  222

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSL M  SP NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEE
Sbjct  223   DYLEGSLSMQNSPPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEE  281

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQ + KGL+F+ G VF KDVS  DFLNRV SGE+ LR KG+WDVPHPWLNLFVP+S I D
Sbjct  282   LQVLLKGLNFLPGFVFTKDVSLVDFLNRVHSGELNLRAKGLWDVPHPWLNLFVPRSSISD  341

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DI+ + N+T+GP LVYP  + +WDDR SAV+P+E+ FY VG+LHSS  ++WE 
Sbjct  342   FNSGVFRDILPKINQTTGPFLVYPMIRNKWDDRTSAVIPDEDIFYTVGVLHSSGADDWEP  401

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EILK+CD+AGIKIK+YL  Y T+EDW  HFG KW+ F+ RKA FDPK+ILSPGQ
Sbjct  402   LENQNKEILKFCDKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDPKMILSPGQ  461

Query  228   RIFS  217
             +IF+
Sbjct  462   QIFN  465



>ref|XP_002263646.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=522

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/424 (69%), Positives = 347/424 (82%), Gaps = 4/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN--GGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+ +   G YADVGG + W+DVL+A
Sbjct  99    ARGQGHSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGSYADVGGEQQWIDVLQA  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK 
Sbjct  159   TLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKD  218

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+ITRARI L+ AP RVKW++MLYDDF+ F+RDQEHLISI+ GL
Sbjct  219   TNSELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFSRDQEHLISIN-GL  277

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSL M  SP NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEE
Sbjct  278   DYLEGSLSMQNSPPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEE  336

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQ + KGL+F+ G VF KDVS  DFLNRV SGE+ LR KG+WDVPHPWLNLFVP+S I D
Sbjct  337   LQVLLKGLNFLPGFVFTKDVSLVDFLNRVHSGELNLRAKGLWDVPHPWLNLFVPRSSISD  396

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DI+ + N+T+GP LVYP  + +WDDR SAV+P+E+ FY VG+LHSS  ++WE 
Sbjct  397   FNSGVFRDILPKINQTTGPFLVYPMIRNKWDDRTSAVIPDEDIFYTVGVLHSSGADDWEP  456

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EILK+CD+AGIKIK+YL  Y T+EDW  HFG KW+ F+ RKA FDPK+ILSPGQ
Sbjct  457   LENQNKEILKFCDKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDPKMILSPGQ  516

Query  228   RIFS  217
             +IF+
Sbjct  517   QIFN  520



>ref|XP_006475463.1| PREDICTED: cytokinin dehydrogenase 3-like [Citrus sinensis]
Length=525

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/430 (66%), Positives = 344/430 (80%), Gaps = 11/430 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G GHS RGQA A  GVVVEM +LK  RNG  I V      GFYADV G +LW+DVL A
Sbjct  99    AKGRGHSVRGQAMADGGVVVEMMALKNYRNGNGITVG----SGFYADVAGEQLWIDVLNA  154

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV E+DVITGKGEL+TCS  
Sbjct  155   TLEHGLAPASWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVITGKGELMTCSAL  214

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+A LGGLGQFG+ITRARI L+ AP RVKWVRMLY DF+ F+RDQE+LIS++   
Sbjct  215   KNSELFYAALGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSSFSRDQEYLISMNGRR  274

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
                 LDY+EG+LIM Q   +NWRSSFF PS   +I S +  H IIY LE+ KYYDD T +
Sbjct  275   QKQALDYLEGTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAIIYCLEVAKYYDDHTQS  334

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             T+ +ELQ +FKGLS++ G +FEKDVS+ +FLNRVRSGE+KL  +G+W+VPHPWLNLF+PK
Sbjct  335   TLHKELQTLFKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQGLWEVPHPWLNLFLPK  394

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRI DFN GVF DI+L++N T+GP+LVYP N+ +WDDRMSAV+P+E+ FY VG LHSS  
Sbjct  395   SRISDFNKGVFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPDEDVFYTVGFLHSSGF  454

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             +EWE   +QN+EILK+C+ AGIK+KQYLP+++ +E+W KHFG KW  F QRKA FDPK+I
Sbjct  455   DEWEAFDDQNKEILKFCENAGIKVKQYLPYHRNKEEWIKHFGSKWNTFAQRKAHFDPKMI  514

Query  243   LSPGQRIFSQ  214
             LSPGQRIF+ 
Sbjct  515   LSPGQRIFNN  524



>gb|KDO49370.1| hypothetical protein CISIN_1g009793mg [Citrus sinensis]
Length=525

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/430 (66%), Positives = 344/430 (80%), Gaps = 11/430 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G GHS RGQA A  GVVVEM +LK  RNG  I V      GFYADV G +LW+DVL A
Sbjct  99    AKGRGHSVRGQAMADGGVVVEMMALKNYRNGNGITVG----SGFYADVAGEQLWIDVLNA  154

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV E+DV+TGKGEL+TCS  
Sbjct  155   TLEHGLAPASWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVVTGKGELMTCSAL  214

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+A LGGLGQFG+ITRARI L+ AP RVKWVRMLY DF+ F+RDQE+LIS++   
Sbjct  215   KNSELFYAALGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSSFSRDQEYLISMNGRR  274

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
                 LDY+EG+LIM Q   +NWRSSFF PS   +I S +  H IIY LE+ KYYDD T +
Sbjct  275   QKQALDYLEGTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAIIYCLEVAKYYDDHTQS  334

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             T+ +ELQ +FKGLS++ G +FEKDVS+ +FLNRVRSGE+KL  +G+W+VPHPWLNLF+PK
Sbjct  335   TLHKELQTLFKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQGLWEVPHPWLNLFLPK  394

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRI DFN GVF DI+L++N T+GP+LVYP N+ +WDDRMSAV+P+E+ FY VG LHSS  
Sbjct  395   SRISDFNKGVFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPDEDVFYTVGFLHSSGF  454

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             +EWE   +QN+EILK+C+ AGIK+KQYLP+++ +E+W KHFG KW  F QRKA FDPK+I
Sbjct  455   DEWEAFDDQNKEILKFCENAGIKVKQYLPYHRNKEEWIKHFGSKWNTFAQRKAHFDPKMI  514

Query  243   LSPGQRIFSQ  214
             LSPGQRIF+ 
Sbjct  515   LSPGQRIFNN  524



>ref|XP_006451484.1| hypothetical protein CICLE_v10007992mg [Citrus clementina]
 gb|ESR64724.1| hypothetical protein CICLE_v10007992mg [Citrus clementina]
Length=525

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/430 (66%), Positives = 344/430 (80%), Gaps = 11/430 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G GHS RGQA A  GVVVEM +LK  RNG  I V      GFYADV G +LW+DVL A
Sbjct  99    AKGRGHSVRGQAMADGGVVVEMMALKNYRNGNGITVG----SGFYADVAGEQLWIDVLNA  154

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV E+DVI+GKGEL+TCS  
Sbjct  155   TLEHGLAPASWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVISGKGELMTCSAL  214

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+A LGGLGQFG+ITRARI L+ AP RVKWVRMLY DF+ F+RDQE+LIS++   
Sbjct  215   KNSELFYAALGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSSFSRDQEYLISMNGRR  274

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
                 LDY+EG+LIM Q   +NWRSSFF PS   +I S +  H IIY LE+ KYYDD T +
Sbjct  275   QKQALDYLEGTLIMDQGSLDNWRSSFFPPSDHPKIISQVKTHAIIYCLEVAKYYDDHTQS  334

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             T+ +ELQ +FKGLS++ G +FEKDVS+ +FLNRVRSGE+KL  +G+W+VPHPWLNLF+PK
Sbjct  335   TLHKELQTLFKGLSYLPGFMFEKDVSYVEFLNRVRSGELKLESQGLWEVPHPWLNLFLPK  394

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRI DFN GVF DI+L++N T+GP+LVYP N+ +WDDRMSAV+P+E+ FY VG LHSS  
Sbjct  395   SRISDFNKGVFRDIVLKRNITTGPVLVYPMNRNKWDDRMSAVIPDEDVFYTVGFLHSSGF  454

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             +EWE   +QN+EILK+C+ AGIK+KQYLP+++ +E+W KHFG KW  F QRKA FDPK+I
Sbjct  455   DEWEAFDDQNKEILKFCENAGIKVKQYLPYHRNKEEWIKHFGSKWNTFAQRKAHFDPKMI  514

Query  243   LSPGQRIFSQ  214
             LSPGQRIF+ 
Sbjct  515   LSPGQRIFNN  524



>ref|XP_007012819.1| Cytokinin oxidase [Theobroma cacao]
 gb|EOY30438.1| Cytokinin oxidase [Theobroma cacao]
Length=524

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/431 (65%), Positives = 352/431 (82%), Gaps = 10/431 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+GHGHS RGQA A +GVVV+M+S+K  RNG  IR+S   S G YAD+GG +LW+DVL A
Sbjct  97    AKGHGHSVRGQAMANNGVVVDMASMKKHRNGSGIRIS---SDGCYADIGGEQLWIDVLNA  153

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GLAPVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV EMDVITG  +  TCS  
Sbjct  154   TLERGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEMDVITGTADFHTCSPE  213

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+AVLGGLGQFG+ITRARI L+ AP RVKWVRMLY+DF+ FTRDQE LISI+   
Sbjct  214   KNSELFYAVLGGLGQFGIITRARIPLEPAPKRVKWVRMLYNDFSAFTRDQELLISINGRK  273

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LDY+EGSL+M Q   +NWRSSFF P+   +I SLI+ H IIY LE+VK+YDD+T +
Sbjct  274   DNNALDYLEGSLMMDQGSPDNWRSSFFPPADHPKIMSLITEHRIIYCLEVVKHYDDQTKS  333

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             T+D+ELQ++ KGLS+  GL+FEKDV + +FLNRVRSGE+KL+ +G+WDVPHPWLNLF+PK
Sbjct  334   TVDKELQQLLKGLSYTPGLMFEKDVLYAEFLNRVRSGELKLKSQGLWDVPHPWLNLFIPK  393

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             S+I DFN GVF  I+L ++ T+GP+L+YP N+ +WDDRMSAV+P+EE FY VG+LHSS  
Sbjct  394   SQIADFNDGVFKGIVLERSITTGPVLLYPMNRKKWDDRMSAVIPDEEIFYTVGILHSSGF  453

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             ++WE   +QN+EI+++CD+AGI +KQYLPHY  +E+W +HFG KW+ FQQ K  FDPK+I
Sbjct  454   DDWEAFDDQNKEIMQFCDKAGIGVKQYLPHYTAKEEWIQHFGSKWKTFQQSKHQFDPKMI  513

Query  243   LSPGQRIFSQS  211
             LSPGQRIF+ +
Sbjct  514   LSPGQRIFNNN  524



>ref|XP_002264445.1| PREDICTED: cytokinin dehydrogenase 3 [Vitis vinifera]
Length=522

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/424 (68%), Positives = 344/424 (81%), Gaps = 4/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+ +   G YAD GG +LW+DVL+A
Sbjct  99    ARGQGHSLRGQAMAPHGVVVEMRSLNNCSRGSGIRVTKNPISGSYADAGGEQLWIDVLQA  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK 
Sbjct  159   TLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKD  218

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHLISI+ GL
Sbjct  219   TNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISIN-GL  277

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSL+M  S  NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEE
Sbjct  278   DYLEGSLLMQNSSPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEE  336

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQE+ KGL+F+ G VF KDVS  DFLNRV S E+ L+ KG+WDVPHPWLNLFVP SRI D
Sbjct  337   LQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLQAKGLWDVPHPWLNLFVPGSRISD  396

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DI+ + N+T+G  LVYP  + +WDDR SAV+P+E+ FY VGLLHSS  ++WE 
Sbjct  397   FNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEP  456

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EIL++CD+AGIKIK+YL  Y T+EDW  HFG KW+ F+ RKA FDPKLILSPGQ
Sbjct  457   LENQNKEILQFCDKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDPKLILSPGQ  516

Query  228   RIFS  217
             +IF+
Sbjct  517   QIFN  520



>emb|CAN80714.1| hypothetical protein VITISV_042932 [Vitis vinifera]
Length=522

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/424 (68%), Positives = 344/424 (81%), Gaps = 4/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+ +   G YADVGG + W+DVL+A
Sbjct  99    ARGQGHSLRGQAMAXHGVVVEMRSLNNCSXGSGIRVTKNPIWGSYADVGGEQQWIDVLQA  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK 
Sbjct  159   TLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKD  218

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHLISI+ GL
Sbjct  219   TNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISIN-GL  277

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSL+M  S  NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEE
Sbjct  278   DYLEGSLLMQNSSPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEE  336

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQE+ KGL+F+ G VF KDVS  DFLNRV S E+ LR KG+WDVPHPWLNLFVP SRI D
Sbjct  337   LQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRISD  396

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DI+ + N+T+G  LVYP  + +WDDR SAV+P+E+ FY VGLLHSS  ++WE 
Sbjct  397   FNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEP  456

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EILK+CD+AGIKIK+YL  Y T++DW  HFG KW+ F+ RKA FDPK+ILSPGQ
Sbjct  457   LENQNKEILKFCDKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPKMILSPGQ  516

Query  228   RIFS  217
             +IF+
Sbjct  517   QIFN  520



>ref|XP_010090055.1| Cytokinin dehydrogenase 3 [Morus notabilis]
 gb|EXB38852.1| Cytokinin dehydrogenase 3 [Morus notabilis]
Length=529

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/429 (64%), Positives = 346/429 (81%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA A++GVVV M++LK  R+G  I VS   SLG+YADVGG +LW+DVL A
Sbjct  101   ARGHGHSVHGQAMAQNGVVVNMAALKTYRSGTGIVVSGDPSLGYYADVGGEQLWIDVLHA  160

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HG APVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV E+DVITGKGE +TCS H
Sbjct  161   TLEHGFAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVITGKGEFVTCSVH  220

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+A LGGLGQFG+I RARI L+ AP RVKWVRMLY DF+ F+RDQE LI I+   
Sbjct  221   KNSELFYAALGGLGQFGIIVRARIALEPAPKRVKWVRMLYSDFSAFSRDQERLIKINGRK  280

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LDY+EGSL+M Q   NNWRSSFF  S  S+I S ++ H IIY LE+ K YDD + T
Sbjct  281   DKNALDYLEGSLLMNQGSPNNWRSSFFPRSDHSRIISKVTEHKIIYCLEVAKLYDDRSKT  340

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             T+D+ LQ + +GLSF  G +FEKDV++ DF++RVR GE+KL+ +G+W+VPHPWLNLF+PK
Sbjct  341   TVDKVLQVLLQGLSFEPGFMFEKDVAYVDFVDRVRGGELKLQSQGLWEVPHPWLNLFIPK  400

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SR+ DFN GVF +I+L++N T+GP+L+YP N+ +WDDR SAV+P+E+ FY VG LHSS  
Sbjct  401   SRVSDFNAGVFREIVLKRNITTGPVLLYPMNRNKWDDRTSAVIPDEDVFYTVGFLHSSGF  460

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             ++WE    QN++IL++C++ GI++KQYLPHYKT+EDW KHFG KW+ F +RK++FDPK I
Sbjct  461   DDWESFDQQNKDILQFCEDVGIEVKQYLPHYKTQEDWMKHFGSKWRTFNERKSMFDPKKI  520

Query  243   LSPGQRIFS  217
             LSPGQRIF+
Sbjct  521   LSPGQRIFN  529



>emb|CAN77185.1| hypothetical protein VITISV_039458 [Vitis vinifera]
Length=522

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/424 (68%), Positives = 342/424 (81%), Gaps = 4/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN--GGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+ +   G YADVGG + W+DVL+A
Sbjct  99    ARGQGHSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGSYADVGGEQQWIDVLQA  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK 
Sbjct  159   TLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKD  218

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+ITRARI L+ AP RVKW++MLYDDF+ F+RDQEHLISI+ GL
Sbjct  219   TNSELFFAVLGGLGQFGIITRARIALEPAPERVKWIQMLYDDFSTFSRDQEHLISIN-GL  277

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSL M  S  NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEE
Sbjct  278   DYLEGSLXMQNSXPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEE  336

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQE+ KGL+F+ G VF KDVS  DFLNRV S E+ LR KG+WDVPHPWLNLFVP SRI D
Sbjct  337   LQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRISD  396

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DI+ + N+T+G  LVYP  + +WDDR SAV+P+E+ FY VG LHSS  ++WE 
Sbjct  397   FNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGXLHSSGADDWEP  456

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EILK+CD+AGIKIK+YL  Y T+ DW  HFG KW  F+ RKA FDPK+ILSPGQ
Sbjct  457   LENQNKEILKFCDKAGIKIKRYLSRYTTKXDWMNHFGPKWXTFEDRKAQFDPKMILSPGQ  516

Query  228   RIFS  217
             +IF+
Sbjct  517   QIFN  520



>gb|AGW52152.1| CKX3 [Populus tomentosa]
Length=529

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 343/429 (80%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             AR HGHS  GQA A +GVVV+M+SL+  +NG  I VS   SLGFYADVGG  LW+DVL +
Sbjct  99    ARRHGHSVGGQAMASNGVVVDMTSLRNHKNGTGITVSKCPSLGFYADVGGELLWIDVLHS  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             ++ HG APVSWTD LYL+VGGTLSNAGISG +FRYGPQI+NV EMDV+TGKGEL+T S H
Sbjct  159   TMEHGFAPVSWTDCLYLSVGGTLSNAGISGTTFRYGPQISNVYEMDVVTGKGELVTYSSH  218

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+AVLGGLGQFG+ITRARI L+ AP RVKWVR+LY DF+ F RDQE LISI+   
Sbjct  219   TNSELFYAVLGGLGQFGIITRARIALEPAPNRVKWVRILYSDFSAFRRDQERLISINGRK  278

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + L Y+EGSL+M Q P NNWRSSFF  S   +I SL++ H IIY LE+ KYYDD T  
Sbjct  279   QKNALAYLEGSLLMAQGPPNNWRSSFFPSSDIPKIMSLVTQHAIIYCLEVAKYYDDGTRH  338

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D++LQ++ KGLSF+ G +FEKDVSF DFLNRVRSGE KL  +G+WDVPHPWLNLF+PK
Sbjct  339   IVDQDLQQLLKGLSFVAGFMFEKDVSFVDFLNRVRSGEQKLHSQGLWDVPHPWLNLFLPK  398

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRIL+FN GVF D++L++N T+G +L YP N+ +WDD+MSAV+PEE  FY VG LHSS  
Sbjct  399   SRILEFNKGVFHDLVLKRNITTGVVLFYPMNRKKWDDKMSAVIPEEHIFYTVGFLHSSGF  458

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             N+W+  G+QN++ILK+CD AGI+IKQYLP Y + ++W  HFG KW+ F++RKA FDPK++
Sbjct  459   NDWQAYGHQNKDILKFCDTAGIEIKQYLPLYNSNKEWINHFGSKWRNFRERKAQFDPKMM  518

Query  243   LSPGQRIFS  217
             LSPGQRIF+
Sbjct  519   LSPGQRIFN  527



>ref|XP_008450862.1| PREDICTED: cytokinin dehydrogenase 3-like [Cucumis melo]
Length=515

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/426 (64%), Positives = 341/426 (80%), Gaps = 4/426 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             A+G GHS  GQA A++GVVVEM+SL  N  RI +S S   GF+ADVGG ++W+DVL A+L
Sbjct  89    AKGCGHSVHGQAMAQNGVVVEMTSLNNNPTRISISGSADAGFFADVGGEQMWIDVLNATL  148

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAP SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI NV+E+DV+TGKG++++CS   N
Sbjct  149   KHGLAPPSWTDYLYLTVGGTLSNAGISGQTFRYGPQICNVVELDVVTGKGDIVSCSAEKN  208

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI----DD  955
             +ELF +VLGGLGQFG+I RARI L  AP RVKWVRMLY++F +F +DQE+LIS+    D 
Sbjct  209   NELFNSVLGGLGQFGIIVRARIPLFPAPNRVKWVRMLYNNFDEFVKDQENLISMNSNDDG  268

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             GLDY+EG L+M   P +NWRSSFF PSH S I SL++ H IIY LE+ KYYDD +  TI+
Sbjct  269   GLDYLEGLLLMHDGPPDNWRSSFFPPSHHSTIISLVNQHSIIYCLEVAKYYDDHSRHTIN  328

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +EL +  +GL+F+ G  FEKDVS+ +FLNRVR GE+ LR +G+WDVPHPWLNLFVPKSRI
Sbjct  329   QELDDSLEGLNFLPGYKFEKDVSYVEFLNRVRGGELSLRSQGLWDVPHPWLNLFVPKSRI  388

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
              +F++GVF DIIL++   SGPIL+YP N+ +WD++MSA++PEEE FY +G L+SS  + W
Sbjct  389   AEFDLGVFKDIILKRKIASGPILIYPMNRNKWDEKMSAIIPEEEVFYTIGFLNSSGYDNW  448

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             E +  QN+EIL +CD   +KIKQYLPHY T+EDWEKHFG KW+IFQ RK  FDPK+ILSP
Sbjct  449   EAIEEQNKEILSFCDSVDMKIKQYLPHYNTKEDWEKHFGNKWKIFQDRKNQFDPKMILSP  508

Query  234   GQRIFS  217
             GQ+IF+
Sbjct  509   GQKIFN  514



>ref|XP_010242231.1| PREDICTED: cytokinin dehydrogenase 3 isoform X1 [Nelumbo nucifera]
Length=529

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/434 (67%), Positives = 343/434 (79%), Gaps = 16/434 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR---NGGRIRVSWSESL--GFYADVGGHELWVDV  1318
             ARG GHS RGQATA  GVVV+M SL     NG RI V  S      +YADVG  +LWVDV
Sbjct  99    ARGRGHSVRGQATAHKGVVVDMRSLDNDHNNGSRIIVDRSSPSVNNWYADVGCEQLWVDV  158

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L A+L HGLAP SWTDYLYLTVGGTLSNAGISGQSFR+GPQI+NV EMDV+TG+GEL+TC
Sbjct  159   LHATLEHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVYEMDVVTGRGELVTC  218

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S   NSELF+AVLGGLGQFG+ITRARI L+ APT+V+WVR+LY DF  FTRDQEHLIS +
Sbjct  219   SPQTNSELFYAVLGGLGQFGIITRARIALEPAPTKVRWVRLLYHDFIAFTRDQEHLISFN  278

Query  957   D------GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDD  796
             +      GLDYVEGSL+M QSPANNWRSSFFSP   S+I SL + HGI+YSLE+ KYYDD
Sbjct  279   NGSEGIKGLDYVEGSLVMNQSPANNWRSSFFSPDDHSRIISLANEHGILYSLEVAKYYDD  338

Query  795   ETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
             E    +D EL+ + KGLSFI  L+F KDVS+ DFLNRVRSGE++L+ +G+WDVPHPWLNL
Sbjct  339   E----VDGELEALLKGLSFIPDLIFAKDVSYIDFLNRVRSGELELQSQGLWDVPHPWLNL  394

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG-LL  439
             FVPKSRILDF+ G F  I+ + NK SGPILVYP N+ +WDDRMSAV+PEE+ FY +G LL
Sbjct  395   FVPKSRILDFDSGAFKGILRQNNKISGPILVYPMNRNKWDDRMSAVIPEEDIFYSIGLLL  454

Query  438   HSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALF  259
              SS  ++WE L  QN EIL++C++AGIKIKQYLP Y+T+ +W  HFG KW  F+QRK  F
Sbjct  455   QSSGTHDWEHLEEQNTEILRFCEKAGIKIKQYLPRYQTKAEWVNHFGPKWDTFKQRKTKF  514

Query  258   DPKLILSPGQRIFS  217
             DPK ILSPGQ +F+
Sbjct  515   DPKAILSPGQGVFT  528



>emb|CBI37295.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/424 (68%), Positives = 344/424 (81%), Gaps = 4/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN--GGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+ +   G YADVGG + W+DVL+A
Sbjct  209   ARGQGHSLRGQAMASHGVVVEMRSLNNCSCGSGIRVTKNPIWGSYADVGGEQQWIDVLQA  268

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK 
Sbjct  269   TLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKD  328

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHLISI+ GL
Sbjct  329   TNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISIN-GL  387

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSL+M  S  NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEE
Sbjct  388   DYLEGSLLMQNSSPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEE  446

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQE+ KGL+F+ G VF KDVS  DFLNRV S E+ L+ KG+WDVPHPWLNLFVP SRI D
Sbjct  447   LQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLQAKGLWDVPHPWLNLFVPGSRISD  506

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DI+ + N+T+G  LVYP  + +WDDR SAV+P+E+ FY VGLLHSS  ++WE 
Sbjct  507   FNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEP  566

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EIL++CD+AGIKIK+YL  Y T+EDW  HFG KW+ F+ RKA FDPKLILSPGQ
Sbjct  567   LENQNKEILQFCDKAGIKIKRYLSRYTTKEDWMNHFGPKWRTFEDRKAQFDPKLILSPGQ  626

Query  228   RIFS  217
             +IF+
Sbjct  627   QIFN  630


 Score =   152 bits (385),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+ +   G YAD GG +LW+DVL+A
Sbjct  99    ARGQGHSLRGQAMAPHGVVVEMRSLNNCSRGSGIRVTKNPISGSYADAGGEQLWIDVLQA  158

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITG  1159
             +L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+T 
Sbjct  159   TLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTA  208



>ref|XP_004158449.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 3-like 
[Cucumis sativus]
Length=516

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/426 (64%), Positives = 338/426 (79%), Gaps = 4/426 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             A+G GHS  GQA A++GVVVEM+SL  N  RI +S S   GF+ADVGG ++W+DVL A+L
Sbjct  90    AKGCGHSVHGQAMAENGVVVEMTSLNNNPSRISISGSADAGFFADVGGEQMWIDVLTATL  149

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAP SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI NV+E+DV+TGKG++++CS   N
Sbjct  150   KHGLAPPSWTDYLYLTVGGTLSNAGISGQTFRYGPQICNVLELDVVTGKGDIVSCSAEXN  209

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI----SIDD  955
             +ELF +VLGGLGQFG+I RARI L  AP RVKWVRMLY++F +F +DQE LI    + D 
Sbjct  210   NELFNSVLGGLGQFGIIVRARIPLFPAPNRVKWVRMLYNNFDEFVKDQEKLILKNSNDDG  269

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             GL+Y+EG L+M   P +NWRSSFF PSH S I SL++ H IIY LE+ KYYDD +  TID
Sbjct  270   GLNYLEGLLLMHDGPPDNWRSSFFPPSHHSTIISLVNQHSIIYCLEVAKYYDDRSRHTID  329

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +EL  + KGL+F+ G  FEKDVS+ +FLNRVR GE+ LR +G+WDVPHPWLNLFVPKSRI
Sbjct  330   KELDNLLKGLNFLPGYKFEKDVSYVEFLNRVRGGELSLRSQGLWDVPHPWLNLFVPKSRI  389

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
              +FN GVF DIIL++   +GPIL+YP N+ +WDD+MSAV+PEEE FY +G L+SS  + W
Sbjct  390   AEFNSGVFKDIILKRKIANGPILIYPMNRNKWDDKMSAVIPEEEVFYTIGFLNSSGYDNW  449

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             E +  QN++IL++CD   +KIKQYLPHY T+EDWEKHFG KW+I Q RK  FDPK+ILSP
Sbjct  450   EAVEEQNKDILRFCDSVDMKIKQYLPHYNTKEDWEKHFGNKWKIIQDRKNQFDPKMILSP  509

Query  234   GQRIFS  217
             GQ+IF+
Sbjct  510   GQKIFN  515



>ref|XP_011093737.1| PREDICTED: cytokinin dehydrogenase 3 [Sesamum indicum]
Length=529

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/431 (67%), Positives = 346/431 (80%), Gaps = 6/431 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+ GVVV+M SL +NG  +RVSW  SLG+YADVGG ++W+DVLRA L
Sbjct  98    ARGRGHSVRGQAMARSGVVVDMPSLSQNGIGVRVSWDPSLGYYADVGGEQMWIDVLRAGL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAPVSWTDYLYL+VGGTLSNAGISGQSF +GPQI+NV+E+DVITGKG+L+TCS+ +N
Sbjct  158   EHGLAPVSWTDYLYLSVGGTLSNAGISGQSFLHGPQISNVLELDVITGKGDLVTCSQQMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS--IDD-G  952
             SELFFAVLGGLGQFG+ITRARIVLDKAPTR KWVR+LY DF+ FTRDQEHLIS  +D+  
Sbjct  218   SELFFAVLGGLGQFGIITRARIVLDKAPTRAKWVRLLYSDFSIFTRDQEHLISSTVDNPS  277

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLI-SNHGIIYSLELVKYYDDETATTID  775
              DYVEGSLI  QSP NNWRSSF++PS +S+IASL+ S  G++YS+ELVKYYDD+TA  ID
Sbjct  278   PDYVEGSLITHQSPPNNWRSSFYTPSDRSKIASLLKSKKGLLYSIELVKYYDDQTADYID  337

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +EL+ + K L+FI G VF+KDV+  DFL RV  G      +      HPWLNLFVPKSRI
Sbjct  338   QELEVLLKDLNFIPGFVFKKDVALIDFLGRV--GRSAASDENNHLEAHPWLNLFVPKSRI  395

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
             LDFN GVFVDII R N TSGPIL YP N+ +WD+RMSAV P+E+ FY +GLL SS   E 
Sbjct  396   LDFNAGVFVDIIGRHNSTSGPILFYPLNRKKWDERMSAVTPDEDVFYTLGLLQSSGAEEP  455

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
              E    N EI+++C++ GIKIKQYLPHYK+EEDW +H+G KW  F +RK  FDP++ILSP
Sbjct  456   GEYDKLNNEIIEFCEKDGIKIKQYLPHYKSEEDWMEHYGPKWNTFLERKNKFDPRMILSP  515

Query  234   GQRIFSQSSSW  202
             GQRIF+ + ++
Sbjct  516   GQRIFTSAIAY  526



>ref|XP_003635659.1| PREDICTED: cytokinin dehydrogenase 3-like, partial [Vitis vinifera]
Length=418

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/418 (68%), Positives = 339/418 (81%), Gaps = 4/418 (1%)
 Frame = -3

Query  1464  SARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRASLPHGL  1291
             S RGQA A  GVVVEM SL     G  IRV+ +   G YAD GG +LW+DVL+A+L HGL
Sbjct  1     SLRGQAMAPHGVVVEMRSLNNCSRGSGIRVTKNPISGSYADAGGEQLWIDVLQATLKHGL  60

Query  1290  APVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINSELF  1111
             APVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK  NSELF
Sbjct  61    APVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTNSELF  120

Query  1110  FAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDYVEGS  931
             FAVLGGLGQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHLISI+ GLDY+EGS
Sbjct  121   FAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISIN-GLDYLEGS  179

Query  930   LIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQEMFK  751
             L+M  S  NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEELQE+ K
Sbjct  180   LLMQNSSPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEELQELLK  238

Query  750   GLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFNVGVF  571
             GL+F+ G VF KDVS  DFLNRV S E+ LR KG+WDVPHPWLNLFVP SRI DFN GVF
Sbjct  239   GLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRISDFNSGVF  298

Query  570   VDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELGNQNE  391
              DI+ + N+T+G  LVYP  + +WDDR SAV+P+E+ FY VGLLHSS  ++WE L NQN+
Sbjct  299   RDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEPLENQNK  358

Query  390   EILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRIFS  217
             EILK+CD+AGIKIK+YL  Y T++DW  HFG KW+ F+ RKA FDPK+ILSPGQ+IF+
Sbjct  359   EILKFCDKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPKMILSPGQQIFN  416



>ref|XP_011077990.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X1 [Sesamum 
indicum]
Length=528

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/426 (67%), Positives = 340/426 (80%), Gaps = 4/426 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A  GVVVEM++L RNGG IRVSWS SLG+YADVGG E+W DVLR  L
Sbjct  95    ARGRGHSVRGQAMAGGGVVVEMAALSRNGGGIRVSWSPSLGYYADVGGEEMWADVLRVGL  154

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAPVSWTDYLYLTVGGTLSNAGISGQSFR+GPQI+NV+E+DVITGKG+ +TCSK +N
Sbjct  155   EHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVLELDVITGKGDFLTCSKDMN  214

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-DGLD  946
             S+LFFAVLGGLGQFG+ITRARIVL KAPTR KWVR++Y+DFT FTRDQEHLIS + +G +
Sbjct  215   SDLFFAVLGGLGQFGIITRARIVLQKAPTRAKWVRLIYNDFTMFTRDQEHLISTNINGPN  274

Query  945   YVEGSLIMTQSPANNWRSSFFSPSHQSQIASLI-SNHGIIYSLELVKYYDDETATTIDEE  769
             YVEGSLI  QSP NNWRSSF+SPS QS+I SL+ S  G++YS+E+VKYY D    TID+E
Sbjct  275   YVEGSLITDQSPPNNWRSSFYSPSDQSKILSLLRSKQGLLYSIEVVKYYHDTNIDTIDQE  334

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWD--VPHPWLNLFVPKSRI  595
             ++ + K L+FI G VF KDVS  DFL RV SG  K  +K        HPWLNLF+PKS I
Sbjct  335   VKLLVKDLNFIPGFVFNKDVSLVDFLTRVGSGRDKEEEKSSDRELETHPWLNLFLPKSSI  394

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
             +DFN  VFV++I R N TSGPIL YP N+ +WDDRMSAV P+E+ FY +GLLH+SR ++ 
Sbjct  395   MDFNDAVFVNVIRRHNHTSGPILFYPFNRQKWDDRMSAVTPDEDIFYTLGLLHTSRPHQS  454

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             +   N N EIL  C++A I +KQYLPHY ++EDW KHFG KW  FQ+RK  FDP++ILSP
Sbjct  455   DVYDNLNSEILDCCEKADIDVKQYLPHYISKEDWMKHFGPKWDTFQERKTKFDPRMILSP  514

Query  234   GQRIFS  217
             GQRIF+
Sbjct  515   GQRIFT  520



>ref|XP_009352666.1| PREDICTED: cytokinin dehydrogenase 3-like [Pyrus x bretschneideri]
Length=517

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/438 (64%), Positives = 342/438 (78%), Gaps = 15/438 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR---NGGRIRVSWSESLGF-------YADVGGHE  1333
             ARGHGHS RGQA A +GVVV+M+SLK    +   I V+ S++ G        YADVGG +
Sbjct  80    ARGHGHSTRGQAMAPNGVVVDMTSLKNYRPHVSGISVNSSKNSGININNNDNYADVGGGQ  139

Query  1332  LWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKG  1153
             LW+DVL A+L HGL PVSWTDYLYLTVGGTLSNAGISG +FR+GPQI NV EMDV+TG+G
Sbjct  140   LWIDVLHATLEHGLTPVSWTDYLYLTVGGTLSNAGISGSAFRFGPQITNVYEMDVVTGQG  199

Query  1152  ELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEH  973
             + +TCS   NSELFF VLGGLGQFG+ITRARI L+ AP RVKWVRMLY DF+ F RDQE 
Sbjct  200   DFVTCSPQKNSELFFGVLGGLGQFGIITRARISLEPAPKRVKWVRMLYSDFSTFARDQER  259

Query  972   LISID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVK  808
             LIS++     + LDY+EGSL++ Q P +NWRSSFF  S  S+I SL++  GIIY LE+ K
Sbjct  260   LISLNGRKQRNALDYLEGSLMLNQGPPDNWRSSFFPQSSHSRIVSLVTKRGIIYCLEVSK  319

Query  807   YYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHP  628
             YYD+ T TT+ +EL+ +FKGLSF+ G +FEKDVS+ DFLNRVRSGE KL  +G WDVPHP
Sbjct  320   YYDEHTETTVKKELELLFKGLSFLPGFLFEKDVSYVDFLNRVRSGEEKLHSQGQWDVPHP  379

Query  627   WLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCV  448
             WLNLF+PKS I DF+ GVF DI+LR+N T+GP+LVYP N+ +WDDRMSAV+P+E+ FY V
Sbjct  380   WLNLFIPKSSISDFDAGVFKDIVLRRNITTGPVLVYPMNRTKWDDRMSAVIPQEDVFYTV  439

Query  447   GLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRK  268
             G L+SS  ++WE    QNEEIL +CD AG+++KQYLPH KT++ W  HFG KW+ F ++K
Sbjct  440   GFLYSSGFDDWEAFEEQNEEILGFCDRAGLEVKQYLPHIKTQQGWINHFGSKWKAFLKKK  499

Query  267   ALFDPKLILSPGQRIFSQ  214
             ALFDPK ILSPGQRIF+ 
Sbjct  500   ALFDPKRILSPGQRIFNN  517



>ref|XP_007154651.1| hypothetical protein PHAVU_003G136400g [Phaseolus vulgaris]
 gb|ESW26645.1| hypothetical protein PHAVU_003G136400g [Phaseolus vulgaris]
Length=535

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/430 (64%), Positives = 342/430 (80%), Gaps = 7/430 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A+DGVVV+M++L+  RNG  I VS    +G YADVGG +LW+DVL A
Sbjct  100   ARGQGHSHHGQAMARDGVVVDMATLRKQRNGVSISVSKDPLIGHYADVGGEQLWIDVLHA  159

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             SL HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQI+NV EMDVITGKGE +TCS  
Sbjct  160   SLEHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSTQ  219

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              N ELF AVLGG GQFGVI RARI L+ AP RVKWVR+LY DF+ FT+DQE LISI+   
Sbjct  220   KNLELFNAVLGGFGQFGVIARARIALETAPKRVKWVRLLYSDFSAFTKDQERLISINGRK  279

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LD++EG L+M Q P NNWRSSFF  S   +IASLI+ HGI+Y LE+ KYYDD+T  
Sbjct  280   QKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRIASLITEHGILYCLEVAKYYDDQTEK  339

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D+E+  + +GL++I G  +EK+VS+ +FLNRVRSGE+KL+ +G+W+VPHPWLNLF+PK
Sbjct  340   NVDKEIHVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQGLWEVPHPWLNLFLPK  399

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             S+ILDFN GVF+DIIL++N +SGP+LVYP N+ +WDDRMSA +P+E+ FY VG LHSS  
Sbjct  400   SQILDFNSGVFMDIILKRNISSGPVLVYPMNRNKWDDRMSASIPDEDVFYTVGFLHSSGF  459

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             + W+    QN EIL++C +AGIK+KQYLP++ T+EDW  HFG KW  F +RK  FDP++I
Sbjct  460   DSWKAHDAQNREILEFCRDAGIKVKQYLPNHSTQEDWTNHFGTKWLKFLERKHQFDPRMI  519

Query  243   LSPGQRIFSQ  214
             LSPGQ+IF +
Sbjct  520   LSPGQKIFHK  529



>ref|XP_004508239.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=543

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/433 (64%), Positives = 344/433 (79%), Gaps = 7/433 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A+DGVVV+M+S +  RNGG I VS    +G+Y DVGG +LW+DVL  
Sbjct  103   ARGQGHSTSGQAMARDGVVVDMASYRKQRNGGAISVSEDPLIGYYVDVGGEQLWIDVLYE  162

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +  H LAPVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI NV EMDVITGKG+L+TCS  
Sbjct  163   TFEHRLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVHEMDVITGKGDLVTCSSK  222

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDG-  952
              NSELF A+LGGLGQFGVITRARI L+ APT VKWVR+LY DF+ FT+DQE LISID   
Sbjct  223   KNSELFHALLGGLGQFGVITRARISLEPAPTWVKWVRVLYSDFSDFTKDQERLISIDGST  282

Query  951   ----LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
                 LD++EG L+M Q   NNWRSSFF  SH S+I+SLI+ H I+Y LEL KYYD ++  
Sbjct  283   KNIELDFLEGMLLMQQGSINNWRSSFFPLSHHSRISSLITKHNILYCLELAKYYDHQSEK  342

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D+E+Q + +GL++I GL +EK+VS+ +FLNRVRSGE+KL+ +G+W VPHPWLNLFVPK
Sbjct  343   MVDKEIQVLLQGLAYIPGLHYEKNVSYVEFLNRVRSGELKLQSQGLWHVPHPWLNLFVPK  402

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             S+ILDFN GVF DIIL++N TSG +L+YP NK++WDDRMS + P+E+ FY VG LHSS  
Sbjct  403   SQILDFNSGVFNDIILKRNITSGIVLIYPMNKSKWDDRMSTITPDEDVFYAVGFLHSSAF  462

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             N W+    QN+EILK+C++ GIK+KQYLP++ TEE W+ HFG KW+ F + K LFDP++I
Sbjct  463   NNWKAYDAQNKEILKFCNDVGIKVKQYLPNHSTEEHWKNHFGTKWRTFLETKLLFDPRMI  522

Query  243   LSPGQRIFSQSSS  205
             LSPGQ+IF+ +++
Sbjct  523   LSPGQKIFNDNTN  535



>dbj|BAM74651.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=545

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/448 (62%), Positives = 354/448 (79%), Gaps = 19/448 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR---------------IRVSWSESLGFYAD  1348
             A+G GHS RGQA ++ GVV++M+SL ++  +               IRVSWS SLG+YAD
Sbjct  97    AKGCGHSVRGQAMSRSGVVIDMTSLNKHDHKNNMNNDAKNENYDSGIRVSWSSSLGYYAD  156

Query  1347  VGGHELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDV  1168
             VGG +LW+DVLRA++ HGLAP+SWTDYLYLTVGGTLSN GISGQSF +GPQI+NV+E+DV
Sbjct  157   VGGEQLWIDVLRATIEHGLAPLSWTDYLYLTVGGTLSNGGISGQSFLHGPQISNVLELDV  216

Query  1167  ITGKGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFT  988
             +TGKG  +TCS+HINSELFFAVLGGLGQFG+ITRARIVLDKAPTR KW+R+LY+DFT FT
Sbjct  217   VTGKGAFVTCSEHINSELFFAVLGGLGQFGIITRARIVLDKAPTRAKWIRLLYEDFTMFT  276

Query  987   RDQEHLIS-IDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLI-SNHGIIYSLEL  814
              DQE LIS +++G DYVEGSLI   SP NNWRSSF+S +HQS+I SL+ +N G++YS+EL
Sbjct  277   SDQETLISTVNNGPDYVEGSLITDHSPPNNWRSSFYSHAHQSKIHSLLKNNQGLLYSIEL  336

Query  813   VKYY-DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDV  637
             VKYY DD++ +TIDEE+  + K L+FI G +F+KDV+  +FL RV   + + +   +   
Sbjct  337   VKYYHDDQSVSTIDEEIHSLLKDLNFIPGFIFKKDVTITEFLTRVARTDNE-KGSSVQSQ  395

Query  636   PHPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETF  457
              HPWLNLFVPKSRI DFN GV V II R  +TSGPIL YP N+ +WDDRMSAVVP+E+ F
Sbjct  396   AHPWLNLFVPKSRIHDFNAGVLVHIIARHKQTSGPILFYPLNRKKWDDRMSAVVPDEDIF  455

Query  456   YCVGLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQ  277
             Y +GLLHS RV+E E+    N +I+++C++AGI+IKQYLPHYK++EDW KHFG KW+IFQ
Sbjct  456   YTLGLLHSCRVDESEDFDRLNNKIMEFCEKAGIRIKQYLPHYKSKEDWAKHFGDKWKIFQ  515

Query  276   QRKALFDPKLILSPGQRIFSQSSSWVWS  193
             +RK  FDP++ILSPGQ+IF+     V+S
Sbjct  516   ERKLKFDPEMILSPGQKIFNYDDRIVYS  543



>ref|XP_004144003.1| PREDICTED: cytokinin dehydrogenase 3-like [Cucumis sativus]
Length=522

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/432 (63%), Positives = 338/432 (78%), Gaps = 10/432 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             A+G GHS  GQA A++GVVVEM+SL  N  RI +S S   GF+ADVGG ++W+DVL A+L
Sbjct  90    AKGCGHSVHGQAMAENGVVVEMTSLNNNPSRISISGSADAGFFADVGGEQMWIDVLTATL  149

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAP SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI NV+E+DV+TGKG++++CS   N
Sbjct  150   KHGLAPPSWTDYLYLTVGGTLSNAGISGQTFRYGPQICNVLELDVVTGKGDIVSCSAEKN  209

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI----SIDD  955
             +ELF +VLGGLGQFG+I RARI L  AP RVKWVRMLY++F +F +DQE LI    + D 
Sbjct  210   NELFNSVLGGLGQFGIIVRARIPLFPAPNRVKWVRMLYNNFDEFVKDQEKLILKNSNDDG  269

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             GL+Y+EG L+M   P +NWRSSFF PSH S I SL++ H IIY LE+ KYYDD +  TID
Sbjct  270   GLNYLEGLLLMHDGPPDNWRSSFFPPSHHSTIISLVNQHSIIYCLEVAKYYDDRSRHTID  329

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +EL  + KGL+F+ G  FEKDVS+ +FLNRVR GE+ LR +G+WDVPHPWLNLFVPKSRI
Sbjct  330   KELDNLLKGLNFLPGYKFEKDVSYVEFLNRVRGGELSLRSQGLWDVPHPWLNLFVPKSRI  389

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
              +FN GVF DIIL++   +GPIL+YP N+ +WDD+MSAV+PEEE FY +G L+SS  + W
Sbjct  390   AEFNSGVFKDIILKRKIANGPILIYPMNRNKWDDKMSAVIPEEEVFYTIGFLNSSGYDNW  449

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKK------WQIFQQRKALFDP  253
             E +  QN++IL++CD   +KIKQYLPHY T+EDWEKHFG K      W+I Q RK  FDP
Sbjct  450   EAVEEQNKDILRFCDSVDMKIKQYLPHYNTKEDWEKHFGNKWKIIQDWKIIQDRKNQFDP  509

Query  252   KLILSPGQRIFS  217
             K+ILSPGQ+IF+
Sbjct  510   KMILSPGQKIFN  521



>ref|XP_003542331.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=535

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/430 (64%), Positives = 340/430 (79%), Gaps = 7/430 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A+DGVVV+M++L+  RNG  I VS    +G YADVGG +LW+DVL  
Sbjct  100   ARGQGHSTHGQAMARDGVVVDMANLRKQRNGVAISVSKDPLMGHYADVGGEQLWIDVLHT  159

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQI+NV EMDVITGKGE +TCS  
Sbjct  160   TLKHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSSQ  219

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              N ELF AVLGGLGQFGVI RARI L+ AP RVKWVR+LY DF  FT+DQE LISI+   
Sbjct  220   KNLELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFFAFTKDQERLISINGRK  279

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LD++EG L+M Q P NNWRSSFF  S   +I+SLI+ H I+Y LE+ KYYD++T  
Sbjct  280   QKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRISSLITEHSILYCLEVAKYYDEQTEI  339

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D+E+Q + +GL++I G  +EK+VS+ +FLNRVRSGE+KL+ +G+WDVPHPWLNLF+PK
Sbjct  340   NVDKEIQVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPK  399

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             S+ILDFN  VF DI+L++N +SGP+LVYPTN+ +WDDRMSA +P+EE FY VG LHSS  
Sbjct  400   SQILDFNSRVFKDIVLKRNISSGPVLVYPTNRNKWDDRMSASIPDEEVFYTVGFLHSSGF  459

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             + W+    QN EIL++C +AGIK+KQYLP++ T+EDW  HFG KW  F +RK  FDP++I
Sbjct  460   DTWKAYDAQNSEILEFCRDAGIKVKQYLPNHSTQEDWTNHFGAKWIKFLERKHQFDPRMI  519

Query  243   LSPGQRIFSQ  214
             LSPGQ+IF +
Sbjct  520   LSPGQKIFHK  529



>ref|XP_010696503.1| PREDICTED: cytokinin dehydrogenase 3 [Beta vulgaris subsp. vulgaris]
Length=551

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/451 (63%), Positives = 347/451 (77%), Gaps = 31/451 (7%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR----------------NGGRIRVSWSESLGFYA  1351
             ARG GHS RGQA  ++GVV++M+SL R                +  RIRVS+   LGFYA
Sbjct  101   ARGRGHSCRGQAMVENGVVIDMTSLNRFKLKNISYNNNYHQYYDNSRIRVSYDALLGFYA  160

Query  1350  DVGGHELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMD  1171
             DVGG +LW+DVL A+L HG+APVSWTDYLYLTVGGTLSNAGISGQSFRYGPQI NV E+D
Sbjct  161   DVGGEQLWIDVLHATLDHGVAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQITNVHELD  220

Query  1170  VITGKGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKF  991
             V+TGKGELITCSK INSELF AVLGGLGQFG+ITRARI L  AP RVKWVRMLYD+++ F
Sbjct  221   VVTGKGELITCSKKINSELFNAVLGGLGQFGIITRARIKLKAAPKRVKWVRMLYDNYSTF  280

Query  990   TRDQEHLIS----------IDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISN  841
             TRDQEHLIS          ++DGLDYVEGSLIM     NNWRSSFF+P+ Q +IASL S 
Sbjct  281   TRDQEHLISLYGNYQDLIDVNDGLDYVEGSLIMHNVDPNNWRSSFFTPNDQDRIASLNSP  340

Query  840   HGIIYSLELVKYY---DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGE  670
             +GI+Y LE+ KYY   DD   T ID+E+++  KGL+FI G +F ++VSF +FLNRVR GE
Sbjct  341   NGILYFLEVAKYYYHDDDANDTNIDKEVEKQLKGLNFIPGYIFTQEVSFVEFLNRVRKGE  400

Query  669   VKLRQKGMWDVPHPWLNLFVPKSRILDFNVGVFVDIILRQNK-TSGPILVYPTNKARWDD  493
             ++L  KG+WDVPHPWLN+F+P+S+I DF   VF +II + +K   GPIL YP N+ +WDD
Sbjct  401   LELESKGLWDVPHPWLNMFIPRSQIDDFQY-VFANIIAKDSKGLEGPILFYPFNRNKWDD  459

Query  492   RMSAVVPEEETFYCVGLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDW  313
             +MSAV PEE+ FY +GLLHSS +++W+ L ++NEEI+ YC+E GI+IKQYLP Y T E+W
Sbjct  460   KMSAVTPEEDVFYTLGLLHSSGLDDWDVLEHKNEEIINYCNENGIQIKQYLPRYTTTEEW  519

Query  312   EKHFGKKWQIFQQRKALFDPKLILSPGQRIF  220
             + HFG KW+IFQ RK LFDPKLILSPGQ IF
Sbjct  520   KTHFGSKWRIFQHRKNLFDPKLILSPGQNIF  550



>ref|XP_007138720.1| hypothetical protein PHAVU_009G231700g [Phaseolus vulgaris]
 gb|ESW10714.1| hypothetical protein PHAVU_009G231700g [Phaseolus vulgaris]
Length=539

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/433 (62%), Positives = 343/433 (79%), Gaps = 11/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSE----SLGF--YADVGGHELWVD  1321
             ARG GHS RGQA A+ GVVV+M+  +  G  + +  S     S+G+  YADVGG +LW+D
Sbjct  104   ARGQGHSTRGQAMARGGVVVDMAGFRERGSGVGIKVSNTVDPSVGYFHYADVGGEQLWID  163

Query  1320  VLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELIT  1141
             VL A+L HGLAP+SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+ V EMDVITGKGE +T
Sbjct  164   VLHATLQHGLAPLSWTDYLYLTVGGTLSNAGISGQTFRYGPQISTVREMDVITGKGETVT  223

Query  1140  CSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI  961
             CS   NSELF  VLGGLGQFG+ITRARI L  AP RVKW+R+LY DF+ FT+DQE LIS+
Sbjct  224   CSPQTNSELFHGVLGGLGQFGIITRARIALAPAPKRVKWIRLLYKDFSSFTKDQEQLISM  283

Query  960   DD-----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDD  796
             +      G+DYVEGSL+M Q P NNWRSSFF  +  ++I SL++ H ++Y LE+ KYYD 
Sbjct  284   NGRKQNIGVDYVEGSLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDG  343

Query  795   ETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
             ++   +D+ELQ + +GLS+I G  +EKDVS+ +FLNRVRSGE+KL+ +G+WDVPHPWLNL
Sbjct  344   QSENNVDKELQVLLQGLSYIPGFYYEKDVSYVEFLNRVRSGELKLQSQGLWDVPHPWLNL  403

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH  436
             F+PKS+I+DF+ GVF DIIL++N T+GP+LVYP N+ +WD+RMSA +P+E+ FY VG LH
Sbjct  404   FIPKSQIMDFDSGVFKDIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLH  463

Query  435   SSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFD  256
             SS  + W+    QN+EIL++C++AG+KIKQYLPHY+T+EDW  HFG KW+ F +RK  FD
Sbjct  464   SSGFDNWKAYDTQNKEILQFCNDAGMKIKQYLPHYRTQEDWTNHFGPKWRSFVERKQQFD  523

Query  255   PKLILSPGQRIFS  217
             P++ILSPGQRIF+
Sbjct  524   PRMILSPGQRIFN  536



>gb|ACM79256.1| cytokinin oxidase/dehydrogenase [Gossypium hirsutum]
 gb|ACT21088.1| cytokinin oxidase/dehydrogenase [Gossypium hirsutum]
Length=526

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/432 (63%), Positives = 346/432 (80%), Gaps = 11/432 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSL---KRNGGRIRVSWSESLGFYADVGGHELWVDVLR  1312
             A+GHGHSARGQA A++GVVV+M S+   +RNG  IRVS       YADVGG +LW+DVL 
Sbjct  98    AKGHGHSARGQAMAENGVVVDMRSMANNRRNGTGIRVSIDR---LYADVGGEQLWIDVLN  154

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             A+L +GLAPVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV+EMDVITGK + +TCS 
Sbjct  155   ATLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVLEMDVITGKADFLTCSP  214

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID--  958
              +NSELF+AVLGGLGQFG+ITRARI L  AP  VKWVR+LYDDF+ FT+DQE LIS +  
Sbjct  215   RMNSELFYAVLGGLGQFGIITRARIPLQPAPKGVKWVRLLYDDFSSFTKDQELLISKNGR  274

Query  957   ---DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETA  787
                  LDY+EGSL+M Q   +NWRSSFF      +I SLI+ HGIIY LE+VK+YDD T 
Sbjct  275   KDKSALDYLEGSLLMDQGSPDNWRSSFFPHKDHPKIISLITKHGIIYCLEIVKHYDDRTK  334

Query  786   TTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
              T+D+E++++ +GL+++ G +F KDV + +FLNRVRSGE+KL+ +G+WDVPHPWLNLF+P
Sbjct  335   HTVDKEMKQVLQGLNYMPGFMFGKDVGYEEFLNRVRSGELKLKSQGLWDVPHPWLNLFIP  394

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR  427
             KS+I DFN GVF DI+L +N T+GP+LVYP N+ + DDRMSAV+P+EE FY VG LHSS 
Sbjct  395   KSQISDFNNGVFRDIVLERNITTGPVLVYPMNRQKRDDRMSAVIPDEEIFYTVGFLHSSG  454

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
              + WE   +QN++I+++C++ GI +KQYLPHY T+E+W  HFG KW++FQ RK  FDP++
Sbjct  455   FDTWEAFEDQNKDIMRFCNKTGILVKQYLPHYSTKEEWVHHFGSKWKVFQHRKYQFDPRM  514

Query  246   ILSPGQRIFSQS  211
             +LSPGQRIF+ +
Sbjct  515   LLSPGQRIFNNN  526



>gb|KDP33841.1| hypothetical protein JCGZ_07412 [Jatropha curcas]
Length=531

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/433 (64%), Positives = 343/433 (79%), Gaps = 13/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK----RNGGRIRVSWSESLGFYADVGGHELWVDVL  1315
             ARG  HS  GQA A +GVVV+M  L+    +NG  + +  S S GFYADVGG +LW+DVL
Sbjct  101   ARGRSHSVSGQAMAPNGVVVDMMRLRSYTEKNG--VEIFKSPSSGFYADVGGEQLWIDVL  158

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
             +A++ HGLAP SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI+NV EMDVITG+GEL+TCS
Sbjct  159   KATIEHGLAPTSWTDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEMDVITGRGELVTCS  218

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-  958
                NSELFFAVLGGLGQFG+ITRARI ++ AP RVKWVRMLY DF+ FT+DQEHLIS + 
Sbjct  219   AQKNSELFFAVLGGLGQFGIITRARIAIEPAPKRVKWVRMLYSDFSAFTKDQEHLISKNG  278

Query  957   ----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
                 + +DYVEGSL+M Q P NNWRSSFF  S   +I SL   H IIY LE+ KYY D+ 
Sbjct  279   RKQSNAVDYVEGSLLMDQGPPNNWRSSFFPSSDIPRIMSLFIQHRIIYCLEIAKYYYDDA  338

Query  789   AT--TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
              T  +  +EL++M+  LSFI G   EKDV + +FL+RVR+GE+KL+ +G+W+VPHPWLNL
Sbjct  339   TTQHSAAKELEQMYGELSFIAGFKTEKDVGYVEFLDRVRNGELKLQSEGLWEVPHPWLNL  398

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH  436
             F+PKS I DFN GVF DI+L++N T+GP+LVYP N+ +WDDR SAV+P+EE FY VG LH
Sbjct  399   FLPKSSISDFNSGVFRDIVLKRNITTGPVLVYPMNRNKWDDRTSAVIPDEEVFYTVGFLH  458

Query  435   SSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFD  256
             SS  ++W+   +QN+EIL +CD+AGIK+KQY P+YKT+E+W KHFG KW+ F++RKALFD
Sbjct  459   SSGFDDWQRYDDQNKEILSFCDKAGIKVKQYFPYYKTKEEWIKHFGSKWRSFRERKALFD  518

Query  255   PKLILSPGQRIFS  217
             PK++LSPGQRIF+
Sbjct  519   PKMMLSPGQRIFN  531



>emb|CBI33301.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/411 (68%), Positives = 334/411 (81%), Gaps = 4/411 (1%)
 Frame = -3

Query  1443  AKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRASLPHGLAPVSWTD  1270
             A  GVVVEM SL     G  IRV+ +   G YAD GG +LW+DVL+A+L HGLAPVSWTD
Sbjct  2     APHGVVVEMRSLNNCSRGSGIRVTKNPISGSYADAGGEQLWIDVLQATLKHGLAPVSWTD  61

Query  1269  YLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINSELFFAVLGGL  1090
             YLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK  NSELFFAVLGGL
Sbjct  62    YLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKDTNSELFFAVLGGL  121

Query  1089  GQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDYVEGSLIMTQSP  910
             GQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHLISI+ GLDY+EGSL+M  S 
Sbjct  122   GQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISIN-GLDYLEGSLLMQNSS  180

Query  909   ANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQEMFKGLSFIGG  730
              NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T+ T+DEELQE+ KGL+F+ G
Sbjct  181   PNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELTSHTVDEELQELLKGLNFLPG  239

Query  729   LVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFNVGVFVDIILRQ  550
              VF KDVS  DFLNRV S E+ LR KG+WDVPHPWLNLFVP SRI DFN GVF DI+ + 
Sbjct  240   FVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRISDFNSGVFRDILPKI  299

Query  549   NKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELGNQNEEILKYCD  370
             N+T+G  LVYP  + +WDDR SAV+P+E+ FY VGLLHSS  ++WE L NQN+EILK+CD
Sbjct  300   NQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEPLENQNKEILKFCD  359

Query  369   EAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRIFS  217
             +AGIKIK+YL  Y T++DW  HFG KW+ F+ RKA FDPK+ILSPGQ+IF+
Sbjct  360   KAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPKMILSPGQQIFN  410



>ref|NP_001243813.1| cytokinin dehydrogenase 3-like [Glycine max]
 gb|AFB18642.1| cytokinin dehydrogenase 3 [Glycine max]
Length=535

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/430 (63%), Positives = 341/430 (79%), Gaps = 7/430 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A+DG+VV+M+SL+  RNG  I VS    +G YADVGG +LW+DVL A
Sbjct  100   ARGQGHSTHGQAMARDGIVVDMASLRKQRNGVAISVSKDPLMGHYADVGGEQLWIDVLHA  159

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L +GLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQI+NV EMDVITGKGE +TCS  
Sbjct  160   TLEYGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSSQ  219

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              N ELF AVLGGLGQFGVI RARI L+ AP RVKWVR+LY DF+ FT+DQE LISI+   
Sbjct  220   KNLELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFSAFTKDQERLISINGRK  279

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LD++EG L+M Q P NNWRSSFF  S   +IASLI+ H I+Y LE+ KYYD++T  
Sbjct  280   QKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRIASLITEHSILYCLEVAKYYDEQTEL  339

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D+E++ + +GL++I G  +EK+VS+ +FLNRVRSGE+KL+ +G+W+VPHPWLNLF+PK
Sbjct  340   NVDKEIEVLLQGLAYIPGFNYEKNVSYVEFLNRVRSGELKLQSQGLWEVPHPWLNLFIPK  399

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             S+ILDFN GVF DI+L++N +SGP+LVYP N+ +WDDRMSA +P+E+ FY VG LHSS  
Sbjct  400   SQILDFNSGVFKDIVLKRNISSGPVLVYPMNRNKWDDRMSASIPDEDVFYTVGFLHSSGF  459

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             + W+    QN EIL++C +AGI +KQYLP++ T+EDW  HFG KW  F +RK  FDP++I
Sbjct  460   DTWKAYDAQNREILEFCRDAGIMVKQYLPNHSTQEDWTNHFGAKWMKFLERKHQFDPRMI  519

Query  243   LSPGQRIFSQ  214
             LSPGQ+IF +
Sbjct  520   LSPGQKIFHK  529



>ref|XP_010242232.1| PREDICTED: cytokinin dehydrogenase 3 isoform X2 [Nelumbo nucifera]
Length=525

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/434 (66%), Positives = 340/434 (78%), Gaps = 20/434 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR---NGGRIRVSWSESL--GFYADVGGHELWVDV  1318
             ARG GHS RGQATA  GVVV+M SL     NG RI V  S      +YADVG  +LWVDV
Sbjct  99    ARGRGHSVRGQATAHKGVVVDMRSLDNDHNNGSRIIVDRSSPSVNNWYADVGCEQLWVDV  158

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L A+L HGLAP SWTDYLYLTVGGTLSNAGISGQSFR+GPQI+NV EMDV+TG+GEL+TC
Sbjct  159   LHATLEHGLAPRSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVYEMDVVTGRGELVTC  218

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S   NSELF+AVLGGLGQFG+ITRARI L+ APT+V+WVR+LY DF  FTRDQEHLIS +
Sbjct  219   SPQTNSELFYAVLGGLGQFGIITRARIALEPAPTKVRWVRLLYHDFIAFTRDQEHLISFN  278

Query  957   D------GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDD  796
             +      GLDYVEGSL+M QSPANNWRSSFFSP   S+I SL + HGI+YSLE+ KYYDD
Sbjct  279   NGSEGIKGLDYVEGSLVMNQSPANNWRSSFFSPDDHSRIISLANEHGILYSLEVAKYYDD  338

Query  795   ETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
             E    +D EL+ + KGLSFI  L+F KDVS+ DFLNRVRSGE++L+ +G+WDVPHPWLNL
Sbjct  339   E----VDGELEALLKGLSFIPDLIFAKDVSYIDFLNRVRSGELELQSQGLWDVPHPWLNL  394

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG-LL  439
             FVPKSRILDF+ G F  I+ + NK SGPILVYP N+    ++MSAV+PEE+ FY +G LL
Sbjct  395   FVPKSRILDFDSGAFKGILRQNNKISGPILVYPMNR----NKMSAVIPEEDIFYSIGLLL  450

Query  438   HSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALF  259
              SS  ++WE L  QN EIL++C++AGIKIKQYLP Y+T+ +W  HFG KW  F+QRK  F
Sbjct  451   QSSGTHDWEHLEEQNTEILRFCEKAGIKIKQYLPRYQTKAEWVNHFGPKWDTFKQRKTKF  510

Query  258   DPKLILSPGQRIFS  217
             DPK ILSPGQ +F+
Sbjct  511   DPKAILSPGQGVFT  524



>ref|XP_007203595.1| hypothetical protein PRUPE_ppb021417mg [Prunus persica]
 gb|EMJ04794.1| hypothetical protein PRUPE_ppb021417mg [Prunus persica]
Length=516

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/436 (64%), Positives = 345/436 (79%), Gaps = 13/436 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN-----GGRIRVSWSESLG---FYADVGGHELW  1327
             ARGHGHS  GQA A +GVVV+M SLK +      G I  +++ S+    +YADVGG +LW
Sbjct  81    ARGHGHSTMGQAMAPNGVVVDMMSLKNHLPSHASGIIVNTFNSSVNNNYYYADVGGGQLW  140

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             +DVL ASL HGLAPV+WTDYLYLTVGGTLSNAGISG +FR+GPQI+NV EMDV+TG+G+ 
Sbjct  141   IDVLHASLEHGLAPVAWTDYLYLTVGGTLSNAGISGSAFRFGPQISNVYEMDVVTGQGDF  200

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
             +TCS   NS+LFF VLGGLGQFG+ITRARI L+ AP RVKWVRMLY+DF+ + RDQE LI
Sbjct  201   VTCSPQNNSDLFFGVLGGLGQFGIITRARIALEPAPKRVKWVRMLYNDFSAYARDQERLI  260

Query  966   SID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             S++     + LDY+EGSL++ Q   NNWRSSFF  S  S+I SL++ HGIIYSLE+ KYY
Sbjct  261   SVNGRKQSNALDYLEGSLLINQGSPNNWRSSFFPQSTYSRIISLVTKHGIIYSLEVAKYY  320

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
             D  T T +D+EL+ + KGLSF+ G VFEKDV++ +FLNRV+SGE KL+ +G WDVPHPWL
Sbjct  321   DQHTETAVDKELELLLKGLSFLPGFVFEKDVAYVEFLNRVKSGEEKLQSQGQWDVPHPWL  380

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLFVPKSRI DF+ GV   I+L++N T+ P+L+YP N+ +WDDRMSAVVPEEE FY VG 
Sbjct  381   NLFVPKSRISDFDAGVLKGIVLKRNITTAPVLLYPMNRTKWDDRMSAVVPEEEVFYTVGF  440

Query  441   LHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKAL  262
             LHSS  +EWE L  QN+EILK+C   GI+IKQYLP+YKT++ W  HFG KW+ FQ+RKAL
Sbjct  441   LHSSGFDEWEALEEQNKEILKFCASVGIEIKQYLPYYKTQQGWMNHFGSKWKTFQKRKAL  500

Query  261   FDPKLILSPGQRIFSQ  214
             FDPK ILSPGQRIF++
Sbjct  501   FDPKKILSPGQRIFNK  516



>ref|XP_010047562.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=531

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/436 (62%), Positives = 344/436 (79%), Gaps = 10/436 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN-----GGRIRVSWSESLGFYADVGGHELWVDV  1318
             ARG GHS RGQA A  GVVV+M+SL R+     G  I VSWS SLG+YADVGG +LW DV
Sbjct  95    ARGRGHSVRGQAMAPGGVVVDMTSLARHRGGGGGSAISVSWSRSLGYYADVGGGQLWRDV  154

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L  +L HGL+PVSW DYLYLTVGGTLSNAGISGQ+FRYGPQI+NV EMDVITG GEL TC
Sbjct  155   LEETLWHGLSPVSWPDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEMDVITGTGELTTC  214

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-  961
             S   N ELF++VLGGLGQFG+ITRAR+ LD+APTRVKW RMLY DF+ FTRDQE+LIS  
Sbjct  215   SPDKNPELFYSVLGGLGQFGIITRARVALDRAPTRVKWARMLYSDFSDFTRDQEYLISKN  274

Query  960   ----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                 D+ LDYVEG L+M Q P ++WRSSFF  S   +I SL+  H I+Y LE+ KYYDD 
Sbjct  275   GRYQDNALDYVEGMLLMPQGPPDSWRSSFFPLSDHPRIISLLKQHKIVYCLEVAKYYDDL  334

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T  T++++L+++F+GL+ I    F+KDV++ DFL+RVR GE+KL  +G+WDVPHPWLNLF
Sbjct  335   TQNTVNKDLEKLFEGLNHIPEFEFQKDVAYVDFLDRVREGELKLTAQGLWDVPHPWLNLF  394

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VPKSRI DFN GVF +IIL++N T+GP+L+YP N+ +WDD+MSAVVP+E+ FY VG LHS
Sbjct  395   VPKSRIADFNDGVFKNIILKRNITTGPVLIYPMNRNKWDDQMSAVVPDEDVFYTVGFLHS  454

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             S  ++W++   QN+E+L +C++ GI++K YLP +  E++W +HFG KW+ F+QRKA FDP
Sbjct  455   SGFDDWQQFYLQNKELLSFCEDTGIELKHYLPSFGNEQEWMRHFGSKWRRFRQRKARFDP  514

Query  252   KLILSPGQRIFSQSSS  205
             K+I SPGQ+IF+++ S
Sbjct  515   KMIFSPGQKIFNRNHS  530



>ref|XP_004288952.1| PREDICTED: cytokinin dehydrogenase 3-like [Fragaria vesca subsp. 
vesca]
Length=517

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/433 (62%), Positives = 345/433 (80%), Gaps = 12/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRV------SWSESLGFYADVGGHELWVD  1321
             A+G GHS RGQA A++GVVVEMSSL+   G   +      S  +   +YADVGG +LWVD
Sbjct  81    AKGQGHSTRGQAMARNGVVVEMSSLRNQHGSSGIEVVSTTSKDDVTVYYADVGGEQLWVD  140

Query  1320  VLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELIT  1141
             VL A+L HGL+PV+WTDYLYLTVGGTLSNAGI GQ+FR+GPQI+NV EMDV+TG+G+ +T
Sbjct  141   VLHATLEHGLSPVTWTDYLYLTVGGTLSNAGIGGQTFRFGPQISNVYEMDVVTGEGDFVT  200

Query  1140  CSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI  961
             CS + N+ELF+ VLGGLGQFGVI+RARI L+ APTRVKWVRMLY DF+ F+RDQE LISI
Sbjct  201   CSPNNNAELFYGVLGGLGQFGVISRARIALEPAPTRVKWVRMLYSDFSAFSRDQERLISI  260

Query  960   D-----DGLDYVEGSLIMTQSPANNWR-SSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
             +     + LDY+EGSL++ Q P NNWR SSFF  S   +I S ++ HGIIY LE+VKYYD
Sbjct  261   NGRQQSNALDYIEGSLLINQGPPNNWRASSFFPQSSHKKIISRVNKHGIIYCLEVVKYYD  320

Query  798   DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
              +T +T+D+E+Q +  GL+++ G  FE D S+ +FLNRVRSGE+KL+ +G WDVPHPWLN
Sbjct  321   HQTESTVDKEVQNLLNGLNYLPGFKFENDASYVEFLNRVRSGELKLQSEGQWDVPHPWLN  380

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LF+PKSRI DF+ GVF DI+L++N T+GP+LVYP N+++W+++MSAVVPEE+ FY +G L
Sbjct  381   LFIPKSRIADFDQGVFRDIVLKRNITTGPVLVYPMNRSKWNEKMSAVVPEEDVFYTIGFL  440

Query  438   HSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALF  259
             H++  +EW+    QN+EIL++C +AGI +KQYLP +KT++ W KHFG KW+ F++RKALF
Sbjct  441   HATGFDEWKAFDEQNKEILEFCVKAGIDVKQYLPDHKTQQGWMKHFGSKWKTFEKRKALF  500

Query  258   DPKLILSPGQRIF  220
             DPK ILSPGQRIF
Sbjct  501   DPKRILSPGQRIF  513



>gb|KCW79507.1| hypothetical protein EUGRSUZ_C00881 [Eucalyptus grandis]
Length=520

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/436 (62%), Positives = 344/436 (79%), Gaps = 10/436 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN-----GGRIRVSWSESLGFYADVGGHELWVDV  1318
             ARG GHS RGQA A  GVVV+M+SL R+     G  I VSWS SLG+YADVGG +LW DV
Sbjct  84    ARGRGHSVRGQAMAPGGVVVDMTSLARHRGGGGGSAISVSWSRSLGYYADVGGGQLWRDV  143

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L  +L HGL+PVSW DYLYLTVGGTLSNAGISGQ+FRYGPQI+NV EMDVITG GEL TC
Sbjct  144   LEETLWHGLSPVSWPDYLYLTVGGTLSNAGISGQTFRYGPQISNVYEMDVITGTGELTTC  203

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-  961
             S   N ELF++VLGGLGQFG+ITRAR+ LD+APTRVKW RMLY DF+ FTRDQE+LIS  
Sbjct  204   SPDKNPELFYSVLGGLGQFGIITRARVALDRAPTRVKWARMLYSDFSDFTRDQEYLISKN  263

Query  960   ----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                 D+ LDYVEG L+M Q P ++WRSSFF  S   +I SL+  H I+Y LE+ KYYDD 
Sbjct  264   GRYQDNALDYVEGMLLMPQGPPDSWRSSFFPLSDHPRIISLLKQHKIVYCLEVAKYYDDL  323

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T  T++++L+++F+GL+ I    F+KDV++ DFL+RVR GE+KL  +G+WDVPHPWLNLF
Sbjct  324   TQNTVNKDLEKLFEGLNHIPEFEFQKDVAYVDFLDRVREGELKLTAQGLWDVPHPWLNLF  383

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VPKSRI DFN GVF +IIL++N T+GP+L+YP N+ +WDD+MSAVVP+E+ FY VG LHS
Sbjct  384   VPKSRIADFNDGVFKNIILKRNITTGPVLIYPMNRNKWDDQMSAVVPDEDVFYTVGFLHS  443

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             S  ++W++   QN+E+L +C++ GI++K YLP +  E++W +HFG KW+ F+QRKA FDP
Sbjct  444   SGFDDWQQFYLQNKELLSFCEDTGIELKHYLPSFGNEQEWMRHFGSKWRRFRQRKARFDP  503

Query  252   KLILSPGQRIFSQSSS  205
             K+I SPGQ+IF+++ S
Sbjct  504   KMIFSPGQKIFNRNHS  519



>ref|XP_003547474.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=543

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/436 (61%), Positives = 342/436 (78%), Gaps = 13/436 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWS------ESLGFYADVGGHELW  1327
             ARG GHS RGQA A++GVVV+M+  +   NG  IRV  S          +YADVGG +LW
Sbjct  108   ARGQGHSTRGQAMAREGVVVDMAGFRERGNGVGIRVVSSVDPNNKNGYYYYADVGGEQLW  167

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             +DVL A+L HGLAP+SWTDYLYLT+GGTLSNAGISGQ+FRYGPQI  V EMDVITGKGE 
Sbjct  168   IDVLHATLEHGLAPMSWTDYLYLTLGGTLSNAGISGQTFRYGPQITTVREMDVITGKGEF  227

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
             +TCS+  NSELF AVLGGLGQFG+ITRARI L  AP RVKWVR+LY+DF+ FT+DQE LI
Sbjct  228   VTCSQQTNSELFHAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQEQLI  287

Query  966   SI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             S+     +  LDY+EG L+M Q P NNWRSSFF  +  ++I SL++ H ++Y LE+ KYY
Sbjct  288   SVTGRKQNVSLDYLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYY  347

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
             D +    +D+ELQ + +GLS+I G  +EKDVS+F+FLNRVRSGE+KL+ +G+WDVPHPWL
Sbjct  348   DGQNENNVDKELQVLLQGLSYIPGFYYEKDVSYFEFLNRVRSGELKLQSQGLWDVPHPWL  407

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLF+PKS+I++F+ GVF +IIL++N T+GP+LVYP N+ +WD+RMSA +P+E+ FY VG 
Sbjct  408   NLFIPKSQIMEFDSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGF  467

Query  441   LHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKAL  262
             LHSS  + W+    QN+EIL++C+ AGIK+KQYLPHY+T+EDW  HFG KW+ F +RK  
Sbjct  468   LHSSGFDNWKAYDAQNKEILQFCNVAGIKVKQYLPHYRTQEDWANHFGPKWRTFVERKHQ  527

Query  261   FDPKLILSPGQRIFSQ  214
             FDP++ILSPGQRIF+ 
Sbjct  528   FDPRMILSPGQRIFNN  543



>ref|XP_008367923.1| PREDICTED: cytokinin dehydrogenase 3-like [Malus domestica]
Length=519

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/438 (63%), Positives = 333/438 (76%), Gaps = 15/438 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGF----------YADVGGHE  1333
             ARGHGHS RGQA A +GVVV+M+SL      +      S             YADVGG +
Sbjct  82    ARGHGHSTRGQAMAPNGVVVDMTSLTNYRPHVSGISVNSSNNSGININNNDNYADVGGGQ  141

Query  1332  LWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKG  1153
             LW+DVL A+L HGL PVSWTDYLYLTVGGTLSNAGISG +FR+GPQI NV EMDV+TG+G
Sbjct  142   LWIDVLHATLEHGLTPVSWTDYLYLTVGGTLSNAGISGSAFRFGPQITNVYEMDVVTGQG  201

Query  1152  ELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEH  973
               +TCS   NSELFF VLGGLGQFG+ITRARI L+ AP RVKWVRMLY DF+ F RDQE 
Sbjct  202   GFVTCSPQKNSELFFGVLGGLGQFGIITRARIALEPAPKRVKWVRMLYSDFSTFARDQER  261

Query  972   LISID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVK  808
             LIS++     + LDY+EGSL++ + P +NWRS FF  S  S+I SL++  GIIY LE+ K
Sbjct  262   LISLNGRKQSNALDYLEGSLMLNRGPPDNWRSXFFPQSSHSRIISLVTKRGIIYCLEVSK  321

Query  807   YYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHP  628
             YYD+ T TT+ +EL+ +FKGLSF+ G +FEKDVS+ DFLNRVRSGE KL  +G WDVPHP
Sbjct  322   YYDEHTETTVKKELELLFKGLSFLPGFLFEKDVSYVDFLNRVRSGEEKLHSQGQWDVPHP  381

Query  627   WLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCV  448
             WLNLF+PKS I DF+ GVF DI+LR+N T+GP+LVYP N+ +WDDRMSAV+P+E+ FY V
Sbjct  382   WLNLFIPKSSISDFDAGVFKDIVLRRNITTGPVLVYPMNRTKWDDRMSAVIPQEDVFYTV  441

Query  447   GLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRK  268
             G LHSS  ++WE    QNEEIL +CD AG+++KQYLPH KT++ W  HFG KW+ F ++K
Sbjct  442   GFLHSSGFDDWEAFEEQNEEILGFCDRAGLEVKQYLPHIKTQQGWINHFGSKWKAFLKKK  501

Query  267   ALFDPKLILSPGQRIFSQ  214
             ALFDPK ILSPGQRIF+ 
Sbjct  502   ALFDPKRILSPGQRIFNN  519



>ref|XP_008242354.1| PREDICTED: cytokinin dehydrogenase 3-like [Prunus mume]
Length=516

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/436 (64%), Positives = 345/436 (79%), Gaps = 13/436 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN-----GGRIRVSWSESLG---FYADVGGHELW  1327
             ARGHGHS  GQA A +GVVV+M SLK +      G I  +++ S+    +YADVGG +LW
Sbjct  81    ARGHGHSTMGQAMAPNGVVVDMMSLKNHHPSHASGIIVNTFNLSVNNNNYYADVGGGQLW  140

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             +DVL A+L HGLAPV+WTDYLYLTVGGTLSNAGISG +FR+GPQI+NV EMDV+TG+G+ 
Sbjct  141   IDVLHATLEHGLAPVAWTDYLYLTVGGTLSNAGISGSAFRFGPQISNVYEMDVVTGQGDF  200

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
             +TCS   NS+LFF VLGGLGQFG+ITRARI L+ AP RVKWVRMLY+DF+ + RDQE LI
Sbjct  201   VTCSPQNNSDLFFGVLGGLGQFGIITRARIALEPAPKRVKWVRMLYNDFSAYARDQERLI  260

Query  966   SID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             S++     + LDY+EGSL++ Q   NNWRSSFF  S  S+I SL++ HGIIYSLE+ KYY
Sbjct  261   SVNGRKQSNALDYLEGSLLINQGSPNNWRSSFFPQSTYSRIISLVTKHGIIYSLEVAKYY  320

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
             D  T TT+D+EL+ + KGLSF+ G VFEKDV++ +FLNRV+SGE KL+ +G WDVPHPWL
Sbjct  321   DQHTETTVDKELELLLKGLSFLPGFVFEKDVAYVEFLNRVKSGEEKLQSQGQWDVPHPWL  380

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLFVPKSRI DF+ GV   I+L++N T+ P+L+YP N+ +WDDRMSAVVPEEE FY VG 
Sbjct  381   NLFVPKSRISDFDAGVLKGIVLKRNITTAPVLLYPMNRTKWDDRMSAVVPEEEVFYTVGF  440

Query  441   LHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKAL  262
             LHSS  +EWE L  QN+EILK+C   GI+IKQYLP+YKT++ W  HFG KW  FQ+RKAL
Sbjct  441   LHSSGFDEWEALEEQNKEILKFCAGVGIEIKQYLPYYKTQQGWMNHFGSKWNTFQKRKAL  500

Query  261   FDPKLILSPGQRIFSQ  214
             FDPK ILSPGQRIF++
Sbjct  501   FDPKKILSPGQRIFNK  516



>gb|KHN35852.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=514

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/439 (61%), Positives = 342/439 (78%), Gaps = 16/439 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLG---------FYADVGGH  1336
             ARG GHS RGQA  +DGVVV+M+  +   NG  IRV  S  +          +YADVGG 
Sbjct  76    ARGQGHSTRGQAMVRDGVVVDMAGFRERGNGEGIRVVMSVVVDPNNKNGYGYYYADVGGE  135

Query  1335  ELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGK  1156
             +LW+DVL A+L HGLAP+SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI  V +MDVITGK
Sbjct  136   QLWIDVLNATLEHGLAPMSWTDYLYLTVGGTLSNAGISGQTFRYGPQITTVRQMDVITGK  195

Query  1155  GELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQE  976
             GE +TCS+  NSELF AVLGGLGQFG+ITRARI L  AP RVKWVR+LY+DF+ FT+DQE
Sbjct  196   GEFVTCSQQTNSELFHAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQE  255

Query  975   HLISI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELV  811
              LISI     +  LDY+EG L+M Q P NNWRSSFF  +  ++I SL++ H ++Y LE+ 
Sbjct  256   QLISITRRKQNIALDYLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVA  315

Query  810   KYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPH  631
             KYYD +    +D+EL+ + +GLS+I G  +EKDVS+ +FLNRVRSGE+KL+ +G+WDVPH
Sbjct  316   KYYDGQNENNVDKELKVLLQGLSYIPGFYYEKDVSYVEFLNRVRSGELKLQSQGLWDVPH  375

Query  630   PWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYC  451
             PWLNLF+PKS+I++F+ GVF +IIL++N T+GP+LVYP N+ +WD+RMSA +P+E+ FY 
Sbjct  376   PWLNLFIPKSQIMEFDSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYT  435

Query  450   VGLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQR  271
             VG LHSS  + W+    QN+EIL++C+++GIK+KQYLPHY+T+EDW  HFG KW+ F +R
Sbjct  436   VGFLHSSGFDNWKAYDAQNKEILQFCNDSGIKVKQYLPHYRTQEDWTNHFGPKWRTFVER  495

Query  270   KALFDPKLILSPGQRIFSQ  214
             K  FDPK+ILSPGQRIF+ 
Sbjct  496   KHQFDPKMILSPGQRIFNN  514



>ref|XP_003534923.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=546

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/439 (61%), Positives = 342/439 (78%), Gaps = 16/439 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLG---------FYADVGGH  1336
             ARG GHS RGQA  +DGVVV+M+  +   NG  IRV  S  +          +YADVGG 
Sbjct  108   ARGQGHSTRGQAMVRDGVVVDMAGFRERGNGEGIRVVMSVVVDPNNKNGYGYYYADVGGE  167

Query  1335  ELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGK  1156
             +LW+DVL A+L HGLAP+SWTDYLYLTVGGTLSNAGISGQ+FRYGPQI  V +MDVITGK
Sbjct  168   QLWIDVLNATLEHGLAPMSWTDYLYLTVGGTLSNAGISGQTFRYGPQITTVRQMDVITGK  227

Query  1155  GELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQE  976
             GE +TCS+  NSELF AVLGGLGQFG+ITRARI L  AP RVKWVR+LY+DF+ FT+DQE
Sbjct  228   GEFVTCSQQTNSELFHAVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQE  287

Query  975   HLISI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELV  811
              LISI     +  LDY+EG L+M Q P NNWRSSFF  +  ++I SL++ H ++Y LE+ 
Sbjct  288   QLISITRRKQNIALDYLEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVA  347

Query  810   KYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPH  631
             KYYD +    +D+EL+ + +GLS+I G  +EKDVS+ +FLNRVRSGE+KL+ +G+WDVPH
Sbjct  348   KYYDGQNENNVDKELKVLLQGLSYIPGFYYEKDVSYVEFLNRVRSGELKLQSQGLWDVPH  407

Query  630   PWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYC  451
             PWLNLF+PKS+I++F+ GVF +IIL++N T+GP+LVYP N+ +WD+RMSA +P+E+ FY 
Sbjct  408   PWLNLFIPKSQIMEFDSGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYT  467

Query  450   VGLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQR  271
             VG LHSS  + W+    QN+EIL++C+++GIK+KQYLPHY+T+EDW  HFG KW+ F +R
Sbjct  468   VGFLHSSGFDNWKAYDAQNKEILQFCNDSGIKVKQYLPHYRTQEDWTNHFGPKWRTFVER  527

Query  270   KALFDPKLILSPGQRIFSQ  214
             K  FDPK+ILSPGQRIF+ 
Sbjct  528   KHQFDPKMILSPGQRIFNN  546



>ref|XP_010047563.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
 gb|KCW79508.1| hypothetical protein EUGRSUZ_C00883 [Eucalyptus grandis]
Length=531

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 336/434 (77%), Gaps = 11/434 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN------GGRIRVSWSESLGFYADVGGHELWVD  1321
             ARG GHS RGQA A  G+VV+M+SL  +      G  + VSWS SLG YADV G ++W D
Sbjct  97    ARGCGHSVRGQALAPGGIVVDMTSLASHQGGTGGGPAVAVSWSRSLGHYADVSGGQIWRD  156

Query  1320  VLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELIT  1141
             VL  +L HGLAPVSWTDYLY+TVGGTLSN GISGQ+FRYGPQI+NV EMD+ITG  EL+T
Sbjct  157   VLEETLRHGLAPVSWTDYLYVTVGGTLSNGGISGQTFRYGPQISNVYEMDIITGTEELMT  216

Query  1140  CSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI  961
             CS   N ELF++VLGGLGQFG+ITRARI LD+AP RVKWVRMLY DF+ FTRDQEHLIS 
Sbjct  217   CSPDKNPELFYSVLGGLGQFGIITRARIALDRAPKRVKWVRMLYSDFSAFTRDQEHLISK  276

Query  960   -----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDD  796
                  DD LDYVEG L+M Q P ++WRSSFF      +IASL+  H +IY LE+ KYYDD
Sbjct  277   SGRDQDDALDYVEGLLLMHQGPPDSWRSSFFPEPDHPRIASLMDRHELIYCLEVAKYYDD  336

Query  795   ETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
              T  T++ +L+ +F+ LS I   +F+KDV++ DFL+RVR GE+KLR +G WD PHPWLNL
Sbjct  337   LTENTVNRDLENLFQELSHIPEFLFQKDVTYIDFLDRVRKGELKLRAQGRWDAPHPWLNL  396

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH  436
             FVPKSRI DFN GVF +I+L++N T+G +L+YP N+ +WDDRMS VVP+E  FY VG LH
Sbjct  397   FVPKSRISDFNNGVFKNIVLKRNITTGTVLIYPMNRNKWDDRMSTVVPDENVFYFVGFLH  456

Query  435   SSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFD  256
             +S  ++W+E   QNEE+L++C++A I++KQYLPH+ +E +W +HFG KW++F++RKA FD
Sbjct  457   ASGFDDWQEFDLQNEELLQFCEDACIEVKQYLPHFGSEREWMRHFGSKWRLFRERKAQFD  516

Query  255   PKLILSPGQRIFSQ  214
             PK++ +PGQRIF +
Sbjct  517   PKMVFAPGQRIFDR  530



>gb|EYU37164.1| hypothetical protein MIMGU_mgv1a004294mg [Erythranthe guttata]
Length=534

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/438 (64%), Positives = 343/438 (78%), Gaps = 19/438 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR-----NGGRIRVSWSESLG-FYADVGGHELWVD  1321
             ARG GHS RGQATA  GVVVEMSSL       N G IRVSW  SLG +YADVGG ++W D
Sbjct  97    ARGRGHSVRGQATAAGGVVVEMSSLSSGDQVSNDG-IRVSWDSSLGCYYADVGGEKMWAD  155

Query  1320  VLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELIT  1141
             VLRA L +GLAPVSWTDYLYLTVGGTLSN GISGQSF +GPQI+NV+E+DVITGKG+ +T
Sbjct  156   VLRAGLEYGLAPVSWTDYLYLTVGGTLSNGGISGQSFLHGPQISNVLELDVITGKGDFVT  215

Query  1140  CSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI  961
             CSK +N ELFFAVLGGLGQFG+ITRARIVL+KAPTRVKW+R++Y DFT FTRDQEHLIS 
Sbjct  216   CSKDVNPELFFAVLGGLGQFGIITRARIVLEKAPTRVKWLRLIYSDFTIFTRDQEHLIS-  274

Query  960   DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLI-SNHGIIYSLELVKYYDDETAT  784
                 DYVEGSLI  +SP NNWRSSF+SPSH S+I SL+ +  G++YS+E+VKYYD++TA 
Sbjct  275   SSVPDYVEGSLITDKSPPNNWRSSFYSPSHYSKIISLLNTKQGLLYSIEVVKYYDEQTAD  334

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGE-VKLRQKGMWDVP---HPWLNL  616
             ++D+E++ +   LS+  G +F+KDV   DFL RV + +   + QK         HPWLNL
Sbjct  335   SVDQEIEVLMNELSYTRGFIFKKDVGLIDFLGRVENTDNNNIHQKSSAKAAASVHPWLNL  394

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH  436
             FVPKSRILDFN GVFVDII R N +SGPIL YP ++ +WD+RMSAV+P+EE FY +GLLH
Sbjct  395   FVPKSRILDFNAGVFVDIIARHNHSSGPILFYPFHRIKWDERMSAVIPDEEIFYTLGLLH  454

Query  435   SSRVNE---WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
             S   +E   +EEL   N+EI+++C+E  I IKQYLPHYK++EDW KHFG+KW  FQ+ K 
Sbjct  455   SCGAHEAGIYEEL---NKEIIRFCEENEINIKQYLPHYKSKEDWMKHFGRKWNTFQELKT  511

Query  264   LFDPKLILSPGQRIFSQS  211
              FDP+LILSPGQRIF+ +
Sbjct  512   KFDPRLILSPGQRIFTSA  529



>ref|XP_008459369.1| PREDICTED: cytokinin dehydrogenase 3-like [Cucumis melo]
Length=524

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/432 (61%), Positives = 339/432 (78%), Gaps = 11/432 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR--IRVS---WSESLGFYADVGGHELWVDV  1318
             ARG GHS RGQA AK+GVV++MS+L+RN     I VS   W+    FY DVGG +LW+DV
Sbjct  93    ARGQGHSVRGQAMAKNGVVIDMSALRRNRKTPGIVVSCRRWTTG-EFYVDVGGEQLWIDV  151

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L  +L +G+ PVSWTDYLY+TVGGTLSNAGISGQSFRYGPQ++NV+EMDV+TGKG ++TC
Sbjct  152   LNETLGYGMTPVSWTDYLYITVGGTLSNAGISGQSFRYGPQVSNVVEMDVVTGKGNMMTC  211

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S   N ELF AVLGGLGQFG+I RARI L+ AP RVKWVRMLY +F  FT+DQEHLIS++
Sbjct  212   SPKKNCELFHAVLGGLGQFGIIARARIALEPAPIRVKWVRMLYTNFAAFTKDQEHLISLN  271

Query  957   -----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  + LDY+EG +++  +  +NWRSSFF PS  S+I SL + + IIY LE+VKYYD  
Sbjct  272   GRKQMNALDYLEGLVLLHHNKPDNWRSSFFPPSDHSRIISLANQNSIIYCLEVVKYYDHH  331

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T +T+D++L+ + +GL +  G  FEKDV++ +FLNRVR+GE+KL+ KG+WDVPHPWLNLF
Sbjct  332   TQSTVDKDLEVLLQGLDYESGFKFEKDVTYVEFLNRVRTGELKLQSKGLWDVPHPWLNLF  391

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VP+SRI+DFN GVF DI+LR+N T GPIL+YP N+++WD+R S V+P+EE FY +G L+S
Sbjct  392   VPRSRIMDFNSGVFKDIVLRRNITKGPILIYPMNRSKWDERNSTVIPDEEVFYTIGFLNS  451

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             S  ++W++   QNEEIL+YC ++GI+IKQYLPHYKT+  W +HFG KW  FQ  K  FDP
Sbjct  452   SGFDDWKKFEEQNEEILEYCGKSGIEIKQYLPHYKTQTQWIQHFGSKWTNFQHNKFKFDP  511

Query  252   KLILSPGQRIFS  217
             K ILSPGQ+IF+
Sbjct  512   KNILSPGQKIFN  523



>gb|KEH32513.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=527

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/427 (62%), Positives = 335/427 (78%), Gaps = 4/427 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA   DG+VV+M+S +  R G  I V     +G+Y DVGG +LW+DVL A
Sbjct  101   ARGQGHSTNGQAMTHDGIVVDMASFRKQRKGVAISVFEDPLIGYYVDVGGEQLWIDVLYA  160

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLTVGGTLSNAGISGQ+F YGPQI NV E DVITGKG+ +TCS  
Sbjct  161   TLEHGLAPVSWTDYLYLTVGGTLSNAGISGQTFLYGPQITNVHEFDVITGKGDFVTCSSE  220

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD-G  952
              NSEL+ AVLGGLGQFGVITRARI L  APT VKW+R+LY DF+ FT+DQE LISI+   
Sbjct  221   KNSELYHAVLGGLGQFGVITRARISLKPAPTTVKWIRLLYSDFSAFTKDQERLISINGRK  280

Query  951   LDYVEGSLIMTQSPANNWRSS-FFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             L+++EG L+M Q   NNWRSS FF  S Q +IASLI+ H IIY LE  KYYD ++   +D
Sbjct  281   LNFLEGMLLMQQGSINNWRSSNFFPLSDQHRIASLITKHSIIYCLEFAKYYDHQSEKMVD  340

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +E++ + +GL++I GL +EK VS+ +FLNRVRSGE+KL+ +G+W+VPHPWLNLF+PKS+I
Sbjct  341   KEIEILLQGLAYIPGLHYEKKVSYVEFLNRVRSGELKLQSQGLWEVPHPWLNLFIPKSQI  400

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
             LDFN GVF DII ++N TSG +LVYP +K++WDD+MSA++P E+ FY VG LHSS  + W
Sbjct  401   LDFNSGVFKDIIFKRNITSGTVLVYPMHKSKWDDKMSAMIPNEDVFYTVGFLHSSGFDNW  460

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             +   +QN+EILK+C +AGIK+KQYLP+Y  +EDW+KHFG KW+ F + K  FDP++ILSP
Sbjct  461   KAYESQNKEILKFCTDAGIKVKQYLPNYSIQEDWKKHFGTKWKSFLESKHKFDPRMILSP  520

Query  234   GQRIFSQ  214
             GQ+IF++
Sbjct  521   GQKIFNK  527



>gb|KHN13439.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=424

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/422 (62%), Positives = 332/422 (79%), Gaps = 13/422 (3%)
 Frame = -3

Query  1443  AKDGVVVEMSSLKR--NGGRIRVSWS------ESLGFYADVGGHELWVDVLRASLPHGLA  1288
             A++GVVV+M+  +   NG  IRV  S          +YADVGG +LW+DVL A+L HGLA
Sbjct  2     AREGVVVDMAGFRERGNGVGIRVVSSVDPNNKNGYYYYADVGGEQLWIDVLHATLEHGLA  61

Query  1287  PVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINSELFF  1108
             P+SWTDYLYLT+GGTLSNAGISGQ+FRYGPQI  V EMDVITGKGE +TCS+  NSELF 
Sbjct  62    PMSWTDYLYLTLGGTLSNAGISGQTFRYGPQITTVREMDVITGKGEFVTCSQQTNSELFH  121

Query  1107  AVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----DDGLDY  943
             AVLGGLGQFG+ITRARI L  AP RVKWVR+LY+DF+ FT+DQE LISI     +  LDY
Sbjct  122   AVLGGLGQFGIITRARIALAPAPKRVKWVRLLYNDFSAFTKDQEQLISITGRKQNVSLDY  181

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EG L+M Q P NNWRSSFF  +  ++I SL++ H ++Y LE+ KYYD +    +D+ELQ
Sbjct  182   LEGLLLMHQGPINNWRSSFFPLADHARIISLVTKHSVLYCLEVAKYYDGQNENNVDKELQ  241

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
              + +GLS+I G  +EKDVS+F+FLNRVRSGE+KL+ +G+WDVPHPWLNLF+PKS+I++F+
Sbjct  242   VLLQGLSYIPGFYYEKDVSYFEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPKSQIMEFD  301

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF +IIL++N T+GP+LVYP N+ +WD+RMSA +P+E+ FY VG LHSS  + W+   
Sbjct  302   SGVFKNIILKRNITTGPVLVYPMNRNKWDNRMSASIPDEDIFYTVGFLHSSGFDNWKAYD  361

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              QN+EIL++C+ AGIK+KQYLPHY+T+EDW  HFG KW+ F +RK  FDPK+ILSPGQRI
Sbjct  362   AQNKEILQFCNVAGIKVKQYLPHYRTQEDWANHFGPKWRTFVERKHQFDPKMILSPGQRI  421

Query  222   FS  217
             F+
Sbjct  422   FN  423



>ref|XP_010024208.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=522

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/429 (60%), Positives = 337/429 (79%), Gaps = 10/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G +  VSWS+SLG YADVGG +LW++VL  +L
Sbjct  99    ARGCGHSVRGQAMARDGVVVDMTSL---GNKTAVSWSQSLGHYADVGGQQLWINVLEETL  155

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+ PVSWTDYLYLTVGGTLSNAGISG++FRYGPQI+NV EMDVITG G   TCS H N
Sbjct  156   KHGVTPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGHFFTCSPHKN  215

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----D  958
              ELF++VLGGLGQFG+ITRARI L +AP R  WVRMLY DF+ FT DQE LIS+     D
Sbjct  216   PELFYSVLGGLGQFGIITRARIALGQAPNRAIWVRMLYSDFSAFTTDQERLISLHGRDQD  275

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEG L M ++ +++W  SFFS S + ++ SL++ H ++Y +E+ K+YD+ T +T+
Sbjct  276   EALDYVEGQLFMRRN-SDSW-ISFFSLSDRPRLMSLLTEHELLYCIEVAKFYDERTRSTV  333

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+ + K LS +   +F+KDV + DFLNRVR+ E+ LR+ G+W+VPHPWLNLFVPKSR
Sbjct  334   DKDLKTILKDLSHVPEFLFQKDVGYVDFLNRVRAEELTLRELGLWNVPHPWLNLFVPKSR  393

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+LR+N T+GP+L+YP N  +WDDRMSAV+P+E+ FY VG L SS   +
Sbjct  394   IADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLLSSGFKD  453

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C++ GIK+KQYLP+Y TE +W +HFG KW+ FQ+ KA FDPK++LS
Sbjct  454   WQEFDLQNKEVLLFCEDNGIKVKQYLPNYSTEREWMQHFGPKWRAFQESKAQFDPKMLLS  513

Query  237   PGQRIFSQS  211
             PGQRIF+Q+
Sbjct  514   PGQRIFNQN  522



>ref|XP_004488057.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=533

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/432 (60%), Positives = 329/432 (76%), Gaps = 8/432 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESL--GFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A+DGVVV+M  L+           +    G Y DVGG +LW+DVL  
Sbjct  102   ARGQGHSTCGQAMARDGVVVDMKGLREINNNNNNVGIKVFKEGNYVDVGGEQLWIDVLYG  161

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L +GLAPVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI +V +MDV+TGKGE +TCSK 
Sbjct  162   TLEYGLAPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITSVHQMDVVTGKGEFVTCSKQ  221

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI----  961
              NSELF  VLGGLGQFG+ITRARI L+ AP RVKWVR+LY DF+ FT+DQE LIS+    
Sbjct  222   KNSELFHGVLGGLGQFGIITRARIALEPAPKRVKWVRLLYSDFSIFTKDQERLISMKGSK  281

Query  960   DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATT  781
             +  LDY+EG L+M Q P NNWRSSFF  +   +I SL++ H ++Y LE+ KYYDD++   
Sbjct  282   NSSLDYLEGMLLMHQGPINNWRSSFFPLADHQRIISLVTQHRVLYCLEIAKYYDDQSEIN  341

Query  780   IDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKS  601
             +++E+Q + +GL+ I G  +EK+VSF +FLNRVRSGE+KL+ +G+WDVPHPWLNLF+PKS
Sbjct  342   VNKEIQVLLQGLNHIPGFYYEKNVSFVEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPKS  401

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP--EEETFYCVGLLHSSR  427
             RILDFN GVF  II ++N T+GP+LVYP N+ +WD++MSA +P  E+E FY VG LHSS 
Sbjct  402   RILDFNSGVFKKIIYKRNITTGPVLVYPMNRNKWDNKMSARIPDEEDEIFYAVGFLHSSG  461

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
              + W+E   QN EIL++C++ GIK K YLPHY+T+EDW  HFG KW  F QRK  FDP++
Sbjct  462   FDNWKEFDAQNREILQFCNDVGIKYKLYLPHYRTQEDWTNHFGPKWTTFLQRKFQFDPRM  521

Query  246   ILSPGQRIFSQS  211
             ILSPGQRIF+ +
Sbjct  522   ILSPGQRIFNNN  533



>ref|XP_003635626.2| PREDICTED: cytokinin dehydrogenase 3-like, partial [Vitis vinifera]
Length=372

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/371 (70%), Positives = 311/371 (84%), Gaps = 2/371 (1%)
 Frame = -3

Query  1329  WVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGE  1150
             W+DVL+A+L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGE
Sbjct  2     WIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGE  61

Query  1149  LITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHL  970
             L+TCSK  NSELFFAVLGGLGQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHL
Sbjct  62    LVTCSKDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHL  121

Query  969   ISIDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
             ISI+ GLDY+EGSL+M  S  NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T
Sbjct  122   ISIN-GLDYLEGSLLMQNSSPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELT  179

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             + T+DEELQE+ KGL+F+ G VF KDVS  DFLNRV S E+ LR KG+WDVPHPWLNLFV
Sbjct  180   SHTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFV  239

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             P SRI DFN GVF DI+ + N+T+G  L+YP  + +WDDR SAV+P+E+ FY VGLLHSS
Sbjct  240   PGSRISDFNSGVFRDILPKINQTTGTFLIYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSS  299

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               ++WE L NQN+EILK+CD+AGIKIK+YL  Y T++DW  HFG KW+ F+ RKA FDPK
Sbjct  300   GADDWEPLENQNKEILKFCDKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPK  359

Query  249   LILSPGQRIFS  217
             +ILSPGQ+IF+
Sbjct  360   MILSPGQQIFN  370



>ref|XP_010026881.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=512

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/429 (60%), Positives = 334/429 (78%), Gaps = 10/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G +  VSWS+SLG YADVGG +LW+DVL  +L
Sbjct  89    ARGCGHSVRGQAMARDGVVVDMTSL---GNKTTVSWSQSLGHYADVGGQQLWIDVLEETL  145

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+APVSWTDYLYLTVGGTLSNAGISG++FRYGPQI+N  EMDVITG G  +TCS H N
Sbjct  146   KHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNAYEMDVITGTGHFLTCSPHEN  205

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----D  958
              ELF +VLGGLGQF +ITRARI L  AP R KWVRMLY DF+ FT DQE LIS+     D
Sbjct  206   PELFHSVLGGLGQFVIITRARIALGPAPKRAKWVRMLYSDFSAFTMDQERLISVHGRDQD  265

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEG L + +  +++W  SFFS S   ++ SL++ H ++Y +E+ K+YD+ T +T+
Sbjct  266   EALDYVEGQLFI-RGNSDSW-ISFFSLSDHPRLMSLLTEHELLYCIEVAKFYDERTRSTV  323

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+ + K LS +   +F+KDV + DFLNRVR+ E+ LR+ G+W+VPHPWLNLFVPKSR
Sbjct  324   DKDLKMILKDLSHVPEFLFQKDVGYVDFLNRVRAEEMTLRKLGLWNVPHPWLNLFVPKSR  383

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+LR+N T+GP+L+YP N  +WDDRMSAV+P+E+ FY VG L SS   +
Sbjct  384   IADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLLSSGFKD  443

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C++ GIK+KQYLP+Y TE +W +HFG KW+ FQ+ KA FDPK++LS
Sbjct  444   WQEFDLQNKEVLLFCEDNGIKVKQYLPNYSTEREWMQHFGPKWRAFQESKAQFDPKMLLS  503

Query  237   PGQRIFSQS  211
             PGQRIF+Q+
Sbjct  504   PGQRIFNQN  512



>emb|CBI41113.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/371 (70%), Positives = 311/371 (84%), Gaps = 2/371 (1%)
 Frame = -3

Query  1329  WVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGE  1150
             W+DVL+A+L HGLAPVSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGE
Sbjct  3     WIDVLQATLKHGLAPVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGE  62

Query  1149  LITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHL  970
             L+TCSK  NSELFFAVLGGLGQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHL
Sbjct  63    LVTCSKDTNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHL  122

Query  969   ISIDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
             ISI+ GLDY+EGSL+M  S  NNWRSSF SPS   +I+SLIS +GIIY LE+VKYYD+ T
Sbjct  123   ISIN-GLDYLEGSLLMQNSSPNNWRSSF-SPSEYPRISSLISKNGIIYCLEVVKYYDELT  180

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             + T+DEELQE+ KGL+F+ G VF KDVS  DFLNRV S E+ LR KG+WDVPHPWLNLFV
Sbjct  181   SHTVDEELQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFV  240

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             P SRI DFN GVF DI+ + N+T+G  L+YP  + +WDDR SAV+P+E+ FY VGLLHSS
Sbjct  241   PGSRISDFNSGVFRDILPKINQTTGTFLIYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSS  300

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               ++WE L NQN+EILK+CD+AGIKIK+YL  Y T++DW  HFG KW+ F+ RKA FDPK
Sbjct  301   GADDWEPLENQNKEILKFCDKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPK  360

Query  249   LILSPGQRIFS  217
             +ILSPGQ+IF+
Sbjct  361   MILSPGQQIFN  371



>ref|XP_010040366.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=528

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/429 (61%), Positives = 335/429 (78%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG  HS +GQA A DGVVV+M SL+       V WS SLG YADVGG +LW+DVL  +L
Sbjct  102   ARGCSHSIQGQAMAPDGVVVDMMSLENKRRGTTVLWSWSLGHYADVGGQQLWIDVLEETL  161

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+APVSWTDYLYLTVGGTLSNAGISG++FRYGPQI+NV EMDVITG G+ +TCS   N
Sbjct  162   KHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGDFLTCSPDKN  221

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              ELF++VLGGLGQFG+ITRARI L +AP RVKWVRMLY DF+ FT DQE LIS      D
Sbjct  222   PELFYSVLGGLGQFGIITRARIALGQAPKRVKWVRMLYSDFSDFTIDQESLISHHGRDQD  281

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEGSL+M ++ +++W +SFFS S + ++ SL++ H ++Y +E+ K+YD  T TT+
Sbjct  282   EALDYVEGSLLMHRN-SDSW-TSFFSLSDRQRLMSLVTEHELLYCIEVAKFYDGRTQTTV  339

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+ L+ + K LS +   +FEKDV++ DFLNRVR  E+KLR++G+W+VPHPWLNLFVPKSR
Sbjct  340   DKALEIILKDLSHVPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWNVPHPWLNLFVPKSR  399

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+L++N T+G +L+YP N  +WDDRMSAV+P+E+ FY VG LHSS   +
Sbjct  400   IADFNTGVFNNIVLKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLHSSGFED  459

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C+  GIK+KQYLP+Y TE +W +HFG KW+ FQ+ KA FDPK++LS
Sbjct  460   WQEFDLQNKEVLLFCENNGIKVKQYLPNYNTEREWMEHFGSKWRTFQESKAQFDPKMLLS  519

Query  237   PGQRIFSQS  211
             PGQRIF+ +
Sbjct  520   PGQRIFNHN  528



>gb|KCW60471.1| hypothetical protein EUGRSUZ_H03198, partial [Eucalyptus grandis]
Length=545

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/429 (60%), Positives = 333/429 (78%), Gaps = 10/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
              RG GHS RGQA A+DGVVV+M+SL   G +  VSWS+SLG YADVGG +LW+DVL  +L
Sbjct  122   TRGCGHSVRGQAMARDGVVVDMTSL---GNKTTVSWSQSLGHYADVGGQQLWIDVLEETL  178

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+APVSWTDYLYLTVGGTLSNAGISG++FRYGPQI+N  EMDVITG G  +TCS H N
Sbjct  179   KHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNAYEMDVITGTGHFLTCSPHEN  238

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----D  958
              ELF +VLGGLGQF +ITRARI L  AP R KWVRMLY DF+ FT DQE LIS+     D
Sbjct  239   PELFHSVLGGLGQFVIITRARIALGPAPKRAKWVRMLYSDFSAFTMDQERLISVHGRDQD  298

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEG L + +  +++W  SFFS S   ++ SL++ H ++Y +E+ K+YD+ T +T+
Sbjct  299   EALDYVEGQLFI-RGNSDSW-ISFFSLSDHPRLMSLLTEHELLYCIEVAKFYDERTRSTV  356

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+ + K LS +   +F+KDV + DFLNRVR+ E+ LR+ G+W+VPHPWLNLFVPKSR
Sbjct  357   DKDLKMILKDLSHVPEFLFQKDVGYVDFLNRVRAEEMTLRKLGLWNVPHPWLNLFVPKSR  416

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+LR+N T+GP+L+YP N  +WDDRMSAV+P+E+ FY VG L SS   +
Sbjct  417   IADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLLSSGFKD  476

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C++ GIK+KQYLP+Y TE +W +HFG KW+ FQ+ KA FDPK++LS
Sbjct  477   WQEFDLQNKEVLLFCEDNGIKVKQYLPNYSTEREWMQHFGPKWRAFQESKAQFDPKMLLS  536

Query  237   PGQRIFSQS  211
             PGQRIF+Q+
Sbjct  537   PGQRIFNQN  545



>ref|XP_010451653.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X1 [Camelina 
sativa]
Length=519

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 328/421 (78%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA+AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  101   ARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDAAWLWIEVLNKTL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI NV EMDVITGKGE+ TCSK++N
Sbjct  158   ELGLTPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVQEMDVITGKGEIATCSKYMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LFFA LGGLGQFG+ITRARI L+ AP R KW R LY DF++FTRDQE LIS  DGLD+
Sbjct  218   SDLFFAALGGLGQFGIITRARIKLEVAPKRAKWFRFLYIDFSEFTRDQERLISETDGLDF  277

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++ + P +NWRS+++ PS   +I S++    +IY LE+VKYYD+ +  T++EE++
Sbjct  278   LEGSVMLDRGPPDNWRSTYYPPSDHLRIVSMVKRRRVIYCLEVVKYYDETSQYTVNEEME  337

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+ + L+F+ G ++EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F+
Sbjct  338   ELGESLNFVKGFMYEKDVTYMDFLNRVRTGELSLKSKGQWDVPHPWLNLFVPKSQISKFD  397

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N TSGP+LVYP N+ +W+DRMSA +PEE+ FY VG L S+  ++WE   
Sbjct  398   HGVFKGIILRNNITSGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSADFDDWEAYD  457

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N EILK+C++A +++ QYLP++ ++E W +HFG +W IF +RK  +DPK+ILSPGQ I
Sbjct  458   RENMEILKFCEDANMRVIQYLPYHSSQEGWVRHFGPRWNIFLERKYKYDPKMILSPGQNI  517

Query  222   F  220
             F
Sbjct  518   F  518



>gb|KCW60469.1| hypothetical protein EUGRSUZ_H03195 [Eucalyptus grandis]
Length=522

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/429 (61%), Positives = 334/429 (78%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG  HS +GQA A DGVVV+M SL        V WS SLG YADVGG +LW+DVL  +L
Sbjct  96    ARGCSHSIQGQAMAPDGVVVDMMSLGNKRRGTTVLWSWSLGHYADVGGQQLWIDVLEETL  155

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+APVSWTDYLYLTVGGTLSNAGISG++FRYGPQI+NV EMDVITG G+ +TCS   N
Sbjct  156   KHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGDFLTCSPDKN  215

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              ELF++VLGGLGQFG+ITRARI L +AP RVKWVRMLY DF+ FT DQE LIS      D
Sbjct  216   PELFYSVLGGLGQFGIITRARIALGQAPKRVKWVRMLYSDFSDFTIDQESLISHHGRDQD  275

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEGSL+M ++ +++W +SFFS S + ++ SL++ H ++Y +E+ K+YD  T TT+
Sbjct  276   EALDYVEGSLLMHRN-SDSW-TSFFSLSDRQRLMSLVTEHELLYCIEVAKFYDGRTQTTV  333

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+ L+ + K LS +   +FEKDV++ DFLNRVR  E+KLR++G+W+VPHPWLNLFVPKSR
Sbjct  334   DKALEIILKDLSHVPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWNVPHPWLNLFVPKSR  393

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+L++N T+G +L+YP N  +WDDRMSAV+P+E+ FY VG LHSS   +
Sbjct  394   IADFNTGVFNNIVLKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLHSSGFED  453

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C+  GIK+KQYLP+Y TE +W +HFG KW+ FQ+ KA FDPK++LS
Sbjct  454   WQEFDLQNKEVLLFCENNGIKVKQYLPNYNTEREWMEHFGSKWRTFQESKAQFDPKMLLS  513

Query  237   PGQRIFSQS  211
             PGQRIF+ +
Sbjct  514   PGQRIFNHN  522



>ref|XP_010024059.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=528

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/429 (61%), Positives = 334/429 (78%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG  HS +GQA A DGVVV+M SL        V WS SLG YADVGG +LW+DVL  +L
Sbjct  102   ARGCSHSIQGQAMAPDGVVVDMMSLGNKRRGTTVLWSWSLGHYADVGGQQLWIDVLEETL  161

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+APVSWTDYLYLTVGGTLSNAGISG++FRYGPQI+NV EMDVITG G+ +TCS   N
Sbjct  162   KHGVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGDFLTCSPDKN  221

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              ELF++VLGGLGQFG+ITRARI L +AP RVKWVRMLY DF+ FT DQE LIS      D
Sbjct  222   PELFYSVLGGLGQFGIITRARIALGQAPKRVKWVRMLYSDFSDFTIDQESLISHHGRDQD  281

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEGSL+M ++ +++W +SFFS S + ++ SL++ H ++Y +E+ K+YD  T TT+
Sbjct  282   EALDYVEGSLLMHRN-SDSW-TSFFSLSDRQRLMSLVTEHELLYCIEVAKFYDGRTQTTV  339

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+ L+ + K LS +   +FEKDV++ DFLNRVR  E+KLR++G+W+VPHPWLNLFVPKSR
Sbjct  340   DKALEIILKDLSHVPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWNVPHPWLNLFVPKSR  399

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+L++N T+G +L+YP N  +WDDRMSAV+P+E+ FY VG LHSS   +
Sbjct  400   IADFNTGVFNNIVLKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLHSSGFED  459

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C+  GIK+KQYLP+Y TE +W +HFG KW+ FQ+ KA FDPK++LS
Sbjct  460   WQEFDLQNKEVLLFCENNGIKVKQYLPNYNTEREWMEHFGSKWRTFQESKAQFDPKMLLS  519

Query  237   PGQRIFSQS  211
             PGQRIF+ +
Sbjct  520   PGQRIFNHN  528



>ref|XP_011077992.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X2 [Sesamum 
indicum]
Length=509

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/426 (64%), Positives = 323/426 (76%), Gaps = 23/426 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A  GVVVEM++L RNGG IRVSWS SLG+YADVGG E+W DVLR  L
Sbjct  95    ARGRGHSVRGQAMAGGGVVVEMAALSRNGGGIRVSWSPSLGYYADVGGEEMWADVLRVGL  154

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAPVSWTDYLYLTVGGTLSNAGISGQSFR+GPQI+NV+E+DVIT             
Sbjct  155   EHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVLELDVIT-------------  201

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-DGLD  946
                   VLGGLGQFG+ITRARIVL KAPTR KWVR++Y+DFT FTRDQEHLIS + +G +
Sbjct  202   ------VLGGLGQFGIITRARIVLQKAPTRAKWVRLIYNDFTMFTRDQEHLISTNINGPN  255

Query  945   YVEGSLIMTQSPANNWRSSFFSPSHQSQIASLI-SNHGIIYSLELVKYYDDETATTIDEE  769
             YVEGSLI  QSP NNWRSSF+SPS QS+I SL+ S  G++YS+E+VKYY D    TID+E
Sbjct  256   YVEGSLITDQSPPNNWRSSFYSPSDQSKILSLLRSKQGLLYSIEVVKYYHDTNIDTIDQE  315

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDV--PHPWLNLFVPKSRI  595
             ++ + K L+FI G VF KDVS  DFL RV SG  K  +K        HPWLNLF+PKS I
Sbjct  316   VKLLVKDLNFIPGFVFNKDVSLVDFLTRVGSGRDKEEEKSSDRELETHPWLNLFLPKSSI  375

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
             +DFN  VFV++I R N TSGPIL YP N+ +WDDRMSAV P+E+ FY +GLLH+SR ++ 
Sbjct  376   MDFNDAVFVNVIRRHNHTSGPILFYPFNRQKWDDRMSAVTPDEDIFYTLGLLHTSRPHQS  435

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             +   N N EIL  C++A I +KQYLPHY ++EDW KHFG KW  FQ+RK  FDP++ILSP
Sbjct  436   DVYDNLNSEILDCCEKADIDVKQYLPHYISKEDWMKHFGPKWDTFQERKTKFDPRMILSP  495

Query  234   GQRIFS  217
             GQRIF+
Sbjct  496   GQRIFT  501



>ref|XP_010451656.1| PREDICTED: cytokinin dehydrogenase 3-like isoform X2 [Camelina 
sativa]
Length=519

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 326/421 (77%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA+AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  101   ARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDAAWLWIEVLNKTL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI NV EMDVITGKGE  TCSK +N
Sbjct  158   ELGLTPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVQEMDVITGKGESATCSKDMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LFFA LGGLGQFG+ITRARI L+ AP R KW R LY DF++FTRDQE LIS  DGLD+
Sbjct  218   SDLFFAALGGLGQFGIITRARIKLEVAPKRAKWFRFLYIDFSEFTRDQERLISETDGLDF  277

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++ + P +NWRS+++ PS   +I S++    +IY LE+VKYYD+ +  T++EE++
Sbjct  278   LEGSVMLDRGPPDNWRSTYYPPSDHLRIVSMVKRRRVIYCLEVVKYYDETSQYTVNEEME  337

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+ + L+F+ G ++EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F+
Sbjct  338   ELGESLNFVKGFMYEKDVTYMDFLNRVRTGELSLKSKGQWDVPHPWLNLFVPKSQISKFD  397

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N TSGP+LVYP N+ +W+DRMSA +PEE+ FY VG L S+  ++WE   
Sbjct  398   HGVFKGIILRNNITSGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSADFDDWEAYD  457

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N EILK+C++A +++ QYLP++ ++E W +HFG +W IF +RK  +DPK+ILSPGQ I
Sbjct  458   RENMEILKFCEDANMRVIQYLPYHSSQEGWVRHFGPRWNIFLERKYKYDPKMILSPGQNI  517

Query  222   F  220
             F
Sbjct  518   F  518



>ref|XP_003595184.1| Cytokinin dehydrogenase [Medicago truncatula]
 gb|ABN05760.1| FAD linked oxidase, N-terminal [Medicago truncatula]
 gb|AES65435.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=540

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 331/445 (74%), Gaps = 21/445 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--------------NGGRIRVSWSESLGFYADV  1345
             ARG GHS RGQA A+DGVVV+M  L+R               G  +        G+Y DV
Sbjct  96    ARGQGHSTRGQAMARDGVVVDMKGLRRLKNNNKNNEHNNKNVGIEVFEDPKVGFGYYVDV  155

Query  1344  GGHELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVI  1165
             GG +LW+DVL  +L +GLAPVSWTDYLYLT+GGTLSNAGISGQ+FRYGPQI +V ++DV+
Sbjct  156   GGEQLWIDVLYETLEYGLAPVSWTDYLYLTIGGTLSNAGISGQTFRYGPQITSVHQLDVV  215

Query  1164  TGKGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTR  985
             TGKGE +TCSK  NSELF  VLGGLGQFG+ITRARI L+ AP RVKWVR+LY DF+ FT+
Sbjct  216   TGKGEFVTCSKQNNSELFNGVLGGLGQFGIITRARIALEPAPKRVKWVRLLYSDFSVFTK  275

Query  984   DQEHLISI----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLE  817
             DQE LIS+    +  LDY+EG ++M Q P NNWRSSFF  +   +I SL++ H ++Y LE
Sbjct  276   DQERLISMKGNKNSALDYLEGMVLMNQGPINNWRSSFFPLTDHHRILSLVTQHTVLYCLE  335

Query  816   LVKYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDV  637
             + KYYD  +   +++E+Q + +GL++I G  +EK+VSF +FLNRVRSGE+KL+ +G+WDV
Sbjct  336   IAKYYDYHSENNVNKEIQVLLQGLNYIPGFHYEKNVSFVEFLNRVRSGELKLQSQGLWDV  395

Query  636   PHPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP--EEE  463
             PHPWLN+F+PKSRILDFN+GVF  II ++N T+GP+LVYP N+ +WD+ MSA +P  EE+
Sbjct  396   PHPWLNMFIPKSRILDFNLGVFKKIIQKRNITTGPVLVYPMNRNKWDNEMSATIPDDEED  455

Query  462   TFYCVGLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQ  286
              FY VG LHSS  + W+    QN+EIL++C+ A I  K YLPHY T+E+W  HFG KKW+
Sbjct  456   IFYAVGFLHSSGFDNWKAFDAQNKEILQFCNHAKINYKLYLPHYSTQEEWTNHFGPKKWK  515

Query  285   IFQQRKALFDPKLILSPGQRIFSQS  211
              F QRK  FDP++ILSPGQRIF+ +
Sbjct  516   TFLQRKNEFDPRMILSPGQRIFNNN  540



>emb|CAN61742.1| hypothetical protein VITISV_038638 [Vitis vinifera]
Length=496

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/423 (64%), Positives = 319/423 (75%), Gaps = 30/423 (7%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVVEM SL     G  IRV+                       
Sbjct  99    ARGQGHSLRGQAMAXHGVVVEMRSLNNCSXGSGIRVT-----------------------  135

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
                     VSWTDYLYLT+GGTLSNAGISGQ+FR+GPQI+NV EMDV+TGKGEL+TCSK 
Sbjct  136   ---KNPIXVSWTDYLYLTIGGTLSNAGISGQTFRHGPQISNVYEMDVLTGKGELVTCSKD  192

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELFFAVLGGLGQFG+I RARI L  AP RVKW++MLYDDF+ F+RDQEHLISI+ GL
Sbjct  193   TNSELFFAVLGGLGQFGIIIRARIALKPAPKRVKWIQMLYDDFSTFSRDQEHLISIN-GL  251

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EGSL+M  S  NNWRSSF SPS   +I+SLIS +G IY LE+VKYYD+ T+ T+DEE
Sbjct  252   DYLEGSLLMQNSSPNNWRSSF-SPSEYPRISSLISKNGXIYCLEVVKYYDELTSHTVDEE  310

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             LQE+ KGL+F+ G VF KDVS  DFLNRV S E+ LR KG+WDVPHPWLNLFVP SRI D
Sbjct  311   LQELLKGLNFLPGFVFTKDVSLVDFLNRVHSEELNLRAKGLWDVPHPWLNLFVPGSRISD  370

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             FN GVF DI+ + N+T+G  LVYP  + +WDDR SAV+P+E+ FY VGLLHSS  ++WE 
Sbjct  371   FNSGVFRDILPKINQTTGTFLVYPVIRNKWDDRTSAVIPDEDIFYTVGLLHSSGADDWEP  430

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L NQN+EILK+CD+AGIKIK+YL  Y T++DW  HFG KW+ F+ RKA FDPK+ILSPGQ
Sbjct  431   LENQNKEILKFCDKAGIKIKRYLSRYTTKKDWMNHFGPKWRTFEDRKAQFDPKMILSPGQ  490

Query  228   RIF  220
             +IF
Sbjct  491   QIF  493



>ref|NP_200507.1| cytokinin dehydrogenase 3 [Arabidopsis thaliana]
 sp|Q9LTS3.1|CKX3_ARATH RecName: Full=Cytokinin dehydrogenase 3; AltName: Full=Cytokinin 
oxidase 3; Short=AtCKX3; Short=CKO 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG30906.1|AF303979_1 cytokinin oxidase [Arabidopsis thaliana]
 dbj|BAA97027.1| cytokinin oxidase [Arabidopsis thaliana]
 gb|ACE62889.1| At5g56970 [Arabidopsis thaliana]
 gb|AED96828.1| cytokinin dehydrogenase 3 [Arabidopsis thaliana]
Length=523

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/426 (59%), Positives = 327/426 (77%), Gaps = 3/426 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA+AKDGVVV M S+      I+VS +     Y DV    LW++VL  +L
Sbjct  100   ARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRT---CLYVDVDAAWLWIEVLNKTL  156

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+FRYGPQI NV+EMDVITGKGE+ TCSK +N
Sbjct  157   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQITNVLEMDVITGKGEIATCSKDMN  216

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LFFAVLGGLGQFG+ITRARI L+ AP R KW+R LY DF++FTRDQE +IS  DG+D+
Sbjct  217   SDLFFAVLGGLGQFGIITRARIKLEVAPKRAKWLRFLYIDFSEFTRDQERVISKTDGVDF  276

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +IAS++  H +IY LE+VKYYD+ +  T++EE++
Sbjct  277   LEGSIMVDHGPPDNWRSTYYPPSDHLRIASMVKRHRVIYCLEVVKYYDETSQYTVNEEME  336

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+   L+ + G ++EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPK++I  F+
Sbjct  337   ELSDSLNHVRGFMYEKDVTYMDFLNRVRTGELNLKSKGQWDVPHPWLNLFVPKTQISKFD  396

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N TSGP+LVYP N+ +W+DRMSA +PEE+ FY VG L S+  + WE   
Sbjct  397   DGVFKGIILRNNITSGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSAGFDNWEAFD  456

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N EILK+C++A + + QYLP++ ++E W +HFG +W IF +RK  +DPK+ILSPGQ I
Sbjct  457   QENMEILKFCEDANMGVIQYLPYHSSQEGWVRHFGPRWNIFVERKYKYDPKMILSPGQNI  516

Query  222   FSQSSS  205
             F + +S
Sbjct  517   FQKINS  522



>ref|XP_010443356.1| PREDICTED: cytokinin dehydrogenase 3 [Camelina sativa]
Length=519

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/421 (59%), Positives = 324/421 (77%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA+AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  101   ARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDAAWLWIEVLNKTL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSNAGISGQ+FRYGPQI NV EMDVITGKGE+ TCSK +N
Sbjct  158   ELGLTPVSWTDYLYLTVGGTLSNAGISGQTFRYGPQITNVQEMDVITGKGEIATCSKDMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LFFA LGG GQFG+ITRARI L+ AP R KW R LY DF++FTRDQE LIS  DG+D+
Sbjct  218   SDLFFAALGGFGQFGIITRARIKLEVAPKRAKWFRFLYIDFSEFTRDQERLISETDGVDF  277

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD+ +   ++EE++
Sbjct  278   LEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMVKRHRVIYCLEVVKYYDETSQYAVNEEME  337

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             ++ + L+F+ G ++EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F+
Sbjct  338   DLGESLNFVKGFMYEKDVTYMDFLNRVRTGELSLKSKGQWDVPHPWLNLFVPKSQISKFD  397

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
               VF  IILR N TSGP+LVYP N+ +W++RMSA +PEE+ FY VG L S+  ++WE   
Sbjct  398   NSVFKGIILRNNITSGPVLVYPMNRNKWNERMSAAIPEEDVFYAVGFLRSADFDDWEAYD  457

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N EILK+C++A ++I QYLP++ ++E W +HFG +W IF +RK  +DPK+ILSPGQ I
Sbjct  458   KENMEILKFCEDANMRIIQYLPYHSSQEGWVRHFGPRWNIFLERKYKYDPKMILSPGQNI  517

Query  222   F  220
             F
Sbjct  518   F  518



>ref|XP_009352704.1| PREDICTED: cytokinin dehydrogenase 2-like [Pyrus x bretschneideri]
Length=513

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 324/422 (77%), Gaps = 4/422 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA   DGVV+ M++L  NG RI VS S SLG YADVGG + W+DVL A+L
Sbjct  94    ARGQGHSVRGQALTSDGVVINMTALISNGSRIVVSESPSLGSYADVGGEQRWIDVLHATL  153

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYL+VGGTLSNAGISGQ+FRYGPQI NV E+DV+TGKGEL+TCS +  
Sbjct  154   DRGLTPVSWTDYLYLSVGGTLSNAGISGQTFRYGPQINNVYELDVVTGKGELVTCSSNKV  213

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
               LF+AVLGGLGQFG+ITRARI L+ AP R KWVRM+Y +F+ F++DQE L++ ++G DY
Sbjct  214   PGLFYAVLGGLGQFGIITRARIPLEPAPKRAKWVRMMYSNFSAFSKDQERLMA-NNGFDY  272

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EG L+M Q P +    SF+    Q +I +LI+ +GIIY +E  KYYDD T TT+D+ ++
Sbjct  273   LEGFLLMKQGPLD---LSFYPLLDQPRITALINQYGIIYYIEAAKYYDDSTRTTVDKVVE  329

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             ++  GLSF+ G +F++DV + DFL+RV + E KLR  G+WD+ HPWLN+FVPKSRILD +
Sbjct  330   KLINGLSFVPGFLFDQDVLYIDFLDRVHTEEEKLRSLGLWDIAHPWLNVFVPKSRILDID  389

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF +I+L+QN  +   L+YP N+ +WD RMSAV+P+E+ FY VGLLH+S  N+W+   
Sbjct  390   SGVFRNILLKQNVPTAVTLIYPMNRKKWDGRMSAVIPDEDVFYVVGLLHASGFNDWQAFD  449

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
               N +IL++C++AGI +KQYLPHY+T+EDW+ HFG KWQ FQ RK  FDP  IL+PGQRI
Sbjct  450   EVNRQILQFCNDAGILVKQYLPHYETQEDWKNHFGTKWQSFQDRKVRFDPNKILAPGQRI  509

Query  222   FS  217
             FS
Sbjct  510   FS  511



>ref|XP_008338887.1| PREDICTED: cytokinin dehydrogenase 4-like [Malus domestica]
Length=513

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/422 (60%), Positives = 319/422 (76%), Gaps = 4/422 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA    GVV+ M++L RNG RI VS S SLG YADVGG + W+DVLRA+L
Sbjct  94    ARGQGHSVRGQALTSGGVVINMTALIRNGSRIVVSESPSLGSYADVGGEQRWIDVLRATL  153

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYL+VGGTLSNAGISGQ+F YGPQI NV E+DV+TGKGEL+TCS    
Sbjct  154   ERGLTPVSWTDYLYLSVGGTLSNAGISGQTFLYGPQINNVYELDVVTGKGELVTCSSKKV  213

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELF+AVLGGLGQFG+ITRARI L  AP R KWVRM+Y +F+ F+RDQEHL++  +G DY
Sbjct  214   PELFYAVLGGLGQFGIITRARIPLAPAPKRAKWVRMMYSNFSAFSRDQEHLMA-PNGFDY  272

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EG L+M Q P +    SF+    Q +IA+LI+ +GIIY +E  KYYDD T  T+D+ ++
Sbjct  273   LEGFLLMKQGPLD---LSFYPLLDQPRIAALINRYGIIYYIEAAKYYDDSTTKTVDKVVE  329

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             +  KGLSF+   +FE+DVS+ DFL+RV + E  LR  G+W++ HPWLN+FVPKSRI D +
Sbjct  330   KTIKGLSFVPEFLFEQDVSYIDFLDRVHTEEENLRSLGLWEIAHPWLNIFVPKSRISDID  389

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF +I+L+QN  +    +YP N+ RWD RMSAV+P+E+ FY VGLLH+S  N+W+   
Sbjct  390   SGVFRNILLKQNVPTAVSXIYPMNRKRWDGRMSAVIPDEDVFYVVGLLHASGFNDWQAFD  449

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
               N ++L++C +AGI++KQYLPHYKT EDW+ HFG+KWQ FQ  K  FDP  IL+PGQRI
Sbjct  450   EVNRQLLQFCTDAGIRVKQYLPHYKTREDWKNHFGRKWQSFQDMKVRFDPNKILAPGQRI  509

Query  222   FS  217
             FS
Sbjct  510   FS  511



>ref|XP_009120210.1| PREDICTED: cytokinin dehydrogenase 3 isoform X2 [Brassica rapa]
Length=519

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/421 (58%), Positives = 323/421 (77%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  101   ARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLWIEVLNKTL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+FRYGPQI+NV+EMDVITGKGE+ TCSK +N
Sbjct  158   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEIATCSKDMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LF+A LGGLGQFG+ITRARI L+ AP + KW+R LY DF++FTRDQE LIS  +G  +
Sbjct  218   SDLFYAALGGLGQFGIITRARIKLELAPKKAKWLRFLYTDFSEFTRDQERLISETNGPHF  277

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD+ +  +++EE++
Sbjct  278   LEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQHSVNEEME  337

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+   L++  G V+EKDV++ DFLNRVR+GE+KL+ KG WDVPHPWLNLFVPKS+I  F 
Sbjct  338   ELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGKWDVPHPWLNLFVPKSQISRFE  397

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N T+GP+LVYP N+ +W+DRMS V+PEE+ FY VG L S+  + W++  
Sbjct  398   YGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLRSASFDNWDDYE  457

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N E+LK+C++A +++ QYLP+Y ++E W  HFG +W IF +RK  +DP++ILSPGQ I
Sbjct  458   KENMEVLKFCEDANMRVIQYLPYYASQEGWVGHFGPRWNIFLERKYRYDPRMILSPGQNI  517

Query  222   F  220
             F
Sbjct  518   F  518



>ref|XP_004173096.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 3-like, 
partial [Cucumis sativus]
Length=508

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/415 (60%), Positives = 324/415 (78%), Gaps = 11/415 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN--GGRIRVS---WSESLGFYADVGGHELWVDV  1318
             ARG GHS RGQA AK+GVV++MS+L+RN    RI VS   W+    FY DVGG +LW++V
Sbjct  95    ARGQGHSVRGQAMAKNGVVIDMSALRRNRKTPRIVVSCRRWTTG-EFYVDVGGEQLWIEV  153

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L A+L +G+ PVSWTDYLY+TVGGT SNAGISGQSFRYGPQ++NV+EMDV+TGKG ++TC
Sbjct  154   LNATLGYGMTPVSWTDYLYITVGGTXSNAGISGQSFRYGPQVSNVVEMDVVTGKGNMMTC  213

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S   N ELF AVLGGLGQFG+I RARI L+ APTRVKWVRMLY +F  FT+DQEHLIS++
Sbjct  214   SPRKNCELFHAVLGGLGQFGIIARARIALEPAPTRVKWVRMLYTNFVAFTKDQEHLISLN  273

Query  957   -----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  + L+Y+EG +++     +NWRSSFF  S  S+I SL + + +IY LE+VKYYD  
Sbjct  274   GRKQVNALNYLEGLVLLHHGSPDNWRSSFFPLSDHSRIISLANQNSVIYCLEVVKYYDHH  333

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T +T+D++L+ + +GL +  G  FEKDV++ +FLNRVRSGE+KL+ KG+WDVPHPWLNLF
Sbjct  334   TQSTVDKDLEVLLEGLDYESGFKFEKDVTYVEFLNRVRSGELKLQSKGLWDVPHPWLNLF  393

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VP+SRI+DF+ GVF DII+R+N T GPIL+YP N+++WDDR S V+P+EE FY VG L+S
Sbjct  394   VPRSRIIDFDSGVFKDIIVRRNITKGPILIYPMNRSKWDDRNSTVIPDEEVFYTVGFLNS  453

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRK  268
             S  ++W++   QNEEIL+YC+++GI+IKQYLPHYKT+  W  H G KW  FQ  K
Sbjct  454   SGFDDWKKFEEQNEEILEYCEKSGIEIKQYLPHYKTQTQWIHHXGSKWTTFQHNK  508



>gb|KCW45277.1| hypothetical protein EUGRSUZ_L01060 [Eucalyptus grandis]
Length=415

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/416 (61%), Positives = 326/416 (78%), Gaps = 7/416 (2%)
 Frame = -3

Query  1443  AKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASLPHGLAPVSWTDYL  1264
             A DGVVV+M SL+       V WS SLG YADVGG +LW+DVL  +L HG+APVSWTDYL
Sbjct  2     APDGVVVDMMSLENKRRGTTVLWSWSLGHYADVGGQQLWIDVLEETLKHGVAPVSWTDYL  61

Query  1263  YLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINSELFFAVLGGLGQ  1084
             YLTVGGTLSNAGISG++FRYGPQI+NV EMDVITG G+ +TCS   N ELF++VLGGLGQ
Sbjct  62    YLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGDFLTCSPDKNPELFYSVLGGLGQ  121

Query  1083  FGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----IDDGLDYVEGSLIMT  919
             FG+ITRARI L +AP RVKWVRMLY DF+ FT DQE LIS      D+ LDYVEGSL+M 
Sbjct  122   FGIITRARIALGQAPKRVKWVRMLYSDFSDFTIDQESLISHHGRDQDEALDYVEGSLLMH  181

Query  918   QSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQEMFKGLSF  739
             ++ +++W +SFFS S + ++ SL++ H ++Y +E+ K+YD  T TT+D+ L+ + K LS 
Sbjct  182   RN-SDSW-TSFFSLSDRQRLMSLVTEHELLYCIEVAKFYDGRTQTTVDKALEIILKDLSH  239

Query  738   IGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFNVGVFVDII  559
             +   +FEKDV++ DFLNRVR  E+KLR++G+W+VPHPWLNLFVPKSRI DFN GVF +I+
Sbjct  240   VPEFMFEKDVAYVDFLNRVRVEELKLRRQGLWNVPHPWLNLFVPKSRIADFNTGVFNNIV  299

Query  558   LRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELGNQNEEILK  379
             L++N T+G +L+YP N  +WDDRMSAV+P+E+ FY VG LHSS   +W+E   QN+E+L 
Sbjct  300   LKKNITTGLVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLHSSGFEDWQEFDLQNKEVLL  359

Query  378   YCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRIFSQS  211
             +C+  GIK+KQYLP+Y TE +W +HFG KW+ FQ+ KA FDPK++LSPGQRIF+ +
Sbjct  360   FCENNGIKVKQYLPNYNTEREWMEHFGSKWRTFQESKAQFDPKMLLSPGQRIFNHN  415



>ref|XP_008242393.1| PREDICTED: cytokinin dehydrogenase 4-like [Prunus mume]
Length=520

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 325/427 (76%), Gaps = 9/427 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQ  A DGVV+ M++L  NG RI VS S SLG YADVGG +LW+DVL A+L
Sbjct  95    ARGQGHSVRGQDLAHDGVVINMTALS-NGSRIVVSESPSLGSYADVGGEQLWIDVLHATL  153

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL PVSWTDYLYL+VGGTLSNAGISGQ+FR+GPQI+NV E+DV+TGKG+ ITCS    
Sbjct  154   YHGLTPVSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVYELDVVTGKGDFITCSSTKK  213

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-----  958
              +LF+AVLGGLGQFG+ITRARI L  AP R KW+R+LY +F+ F+ DQE LIS       
Sbjct  214   PKLFYAVLGGLGQFGIITRARIALQPAPNRAKWLRLLYSNFSAFSSDQELLISTSGKMER  273

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             DG DYVEG L+M Q P +    SF+  + Q +IASL++ +G++Y++E+VKYYDD T  T+
Sbjct  274   DGFDYVEGLLLMQQGPLD---LSFYPVADQPRIASLVNKYGVVYTIEVVKYYDDSTRDTV  330

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+ ++ + K LSF+ G +FE+DVS+ +FL+RVR+ E  L+  G+WD+ HPW+NLFVPKSR
Sbjct  331   DKVVENLTKRLSFVPGFMFEQDVSYEEFLDRVRNEEKMLKSLGLWDIAHPWMNLFVPKSR  390

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF DI+L+Q   +   L+YP N+ +WD RMSAV+P+E+ FY VGLLHSS  NE
Sbjct  391   ISDFNSGVFKDILLKQKVPAALTLIYPMNRNKWDGRMSAVIPDEDVFYVVGLLHSSGFNE  450

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+     N+++L++C++AGI +KQYLPHY+T+EDW+ HFG  WQ FQ+ K   DP  IL+
Sbjct  451   WQAFDEVNKQLLQFCEDAGIMVKQYLPHYETQEDWKNHFGSNWQSFQEMKTKSDPNKILA  510

Query  237   PGQRIFS  217
             PGQRIF+
Sbjct  511   PGQRIFN  517



>ref|XP_009361720.1| PREDICTED: cytokinin dehydrogenase 4-like [Pyrus x bretschneideri]
Length=513

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 318/422 (75%), Gaps = 4/422 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA    GVV+ M++L RNG RI VS S SLG YADVGG + W+DVLRA+L
Sbjct  94    ARGQGHSVRGQALTSGGVVINMTALIRNGSRIVVSESPSLGSYADVGGEQRWIDVLRATL  153

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYL+VGGTLSNAGISGQ+F YGPQI NV E+DV+TGKGEL+TCS    
Sbjct  154   ERGLTPVSWTDYLYLSVGGTLSNAGISGQTFLYGPQINNVYELDVVTGKGELVTCSSKKV  213

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELF+AVLGGLGQFGVITRARI L  AP R KWVRM+Y +F+ F+RDQEHL++  +G DY
Sbjct  214   PELFYAVLGGLGQFGVITRARIPLAPAPKRAKWVRMMYSNFSAFSRDQEHLMA-PNGFDY  272

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EG L+M Q P +    SF+    Q +IA+LI+ +GIIY +E  KYYDD T  T+D+ + 
Sbjct  273   LEGFLLMKQGPVD---LSFYPLLDQPRIAALINQYGIIYYIEAAKYYDDSTRKTVDKVVD  329

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             +  KGLSF+   +FE+DVS+ DFL+RV + E  LR  G+W++ HPWLN+FVPKSRI D +
Sbjct  330   KTIKGLSFVPEFLFEQDVSYIDFLDRVHTEEENLRSLGLWEIAHPWLNIFVPKSRISDID  389

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF +I+L+QN  +   L+YP N+ +WD RMSAV+P+E+ FY VGLLH+S  N+W+   
Sbjct  390   SGVFRNILLKQNVPTAVSLIYPVNRKKWDGRMSAVIPDEDVFYVVGLLHASGFNDWQAFD  449

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
               N ++L++C +A I++KQYLPHY+T EDW+ HFG+KWQ FQ  K  FDP  IL+PGQRI
Sbjct  450   EVNRQLLQFCKDADIRVKQYLPHYETREDWKNHFGRKWQSFQDMKVRFDPNKILAPGQRI  509

Query  222   FS  217
             FS
Sbjct  510   FS  511



>ref|XP_006280310.1| hypothetical protein CARUB_v10026233mg [Capsella rubella]
 gb|EOA13208.1| hypothetical protein CARUB_v10026233mg [Capsella rubella]
Length=517

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/422 (59%), Positives = 326/422 (77%), Gaps = 4/422 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSL-KRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS RGQA+A+DGVVV M S+  R+ G I+VS +   G YADV    LW++VL  +
Sbjct  98    ARGHGHSHRGQASARDGVVVNMRSMVNRDRGSIKVSRT---GLYADVDAGCLWIEVLNKT  154

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L  GL PVSWTDYLYLTVGGTLSN G SGQ+FRYGPQI NV E+DVITGKGE+ TCSK +
Sbjct  155   LELGLTPVSWTDYLYLTVGGTLSNGGFSGQTFRYGPQITNVQELDVITGKGEIATCSKDM  214

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLD  946
             NS+LFFA LGGLGQFG+ITRARI LD AP R KW R LY DF++FTRDQE LIS  DG+D
Sbjct  215   NSDLFFAALGGLGQFGIITRARIKLDVAPKRAKWFRFLYIDFSEFTRDQERLISETDGVD  274

Query  945   YVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             ++EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD+ +  T++EE+
Sbjct  275   FLEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMVKRHRVIYCLEVVKYYDETSQYTVNEEM  334

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
             +E+ + L+++ G ++EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F
Sbjct  335   EELSESLNYVKGFMYEKDVTYIDFLNRVRTGELSLKSKGQWDVPHPWLNLFVPKSQISKF  394

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEEL  406
             + GVF  I+LR N TSGP+LVYP N+ +WDDRMSA +PEE+ FY VG L S+  + WE  
Sbjct  395   DHGVFKGIVLRNNITSGPVLVYPMNRNKWDDRMSAAIPEEDVFYAVGFLRSADFDNWEAY  454

Query  405   GNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQR  226
               +N EILK+C++A +K  QYLP++ ++E W +HFG +W +F +RK  +DPK+ILSPGQ 
Sbjct  455   DRENMEILKFCEDANMKAIQYLPYHSSQEGWVRHFGPRWNVFVERKDKYDPKMILSPGQN  514

Query  225   IF  220
             IF
Sbjct  515   IF  516



>ref|XP_010026880.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=520

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/438 (58%), Positives = 331/438 (76%), Gaps = 12/438 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G +  VSWS+SLG YADVGG +LW+DVL  +L
Sbjct  89    ARGCGHSVRGQAMARDGVVVDMTSL---GNKTTVSWSQSLGHYADVGGQQLWIDVLEETL  145

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+APVSWTDYLYLTVGGTLSNAGISG +FRYGPQI+NV EMDVITG G  +TCS H N
Sbjct  146   KHGVAPVSWTDYLYLTVGGTLSNAGISGGTFRYGPQISNVYEMDVITGTGHFLTCSPHEN  205

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              ELF +VLGGLGQFG+ITRARI L  AP R KWV+MLY DF+ FT DQE LIS      D
Sbjct  206   PELFHSVLGGLGQFGIITRARIALGPAPKRAKWVKMLYSDFSAFTTDQERLISRHRRDQD  265

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEG L M ++ +++W  SFFS     ++ SL++ H ++Y +E+ K+YD+ T + +
Sbjct  266   EVLDYVEGQLFMRRN-SDSW-ISFFSSLDHPRLMSLVTEHELLYCIEVAKFYDECTQSAV  323

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+++ K LS     +++KDV + DFLNRVR GE+ LR++G+W+VPHPWLNLFVPKSR
Sbjct  324   DKDLEKILKDLSHGPEFLYQKDVGYVDFLNRVRVGEMVLREQGLWNVPHPWLNLFVPKSR  383

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+L++N T+  +L+YP N  +WDDRMSAV+P+E+ FY VG LHSS   +
Sbjct  384   IADFNTGVFKNIVLKKNMTTELVLIYPMNNDKWDDRMSAVIPDEDVFYAVGFLHSSGFED  443

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C++ G  IKQYLP+Y TE DW +HFG KW+ F++ KA FDPK++LS
Sbjct  444   WQEFDLQNKEVLHFCEDNG--IKQYLPNYSTESDWIQHFGPKWRKFEENKAQFDPKMLLS  501

Query  237   PGQRIFSQSSSWVWSIDA  184
             PGQ IF+ +      ID 
Sbjct  502   PGQNIFNHNQGMNSKIDG  519



>ref|XP_002866175.1| hypothetical protein ARALYDRAFT_918856 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42434.1| hypothetical protein ARALYDRAFT_918856 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/421 (60%), Positives = 327/421 (78%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA+AKDGVVV M S+      I+VS +   G Y DV    LW++VL  +L
Sbjct  100   ARGHGHSHRGQASAKDGVVVNMRSMVNRDRGIKVSRT---GLYVDVDAAWLWIEVLNKTL  156

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+FRYGPQIANV+EMDVITGKGE+ TCSK IN
Sbjct  157   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQIANVLEMDVITGKGEIATCSKDIN  216

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LFFAVLGGLGQFG++TRARI L+ AP R KW+R LY DF++FTRDQE LIS  DG+D+
Sbjct  217   SDLFFAVLGGLGQFGILTRARIKLEVAPKRAKWLRFLYIDFSEFTRDQERLISKTDGVDF  276

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +IAS++  H +IY LE+VKYYD+ +  T++EE++
Sbjct  277   LEGSVMVDHGPPDNWRSTYYPPSDHLRIASMVKRHRVIYCLEVVKYYDETSQYTVNEEME  336

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+ + L+++ G ++EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F+
Sbjct  337   ELSESLNYVRGFMYEKDVTYMDFLNRVRTGELNLKSKGQWDVPHPWLNLFVPKSQISKFD  396

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N T+GP+LVYP N+ +W+DRMSA +PEE+ FY VG L S+  + WE   
Sbjct  397   DGVFKGIILRNNITTGPVLVYPMNRNKWNDRMSAAIPEEDVFYAVGFLRSAGFDNWEAYD  456

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N EILK+C++  + + QYLP++ ++E W +HFG +W IF +RK  +DPK+ILSPGQ I
Sbjct  457   QENMEILKFCEDGNMGVIQYLPYHSSQEGWVRHFGPRWDIFVKRKYKYDPKMILSPGQNI  516

Query  222   F  220
             F
Sbjct  517   F  517



>ref|XP_007203856.1| hypothetical protein PRUPE_ppa021859mg [Prunus persica]
 gb|EMJ05055.1| hypothetical protein PRUPE_ppa021859mg [Prunus persica]
Length=480

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/427 (59%), Positives = 323/427 (76%), Gaps = 9/427 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQ  A DGVV+ M++L  NG RI VS S SLG YADVGG +LW+DVL A+L
Sbjct  55    ARGQGHSVRGQDLAPDGVVINMTALS-NGSRIVVSESPSLGSYADVGGEQLWIDVLHATL  113

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL PVSWTDYLYL+VGGTLSNAGISGQ+FR+GPQI+NV E+DV+TGKG+ ITCS    
Sbjct  114   DHGLTPVSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVYELDVVTGKGDFITCSSTKK  173

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-----  958
              +LF+AVLGGLGQFG+ITRARI L  AP R KWVR+LY +F+ F+ DQE LIS       
Sbjct  174   PKLFYAVLGGLGQFGIITRARIALQPAPNRAKWVRLLYSNFSAFSSDQELLISTSGKMER  233

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             DG DYVEG L+M Q P +    SF+  + Q +IASL++ +GI+Y++E++KYYDD T  T+
Sbjct  234   DGFDYVEGLLLMQQGPLD---LSFYPVADQPRIASLVNQYGIVYTIEVIKYYDDSTRDTV  290

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+ ++++ K LSF+ G +FE+DVS+ +FL+RVR  E  L+  G+WD+ HPW+NLFVPKSR
Sbjct  291   DKVVEKLTKRLSFVPGFMFEQDVSYEEFLDRVRIEEKILQSLGLWDIAHPWMNLFVPKSR  350

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DF+ GVF DI+L+Q   +  IL+YP N+ +WD RMSAV+P+E+ FY VGLLHSS  NE
Sbjct  351   ISDFDSGVFKDILLKQKVPAALILIYPMNRNKWDGRMSAVIPDEDVFYVVGLLHSSGFNE  410

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W      N ++L++C +AGI +KQYLPHY+T+EDW+ HFG  WQ FQ+ K   DP  IL+
Sbjct  411   WPAFDEVNTQLLQFCHDAGIMVKQYLPHYQTQEDWKNHFGSNWQSFQEMKTKSDPNKILA  470

Query  237   PGQRIFS  217
             PGQRIF+
Sbjct  471   PGQRIFN  477



>gb|KCW60470.1| hypothetical protein EUGRSUZ_H03197, partial [Eucalyptus grandis]
Length=487

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/438 (58%), Positives = 331/438 (76%), Gaps = 12/438 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G +  VSWS+SLG YADVGG +LW+DVL  +L
Sbjct  56    ARGCGHSVRGQAMARDGVVVDMTSL---GNKTTVSWSQSLGHYADVGGQQLWIDVLEETL  112

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+APVSWTDYLYLTVGGTLSNAGISG +FRYGPQI+NV EMDVITG G  +TCS H N
Sbjct  113   KHGVAPVSWTDYLYLTVGGTLSNAGISGGTFRYGPQISNVYEMDVITGTGHFLTCSPHEN  172

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              ELF +VLGGLGQFG+ITRARI L  AP R KWV+MLY DF+ FT DQE LIS      D
Sbjct  173   PELFHSVLGGLGQFGIITRARIALGPAPKRAKWVKMLYSDFSAFTTDQERLISRHRRDQD  232

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEG L M ++ +++W  SFFS     ++ SL++ H ++Y +E+ K+YD+ T + +
Sbjct  233   EVLDYVEGQLFMRRN-SDSW-ISFFSSLDHPRLMSLVTEHELLYCIEVAKFYDECTQSAV  290

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+++ K LS     +++KDV + DFLNRVR GE+ LR++G+W+VPHPWLNLFVPKSR
Sbjct  291   DKDLEKILKDLSHGPEFLYQKDVGYVDFLNRVRVGEMVLREQGLWNVPHPWLNLFVPKSR  350

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+L++N T+  +L+YP N  +WDDRMSAV+P+E+ FY VG LHSS   +
Sbjct  351   IADFNTGVFKNIVLKKNMTTELVLIYPMNNDKWDDRMSAVIPDEDVFYAVGFLHSSGFED  410

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +C++ G  IKQYLP+Y TE DW +HFG KW+ F++ KA FDPK++LS
Sbjct  411   WQEFDLQNKEVLHFCEDNG--IKQYLPNYSTESDWIQHFGPKWRKFEENKAQFDPKMLLS  468

Query  237   PGQRIFSQSSSWVWSIDA  184
             PGQ IF+ +      ID 
Sbjct  469   PGQNIFNHNQGMNSKIDG  486



>ref|XP_009120209.1| PREDICTED: cytokinin dehydrogenase 3 isoform X1 [Brassica rapa]
Length=522

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/424 (58%), Positives = 323/424 (76%), Gaps = 6/424 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  101   ARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLWIEVLNKTL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+FRYGPQI+NV+EMDVITGKGE+ TCSK +N
Sbjct  158   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEIATCSKDMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LF+A LGGLGQFG+ITRARI L+ AP + KW+R LY DF++FTRDQE LIS  +G  +
Sbjct  218   SDLFYAALGGLGQFGIITRARIKLELAPKKAKWLRFLYTDFSEFTRDQERLISETNGPHF  277

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD+ +  +++E +Q
Sbjct  278   LEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQHSVNETMQ  337

Query  762   EMFK---GLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             EM +    L++  G V+EKDV++ DFLNRVR+GE+KL+ KG WDVPHPWLNLFVPKS+I 
Sbjct  338   EMEELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGKWDVPHPWLNLFVPKSQIS  397

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWE  412
              F  GVF  IILR N T+GP+LVYP N+ +W+DRMS V+PEE+ FY VG L S+  + W+
Sbjct  398   RFEYGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLRSASFDNWD  457

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             +   +N E+LK+C++A +++ QYLP+Y ++E W  HFG +W IF +RK  +DP++ILSPG
Sbjct  458   DYEKENMEVLKFCEDANMRVIQYLPYYASQEGWVGHFGPRWNIFLERKYRYDPRMILSPG  517

Query  231   QRIF  220
             Q IF
Sbjct  518   QNIF  521



>ref|XP_008797779.1| PREDICTED: cytokinin dehydrogenase 6-like [Phoenix dactylifera]
Length=543

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/433 (58%), Positives = 328/433 (76%), Gaps = 12/433 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNGG-------RIRVSWSESLGFYADVGGHELWVD  1321
             RGHGHS RGQA A  GVV+EM+S++R GG       RIRVS + S+  Y D GG + W+D
Sbjct  103   RGHGHSVRGQALAPHGVVIEMTSMRRGGGGDGDGEPRIRVSPAGSVSGYVDAGGEQFWID  162

Query  1320  VLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELIT  1141
             VLR +L +GLAP+SWTDYLYLTVGGTLSNAG+SGQ+F +GPQI+NV E+DVITGKGE++T
Sbjct  163   VLRETLKYGLAPMSWTDYLYLTVGGTLSNAGVSGQAFLHGPQISNVYELDVITGKGEMVT  222

Query  1140  CSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI  961
             CS+    +LFFAVLGGLGQFG+ITRARI L+ AP  V+WVR++Y +F  F RDQE LIS+
Sbjct  223   CSEDHEPDLFFAVLGGLGQFGIITRARIALEPAPQMVRWVRLIYTNFEAFARDQEKLISL  282

Query  960   DD---GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
             DD   G +YVEGS++M     NNWRSSFFS     +I+SL + +G +Y LE  +YYD   
Sbjct  283   DDGNKGFNYVEGSILMDHHVGNNWRSSFFSERDLERISSLAAQYGAVYCLEGARYYDKAM  342

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
                +D+EL+ + +GLSF+ G  F  DV++  FLNRVR GE+KLR +G+W+VPHPWLN+FV
Sbjct  343   VHMVDQELEWLLEGLSFMPGFAFTNDVTYIRFLNRVRDGELKLRSQGLWNVPHPWLNIFV  402

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             P+SRI+DF+ GVF   ILR + ++GPIL+YP ++ +WD RMSAV+P+EE FY +GLL S 
Sbjct  403   PRSRIIDFDRGVFKS-ILRHDNSTGPILIYPMDRNKWDRRMSAVIPDEEIFYSIGLLRSG  461

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
              V+ WE L NQN+EIL +C++AGI  KQYLPHY T+ DW +HFG KW+   +RK  +DPK
Sbjct  462   -VHAWERLENQNKEILHFCNQAGISHKQYLPHYTTQADWMEHFGSKWETIVERKRRYDPK  520

Query  249   LILSPGQRIFSQS  211
              +LSPGQ+IF+ S
Sbjct  521   SLLSPGQQIFTSS  533



>ref|XP_006401261.1| hypothetical protein EUTSA_v10013271mg [Eutrema salsugineum]
 gb|ESQ42714.1| hypothetical protein EUTSA_v10013271mg [Eutrema salsugineum]
Length=517

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/421 (59%), Positives = 326/421 (77%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AK+GVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  99    ARGHGHSLRGQAAAKNGVVVNMRSMVNGDRGIKVSRT---GLYADVDSAWLWIEVLNKTL  155

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+FRYGPQI+NV+EMDVITGKGE+ TCSK +N
Sbjct  156   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEIATCSKDMN  215

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S++FFA LGGLGQFG+ITRARI L+ AP RVKW+R LY DF++FT DQE LIS  DGLD+
Sbjct  216   SDIFFAALGGLGQFGIITRARIKLELAPKRVKWLRFLYTDFSEFTNDQERLISETDGLDF  275

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD+ +  T++EE++
Sbjct  276   LEGSVMLDHGPPDNWRSTYYPPSDHLKIVSMVKRHRVIYCLEVVKYYDETSQRTVNEEME  335

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+ + L ++ G ++E+DV++ DFLNRVR+GE+KL+ KG WD+PHPWLNLFVPKS+I  F+
Sbjct  336   ELSESLKYVRGFMYERDVTYIDFLNRVRTGELKLKSKGQWDLPHPWLNLFVPKSQISKFD  395

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  II R N T+GP+LVYP N+ +W+DRMS V+PEE+ FY VG L S+  N WE+  
Sbjct  396   DGVFKGIIPRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLRSADFNNWEDYE  455

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N E+LK+C++A + + QYLP+Y ++E W +HFG +W IF +RK  +DPK+ILSPGQ I
Sbjct  456   KENMEVLKFCEDAKMGVIQYLPYYSSQEGWVRHFGPRWNIFVERKYRYDPKMILSPGQNI  515

Query  222   F  220
             F
Sbjct  516   F  516



>ref|XP_004291832.1| PREDICTED: cytokinin dehydrogenase 5-like [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/440 (59%), Positives = 324/440 (74%), Gaps = 16/440 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWS--ESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA A++GVV+ MS   R GGR   +       G Y D  G ELW++VLRA
Sbjct  89    ARGHGHSINGQAQARNGVVIAMSGGNRAGGRRETAAGVVSEKGLYVDAWGGELWIEVLRA  148

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV+E+DV+TGKGEL+TCS+ 
Sbjct  149   TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVLELDVVTGKGELLTCSEE  208

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI----  961
              N+ELF AVLGGLGQFG+ITRARI L+ APTRV+W+R+LY +F+ FT+DQE+LIS+    
Sbjct  209   RNAELFHAVLGGLGQFGIITRARIALEPAPTRVRWIRVLYSNFSAFTKDQEYLISLHGQP  268

Query  960   -DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLIS--NHGIIYSLELVKYYDDET  790
                  DYVEG +I+ +   NNWRSSFFSPS+  +I+S+ S  N G++Y LE+ K YDD T
Sbjct  269   SSRKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSIDSNGNGGVLYCLEITKNYDDST  328

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             A +ID+E++ + K L F+   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFV
Sbjct  329   ADSIDQEIEALLKELDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFV  388

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             PKSRI DF+ GVF  I+   NKTSGP+L+YP NK +WD R S V P+E+ FY V LL S+
Sbjct  389   PKSRISDFDEGVFKGIL--GNKTSGPVLIYPMNKDKWDQRSSVVTPDEDVFYLVALLRSA  446

Query  429   -----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
                    +  E L NQN  I K+CDEAGIK+KQYLPHY T+++W  HFG KW +F QRK 
Sbjct  447   LDSGDETHTLEYLTNQNRRIFKFCDEAGIKVKQYLPHYTTQQEWMDHFGDKWPLFYQRKM  506

Query  264   LFDPKLILSPGQRIFSQSSS  205
              FDP+ IL+ GQRIF+  SS
Sbjct  507   EFDPRRILATGQRIFTGPSS  526



>ref|XP_011077993.1| PREDICTED: cytokinin dehydrogenase 4-like [Sesamum indicum]
Length=499

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/425 (63%), Positives = 324/425 (76%), Gaps = 11/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A  GVVVEM++L RNGG IRVSWS SLG+YADVGG E+W DVLR  L
Sbjct  83    ARGRGHSVRGQAMAGGGVVVEMAALSRNGGGIRVSWSRSLGYYADVGGEEMWADVLRVGL  142

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAPVSWTDYLYLTVGGTLSNAGISGQSFR+GPQI+NV+E+DV+TGKGELITCS+++N
Sbjct  143   EHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRHGPQISNVLELDVVTGKGELITCSRNMN  202

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             SELFF  LGGLGQFG+ITRARIVLDKAP R +W R++Y +F++FTRDQE LI + +  +Y
Sbjct  203   SELFFGALGGLGQFGIITRARIVLDKAPARARWARLIYSNFSEFTRDQERLI-LTNASNY  261

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             VEG LI  +     WRSSF SPSHQS +ASL   H ++YS+ELVKYYD+ TA+TID+E  
Sbjct  262   VEGFLITNERTTKQWRSSFSSPSHQSDVASLWKKHRLLYSIELVKYYDNLTASTIDKEFG  321

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNR---VRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
              + + L+FI G +F +DV   DFLNR   +  G  +L         HPWLNLF+PKSRI 
Sbjct  322   VILEELNFIPGFIFRRDVPLVDFLNRAGNLDDGREELEA-------HPWLNLFIPKSRIH  374

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWE  412
             DF  GV  ++I +  KT G  + YP N  +WD RMSAV P+E+ FY +GLLHS R NE +
Sbjct  375   DFYDGVLENMIPKLRKTPGLFIFYPLNTKKWDSRMSAVTPDEDVFYNLGLLHSGRPNESD  434

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
                  N ++L +C++AGIK+KQYLP++K+ EDW KHFG KW IFQQRK  FDPK+ILSPG
Sbjct  435   VFELFNNQVLGFCEKAGIKVKQYLPYHKSREDWIKHFGSKWSIFQQRKMEFDPKMILSPG  494

Query  231   QRIFS  217
             QRIF+
Sbjct  495   QRIFN  499



>gb|KFK42198.1| hypothetical protein AALP_AA2G224300 [Arabis alpina]
Length=519

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 323/423 (76%), Gaps = 3/423 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AK GVVV M S+      I+VS +   G YADV G  LW++VL  +L
Sbjct  100   ARGHGHSLRGQAAAKGGVVVNMRSMVNRDRGIKVSRT---GLYADVEGGCLWIEVLNKTL  156

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+F YGPQI+NV+EMDVITGKGE+ TCSK +N
Sbjct  157   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTFLYGPQISNVLEMDVITGKGEIATCSKDVN  216

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+L+FAVLGGLGQFG+I RARI L  AP R KW+R LY DF++FTRDQE LIS  DGLD+
Sbjct  217   SDLYFAVLGGLGQFGIIARARINLGLAPKRAKWLRFLYIDFSEFTRDQERLISESDGLDF  276

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD  +  T++EE++
Sbjct  277   LEGSVMVDHGPPDNWRSTYYPPSDHLRIVSMVKRHRVIYCLEVVKYYDQTSQYTVNEEVE  336

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+ + L+++ G ++EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS I +F+
Sbjct  337   ELSESLNYVRGFMYEKDVTYMDFLNRVRTGELNLKSKGQWDVPHPWLNLFVPKSHISNFD  396

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF DIILR N TSGP+LVYP N+ +W+DRMS  +P+E+ FY VG L S+  + WE   
Sbjct  397   YGVFKDIILRNNITSGPVLVYPMNRNKWNDRMSTSIPKEDVFYAVGFLRSANFDNWENYE  456

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N EILK+C++A + + QYLP+Y ++E W +HFG +W IF +RK  +DP +ILSPGQ I
Sbjct  457   KENMEILKFCEDAKMGVIQYLPYYSSQEGWVRHFGPRWNIFVERKYRYDPNMILSPGQNI  516

Query  222   FSQ  214
             F Q
Sbjct  517   FQQ  519



>ref|XP_009393975.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=534

 Score =   526 bits (1355),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 246/426 (58%), Positives = 318/426 (75%), Gaps = 5/426 (1%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNG-GRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             RG GHS RGQA A+DGVVV+M +L+ +G GRIRV        Y D GG +LW+DVLR ++
Sbjct  104   RGRGHSVRGQALARDGVVVDMGALRGDGQGRIRVCGEGCRPSYVDAGGEQLWIDVLRETM  163

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAP SWTDYLYLTVGGTLSNAGISGQ+F YGPQI+NV E+DVITGKGE +TCS+   
Sbjct  164   KHGLAPRSWTDYLYLTVGGTLSNAGISGQTFLYGPQISNVYELDVITGKGETVTCSEQHE  223

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID--DGL  949
             ++LFFAVLGGL QFG+ITRARI ++ APT V+WVR++Y DF  FT DQE LIS++   G 
Sbjct  224   ADLFFAVLGGLAQFGIITRARIAIEPAPTMVRWVRLIYKDFAAFTSDQERLISLEKKKGF  283

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             +YVEGS+IM  S  +NWRSSF+     ++I+ L + +G +Y LE  KYYD  TA++ID+E
Sbjct  284   NYVEGSVIMADSLTDNWRSSFYVEEDITRISRLAAQYGAVYCLEGAKYYDHATASSIDQE  343

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             L+ +   L ++ G  F  DVS+  FLNRVR GE KL+ +G+W+VPHPWLN+ +P+SRIL+
Sbjct  344   LRSVVDDLRYLPGFEFRNDVSYMHFLNRVREGETKLQSRGLWNVPHPWLNMLIPRSRILE  403

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             F+ GVF   IL+ N + GPIL+   N+ +WD R SAVVP+EE FY +GLL S  ++ W+ 
Sbjct  404   FDRGVFKS-ILKHNNSVGPILICAMNRNKWDQRTSAVVPDEEVFYAIGLLRSG-MDGWKN  461

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L  QNEEIL++CD+AGI  +QYLPHY +  DW KHFG KW +F +RK  +DP+ +LSPGQ
Sbjct  462   LEEQNEEILRFCDDAGISYRQYLPHYTSLADWRKHFGAKWDVFVERKMRYDPRALLSPGQ  521

Query  228   RIFSQS  211
             RIF+ S
Sbjct  522   RIFTSS  527



>ref|XP_010026879.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=507

 Score =   525 bits (1351),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 244/429 (57%), Positives = 323/429 (75%), Gaps = 7/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G    VS+S+SLG YADVGGHE+W +VL  +L
Sbjct  81    ARGRGHSVRGQAMARDGVVVDMTSLGNKGHETTVSYSQSLGHYADVGGHEIWFNVLEHTL  140

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAPV+ TDY Y TVGGTLSNAGI G++FR GPQI NV EMDVITG G+ +TCS H N
Sbjct  141   KHGLAPVTLTDYQYATVGGTLSNAGIGGEAFRNGPQITNVHEMDVITGTGDFLTCSPHKN  200

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              +LF++VLGGLGQFG+ITRARI L  AP R KWVR+LY DF+ FT DQE LIS      D
Sbjct  201   PDLFYSVLGGLGQFGIITRARIALRPAPKRAKWVRLLYSDFSAFTTDQERLISRHQRDQD  260

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LD+VEG L+M ++  + W  SFF  S + ++ SL++ H ++Y ++  KYYD++T +T+
Sbjct  261   EALDFVEGCLLMHRN-MDTW-VSFFPLSDRPRVMSLLTEHKLLYCIKAAKYYDEQTESTV  318

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             +++L+ + K L+ +    FEKDV+F DFLNR+R  E++LR++G+W++PHPWL+LFVPKSR
Sbjct  319   EKDLEIILKDLNHVPEFKFEKDVAFIDFLNRIRVAELRLREQGLWNIPHPWLDLFVPKSR  378

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             + D N G+F DI L+ N T+G +L+YP NK +WDDRMSAV P+E+ FY V  LH+S   +
Sbjct  379   MADINTGIFKDIALKNNITTGCVLIYPMNKNKWDDRMSAVTPDEDIFYTVEFLHTSGFGD  438

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +  + GIK K+YLP+Y+TE +W +HFG KW+ FQ  KA FDPKL+LS
Sbjct  439   WQECELQNKEMLSFLKDNGIKFKRYLPNYRTEREWMEHFGPKWRTFQGSKAKFDPKLLLS  498

Query  237   PGQRIFSQS  211
             PGQRIF+ S
Sbjct  499   PGQRIFNHS  507



>ref|XP_010090054.1| Cytokinin dehydrogenase 4 [Morus notabilis]
 gb|EXB38851.1| Cytokinin dehydrogenase 4 [Morus notabilis]
Length=527

 Score =   525 bits (1351),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 250/432 (58%), Positives = 325/432 (75%), Gaps = 14/432 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNG------GRIRVSWSESLGFYADVGGHELWVDV  1318
             RG GHS RGQA A+ G+VV M+SL R+G      G   V  +  LG Y DVGG ++W+DV
Sbjct  97    RGQGHSVRGQAMARRGIVVNMTSLARHGNNNYNIGIKVVKENFHLGPYVDVGGEQIWIDV  156

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             LR +L H L+PVSWTDYLY+TVGGTLSNAGISGQ+FR+GPQI++V EMDVITGKG+L+TC
Sbjct  157   LRDTLKHSLSPVSWTDYLYITVGGTLSNAGISGQTFRFGPQISSVHEMDVITGKGDLVTC  216

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S++  SELF+AVLGGLGQFG+ITRARI L  APTRVKWVR+ Y+DF  F +DQE LIS +
Sbjct  217   SRNNASELFYAVLGGLGQFGIITRARIALAPAPTRVKWVRLFYNDFLAFKKDQEKLISKN  276

Query  957   -----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  +G+DY+EG L+M Q P +    SF+  + Q +I SL++  GI+YS+EL KYYDD 
Sbjct  277   GRKEKNGVDYLEGFLLMRQGPLD---LSFYPTADQLRITSLVTQSGIVYSIELAKYYDDS  333

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T  ++D++LQ +   LSF+ G  F KDV++ DFLNRV+S E KLR+   W++PHPWLNLF
Sbjct  334   TQNSVDKDLQILLDQLSFVPGFGFVKDVTYEDFLNRVQSEEEKLRELQRWEIPHPWLNLF  393

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VP+S++ DFN GVF  I+L Q+   G  ++YP N+ +WD +MSAV+PEE+ FY +GLLHS
Sbjct  394   VPESQVSDFNSGVFKGILLNQSVPMGVFIIYPMNRNKWDVKMSAVIPEEDVFYTIGLLHS  453

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             S  +EWE +   N++IL++C +AGI+ KQYLPHY+ ++DW  HFG KW+ FQQ K  FDP
Sbjct  454   SSYSEWEAIDEVNKQILQFCHDAGIQAKQYLPHYEAQQDWMDHFGAKWKHFQQMKTQFDP  513

Query  252   KLILSPGQRIFS  217
             K ILSPGQ+IFS
Sbjct  514   KKILSPGQKIFS  525



>ref|XP_010912967.1| PREDICTED: cytokinin dehydrogenase 6 [Elaeis guineensis]
Length=536

 Score =   524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 248/428 (58%), Positives = 322/428 (75%), Gaps = 8/428 (2%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNG--GRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             RGHGHS RGQA A  GVV+EM+S++  G  G  R+S S   G Y D GG + W+DVL+ +
Sbjct  103   RGHGHSLRGQALAPHGVVIEMTSMRNGGCDGEPRLSVSPE-GSYVDAGGEQFWIDVLQET  161

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYLTVGGTLSNAG+SGQ+F +GPQI++V E+DVITGKGE++TCS+  
Sbjct  162   LKYGLAPRSWTDYLYLTVGGTLSNAGVSGQAFLHGPQISSVYELDVITGKGEMVTCSEDQ  221

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD---  955
               +LFFAVLGGLGQFG+ITRARI L+ AP  V+WVR++Y +F  F RDQE LIS+DD   
Sbjct  222   EPDLFFAVLGGLGQFGIITRARIALEPAPQMVRWVRLIYMNFEAFARDQEKLISLDDGKK  281

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
             G +YVEGS++M  +  NNWRSSFF      +I+SL + HG +Y LE  +YYD      +D
Sbjct  282   GFNYVEGSILMHHNVGNNWRSSFFPERDLGRISSLAAQHGAVYCLEGARYYDKAMVHMVD  341

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +EL+ + + LSF+ G  F+ DV++  FLNRVR GE+KLR +G+W+VPHPWLN+FVP+SRI
Sbjct  342   KELESLLEALSFMPGFAFKNDVTYTRFLNRVRDGELKLRSQGLWNVPHPWLNIFVPRSRI  401

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
             +DF+ G+F   ILR + + GPIL+YP N+ +WD R SAV+P+EE FY +GLL S  V+ W
Sbjct  402   IDFDRGIFKS-ILRHDNSMGPILIYPMNRNKWDRRTSAVIPDEEIFYSIGLLWSG-VHAW  459

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             E L +QN+EIL +C++AGI  KQYLPHY T+ DW KHFG KW IF +RK  +DPK +LSP
Sbjct  460   EWLEDQNKEILHFCNQAGINHKQYLPHYTTQADWMKHFGSKWDIFVERKRRYDPKALLSP  519

Query  234   GQRIFSQS  211
             GQ+IF+ S
Sbjct  520   GQQIFTSS  527



>ref|XP_008451152.1| PREDICTED: cytokinin dehydrogenase 4 [Cucumis melo]
Length=516

 Score =   521 bits (1343),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 324/427 (76%), Gaps = 7/427 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSL---KRNGGRIRVSWSESLGFYADVGGHELWVDVLR  1312
             ARG GH  RGQA  ++G+VV M+SL   ++   RI VS +  LG YADVG  +LW+DVL 
Sbjct  92    ARGQGHCVRGQALVENGLVVNMTSLGGFRQKTSRIVVSTTSPLGPYADVGAEQLWIDVLH  151

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             A+   GL+PVSWTDYL++TVGGTLSNAGISGQ+FR+GPQI NV E+DVITG+GEL+TCS 
Sbjct  152   ATTQKGLSPVSWTDYLHITVGGTLSNAGISGQTFRFGPQINNVHELDVITGRGELLTCSP  211

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID--  958
               N ELF++VLGGLGQFG+ITRARI L   PTRVKWVRMLY +F  FT DQE LIS D  
Sbjct  212   TNNPELFYSVLGGLGQFGIITRARIALAPTPTRVKWVRMLYTNFASFTSDQETLISRDKS  271

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             +  DY+EG L+M Q  AN+  SSF+    Q +I+SL+S +GI+Y LE+VKYYD  T++++
Sbjct  272   NAPDYLEG-LLMLQFNAND-DSSFYPLPDQPKISSLVSQYGIVYVLEIVKYYDQTTSSSV  329

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+E++ +  GL F  G+ F KDVS+  FL+RV + EV LR  G+W+VPHPW+NLFVPKSR
Sbjct  330   DQEVENLVAGLKFEAGMKFIKDVSYEQFLDRVHTDEVALRALGLWEVPHPWINLFVPKSR  389

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DF+ GVF  II ++N TSG  L YP  K +WD+R SAVVP+E+ FY  G L SS   +
Sbjct  390   IADFDSGVFRGIIQKRNLTSGVFLFYPMFKNKWDERTSAVVPDEDVFYAAGFLFSSGFKD  449

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             WE +   N +ILK+C+EAGI++KQYLPH++T++DW  HFG+KW +F+QRKA+FDPK +LS
Sbjct  450   WETVDGHNRDILKFCEEAGIEVKQYLPHFETQKDWINHFGRKWSVFRQRKAMFDPKKLLS  509

Query  237   PGQRIFS  217
             PGQ+IF+
Sbjct  510   PGQKIFN  516



>emb|CDY62828.1| BnaCnng41060D [Brassica napus]
Length=518

 Score =   521 bits (1342),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 238/421 (57%), Positives = 316/421 (75%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  100   ARGHGHSFRGQAAAKDGVVVNMRSMVNEDRGIKVSRT---GLYADVDTAWLWIEVLNKTL  156

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLT+GGTLSN GISGQ+ RYGPQI+NV+E+DVITGKGE+ TCS   N
Sbjct  157   ELGLTPVSWTDYLYLTIGGTLSNGGISGQTSRYGPQISNVLELDVITGKGEIATCSNDTN  216

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LF+A LGGLGQFG+ITRARI L+ AP R KW+R LY DF++FTRDQE LIS  DGL +
Sbjct  217   SDLFYAALGGLGQFGIITRARIKLELAPKRAKWLRFLYTDFSEFTRDQERLISETDGLHF  276

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S+I  + +IY LE+ KYYD+ +  +++EE++
Sbjct  277   LEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMIKRYRVIYCLEVAKYYDETSQHSVNEEIE  336

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             ++ + L+++ G V+EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F+
Sbjct  337   KLSESLNYVRGFVYEKDVTYIDFLNRVRTGELNLKSKGQWDVPHPWLNLFVPKSQISRFD  396

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N T+GP+LVYP  +  W+D+MS  +PEE+ FY VG L S+  + WE   
Sbjct  397   YGVFKGIILRNNITTGPLLVYPMKRIMWNDQMSTAIPEEDVFYAVGFLRSAEFDNWEAYD  456

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N E+LK+C++A + + QYLP++ ++E W +HFG  W  F +RK  +DPK+ILSPGQ I
Sbjct  457   KENMEVLKFCEDAKMDVIQYLPYHASQEGWVRHFGPMWNTFVERKYRYDPKMILSPGQNI  516

Query  222   F  220
             F
Sbjct  517   F  517



>gb|AES65430.2| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=522

 Score =   520 bits (1338),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 247/431 (57%), Positives = 326/431 (76%), Gaps = 14/431 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSE---SLGFYADVGGHELWVDVL  1315
             RG  HS  GQA  ++G+VV M+ L   RNG  I VS  +    LG Y DVGG +LW+DVL
Sbjct  94    RGQAHSVLGQAMTQNGIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVL  153

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              A+L HGL P+SWTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV+E+DVITG+G ++TCS
Sbjct  154   NATLKHGLTPLSWTDYLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGQGNIVTCS  213

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-  958
             +  NSE+F+AVLGGLGQFGVITRARI+L  APTRVKW+R++Y+DF+ F+ DQEHLIS D 
Sbjct  214   QEKNSEVFYAVLGGLGQFGVITRARILLGPAPTRVKWLRLIYNDFSAFSTDQEHLISFDR  273

Query  957   ----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
                 +G DYVEG L++ + P      SF+ PS   +I SL++ +GI Y LELVKYYD  +
Sbjct  274   RNDSNGADYVEGMLLLNKPPL---ILSFYPPSDHPRITSLVTQYGITYVLELVKYYDTNS  330

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
                I EE+  + KGL F+   +F+KDV++ +FL+RV S E+ LR KG+WDVPHPWLN+F+
Sbjct  331   QANITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKGLWDVPHPWLNMFI  390

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             PKSRI DFN GVF  IIL+QN ++G +LVYP N+ +WDDRMSA+ P+E+ FY + LLH++
Sbjct  391   PKSRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPDEDVFYTLALLHAA  450

Query  429   R-VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             + ++E +    QN +IL++C++AGIK+K+YL   KT ++W +HFG KWQ F++RKA FDP
Sbjct  451   KEMDEVKTFQAQNHQILQFCNDAGIKVKEYLSGNKTHQEWVEHFGAKWQQFEERKAKFDP  510

Query  252   KLILSPGQRIF  220
             K ILSPGQ IF
Sbjct  511   KRILSPGQGIF  521



>gb|AHL64253.1| cytokinin dehydrogenase 5 [Rosa canina]
Length=541

 Score =   520 bits (1339),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 259/446 (58%), Positives = 325/446 (73%), Gaps = 22/446 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNG-GRIRVSWSESLG-------FYADVGGHELW  1327
             ARGHGHS  GQA A++GVVVEMS   R G G+     SE++G        Y D  G ELW
Sbjct  89    ARGHGHSINGQAQARNGVVVEMSGGNRVGSGKPAAGRSETVGRVVSEKGLYMDAWGGELW  148

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             ++VLRA+L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV+E+DV+TGKGEL
Sbjct  149   IEVLRATLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVLEVDVVTGKGEL  208

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
             +TCS+  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE+LI
Sbjct  209   LTCSEERNSELFHAVLGGLGQFGIITRARIALEPAPKRVRWIRVLYSNFSAFTKDQEYLI  268

Query  966   SI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLIS--NHGIIYSLELVK  808
             S+         DYVEG +I+ +   NNWRSSFFSPS+  +I+S+ S  N GI+Y LE+ K
Sbjct  269   SLHGQPSSQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSIDSNGNGGILYCLEITK  328

Query  807   YYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHP  628
              YDD TA TID+E++ + + L F+   VF  D+ + DFL+RV   E+KLR KG+WDVPHP
Sbjct  329   NYDDSTADTIDQEIEALLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHP  388

Query  627   WLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCV  448
             WLNLFVPKSRI DF+ GVF  I+   NKTSGP+L+YP N  +WD + S V P+E+ FY V
Sbjct  389   WLNLFVPKSRIADFDEGVFKGIL--GNKTSGPVLIYPMNNDKWDQQSSVVTPDEDVFYLV  446

Query  447   GLLHSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQI  283
              LL S+       +  E L +QN  I K+CDEAGIKIKQYLPHY T+++W  HFG KW  
Sbjct  447   ALLRSALDSGDETHTLEYLTDQNRRIFKFCDEAGIKIKQYLPHYTTQQEWMDHFGDKWPQ  506

Query  282   FQQRKALFDPKLILSPGQRIFSQSSS  205
             F QRK  FDP+ IL+ GQRIF+  SS
Sbjct  507   FYQRKMEFDPRRILATGQRIFAGPSS  532



>ref|XP_004288951.1| PREDICTED: cytokinin dehydrogenase 2-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   519 bits (1336),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 240/426 (56%), Positives = 317/426 (74%), Gaps = 11/426 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHSARGQA AKDG+V+ M++L   G RI VS S   G YADVGG +LW+DVLRA++
Sbjct  92    ARGQGHSARGQAMAKDGIVINMTTLNNMGSRIVVSQS---GEYADVGGEQLWIDVLRATV  148

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL+PVSWTDYLYL+VGGTLSNAGISGQ+FRYGPQI NV E+DV+TGKG++ITCS    
Sbjct  149   DQGLSPVSWTDYLYLSVGGTLSNAGISGQTFRYGPQITNVYELDVVTGKGDVITCSSKQT  208

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD----  955
             SELF++ LGGLGQ G+ITRARI L  AP R  W+R+ Y DF+ F++DQE LI+       
Sbjct  209   SELFYSALGGLGQVGIITRARIALQPAPNRAVWIRLFYSDFSAFSKDQELLIASKGKQGS  268

Query  954   -GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
              G DYVEG ++M Q P +    SF+S + Q +I +L+  +GI+Y++E+ KYYDD+ A TI
Sbjct  269   VGFDYVEGFVLMPQGPVD---LSFYSVADQPRITALLEQYGILYTIEIAKYYDDKAAKTI  325

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
              + ++ + K  S+I G +F++DVS+ DFLNRV + E  LR  G+W+V HPWLNLFVPKS 
Sbjct  326   AKVVEILLKQFSYIPGFIFQQDVSYIDFLNRVHTEEKFLRTLGLWEVAHPWLNLFVPKSG  385

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DF+ GVF  I+L+Q   +G ++VYP N+ +WDD+M+AV+PEE+ FY V LLHSS + E
Sbjct  386   IADFDSGVFKGILLKQKVPAGLVIVYPMNRNKWDDKMTAVIPEEDVFYVVALLHSSGLEE  445

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+     N +IL++C++ GI+IKQYLPHY+ ++DW  HFG KWQ FQ+ K  +DP  IL+
Sbjct  446   WQLFDEVNAQILQFCNDTGIEIKQYLPHYEKQQDWTDHFGSKWQTFQEMKVKYDPNKILA  505

Query  237   PGQRIF  220
             PGQR+F
Sbjct  506   PGQRVF  511



>ref|XP_010539134.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 3 [Tarenaya 
hassleriana]
Length=539

 Score =   519 bits (1337),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 248/427 (58%), Positives = 322/427 (75%), Gaps = 10/427 (2%)
 Frame = -3

Query  1464  SARGQ--ATAKDGVVVEMSSLKR-----NGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             +ARG   A A  GVVV M  L+R     +G  +R+S     G YADVGG  LW++VL A+
Sbjct  116   AARGXNLAAADGGVVVNMRPLRRELRRGDGFHLRIS---PEGSYADVGGEWLWIEVLNAT  172

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L  G +PVSWTDYLYLTVGGTLS+ GISGQSFR+GPQI+NV+EMDVITGKGE +TCSK  
Sbjct  173   LEFGWSPVSWTDYLYLTVGGTLSSGGISGQSFRHGPQISNVVEMDVITGKGETVTCSKDR  232

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLD  946
             NS+LF+AVLGGLGQFG+ITRARI L  AP RVKW+R LY+DF+KFTRDQE LIS  +G D
Sbjct  233   NSDLFYAVLGGLGQFGIITRARIHLRPAPKRVKWLRFLYNDFSKFTRDQESLISETNGPD  292

Query  945   YVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             ++EG L+      +NWRS++F PS  S+I S++  H +IY LE+VKYYD  +  TIDEE+
Sbjct  293   FLEGLLMTHHGSPDNWRSTYFPPSDHSRIISMVKRHRVIYCLEVVKYYDQTSQHTIDEEI  352

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
             +E+ +GL ++ G ++EKDV++ +FLNRVRSGE++LR +G WD PHPWLNLFVPKS I  F
Sbjct  353   EELTEGLKYVRGYMYEKDVTYTEFLNRVRSGELRLRSEGQWDNPHPWLNLFVPKSHISRF  412

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEEL  406
             ++ VF DI+LR N T+GP+LVYP N+ +W+D+MS VVPEE+ FY +G LHS+R ++    
Sbjct  413   DLRVFRDIVLRNNITTGPVLVYPMNRNKWNDKMSTVVPEEDIFYTIGFLHSARDDDLGAY  472

Query  405   GNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQR  226
               QN EIL+ C++ GIK  QYLPH+ + E W +HFG KW +F +RK  +DP++ILSPG  
Sbjct  473   EEQNMEILESCEDDGIKAIQYLPHHASSEGWSRHFGPKWSVFIERKNRYDPRMILSPGHN  532

Query  225   IFSQSSS  205
             IF ++SS
Sbjct  533   IFLRNSS  539



>ref|XP_009408848.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=533

 Score =   518 bits (1333),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 249/428 (58%), Positives = 315/428 (74%), Gaps = 5/428 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN-GGRIRVSWSES-LGFYADVGGHELWVDVLRA  1309
             ARGHGHS RGQA A  GVVV+M+SL      RI VS+  + L +Y D GG +LW+DVL  
Sbjct  102   ARGHGHSIRGQALAPGGVVVDMASLGHGRADRISVSFDNAPLVWYVDAGGEQLWIDVLHE  161

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYLTVGGTLSNAG+SGQ+FR+GPQI+NV E+DVITGKGE+ITCS  
Sbjct  162   TLKHGLAPRSWTDYLYLTVGGTLSNAGVSGQAFRHGPQISNVYELDVITGKGEMITCSHE  221

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-IDDG  952
               S+LF+ VLGGLGQFG+ITRARI L+ AP RV+WVR++Y  F  F+RDQE LIS +D G
Sbjct  222   NKSDLFYGVLGGLGQFGIITRARIALEPAPQRVRWVRLIYTHFVSFSRDQELLISMMDQG  281

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDD-ETATTID  775
              DYVEGSL+M  +   NWRSSFFS ++  +I  L +  G IY LE   YY +   A+ +D
Sbjct  282   FDYVEGSLLMDHTLITNWRSSFFSKTNSEKIRGLAAEFGAIYCLEGAVYYHELAMASRVD  341

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             ++L  + + LSF+ G  F  DVS+  FL+RV  GEVKLR  G+W+VPHPWLN+FVPKSRI
Sbjct  342   QKLHLLLQRLSFVPGFAFTNDVSYVGFLDRVHDGEVKLRSMGLWEVPHPWLNIFVPKSRI  401

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
              DF VGVF  I++  N T GP+L+YP  K +W D MSAV P+EE FY +GLL S+  ++W
Sbjct  402   QDFEVGVFKGILMPNNST-GPVLIYPMIKNKWHDEMSAVTPDEEVFYSIGLLRSAITDDW  460

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             ++L NQN++IL +C   GI+ KQYLPHY ++ DW+ HFG+KW  F + K  +DPK +LSP
Sbjct  461   QDLDNQNDDILGFCHREGIQFKQYLPHYASQRDWKNHFGRKWDTFVEMKRRYDPKALLSP  520

Query  234   GQRIFSQS  211
             GQRIF+ S
Sbjct  521   GQRIFTSS  528



>ref|XP_002280797.1| PREDICTED: cytokinin dehydrogenase 5 isoform X1 [Vitis vinifera]
Length=524

 Score =   516 bits (1330),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 256/442 (58%), Positives = 320/442 (72%), Gaps = 18/442 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA    GVV+EMS+ K  R  G  RVS       Y D  G ELW+DVL+ 
Sbjct  88    ARGHGHSINGQAQTSSGVVIEMSASKGVRQWGLPRVSEQSR---YVDAWGGELWIDVLKT  144

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL+TCS+ 
Sbjct  145   TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSEE  204

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI----  961
              NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE+LIS+    
Sbjct  205   QNSELFHAVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQP  264

Query  960   -DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
              +   DYVEG +I+ +   NNWRSSFFSP +  +I+S  +N G++Y LE+ K Y + TA 
Sbjct  265   PNQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTAD  324

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             TID++++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVP+
Sbjct  325   TIDQDVEALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPR  384

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS--  430
             SRI DF+ GVF  I+   NKTSGPIL+YP NK +WDDR S V PEE+ FY V LL S+  
Sbjct  385   SRIADFDEGVFKGIL--GNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSALD  442

Query  429   ---RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKAL  262
                     E L NQN +IL++CD+AGIK+KQYLPHY T+EDW  HFG  KW +F +RK  
Sbjct  443   SGDEAQSLEYLSNQNRQILRFCDDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKRKMD  502

Query  261   FDPKLILSPGQRIFSQSSSWVW  196
             FDP+ IL+ GQRIF   ++  W
Sbjct  503   FDPRRILATGQRIFKPMAASSW  524



>ref|XP_010026877.1| PREDICTED: cytokinin dehydrogenase 3-like [Eucalyptus grandis]
Length=507

 Score =   515 bits (1327),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 241/428 (56%), Positives = 319/428 (75%), Gaps = 7/428 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G    VS+S+SLG YADVGGH++W +VL  +L
Sbjct  81    ARGRGHSVRGQAMARDGVVVDMTSLGNKGHGTTVSYSQSLGHYADVGGHQIWFNVLEHTL  140

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAPV+ TDY Y TVGGTLSNAGI G++FR GPQI NV EMDVITG G+ +TCS H N
Sbjct  141   KHGLAPVTLTDYQYATVGGTLSNAGIGGEAFRNGPQITNVHEMDVITGTGDFLTCSPHKN  200

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              +LF++VLGGLGQFG+ITRARI L  AP R KWVRMLY DF+ FT D E LIS      D
Sbjct  201   PDLFYSVLGGLGQFGIITRARIALRPAPKRAKWVRMLYSDFSAFTTDHERLISRHQRDQD  260

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LD+VEG L+M ++  ++W SSF    H  ++ SL++ H ++Y ++  KYYD++T +T+
Sbjct  261   EALDFVEGCLLMHRN-MDSWISSFPLSDH-PRLMSLLTEHKLLYCIKAAKYYDEQTESTV  318

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             +++L+ + K L+ +    FEKDV+F DFLNR+R  E++LR++G+W++PHPWLNLFVPKS 
Sbjct  319   EKDLEIILKDLNHVPEFKFEKDVAFIDFLNRMRVAELQLREQGLWNIPHPWLNLFVPKSH  378

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             + D N G+F DI L+ N T+G +L+YP NK +WDDRMSAV P+E+ FY V   H+S   +
Sbjct  379   MADINTGIFKDIALKNNITTGYVLIYPMNKNKWDDRMSAVTPDEDIFYTVEFFHASGFGD  438

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+E   QN+E+L +    GIK K+YLP+Y+TE +W +HFG KW+ FQ+ KA FDPKL+LS
Sbjct  439   WQECELQNKEMLSFLKVNGIKFKRYLPNYRTEREWMEHFGPKWRTFQESKAKFDPKLLLS  498

Query  237   PGQRIFSQ  214
             PGQRIF+ 
Sbjct  499   PGQRIFNH  506



>emb|CBI19763.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   518 bits (1333),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 256/442 (58%), Positives = 320/442 (72%), Gaps = 18/442 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA    GVV+EMS+ K  R  G  RVS       Y D  G ELW+DVL+ 
Sbjct  143   ARGHGHSINGQAQTSSGVVIEMSASKGVRQWGLPRVSEQSR---YVDAWGGELWIDVLKT  199

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL+TCS+ 
Sbjct  200   TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSEE  259

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI----  961
              NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE+LIS+    
Sbjct  260   QNSELFHAVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQP  319

Query  960   -DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
              +   DYVEG +I+ +   NNWRSSFFSP +  +I+S  +N G++Y LE+ K Y + TA 
Sbjct  320   PNQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTAD  379

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             TID++++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVP+
Sbjct  380   TIDQDVEALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPR  439

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS--  430
             SRI DF+ GVF  I+   NKTSGPIL+YP NK +WDDR S V PEE+ FY V LL S+  
Sbjct  440   SRIADFDEGVFKGIL--GNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSALD  497

Query  429   ---RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKAL  262
                     E L NQN +IL++CD+AGIK+KQYLPHY T+EDW  HFG  KW +F +RK  
Sbjct  498   SGDEAQSLEYLSNQNRQILRFCDDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKRKMD  557

Query  261   FDPKLILSPGQRIFSQSSSWVW  196
             FDP+ IL+ GQRIF   ++  W
Sbjct  558   FDPRRILATGQRIFKPMAASSW  579



>ref|XP_008377186.1| PREDICTED: cytokinin dehydrogenase 5-like [Malus domestica]
Length=538

 Score =   516 bits (1328),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 250/433 (58%), Positives = 315/433 (73%), Gaps = 13/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSS-LKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA   +GVV++MS    R+G   + +     G Y D  G ELW+DVLR++
Sbjct  90    ARGHGHSINGQAQTNNGVVIQMSGGSSRSGTPGQAARVSEKGMYVDAWGGELWIDVLRST  149

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F YGPQI+NV E+DV+TGKGEL+TCS+  
Sbjct  150   LEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGELLTCSEEQ  209

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----  961
             NSELF AVLGGLGQFG+ITRARI L+ +P RV+W+R+LY +F+ FT+DQE LIS+     
Sbjct  210   NSELFHAVLGGLGQFGIITRARIALEXSPQRVRWIRVLYSNFSAFTKDQEFLISLHGQPT  269

Query  960   DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATT  781
                 DYVEG +I+ +   NNWRSSFFSPS+  +I S+ S  G++Y LE+ K YD+ TA T
Sbjct  270   SQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSEGGVLYCLEITKNYDESTAVT  329

Query  780   IDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKS  601
             ID+E++++ + L F+   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVPKS
Sbjct  330   IDQEIEDLLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKS  389

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS---  430
             RI DF+ GVF  I+   NKTSGPIL+YP NK +WD   S V P+E+ FY V LL S+   
Sbjct  390   RISDFDEGVFKGIL--GNKTSGPILIYPMNKDKWDQSSSVVTPDEDVFYLVALLRSALDT  447

Query  429   --RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFD  256
                    E L NQN +IL++CD+AGI++KQYLPHY T E+W  HFG KW  F QRK  FD
Sbjct  448   GDETRTLEHLTNQNRQILRFCDDAGIEVKQYLPHYTTREEWMDHFGDKWDRFYQRKMKFD  507

Query  255   PKLILSPGQRIFS  217
             P+ IL+ GQRIFS
Sbjct  508   PRRILATGQRIFS  520



>ref|XP_009126914.1| PREDICTED: cytokinin dehydrogenase 3 [Brassica rapa]
Length=518

 Score =   513 bits (1320),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 241/421 (57%), Positives = 318/421 (76%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  100   ARGHGHSFRGQAAAKDGVVVNMRSMVNEDRGIKVSRT---GLYADVDTAWLWIEVLNKTL  156

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+ RYGPQI+NV+E+D+ITGKGE+ TCS  +N
Sbjct  157   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTSRYGPQISNVLELDIITGKGEIATCSNDMN  216

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LF+A LGGLGQFG+ITRARI L+ AP R KW+R LY DF++FTRDQE LIS  DGL +
Sbjct  217   SDLFYAALGGLGQFGIITRARIKLELAPKRAKWLRFLYTDFSEFTRDQERLISEADGLHF  276

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S+I  H +IY LE+VKYYD+ +  +++EE++
Sbjct  277   LEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMIKRHRVIYCLEVVKYYDEFSQHSVNEEME  336

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+ + L+F+ G V+EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F+
Sbjct  337   ELSESLNFVRGFVYEKDVTYIDFLNRVRTGELNLKSKGQWDVPHPWLNLFVPKSQISRFD  396

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N T+GP+LVYP  +  W+D+MS  +PEE+ FY VG L S+  + WE   
Sbjct  397   YGVFKGIILRNNITTGPLLVYPMKRIMWNDQMSTAIPEEDVFYAVGFLRSAEFDNWEAYD  456

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N E+L +C++A + + QYLP++ ++E W +HFG +W  F +RK  +DPK+ILSPGQ I
Sbjct  457   KENMEVLMFCEDAKMDVIQYLPYHASQEGWVRHFGPRWNTFVERKYKYDPKMILSPGQNI  516

Query  222   F  220
             F
Sbjct  517   F  517



>ref|XP_003595179.1| Cytokinin dehydrogenase [Medicago truncatula]
Length=530

 Score =   512 bits (1318),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 247/439 (56%), Positives = 326/439 (74%), Gaps = 22/439 (5%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSE---SLGFYADVGGHELWVDVL  1315
             RG  HS  GQA  ++G+VV M+ L   RNG  I VS  +    LG Y DVGG +LW+DVL
Sbjct  94    RGQAHSVLGQAMTQNGIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVL  153

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITG--------  1159
              A+L HGL P+SWTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV+E+DVITG        
Sbjct  154   NATLKHGLTPLSWTDYLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGLEAERRRG  213

Query  1158  KGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQ  979
             +G ++TCS+  NSE+F+AVLGGLGQFGVITRARI+L  APTRVKW+R++Y+DF+ F+ DQ
Sbjct  214   QGNIVTCSQEKNSEVFYAVLGGLGQFGVITRARILLGPAPTRVKWLRLIYNDFSAFSTDQ  273

Query  978   EHLISID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLEL  814
             EHLIS D     +G DYVEG L++ + P      SF+ PS   +I SL++ +GI Y LEL
Sbjct  274   EHLISFDRRNDSNGADYVEGMLLLNKPPL---ILSFYPPSDHPRITSLVTQYGITYVLEL  330

Query  813   VKYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVP  634
             VKYYD  +   I EE+  + KGL F+   +F+KDV++ +FL+RV S E+ LR KG+WDVP
Sbjct  331   VKYYDTNSQANITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKGLWDVP  390

Query  633   HPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFY  454
             HPWLN+F+PKSRI DFN GVF  IIL+QN ++G +LVYP N+ +WDDRMSA+ P+E+ FY
Sbjct  391   HPWLNMFIPKSRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPDEDVFY  450

Query  453   CVGLLHSSR-VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQ  277
              + LLH+++ ++E +    QN +IL++C++AGIK+K+YL   KT ++W +HFG KWQ F+
Sbjct  451   TLALLHAAKEMDEVKTFQAQNHQILQFCNDAGIKVKEYLSGNKTHQEWVEHFGAKWQQFE  510

Query  276   QRKALFDPKLILSPGQRIF  220
             +RKA FDPK ILSPGQ IF
Sbjct  511   ERKAKFDPKRILSPGQGIF  529



>gb|KHG00982.1| Cytokinin dehydrogenase 5 -like protein [Gossypium arboreum]
Length=520

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 253/433 (58%), Positives = 323/433 (75%), Gaps = 15/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS  GQA    GVVV+MS + R+GG+  V W   +  Y DV G ELW+DVL++ L
Sbjct  84    ARGHGHSINGQAQTGTGVVVQMSGV-RSGGKPSV-WGGDM--YVDVWGGELWIDVLKSCL  139

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL+TCSK  N
Sbjct  140   EYGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVHELDVVTGKGELMTCSKEQN  199

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE+LIS+  +   
Sbjct  200   QELFIAVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSNFSAFTKDQEYLISLHGNQKF  259

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNH--GIIYSLELVKYYDDETATTID  775
             DYVEG +I+ +   NNWRSSFFSP +  +I+SL SN+  G++Y LE+ K Y + TA TID
Sbjct  260   DYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGSNNNGGVLYCLEITKNYHESTAETID  319

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KGMW+VPHPWLNLFVPKS+I
Sbjct  320   QEIEALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGMWEVPHPWLNLFVPKSKI  379

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN--  421
              DF+ GVF  I+   NKTSGPIL+YP NK +WDD+ S V P+E+ FY V  L S+  N  
Sbjct  380   ADFDRGVFKGIL--GNKTSGPILIYPMNKNKWDDKSSVVTPDEDVFYLVAFLRSALDNGE  437

Query  420   ---EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
                  E L NQN +ILK+CDE GIK+KQYLPHYKT+ +W++H+G KW  FQ+ K  FDP+
Sbjct  438   ETQSLEYLTNQNRQILKFCDEDGIKVKQYLPHYKTQSEWKEHYGSKWDRFQRMKMKFDPR  497

Query  249   LILSPGQRIFSQS  211
              IL+ GQ IF+ +
Sbjct  498   HILASGQNIFTPT  510



>gb|ABN05767.1| FAD linked oxidase, N-terminal [Medicago truncatula]
Length=496

 Score =   510 bits (1314),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 326/444 (73%), Gaps = 27/444 (6%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSE---SLGFYADVGGHELWVDVL  1315
             RG  HS  GQA  ++G+VV M+ L   RNG  I VS  +    LG Y DVGG +LW+DVL
Sbjct  55    RGQAHSVLGQAMTQNGIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVL  114

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              A+L HGL P+SWTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV+E+DVITG+G ++TCS
Sbjct  115   NATLKHGLTPLSWTDYLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGQGNIVTCS  174

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTR-------------VKWVRMLYDDFTK  994
             +  NSE+F+AVLGGLGQFGVITRARI+L  APTR             VKW+R++Y+DF+ 
Sbjct  175   QEKNSEVFYAVLGGLGQFGVITRARILLGPAPTRASIIISFSFTHMYVKWLRLIYNDFSA  234

Query  993   FTRDQEHLISID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGII  829
             F+ DQEHLIS D     +G DYVEG L++ + P      SF+ PS   +I SL++ +GI 
Sbjct  235   FSTDQEHLISFDRRNDSNGADYVEGMLLLNKPPL---ILSFYPPSDHPRITSLVTQYGIT  291

Query  828   YSLELVKYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKG  649
             Y LELVKYYD  +   I EE+  + KGL F+   +F+KDV++ +FL+RV S E+ LR KG
Sbjct  292   YVLELVKYYDTNSQANITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKG  351

Query  648   MWDVPHPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE  469
             +WDVPHPWLN+F+PKSRI DFN GVF  IIL+QN ++G +LVYP N+ +WDDRMSA+ P+
Sbjct  352   LWDVPHPWLNMFIPKSRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPD  411

Query  468   EETFYCVGLLHSSR-VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKK  292
             E+ FY + LLH+++ ++E +    QN +IL++C++AGIK+K+YL   KT ++W +HFG K
Sbjct  412   EDVFYTLALLHAAKEMDEVKTFQAQNHQILQFCNDAGIKVKEYLSGNKTHQEWVEHFGAK  471

Query  291   WQIFQQRKALFDPKLILSPGQRIF  220
             WQ F++RKA FDPK ILSPGQ IF
Sbjct  472   WQQFEERKAKFDPKRILSPGQGIF  495



>ref|XP_007221789.1| hypothetical protein PRUPE_ppa003895mg [Prunus persica]
 gb|EMJ22988.1| hypothetical protein PRUPE_ppa003895mg [Prunus persica]
Length=542

 Score =   512 bits (1319),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 256/446 (57%), Positives = 320/446 (72%), Gaps = 27/446 (6%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEM----------SSLKRNGGRIRVSWSESLGFYADVGGHE  1333
             ARGHGHS  GQA   +GVV+EM          S ++   GR+    SE  G Y D  G E
Sbjct  89    ARGHGHSINGQAQTNNGVVIEMNGGGSSGRVMSRVRSGSGRV----SEK-GMYVDAWGGE  143

Query  1332  LWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKG  1153
             LW+DVLR++L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI++V E+DV+TG+G
Sbjct  144   LWIDVLRSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISSVDELDVVTGRG  203

Query  1152  ELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEH  973
             EL+TCS+  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE 
Sbjct  204   ELLTCSEEKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQEF  263

Query  972   LISI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVK  808
             LIS+         DYVEG +I+ +   NNWRSSFFSPS+  +I S+ S  G++Y LE+ K
Sbjct  264   LISLHGQPSTHKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSQGGVLYCLEITK  323

Query  807   YYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHP  628
              Y + TA TID+E++ + K L F+   VF  D+ + DFL+RV   E+KLR K +WDVPHP
Sbjct  324   NYHESTADTIDQEIEGLLKKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKSLWDVPHP  383

Query  627   WLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCV  448
             WLNLFVPKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R S V P+E+ FY V
Sbjct  384   WLNLFVPKSRISDFDKGVFKGIL--GNKTSGPILIYPMNKDKWDQRSSVVTPDEDIFYLV  441

Query  447   GLLHSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQI  283
              LL S+       +  E L NQN +ILK+CD+AGIK+KQYLPHY T+E+W  HFG KW  
Sbjct  442   ALLRSALDTGDETHTLEHLTNQNRQILKFCDDAGIKVKQYLPHYTTQEEWMDHFGDKWGQ  501

Query  282   FQQRKALFDPKLILSPGQRIFSQSSS  205
             F QRK  FDP+ IL+ GQRIFS SSS
Sbjct  502   FYQRKMDFDPRRILATGQRIFSPSSS  527



>emb|CAN81010.1| hypothetical protein VITISV_017949 [Vitis vinifera]
Length=515

 Score =   511 bits (1315),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 256/443 (58%), Positives = 320/443 (72%), Gaps = 19/443 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA    GVV+EMS+ K  R  G  RVS       Y D  G ELW+DVL+ 
Sbjct  78    ARGHGHSINGQAQTSSGVVIEMSASKGVRQWGLPRVSEQSR---YVDAWGGELWIDVLKT  134

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVIT-GKGELITCSK  1132
             +L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+T GKGEL+TCS+
Sbjct  135   TLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTAGKGELLTCSE  194

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---  961
               NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE+LIS+   
Sbjct  195   EQNSELFHAVLGGLGQFGIITRARIGLEPAPQRVRWIRVLYSNFSTFTKDQEYLISLHGQ  254

Query  960   --DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETA  787
               +   DYVEG +I+ +   NNWRSSFFSP +  +I+S  +N G++Y LE+ K Y + TA
Sbjct  255   PPNQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSFGTNGGVLYCLEVTKNYHESTA  314

Query  786   TTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
              TID++++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVP
Sbjct  315   DTIDQDVEALLKRLDFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  374

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-  430
             +SRI DF+ GVF  I+   NKTSGPIL+YP NK +WDDR S V PEE+ FY V LL S+ 
Sbjct  375   RSRIADFDEGVFKGIL--GNKTSGPILIYPMNKNKWDDRTSVVTPEEDVFYLVALLRSAL  432

Query  429   ----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKA  265
                      E L NQN +IL++CD+AGIK+KQYLPHY T+EDW  HFG  KW +F +RK 
Sbjct  433   DSGDEAQSLEYLSNQNRQILRFCDDAGIKVKQYLPHYTTQEDWVDHFGDDKWTLFSKRKM  492

Query  264   LFDPKLILSPGQRIFSQSSSWVW  196
              FDP+ IL+ GQRIF   ++  W
Sbjct  493   DFDPRRILATGQRIFKPMAASSW  515



>ref|XP_008805777.1| PREDICTED: cytokinin dehydrogenase 6-like [Phoenix dactylifera]
Length=546

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 256/438 (58%), Positives = 323/438 (74%), Gaps = 16/438 (4%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRN-GGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             RGHGHS RGQA A DGVV++M SL R    RI V   +S   Y D GG +LW+DVL A+L
Sbjct  103   RGHGHSIRGQAFAPDGVVIDMPSLGRGRADRIIVHSDDSSFRYVDAGGEQLWIDVLHAAL  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL+P SWTDYLYLTVGGTLSNAG+SGQ+FR+GPQI+NV E+DVITGKGE++TCS+  N
Sbjct  163   EHGLSPPSWTDYLYLTVGGTLSNAGVSGQAFRHGPQISNVYELDVITGKGEMVTCSRDYN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-----  958
             SELF+AVLGGLGQFG+ITRARI L+ AP RV+WVR++YDDF  FTRDQE LI+I      
Sbjct  223   SELFYAVLGGLGQFGIITRARIALEPAPQRVRWVRLIYDDFGAFTRDQERLIAISASWES  282

Query  957   ----DGLDYVEGSLIMTQ-SPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  G DYVEGS++    SP  +WRSS F+     +IA L + HG+IY LE   YYD  
Sbjct  283   KKKGGGFDYVEGSVLAADGSPIGSWRSSSFAGWDAERIARLGAQHGVIYCLEGAMYYDSV  342

Query  792   TAT----TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPW  625
              A+     +DEEL+ + + LSF+ G  F  DVS+  FL+RV  GE+KLR  G+WDVPHPW
Sbjct  343   RASRSWVVVDEELELLLEELSFVPGFAFTNDVSYERFLDRVHDGELKLRSMGLWDVPHPW  402

Query  624   LNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG  445
             LN+F+PKS I DFN GVF   IL+ N+++GPIL YP NK +WD+RMS+V+P+EE FY +G
Sbjct  403   LNIFLPKSGIQDFNSGVFKK-ILKHNESTGPILFYPLNKNKWDERMSSVIPDEEIFYSIG  461

Query  444   LLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
             LL S+ +++WE L N N EI+++CD+ GIK KQYLPHY ++EDW KHFG +W  F + K 
Sbjct  462   LLWSAIMDDWEYLENLNMEIIQFCDQKGIKYKQYLPHYLSQEDWMKHFGPRWDKFVEMKR  521

Query  264   LFDPKLILSPGQRIFSQS  211
              +DPK +LSPGQ+IF+ S
Sbjct  522   KYDPKALLSPGQKIFTTS  539



>gb|ABN08744.1| FAD linked oxidase, N-terminal [Medicago truncatula]
Length=535

 Score =   511 bits (1315),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 326/444 (73%), Gaps = 27/444 (6%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSE---SLGFYADVGGHELWVDVL  1315
             RG  HS  GQA  ++G+VV M+ L   RNG  I VS  +    LG Y DVGG +LW+DVL
Sbjct  94    RGQAHSVLGQAMTQNGIVVNMTQLNWYRNGSGIVVSDCDVKNPLGCYVDVGGEQLWIDVL  153

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              A+L HGL P+SWTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV+E+DVITG+G ++TCS
Sbjct  154   NATLKHGLTPLSWTDYLYLSVGGTLSNAGIGGQTFRFGPQISNVLELDVITGQGNIVTCS  213

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTR-------------VKWVRMLYDDFTK  994
             +  NSE+F+AVLGGLGQFGVITRARI+L  APTR             VKW+R++Y+DF+ 
Sbjct  214   QEKNSEVFYAVLGGLGQFGVITRARILLGPAPTRASIIISFSFTHMYVKWLRLIYNDFSA  273

Query  993   FTRDQEHLISID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGII  829
             F+ DQEHLIS D     +G DYVEG L++ + P      SF+ PS   +I SL++ +GI 
Sbjct  274   FSTDQEHLISFDRRNDSNGADYVEGMLLLNKPPL---ILSFYPPSDHPRITSLVTQYGIT  330

Query  828   YSLELVKYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKG  649
             Y LELVKYYD  +   I EE+  + KGL F+   +F+KDV++ +FL+RV S E+ LR KG
Sbjct  331   YVLELVKYYDTNSQANITEEVDNLVKGLKFVPTFMFQKDVTYEEFLDRVHSEELILRSKG  390

Query  648   MWDVPHPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE  469
             +WDVPHPWLN+F+PKSRI DFN GVF  IIL+QN ++G +LVYP N+ +WDDRMSA+ P+
Sbjct  391   LWDVPHPWLNMFIPKSRISDFNEGVFKGIILKQNISAGIVLVYPMNRNKWDDRMSAITPD  450

Query  468   EETFYCVGLLHSSR-VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKK  292
             E+ FY + LLH+++ ++E +    QN +IL++C++AGIK+K+YL   KT ++W +HFG K
Sbjct  451   EDVFYTLALLHAAKEMDEVKTFQAQNHQILQFCNDAGIKVKEYLSGNKTHQEWVEHFGAK  510

Query  291   WQIFQQRKALFDPKLILSPGQRIF  220
             WQ F++RKA FDPK ILSPGQ IF
Sbjct  511   WQQFEERKAKFDPKRILSPGQGIF  534



>emb|CDY20702.1| BnaA02g08420D [Brassica napus]
Length=517

 Score =   509 bits (1312),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 240/421 (57%), Positives = 317/421 (75%), Gaps = 3/421 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  99    ARGHGHSFRGQAAAKDGVVVNMRSMVNEDRGIKVSRT---GLYADVDTAWLWIEVLNKTL  155

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+ RYGPQI+NV+E+D+ITGKGE+ TCS  +N
Sbjct  156   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTSRYGPQISNVLELDIITGKGEIATCSNDMN  215

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LF+A LGGLGQFG+ITRARI L+ AP R KW+R LY DF++FTRDQE LIS   GL +
Sbjct  216   SDLFYAALGGLGQFGIITRARIKLELAPKRAKWLRFLYTDFSEFTRDQERLISEAGGLHF  275

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S+I  H +IY LE+VKYYD+ +  +++EE++
Sbjct  276   LEGSVMLDHGPPDNWRSTYYPPSDHLRIVSMIKRHRVIYCLEVVKYYDEFSQHSVNEEME  335

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+ + L+F+ G V+EKDV++ DFLNRVR+GE+ L+ KG WDVPHPWLNLFVPKS+I  F+
Sbjct  336   ELSESLNFVRGFVYEKDVTYIDFLNRVRTGELNLKSKGQWDVPHPWLNLFVPKSQISRFD  395

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N T+GP+LVYP  +  W+D+MS  +PEE+ FY VG L S+  + WE   
Sbjct  396   YGVFKGIILRNNITTGPLLVYPMKRIMWNDQMSTAIPEEDVFYAVGFLRSAEFDNWEAYD  455

Query  402   NQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRI  223
              +N E+L +C++A + + QYLP++ ++E W +HFG +W  F +RK  +DPK+ILSPGQ I
Sbjct  456   KENMEVLMFCEDAKMDVIQYLPYHASQEGWVRHFGPRWNTFVERKYKYDPKMILSPGQNI  515

Query  222   F  220
             F
Sbjct  516   F  516



>gb|KDP38564.1| hypothetical protein JCGZ_04489 [Jatropha curcas]
Length=538

 Score =   510 bits (1314),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 250/437 (57%), Positives = 315/437 (72%), Gaps = 15/437 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNG---GRIRVSWSESLGFYADVGGHELWVDVLR  1312
             ARGHGHS  GQA   +GVVVEMSS +R+    G+       +   + DV G ELW+DVLR
Sbjct  90    ARGHGHSINGQAQTSNGVVVEMSSARRSQLGRGKPDPPQVSAKEMHVDVWGGELWIDVLR  149

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             ++L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++TCS+
Sbjct  150   STLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGEILTCSQ  209

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---  961
               NSELF AVLGGLGQFG+ITRARI L  AP RV+W+R+LY  F+ FT DQE+LIS+   
Sbjct  210   EQNSELFHAVLGGLGQFGIITRARIALGPAPQRVRWIRVLYSSFSSFTTDQEYLISLYGN  269

Query  960   --DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETA  787
                   DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K YDD T 
Sbjct  270   PSTQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIDANGGVLYCLEITKNYDDSTL  329

Query  786   TTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
               ID+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVP
Sbjct  330   DNIDQEVESLLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  389

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR  427
             KSRI DF+ GVF  I+   NKTSGPIL+YP N+ +WD R S V P+E+ FY V LL S+ 
Sbjct  390   KSRIADFDNGVFKGIL--GNKTSGPILIYPMNRNKWDQRTSVVTPDEDVFYLVALLRSAL  447

Query  426   VN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKAL  262
              N       + L NQN +IL++CD+AGI +KQYLPHY TE+DW  HFG KW  F + K  
Sbjct  448   DNGEDTQTLDYLSNQNRQILRFCDDAGINVKQYLPHYTTEKDWVDHFGDKWSQFYRNKME  507

Query  261   FDPKLILSPGQRIFSQS  211
             FDP+ IL+ GQRIF  S
Sbjct  508   FDPRRILATGQRIFMPS  524



>ref|XP_011094005.1| PREDICTED: cytokinin dehydrogenase 3-like [Sesamum indicum]
Length=501

 Score =   509 bits (1310),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 254/430 (59%), Positives = 321/430 (75%), Gaps = 18/430 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+ GVVV+M++L +   RIRVS  ES GFYADVG  +LW+DVLRA+L
Sbjct  84    ARGRGHSVRGQAMARGGVVVDMTALNKTRSRIRVSGKESSGFYADVGAEQLWIDVLRATL  143

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GLAPVSWT+YLYL+VGGTLSNAGISGQ+F+ GPQI NV+E+DVITGKGE ITCS+   
Sbjct  144   KRGLAPVSWTNYLYLSVGGTLSNAGISGQTFQRGPQINNVLELDVITGKGEFITCSRERK  203

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             ++LFFAVLGGLGQFG+ITRARI+L+KAPTRVKWVR++Y +F+ FT DQEHLIS  +  DY
Sbjct  204   AKLFFAVLGGLGQFGIITRARIILEKAPTRVKWVRLIYSNFSIFTTDQEHLIS-SNSPDY  262

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             V G LI+ ++  N WRSSF SPS QS I +L+   GI+YS+ELVKYYD+ T +TID++ +
Sbjct  263   VLGFLIIDENTTNQWRSSFSSPSRQSDIDALLKKQGILYSIELVKYYDNRTTSTIDKDFE  322

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVP------HPWLNLFVPKS  601
              + K L++    +F  D S FDFL+R+          G  D P      HPWLNLF+PKS
Sbjct  323   TLLKELNYNPEFIFRTDTSLFDFLHRI----------GDLDSPTGPLDSHPWLNLFIPKS  372

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN  421
             RI DFN GV   ++ + N++S  IL YP N+ +WDDRMSAV+PEE+ FY +GLLHSS  N
Sbjct  373   RISDFNAGVLATLLPKLNESST-ILFYPFNRKKWDDRMSAVIPEEDVFYTLGLLHSSSPN  431

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
              ++     N ++L +C  AGIK+KQYLP+YK++ DW +HFG KW  F+QRKA FDPK IL
Sbjct  432   AYQIYDEFNSQVLGFCKRAGIKVKQYLPNYKSQGDWIQHFGPKWPTFRQRKATFDPKFIL  491

Query  240   SPGQRIFSQS  211
             SPGQ IF+ +
Sbjct  492   SPGQGIFNSA  501



>ref|XP_006595335.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=524

 Score =   509 bits (1312),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 244/432 (56%), Positives = 320/432 (74%), Gaps = 14/432 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRV----SWSESLGFYADVGGHELWVDV  1318
             RG  HS  GQA   DGVVV M+ L   RNG  I V    + + ++G YADVGG ++W+DV
Sbjct  96    RGQAHSIHGQAMTNDGVVVNMTELNGFRNGDGIIVVSDDTTATTIGPYADVGGEQIWIDV  155

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L A+L  GL P+SWTDYLYL+VGGTLSNAGISGQ+FR+GPQI+NV E+DV+TGKG+L+TC
Sbjct  156   LHATLERGLTPLSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVHELDVVTGKGDLVTC  215

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S   NSELF+AVLGGLGQFG+ITRARI L  APTRVKW+R+LY++F+ F+ DQE+LIS++
Sbjct  216   SAENNSELFYAVLGGLGQFGIITRARIALGPAPTRVKWLRLLYNNFSAFSGDQEYLISVN  275

Query  957   -----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  +  DYVEG L++ Q P +    SF+      +I SL++ +GIIY +ELVKYYD+ 
Sbjct  276   GRNETNAADYVEGFLLLNQPPQD---LSFYPEPDHPRITSLVTQYGIIYVIELVKYYDNS  332

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T   +DE++    + L F+   +FEKDVS+ +FLNRV + E+ LR +G+WD+PHPWLNLF
Sbjct  333   TQEHVDEDVNFWVEELKFVPTFMFEKDVSYEEFLNRVHADELFLRSQGLWDIPHPWLNLF  392

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VP SRI DF+ GVF  IIL+QN T+G +++YP N+ +WDD MSAV P ++ FY V  LHS
Sbjct  393   VPASRISDFDEGVFKGIILQQNITAGLVIIYPMNRTKWDDNMSAVTPHDDVFYVVSFLHS  452

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             +  ++ EE   QN++IL++C  AGI IKQYLP  KT+E+WEK FG KW+ F++RKA FDP
Sbjct  453   TGFDKLEEFQAQNQQILQFCANAGIGIKQYLPQNKTQEEWEKQFGPKWKTFKERKAQFDP  512

Query  252   KLILSPGQRIFS  217
               ILSPGQ IF+
Sbjct  513   NSILSPGQGIFN  524



>ref|XP_002300742.2| cytokinin oxidase 6 family protein [Populus trichocarpa]
 gb|EEE80015.2| cytokinin oxidase 6 family protein [Populus trichocarpa]
Length=535

 Score =   509 bits (1312),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 255/442 (58%), Positives = 320/442 (72%), Gaps = 23/442 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRI--------RVSWSESLGFYADVGGHELW  1327
             ARGHGHS  GQA   +GVV+EMS   R G R         +VS  E    + DV G ELW
Sbjct  88    ARGHGHSINGQAQTSNGVVIEMSGGSR-GSRFGLRKLDKPQVSIKEK---HVDVWGGELW  143

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             +DVLR++L HGLAP SWTDYLYL+VGGTLSN GISGQ+F +GPQI+NV E+DV+TGKGEL
Sbjct  144   IDVLRSTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGEL  203

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
              TCS+  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT DQE+LI
Sbjct  204   STCSEEKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQEYLI  263

Query  966   SI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             S+         DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K Y
Sbjct  264   SLHGNPYSQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEITKNY  323

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
             D+ TA TID+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWL
Sbjct  324   DEATADTIDQEVEALMKRLNFIPSSVFTTDLPYIDFLDRVHKAELKLRAKGLWEVPHPWL  383

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLFVPKSR+ D + GVF   IL  NKTSGPIL+YP NK++WD R S V P+E+ FY V L
Sbjct  384   NLFVPKSRMADLDRGVFKG-ILGNNKTSGPILIYPMNKSKWDQRSSVVTPDEDVFYLVAL  442

Query  441   LHSSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQ  277
             L S+  N       E L NQN +IL++CD+AGIK+KQYLPHY T+E+W  HFG KW  F 
Sbjct  443   LRSALDNGEETQSLEYLTNQNHKILRFCDDAGIKVKQYLPHYTTQEEWMDHFGDKWDQFS  502

Query  276   QRKALFDPKLILSPGQRIFSQS  211
             +RK  FDP+ IL+ GQRIF+ S
Sbjct  503   RRKMEFDPRHILATGQRIFNPS  524



>ref|XP_004507936.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=516

 Score =   509 bits (1310),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 243/426 (57%), Positives = 312/426 (73%), Gaps = 8/426 (2%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASLP  1300
             RG GHS  GQ+   DGVVV M+ L     R   S       Y D+GG ++W+DVL ASL 
Sbjct  94    RGQGHSVNGQSMTNDGVVVNMTQLINYRFRSNESGIVVFDEYVDIGGEQIWIDVLHASLE  153

Query  1299  HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINS  1120
              GL P+SWTDYL+L+VGGTLSNAGISGQ+FR+GPQI+NV E+DV+TG G+L+TCS   NS
Sbjct  154   RGLTPLSWTDYLFLSVGGTLSNAGISGQTFRFGPQISNVHELDVVTGNGDLVTCSAEKNS  213

Query  1119  ELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-----D  955
             ELF+ VLGGLGQFG+ITRARI L  AP RVKW+R+LY+DF+ F+ DQEHLIS +     +
Sbjct  214   ELFYGVLGGLGQFGIITRARIALGPAPKRVKWLRLLYNDFSTFSGDQEHLISFNGRNETN  273

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
               +YVEG L++ Q P +    SF+    Q +I SL++ +GIIY +ELVKYYDD +   ID
Sbjct  274   AANYVEGMLLLNQQPLD---LSFYPEIDQPRITSLVTQYGIIYIIELVKYYDDNSQDQID  330

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +E++ + K L F+   +FEKDVS+ +FLNRV   E+ LR +G+WD+PHPWLN+FVP+SRI
Sbjct  331   QEIEILVKELRFVPTFMFEKDVSYEEFLNRVHFDELALRAQGLWDIPHPWLNIFVPRSRI  390

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
              DFN GVF  IILRQN ++G ++VYP N+ +WDD+MSAV P EE FY V LL +S   + 
Sbjct  391   SDFNEGVFKGIILRQNISAGLVIVYPMNRTKWDDKMSAVTPNEEIFYIVSLLRTSGFEKL  450

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             EE   QN++IL++C++ GI IKQYLP  KT EDW KHFG KW+ F++RKA FDP  ILSP
Sbjct  451   EEFQAQNQQILQFCNDVGIGIKQYLPLNKTHEDWVKHFGIKWEDFEKRKAQFDPNKILSP  510

Query  234   GQRIFS  217
             GQRIF+
Sbjct  511   GQRIFN  516



>ref|XP_010254676.1| PREDICTED: cytokinin dehydrogenase 5-like [Nelumbo nucifera]
Length=543

 Score =   510 bits (1313),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 253/446 (57%), Positives = 321/446 (72%), Gaps = 24/446 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSES------LG-----FYADVGGH  1336
             ARGHGHS  GQA A DGVV+ MSS      RI +  + +      LG      Y DV G 
Sbjct  90    ARGHGHSINGQAHATDGVVIAMSSSTSKRNRISLQGNPAARPTLLLGDKPSCSYMDVWGG  149

Query  1335  ELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGK  1156
             ELW+DVL ++L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI NV E+DV+TGK
Sbjct  150   ELWIDVLNSTLEYGLAPRSWTDYLYLSVGGTLSNAGISGQAFNHGPQITNVYELDVVTGK  209

Query  1155  GELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQE  976
             GE++TCS   NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE
Sbjct  210   GEVVTCSNEHNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQE  269

Query  975   HLISI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASL-ISNHGIIYSLEL  814
             +LIS+      D  DYVEG +I+ +   NNWRSSFFSP +  +I+SL  +N G++Y LE+
Sbjct  270   YLISLHGNPSTDRFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGAANGGVLYCLEV  329

Query  813   VKYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVP  634
              K YD+ TA T+D+E+  + K L FI   +F  D+ + DFL+RV   E+KLR KG+WDVP
Sbjct  330   TKNYDESTADTVDQEVGALLKKLDFIPTTIFTTDIPYLDFLDRVHKAELKLRSKGLWDVP  389

Query  633   HPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFY  454
             HPWLNLFVPKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R S V P+E+ FY
Sbjct  390   HPWLNLFVPKSRIADFDRGVFKGIL--GNKTSGPILIYPMNKNKWDHRSSVVTPDEDIFY  447

Query  453   CVGLLHSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKW  289
              VGLL S+          E L NQN +IL++C+EAGIK+K YLP++ T+E+W+ HFG+KW
Sbjct  448   LVGLLRSALDSGEETQTMEYLNNQNRQILRFCNEAGIKVKHYLPNHSTQEEWKAHFGEKW  507

Query  288   QIFQQRKALFDPKLILSPGQRIFSQS  211
              +F +RK  FDPK IL+ GQRIF  +
Sbjct  508   DLFVKRKMEFDPKRILATGQRIFQPA  533



>gb|AIU94750.1| cytokinin oxidase [Morus alba var. multicaulis]
Length=496

 Score =   508 bits (1308),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 319/445 (72%), Gaps = 26/445 (6%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMS-SLKRNGG----------RIRVSWSESLGFYADVGGH  1336
             ARGHGHS  GQA A +GVV++MS S +R             R RVS  E    Y DV G 
Sbjct  36    ARGHGHSINGQAQATNGVVIKMSGSRERTAADQTSAVAAAARPRVSERE---MYVDVWGG  92

Query  1335  ELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGK  1156
             ELW++VL+A+L HGLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQIANV E+DV+TGK
Sbjct  93    ELWIEVLKATLEHGLAPKSWTDYLYLTVGGTLSNAGISGQTFNHGPQIANVQELDVVTGK  152

Query  1155  GELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQE  976
             GEL+TCS+  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE
Sbjct  153   GELLTCSEEKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFTKDQE  212

Query  975   HLISI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELV  811
              LIS+        +DYVEG +I+ +   NNWRSSFFSP +  +++S+ ++ G++Y LE+ 
Sbjct  213   FLISLHGLPASQRVDYVEGFVIVDEGLINNWRSSFFSPRNPVKLSSINADEGVLYCLEIT  272

Query  810   KYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPH  631
             K YD+ TA TID+E++ + + L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPH
Sbjct  273   KNYDESTAETIDQEVEGLLRKLDFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPH  332

Query  630   PWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYC  451
             PW NLFVPKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R SA+ P+E+ FY 
Sbjct  333   PWFNLFVPKSRISDFDEGVFKSIL--GNKTSGPILIYPMNKGKWDQRSSAMTPDEDVFYL  390

Query  450   VGLLHSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQ  286
             V LL S+          E L +QN +IL++C  AGIK KQYLPHY T+++W  HFG KW 
Sbjct  391   VALLRSALDTGDETQSLEYLMHQNRQILRFCANAGIKAKQYLPHYTTQQEWVDHFGDKWA  450

Query  285   IFQQRKALFDPKLILSPGQRIFSQS  211
              F  RK  FDP+ IL+ GQRIF+ S
Sbjct  451   QFHMRKMEFDPRHILAIGQRIFTPS  475



>ref|XP_006838693.1| hypothetical protein AMTR_s00002p00248240 [Amborella trichopoda]
 gb|ERN01262.1| hypothetical protein AMTR_s00002p00248240 [Amborella trichopoda]
Length=539

 Score =   509 bits (1312),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 256/453 (57%), Positives = 322/453 (71%), Gaps = 31/453 (7%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR---NGGRI--------------RVSWSESLG--  1360
             A+GH HS +GQA A  GVV+EM +LK    N G +              R S     G  
Sbjct  78    AKGHAHSIQGQAQAPGGVVIEMEALKGCLFNVGVLENESCSFSSSYSVERESVERESGGS  137

Query  1359  -FYADVGGHELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANV  1183
              +YADV G ELW+DVL  +L HGLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV
Sbjct  138   LYYADVWGGELWIDVLHETLKHGLAPRSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNV  197

Query  1182  IEMDVITGKGELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDD  1003
              E+DV+TGKGEL+TCSKH NSELF +VLGGLGQFG+ITRARI L+ AP RV+W+R+LY D
Sbjct  198   YELDVVTGKGELLTCSKHQNSELFHSVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSD  257

Query  1002  FTKFTRDQEHLISID--DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNH--G  835
             F  FTRDQEHLIS+      DYVEG +I+ +   NNWRSSFFSP +  ++ S++S     
Sbjct  258   FNTFTRDQEHLISLHGRTKFDYVEGFVIVDEGLINNWRSSFFSPRNPIKLQSIVSGSKGT  317

Query  834   IIYSLELVKYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQ  655
             ++Y LE+ K YD+ TA T+D+E+  + K LSFI G VF  D+ + DFL+RV   E+KLR 
Sbjct  318   VLYCLEVTKNYDEATADTVDQEVDSLLKTLSFIQGSVFTTDLPYIDFLDRVHKAELKLRA  377

Query  654   KGMWDVPHPWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVV  475
             KG+WDVPHPWLNLF+PKS+I DF+ GVF  I+ +  KTSGPIL+YP NK RWD++ SAV 
Sbjct  378   KGLWDVPHPWLNLFIPKSKIADFDAGVFKGILGK--KTSGPILIYPMNKNRWDEKTSAVT  435

Query  474   PEEETFYCVGLLHSSRVNEWEE-----LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWE  310
             P+E+ FY V  L S+  N  E      L +QNE IL++C+EA I++KQYLPH+     W 
Sbjct  436   PDEDVFYLVAFLRSALDNGEETQSLRYLQDQNERILRFCEEANIEMKQYLPHHTKRAQWV  495

Query  309   KHFGKKWQIFQQRKALFDPKLILSPGQRIFSQS  211
             +H+G KW  F++RKA FDPK IL+PGQRIFS +
Sbjct  496   QHYGPKWAEFEERKATFDPKNILAPGQRIFSAA  528



>ref|XP_009609662.1| PREDICTED: cytokinin dehydrogenase 5 [Nicotiana tomentosiformis]
Length=527

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 251/435 (58%), Positives = 314/435 (72%), Gaps = 14/435 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS  GQA    GVV++MS    +  ++    SE    YADV G ELW+DVL ++L
Sbjct  88    ARGHGHSINGQAMTTKGVVIQMSGGSNSKQKLLTEVSEKF-MYADVWGGELWIDVLTSTL  146

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI NV E+DV+TGKGEL+TCS+  N
Sbjct  147   EYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQINNVHELDVVTGKGELLTCSEKEN  206

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----D  958
             SELF A LGGLGQFG+ITRARI L++AP RV+W+R+LY +F+ FT DQE+LIS+      
Sbjct  207   SELFHAALGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTEDQEYLISLQAKPAS  266

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
                DYVEG +I+ +   NNWRSSFFSPS+  +I+SL ++ G++Y LE+ K Y    A  +
Sbjct  267   QKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSLKADGGVLYCLEITKNYHLSNADIV  326

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+E++ + K L +I   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLNLFVPKSR
Sbjct  327   DQEIETLLKKLKYIPASVFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSR  386

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I+DF+ GVF  I+   NKTSGPIL+YP NK +WD+R S V PEEE FY VG L S+  N 
Sbjct  387   IVDFDKGVFKGIL--GNKTSGPILIYPMNKNKWDERSSVVTPEEEVFYLVGFLRSALTNS  444

Query  417   -----WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKK-WQIFQQRKALFD  256
                   E L NQN EILK+C++A IKIKQYLPHY T+ +W  HFG K W  FQQRK  FD
Sbjct  445   DETQTLEYLSNQNYEILKFCEDANIKIKQYLPHYTTQREWRDHFGDKYWTRFQQRKLEFD  504

Query  255   PKLILSPGQRIFSQS  211
             P+ IL+ GQRIF  S
Sbjct  505   PRHILATGQRIFMPS  519



>gb|EYU32888.1| hypothetical protein MIMGU_mgv1a004444mg [Erythranthe guttata]
Length=526

 Score =   509 bits (1310),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 245/433 (57%), Positives = 317/433 (73%), Gaps = 12/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR-IRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA A +G+V++MS     G R +    SE L  + DV G ELW+DVLR++
Sbjct  88    ARGHGHSINGQAMAGNGLVIQMSGSSAGGSRRLGPRVSEEL-MHVDVWGGELWIDVLRST  146

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYL+VGGT+SNAGISGQ+F +GPQI+NV+E+DV+TGKGEL+TCSK  
Sbjct  147   LEYGLAPKSWTDYLYLSVGGTISNAGISGQAFNHGPQISNVLELDVVTGKGELMTCSKEH  206

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---DD  955
             NS+L+ AVLGGLGQFG+ITRARI L+K PTRVKW+R+LY DF  FT+DQE+LIS+     
Sbjct  207   NSKLYHAVLGGLGQFGIITRARIALEKTPTRVKWIRVLYSDFATFTQDQEYLISLHGQKR  266

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
               DYVEG +I+ +   NNWRSSFFSP +  +I+SL ++ G++Y LE+ K Y +  A TID
Sbjct  267   KFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLNADGGVLYCLEITKNYHESNADTID  326

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +E++ +   L++I   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI
Sbjct  327   QEVEALMNKLNYIPASVFTTDLPYVDFLDRVHKAELKLRAKNLWEVPHPWLNLFVPKSRI  386

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----  430
              DF+ G+F  I+   N TSGPIL+YP NK +WD++ SAV P E+ FY V LL S+     
Sbjct  387   ADFDKGIFKGIL--GNNTSGPILIYPMNKNKWDEKSSAVTPNEDVFYLVALLRSALNDGN  444

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
                  E L NQN +IL++C E GI +KQYLPHY TE++W  HFG+KW +F  RK  FDP+
Sbjct  445   ETQSLEYLSNQNRKILRFCKEEGIDVKQYLPHYTTEQEWRNHFGEKWNLFSSRKTEFDPR  504

Query  249   LILSPGQRIFSQS  211
              IL+ GQRIF+ S
Sbjct  505   RILATGQRIFTPS  517



>ref|XP_009398389.1| PREDICTED: cytokinin dehydrogenase 5 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   508 bits (1308),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 316/439 (72%), Gaps = 16/439 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLG-FYADVGGHELWVDVLRAS  1306
             ARGHGH   GQA A  GVV+EMS   R   R R ++S S G +Y DV G +LW+DVL  +
Sbjct  89    ARGHGHCTGGQALAPGGVVIEMSR-GRLEPRPRPAYSPSTGEYYVDVWGGDLWIDVLNWT  147

Query  1305  LPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             L +G LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQ +NV E+DV+TGKGELITCS+ 
Sbjct  148   LANGDLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQSSNVYELDVVTGKGELITCSEE  207

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              NSELF  VLGGLGQFG+ITRARI L++AP RV+W+R+LY DF  FTRDQEHLIS+   L
Sbjct  208   QNSELFHGVLGGLGQFGIITRARIALEQAPQRVRWIRVLYSDFGAFTRDQEHLISLHGAL  267

Query  948   -----DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
                  DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN G++Y LE+ K YDD TA 
Sbjct  268   PSQRFDYVEGFVIVDEGLINNWRSSFFSPKNPVKISSVGSNGGVLYCLEMTKNYDDSTAD  327

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             TIDE ++ + + LSFI   VF  D+ + DFL+RV   E++LR KG+W+VPHPWLNLFVP 
Sbjct  328   TIDEVVEALLRQLSFIPATVFTTDLPYVDFLDRVHKAELRLRAKGLWEVPHPWLNLFVPA  387

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS--  430
             SRI DF+ GVF  I+   N+TSGPIL+YP NK +WDDR S V P+EE FY V  L S+  
Sbjct  388   SRIADFDRGVFRGIL--GNRTSGPILIYPMNKHKWDDRSSVVTPDEEVFYLVAFLRSALS  445

Query  429   ----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKAL  262
                      E L  QN++IL++CDE GI+IKQYLPH+ +  +W +HFG KW  F +RKA 
Sbjct  446   DSDDPTQSLEYLSQQNQKILEFCDEVGIEIKQYLPHHPSRTEWARHFGPKWARFVRRKAQ  505

Query  261   FDPKLILSPGQRIFSQSSS  205
             FDPK IL  GQ IF  SSS
Sbjct  506   FDPKFILGTGQGIFQPSSS  524



>ref|XP_006475551.1| PREDICTED: cytokinin dehydrogenase 3-like [Citrus sinensis]
Length=511

 Score =   507 bits (1306),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 244/432 (56%), Positives = 321/432 (74%), Gaps = 18/432 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G  HS  GQA A  GVVV+MSSL   RNG  I +S   S GFYADVGG +LW+DVL A
Sbjct  89    AKGQAHSTWGQAQANKGVVVQMSSLNSFRNGTGILISGDRSSGFYADVGGEQLWIDVLNA  148

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GL+PVSWTDYLYLT+GGTLSNAGISGQ++R GPQI NV+E+DV+TGKGE +TC+  
Sbjct  149   TLARGLSPVSWTDYLYLTIGGTLSNAGISGQTYRKGPQITNVLELDVLTGKGEFVTCTSQ  208

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              ++ELF+AVLGGLGQFG+ITRARIVL+ A  RVKW+R+LY DF+ F+ DQE LIS     
Sbjct  209   KDTELFYAVLGGLGQFGIITRARIVLEPAKERVKWLRILYSDFSSFSTDQETLISTTGPS  268

Query  948   -----DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
                  DY+EG L+M+QSP +     F+  S   +I SLI+ +GI+Y +E+  YYD++   
Sbjct  269   HKVMPDYLEGQLLMSQSPLD-----FYPQSQHQKITSLINQYGIVYLIEVATYYDNKNE-  322

Query  783   TIDEELQEMFKGLS-FIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
               D+ +++M K L  F+ G VFEKDV++ +FLNRV   E+ LR+KG+WD+PHPWLN+F+P
Sbjct  323   --DKRVKQMLKSLKGFVHGFVFEKDVTYLEFLNRVHDEEIVLRKKGLWDIPHPWLNIFIP  380

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP-EEETFYCVGLLHSS  430
             +SRI DF+ G F +I+L++N TS  +LVYP  +++WD+RMSAV+P EE+ FY VG L +S
Sbjct  381   RSRITDFDNGAFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIPDEEDVFYVVGFLDAS  440

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               ++WE   N+N++IL++C   GIK KQYL H+ T+E+W  HFG KW  FQQ KA FDPK
Sbjct  441   -ADDWETFDNRNKDILQFCVNGGIKFKQYLGHHATKEEWINHFGSKWNTFQQSKARFDPK  499

Query  249   LILSPGQRIFSQ  214
             +ILSPGQRIF+ 
Sbjct  500   MILSPGQRIFNN  511



>ref|XP_011094006.1| PREDICTED: cytokinin dehydrogenase 3-like [Sesamum indicum]
Length=499

 Score =   506 bits (1304),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 254/430 (59%), Positives = 320/430 (74%), Gaps = 20/430 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+ GVVV+M++L +   RI VS     G YADVG  +LW+DVLRA+L
Sbjct  84    ARGRGHSVRGQAMARGGVVVDMTALSKTRRRITVSRK---GTYADVGAEQLWIDVLRATL  140

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GLAPVSWTDYLYL+VGGTLSNAGISGQSF+ GPQI NV+E+DVITGKGE +TCS+   
Sbjct  141   KRGLAPVSWTDYLYLSVGGTLSNAGISGQSFQRGPQINNVLELDVITGKGEFMTCSRERK  200

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELFFAVLGGLGQFG+ITRARI+L KAPTRVKWVR++Y DF+ F+RDQEHLIS  +  +Y
Sbjct  201   PELFFAVLGGLGQFGIITRARIILQKAPTRVKWVRLIYSDFSIFSRDQEHLIS-SNSPNY  259

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             VEG LI  ++  N+WRSSF SPS QS IA+L+   GI+YS+ELVKYYD+ TA+TID++ +
Sbjct  260   VEGFLITDENITNDWRSSFSSPSRQSDIAALLKKQGILYSIELVKYYDNRTASTIDKDFE  319

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVP------HPWLNLFVPKS  601
              + K L++    +F  D S FDFL+RV          G  D P      HPWLNLF+PKS
Sbjct  320   TLLKELNYNPEFIFSADTSLFDFLHRV----------GDLDSPTAPLDSHPWLNLFIPKS  369

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN  421
             RI DFN GV   ++ + N++S  ++ YP N+ +WDDRMSAV+PEE+ FY +G+LHSS  N
Sbjct  370   RISDFNAGVLATLLPKLNESSPILIFYPLNRNKWDDRMSAVIPEEDVFYTLGVLHSSPPN  429

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
              ++     N +IL +C  AGIK+KQYLP+YK++ +W +HFG KW  F+QRKA FDPK IL
Sbjct  430   AYQIYDEFNSQILGFCKRAGIKVKQYLPNYKSQGEWIQHFGSKWPTFRQRKATFDPKFIL  489

Query  240   SPGQRIFSQS  211
             SPGQRIF+ +
Sbjct  490   SPGQRIFNSA  499



>ref|XP_010110013.1| Cytokinin dehydrogenase 5 [Morus notabilis]
 gb|EXC25031.1| Cytokinin dehydrogenase 5 [Morus notabilis]
Length=566

 Score =   509 bits (1310),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 318/445 (71%), Gaps = 26/445 (6%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGG-----------RIRVSWSESLGFYADVGGH  1336
             ARGHGHS  GQA A +GVV++MSS +               R +VS  E    Y DV G 
Sbjct  106   ARGHGHSINGQAQATNGVVIKMSSSRERTAADQTSAAAAAARPQVSERE---MYVDVWGG  162

Query  1335  ELWVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGK  1156
             +LW+DVL+A+L HGLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQIANV E+DV+TGK
Sbjct  163   DLWIDVLKATLEHGLAPKSWTDYLYLTVGGTLSNAGISGQTFNHGPQIANVQELDVVTGK  222

Query  1155  GELITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQE  976
             GEL+TCS+  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE
Sbjct  223   GELLTCSEEKNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFTKDQE  282

Query  975   HLISI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELV  811
              LIS+         DYVEG +I+ +   NNWRSSFFSP +  +++S+ ++ G++Y LE+ 
Sbjct  283   FLISLHGLPASQRFDYVEGFVIVDEGLINNWRSSFFSPRNPVKLSSINADGGVLYCLEIT  342

Query  810   KYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPH  631
             K YD+ TA TID+E++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPH
Sbjct  343   KNYDESTAETIDQEVEGLLKKLDFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPH  402

Query  630   PWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYC  451
             PW NLFVPKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R SAV P+E+ FY 
Sbjct  403   PWFNLFVPKSRISDFDEGVFKSIL--GNKTSGPILIYPMNKDKWDQRSSAVTPDEDVFYL  460

Query  450   VGLLHSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQ  286
             V LL S+          E L +QN +IL++C  AGIK KQYLPHY T+++W  HFG KW 
Sbjct  461   VALLRSALDTADETQSLEYLMHQNRQILRFCAAAGIKAKQYLPHYTTQQEWVDHFGDKWA  520

Query  285   IFQQRKALFDPKLILSPGQRIFSQS  211
              F +RK  FDP+ IL+ GQRIF+ S
Sbjct  521   QFHKRKMEFDPRHILATGQRIFTPS  545



>ref|XP_002307681.1| hypothetical protein POPTR_0005s25380g [Populus trichocarpa]
 gb|EEE94677.1| hypothetical protein POPTR_0005s25380g [Populus trichocarpa]
Length=534

 Score =   508 bits (1307),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 251/443 (57%), Positives = 320/443 (72%), Gaps = 21/443 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR-------NGGRIRVSWSESLGFYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV+EM+   R       N  + +V+  E    + DV G ELW+
Sbjct  88    ARGHGHSINGQAQTSNGVVIEMNGGSRGSRLGLGNLAKPQVAVKE---MHVDVWGGELWI  144

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVLR++L HGLAP SWTDYLYL+VGGTLSN GISGQ+F +GPQI+NV E+DV+TGKGEL+
Sbjct  145   DVLRSTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGELM  204

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCS+  NS+LF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT DQE+LIS
Sbjct  205   TCSEEKNSKLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQEYLIS  264

Query  963   IDD-----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
             +         DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K YD
Sbjct  265   MHGKPSTLKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSVGANGGVLYCLEITKNYD  324

Query  798   DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
             + T  TID+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLN
Sbjct  325   ESTGDTIDQEVEALMKNLNFIPSTVFTTDLPYTDFLDRVHRAELKLRAKGLWEVPHPWLN  384

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LFVP+SRI D + GVF   IL  NKTSGPIL+YP NK +WD R S V P+E+ FY V LL
Sbjct  385   LFVPRSRIADLDRGVFKG-ILGNNKTSGPILIYPMNKNKWDQRSSVVTPDEDVFYLVALL  443

Query  438   HSSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQ  274
              S+  N       E L +QN +IL++CD+AGIK+KQYLPHY T E+W  HFG KW  F Q
Sbjct  444   RSALDNGEETQSLEYLTDQNRKILRFCDDAGIKVKQYLPHYTTREEWMDHFGDKWDRFYQ  503

Query  273   RKALFDPKLILSPGQRIFSQSSS  205
             RK  FDP+ IL+ GQRIF+ SS+
Sbjct  504   RKMEFDPRRILATGQRIFNPSSA  526



>ref|XP_009335765.1| PREDICTED: cytokinin dehydrogenase 5 [Pyrus x bretschneideri]
Length=538

 Score =   508 bits (1307),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 317/435 (73%), Gaps = 19/435 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMS--SLK--RNGGRIRVSWSESLGFYADVGGHELWVDVL  1315
             ARGHGHS  GQA   +G+V++MS  SL+  R G   RVS     G Y D  G ELW+DVL
Sbjct  90    ARGHGHSINGQAQTNNGIVIQMSGGSLRSGRPGQAARVS---EKGMYVDTWGGELWIDVL  146

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
             R++L +GLAP SWTDYLYLTVGGTLSNAGISGQ+F YGPQI+NV E+DV+TGKG+L+TCS
Sbjct  147   RSTLEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGQLLTCS  206

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--  961
             +  NSELF AVLGGLGQFG+ITRARI L+ +P RV+W+R+LY +F+ FT+DQE LIS+  
Sbjct  207   EEQNSELFHAVLGGLGQFGIITRARIALEPSPQRVRWIRVLYSNFSAFTKDQEFLISLHG  266

Query  960   ---DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
                    DYVEG +I+ +   NNWRSSFFSPS+  +I S+ S  G++Y LE+ K YD+ T
Sbjct  267   QPSSQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSIDSEGGVLYCLEITKNYDEST  326

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             A  ID+E++++ + L+F+   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFV
Sbjct  327   ADAIDKEIEDLLEKLNFVPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFV  386

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             PKSRI DFN GVF  I+   NKTSGPIL+YP NK +WD   S V P+E+ FY V LL ++
Sbjct  387   PKSRISDFNEGVFKGIL--GNKTSGPILIYPMNKDKWDQSNSVVTPDEDIFYLVALLRTA  444

Query  429   -----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
                    +  E L NQN  IL++C +AGI++KQYLPHY T+E+W  HFG KW  F +RK 
Sbjct  445   LDTGDETHTLEHLTNQNRRILRFCGDAGIEVKQYLPHYTTQEEWMDHFGDKWARFYKRKM  504

Query  264   LFDPKLILSPGQRIF  220
              FDP+ IL+ GQRIF
Sbjct  505   EFDPRRILATGQRIF  519



>ref|XP_010907734.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=540

 Score =   507 bits (1306),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 254/442 (57%), Positives = 319/442 (72%), Gaps = 18/442 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGG---RIRVSWSESLG-FYADVGGHELWVDVL  1315
             ARGHGHS  GQA A  GVV+EMS   R  G   R R  +S+SL  +Y DV G ELW+D+L
Sbjct  89    ARGHGHSINGQAQAPGGVVIEMSQYGRAVGPRERSRPVYSQSLEEYYVDVWGGELWIDIL  148

Query  1314  RASLPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
               +L +G LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++TC
Sbjct  149   NWTLENGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEILTC  208

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-  961
             SK  NSELF+ VLGGLGQFG+ITRARI L+ AP RV+W+R+LY +FT FTRDQEHLIS+ 
Sbjct  209   SKEQNSELFYGVLGGLGQFGIITRARIALEPAPRRVRWIRVLYSNFTTFTRDQEHLISLH  268

Query  960   ----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  +  DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN G++Y LE+ K +D+ 
Sbjct  269   TAHRSERFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGSNGGVLYCLEMTKNHDES  328

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
              A+ +D+E++ + K L F+   VF  D+ + DFL+RV  GE+KLR KGMWDVPHPWLNLF
Sbjct  329   AASLLDQEVEALLKKLEFVPASVFMTDLPYADFLDRVHKGELKLRAKGMWDVPHPWLNLF  388

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VP SRI DF+ GVF  I+   NKTSGPIL+YP NK +WD+R S V P+EE FY V  L S
Sbjct  389   VPGSRIADFDRGVFRTIL--GNKTSGPILIYPMNKHKWDERSSVVTPDEEVFYVVAFLRS  446

Query  432   S------RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQR  271
             +           E L +QNE IL +CDEAGI++KQYLPH+ T  +W +HFG KW  F + 
Sbjct  447   ALPDSDESTQSLEYLSDQNERILAFCDEAGIEVKQYLPHHVTRAEWARHFGAKWGRFLKL  506

Query  270   KALFDPKLILSPGQRIFSQSSS  205
             KA FDP+ IL  GQ IF  +SS
Sbjct  507   KAQFDPECILGLGQGIFLPASS  528



>ref|XP_008387997.1| PREDICTED: cytokinin dehydrogenase 5-like [Malus domestica]
Length=538

 Score =   507 bits (1305),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 246/432 (57%), Positives = 313/432 (72%), Gaps = 13/432 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR-IRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA   +GVV++MS      GR  + +     G Y D  G ELW+DVLR++
Sbjct  90    ARGHGHSINGQAQTNNGVVIQMSGGSLRSGRPAQAARVSEKGMYVDTWGGELWIDVLRST  149

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYLTVGGTLSNAGISGQ+F YGPQI+NV E+DV+TGKG+L+TCS+  
Sbjct  150   LEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNYGPQISNVHELDVVTGKGQLLTCSEEQ  209

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----  961
             NSELF AVLGGLGQFG+ITRARI L+ +P RV+W+R+LY +F+ FT+DQE LIS+     
Sbjct  210   NSELFQAVLGGLGQFGIITRARIALEPSPKRVRWIRVLYSNFSAFTKDQEFLISLHGQPS  269

Query  960   DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATT  781
                 DYVEG +I+ +   NNWRSSFFS S+  +I S+ S  G++Y LE+ K YD+ TA T
Sbjct  270   SQKFDYVEGFVIVDEGLINNWRSSFFSASNPVKITSIDSEGGVLYCLEITKNYDESTADT  329

Query  780   IDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKS  601
             ID+E++++ + L F+   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVPKS
Sbjct  330   IDKEIEDLLEKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLFVPKS  389

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS---  430
             RI DFN GVF  I+   NKTSGPIL+YP NK +WD   S V P+E+ FY V LL ++   
Sbjct  390   RISDFNEGVFKGIL--GNKTSGPILIYPMNKDKWDQSSSVVTPDEDIFYLVALLRTALDT  447

Query  429   --RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFD  256
                 +  E L NQN +IL++C +AGI++KQYLPHY T+E+W  HFG KW  F +RK  FD
Sbjct  448   GDETHTLEHLTNQNRQILRFCVDAGIEVKQYLPHYTTQEEWMDHFGDKWARFYKRKMEFD  507

Query  255   PKLILSPGQRIF  220
             P+ IL+ GQRIF
Sbjct  508   PRRILATGQRIF  519



>ref|XP_010915226.1| PREDICTED: cytokinin dehydrogenase 6-like [Elaeis guineensis]
Length=546

 Score =   507 bits (1305),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 323/439 (74%), Gaps = 17/439 (4%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRN-GGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             RGHGHS RGQA A DGVV++M+SL      RI V   +S   Y D GG +LW+DVL A+L
Sbjct  102   RGHGHSIRGQAFAPDGVVIDMASLGHGRNDRIIVHSDDSQFRYVDAGGEQLWIDVLHAAL  161

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAP SWTDYL+LTVGGTLSNAG+SGQ+FR+GPQI+NV E+DV+TGKGE++TCS+  N
Sbjct  162   EHGLAPPSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVYELDVVTGKGEMVTCSRDDN  221

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDG---  952
             SELF+AVLGGLGQ G+ITRARI L+ AP RV+WVR++YDDF +FTRDQE LI++      
Sbjct  222   SELFYAVLGGLGQLGIITRARIGLEPAPQRVRWVRLIYDDFGEFTRDQERLITMISASKE  281

Query  951   --------LDYVEGSLIMTQ-SPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
                      DYVEGS+++   S   +WRSS F+     +IA L + HG+IY LE   YYD
Sbjct  282   MKKKKGGGFDYVEGSVLVADGSLIGSWRSSSFAGWDAERIARLGAEHGVIYCLEGAMYYD  341

Query  798   DETAT---TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHP  628
               TA+    +D+EL+ + + LSF+ G  F  DVS+  FL+RV  GE+KLR KG+WDVPHP
Sbjct  342   WVTASRSWVVDQELELLLEELSFVPGFAFTNDVSYERFLDRVHEGELKLRSKGLWDVPHP  401

Query  627   WLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCV  448
             WLN+FVPKSRI DFN G+F   IL+ NK++GPIL YP N+ +WD RMS+V+P+EE FY +
Sbjct  402   WLNIFVPKSRIQDFNTGIF-KRILKHNKSTGPILFYPMNRDKWDKRMSSVIPDEEIFYSI  460

Query  447   GLLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRK  268
             G L S+ +N+WE L N N EIL++CD+ GIK KQYLPHY ++EDW KHFG +W  F + K
Sbjct  461   GFLWSAIINDWEYLENLNLEILRFCDQEGIKYKQYLPHYLSQEDWMKHFGSRWDKFFEMK  520

Query  267   ALFDPKLILSPGQRIFSQS  211
               +DPK +LSPGQ+IF+ S
Sbjct  521   RKYDPKALLSPGQKIFTTS  539



>ref|XP_006473567.1| PREDICTED: cytokinin dehydrogenase 5-like [Citrus sinensis]
Length=572

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 256/446 (57%), Positives = 319/446 (72%), Gaps = 24/446 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESL-------GFYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV++MS  +  G R+  S   +L         Y DV G ELW+
Sbjct  127   ARGHGHSINGQAQTSNGVVIQMSGSR--GRRLGSSTPAALRPHVYEKERYVDVWGGELWI  184

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVLR++L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F  GPQI NV E+DV+TGKGEL+
Sbjct  185   DVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELL  244

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCS+  NS LF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY DF+ FTRDQE+LIS
Sbjct  245   TCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLIS  304

Query  963   IDD-----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
             + +       DYVEG +I+ +   NNWRSSFFSP +  +I SL ++ G++Y LE+ K YD
Sbjct  305   LHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEITKNYD  364

Query  798   DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
             + TA T D+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLN
Sbjct  365   ESTADTTDQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLN  424

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LF+PKSRI DF+ GVF  I+   NKT GPIL+YP NK +WD+R S V P+E+ FY V  L
Sbjct  425   LFIPKSRIADFDKGVFKGIL--GNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFL  482

Query  438   HSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQ  274
              S+      +   E L +QN +ILK+CDEAGIK KQYLPHY T+E+W  HFG KW  F Q
Sbjct  483   RSALDNGEEMQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQEEWVDHFGDKWGQFYQ  542

Query  273   RKALFDPKLILSPGQRIFS---QSSS  205
             RK  FDP+ IL+ GQRIF    QSSS
Sbjct  543   RKMEFDPRYILATGQRIFKPSFQSSS  568



>ref|XP_011048828.1| PREDICTED: cytokinin dehydrogenase 5-like [Populus euphratica]
Length=534

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 252/442 (57%), Positives = 318/442 (72%), Gaps = 21/442 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR-------NGGRIRVSWSESLGFYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV+EMS   R       N  + +V+  E    + DV G ELW+
Sbjct  88    ARGHGHSINGQAQTNNGVVIEMSGGSRGSRLGLGNLAKQQVAVKE---MHVDVWGGELWI  144

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVLR +L HGLAP SWTDYLYL+VGGTLSN GISGQ+F +GPQI+NV E+DV+TGKGEL+
Sbjct  145   DVLRRTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGELM  204

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCS+  NS+LF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT DQE+LIS
Sbjct  205   TCSEEKNSKLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTGDQEYLIS  264

Query  963   IDD-----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
             +         DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K YD
Sbjct  265   MHGKPSTLKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSVGANGGVLYCLEITKNYD  324

Query  798   DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
             + T  TID+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLN
Sbjct  325   ESTGDTIDQEVEALMKNLNFIPSTVFTTDLPYTDFLDRVHRAELKLRAKGLWEVPHPWLN  384

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LFVP+SRI D + GVF   IL  NKTSGPIL+YP NK +WD R S V P+E+ FY V LL
Sbjct  385   LFVPRSRIADLDRGVFKG-ILGNNKTSGPILIYPMNKNKWDQRSSVVTPDEDVFYLVALL  443

Query  438   HSSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQ  274
              S+  N       E L +QN +IL++CD+AGIK+KQYLPHY T E+W  HFG KW  F Q
Sbjct  444   RSALDNGEETQSLEYLTDQNGKILRFCDDAGIKVKQYLPHYTTREEWMDHFGDKWDRFYQ  503

Query  273   RKALFDPKLILSPGQRIFSQSS  208
             RK  FDP+ IL+ GQRIF+ SS
Sbjct  504   RKMEFDPRRILATGQRIFNPSS  525



>ref|XP_002510450.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF52637.1| gulonolactone oxidase, putative [Ricinus communis]
Length=540

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 253/443 (57%), Positives = 317/443 (72%), Gaps = 24/443 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAK-DGVVVEMSSLK--------RNGGRIRVSWSESLGFYADVGGHEL  1330
             ARGHGHS  GQA  + +GVV+EMS           R     +VS  E    + DV G EL
Sbjct  89    ARGHGHSINGQAQTRINGVVIEMSGSDSRRSQLGLRKPASPKVSAKE---MHVDVWGGEL  145

Query  1329  WVDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGE  1150
             W+DVL+++L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE
Sbjct  146   WIDVLKSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGE  205

Query  1149  LITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHL  970
             ++TCS   NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F+ FTRDQE+L
Sbjct  206   ILTCSDQQNSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSSFSSFTRDQEYL  265

Query  969   ISIDDG-----LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKY  805
             IS+         DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K 
Sbjct  266   ISLQGNSAAQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEVTKN  325

Query  804   YDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPW  625
             YDD T  TID+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPW
Sbjct  326   YDDSTVDTIDQEIEWLLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPW  385

Query  624   LNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG  445
             LNLFVPKSRI DF+ GVF  I+   NKTSGPIL+YP N+ +W+ R SAV P+EE FY V 
Sbjct  386   LNLFVPKSRIADFDKGVFKGIL--GNKTSGPILIYPMNRNKWEQRSSAVTPDEEVFYLVA  443

Query  444   LLHSSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIF  280
             LL S+  N       E L NQN +IL++CD+AGIK+KQYLPHY +EE+W  HFG KW  F
Sbjct  444   LLRSALDNGEETQTLEYLSNQNRQILRFCDDAGIKVKQYLPHYTSEEEWVDHFGDKWSKF  503

Query  279   QQRKALFDPKLILSPGQRIFSQS  211
                K  FDP+ IL+ GQRIF  S
Sbjct  504   YHNKMEFDPRRILATGQRIFMPS  526



>ref|XP_009761052.1| PREDICTED: cytokinin dehydrogenase 5 [Nicotiana sylvestris]
Length=527

 Score =   505 bits (1301),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/435 (58%), Positives = 313/435 (72%), Gaps = 14/435 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS  GQA   +GVV++MS    +  ++    SE    YADV G ELW+DVL ++L
Sbjct  88    ARGHGHSINGQAMITNGVVIQMSGGSNSKQKLLTEVSEKF-MYADVWGGELWIDVLTSTL  146

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI NV E+DV+TGKGEL+TCS+  N
Sbjct  147   EYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQINNVHELDVVTGKGELLTCSEKEN  206

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----D  958
             SELF A LGGLGQFG+ITRARI L++AP RV+W+R+LY +F+ FT DQE+LIS+      
Sbjct  207   SELFHAALGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTEDQEYLISLHGKPAS  266

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
                DYVEG +I+ +   NNWRSSFFSPS+  +I+SL S  G++Y LE+ K Y    A  +
Sbjct  267   QKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSLKSEGGVLYCLEITKNYHLSNADIV  326

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+E++ + K L +I   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLNLFVPKSR
Sbjct  327   DQEIETLLKKLKYIPASVFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSR  386

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN-  421
             I DF+ GVF  I+   NKTSGPIL+YP NK +WD+R S V PEEE FY VG L S+  N 
Sbjct  387   IADFDKGVFKGIL--GNKTSGPILIYPMNKNKWDERSSVVTPEEEVFYLVGFLRSALTNG  444

Query  420   ----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKK-WQIFQQRKALFD  256
                   E L NQN +ILK+C++A IKIKQYLPHY T+ +W  HFG K W  FQQRK  FD
Sbjct  445   DETQTLEYLSNQNYQILKFCEDAKIKIKQYLPHYTTQREWRDHFGDKYWTRFQQRKLDFD  504

Query  255   PKLILSPGQRIFSQS  211
             P+ IL+ GQRIF  S
Sbjct  505   PRHILATGQRIFMPS  519



>ref|XP_011028922.1| PREDICTED: cytokinin dehydrogenase 5-like [Populus euphratica]
Length=534

 Score =   506 bits (1302),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 254/439 (58%), Positives = 319/439 (73%), Gaps = 21/439 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMS--SLKRNGG-----RIRVSWSESLGFYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV+EMS  S  R  G     + +VS  E    + DV G ELW+
Sbjct  87    ARGHGHSINGQAQTSNGVVIEMSGGSKGRRLGLRKLDKPQVSIKEK---HVDVWGGELWI  143

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVLR +L HGLAP SWTDYLYL+VGGTLSN GISGQ+F +GPQI+NV E+DV+TGKGEL 
Sbjct  144   DVLRRTLEHGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGELW  203

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCS+  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FTRDQE LIS
Sbjct  204   TCSEEENSELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSTFTRDQEDLIS  263

Query  963   I-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
             +         DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K YD
Sbjct  264   LHGNPYSQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEITKNYD  323

Query  798   DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
             + TA TID+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLN
Sbjct  324   EATADTIDQEVEALMKRLNFIPSSVFTTDLPYIDFLDRVHKAELKLRAKGLWEVPHPWLN  383

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LFVPKSR+ D + GVF   IL  NKTSGPIL+YP NK++WD R S V P+E+ FY V LL
Sbjct  384   LFVPKSRMADVDRGVFKG-ILGNNKTSGPILIYPMNKSKWDQRSSVVTPDEDVFYLVALL  442

Query  438   HSSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQ  274
              S+  N       E L NQN ++L++CD+AGIK+KQYLPHY T+E+W  HFG KW  F +
Sbjct  443   RSALDNGEETQSLEYLTNQNHKVLRFCDDAGIKVKQYLPHYTTQEEWRDHFGDKWDQFSR  502

Query  273   RKALFDPKLILSPGQRIFS  217
             RK  FDP+ IL+ GQRIF+
Sbjct  503   RKMEFDPRHILATGQRIFN  521



>ref|XP_008796604.1| PREDICTED: cytokinin dehydrogenase 5-like [Phoenix dactylifera]
Length=554

 Score =   506 bits (1304),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 253/437 (58%), Positives = 312/437 (71%), Gaps = 18/437 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGG---RIRVSWSESLG-FYADVGGHELWVDVL  1315
             ARGHGHS  GQA A  GVV+EMS   R  G   R R  +S SLG +Y DV G ELW+D+L
Sbjct  89    ARGHGHSIDGQAQAPGGVVIEMSQYGRAAGHRARPRPVYSPSLGEYYVDVWGGELWIDIL  148

Query  1314  RASLPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
               +L +G LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TG GE++TC
Sbjct  149   NWTLENGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGMGEILTC  208

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S+  NSELF+ VLGGLGQFG+ITRARI L+ AP RV+W+R+LY +FT FTRDQEHLIS+ 
Sbjct  209   SEEENSELFYGVLGGLGQFGIITRARIALEPAPRRVRWIRVLYSNFTTFTRDQEHLISLH  268

Query  957   DG-----LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                     DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K YD+ 
Sbjct  269   SAHRSERFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSIGANGGVLYCLEMTKNYDES  328

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             TA  +D+E++ +   L FI   VF  D+ + DFL+RV   E+KLR KGMWDVPHPWLNLF
Sbjct  329   TAGLVDQEVEALLTKLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGMWDVPHPWLNLF  388

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VP SRI DF+ GVF  I+   NKTSGPIL+YP NK +WD+R S V PEEE FY V  L S
Sbjct  389   VPGSRIADFDHGVFRAIL--GNKTSGPILIYPMNKHKWDERSSVVTPEEEVFYLVAFLRS  446

Query  432   S------RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQR  271
             +           E L  QNE IL +C+EAGI++KQYLPH+ T  DW +HFG KW  F++ 
Sbjct  447   ALPDSDESTQSLEYLSQQNERILAFCEEAGIQVKQYLPHHLTRADWARHFGPKWGRFRRL  506

Query  270   KALFDPKLILSPGQRIF  220
             KA FDPK IL  GQ IF
Sbjct  507   KAQFDPKCILGSGQGIF  523



>ref|XP_006435071.1| hypothetical protein CICLE_v10000709mg [Citrus clementina]
 gb|ESR48311.1| hypothetical protein CICLE_v10000709mg [Citrus clementina]
Length=572

 Score =   506 bits (1304),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 256/446 (57%), Positives = 319/446 (72%), Gaps = 24/446 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESL-------GFYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV++MS  +  G R+  S   +L         Y DV G ELW+
Sbjct  127   ARGHGHSINGQAQTSNGVVIQMSGSR--GRRLGSSTPAALRPHVYEKERYVDVWGGELWI  184

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVLR++L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F  GPQI NV E+DV+TGKGEL+
Sbjct  185   DVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELL  244

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCS+  NS LF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY DF+ FTRDQE+LIS
Sbjct  245   TCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLIS  304

Query  963   IDD-----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
             + +       DYVEG +I+ +   NNWRSSFFSP +  +I SL ++ G++Y LE+ K YD
Sbjct  305   LHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGADGGVLYCLEITKNYD  364

Query  798   DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
             + TA T D+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLN
Sbjct  365   ESTAETTDQEVESLLKKLNFIPSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLN  424

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LF+PKSRI DF+ GVF  I+   NKT GPIL+YP NK +WD+R S V P+E+ FY V  L
Sbjct  425   LFIPKSRIADFDKGVFKGIL--GNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFL  482

Query  438   HSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQ  274
              S+      +   E L +QN +ILK+CDEAGIK KQYLPHY T+E+W  HFG KW  F Q
Sbjct  483   RSALDNGEEMQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQEEWVDHFGDKWGQFYQ  542

Query  273   RKALFDPKLILSPGQRIFS---QSSS  205
             RK  FDP+ IL+ GQRIF    QSSS
Sbjct  543   RKMEFDPRHILATGQRIFKPSFQSSS  568



>ref|XP_003550630.1| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=560

 Score =   505 bits (1301),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 244/429 (57%), Positives = 314/429 (73%), Gaps = 11/429 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNG-GRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             RG  HS  GQA    GVVV M+ L   RNG G + V    ++G YADVGG ++W+DVL A
Sbjct  135   RGQAHSVHGQAMTNHGVVVNMTELNGFRNGDGIVVVVDDTTIGPYADVGGEQIWIDVLHA  194

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GL P+SWTDYLYL+VGGTLSNAGISGQ+FR+GPQI+NV ++DV+TGKG+L+TCS  
Sbjct  195   TLERGLTPLSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVHQLDVVTGKGDLVTCSAE  254

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF+AVLGGLGQFG+ITRARI L  APTRVKW+R+LY+DF+ F+ DQEHLIS +   
Sbjct  255   NNSELFYAVLGGLGQFGIITRARIALGPAPTRVKWLRLLYNDFSAFSGDQEHLISFNGIN  314

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               +  DYVEG L+  Q P +    SF+    Q +I SL++ +GIIY +ELVKYYD+ T  
Sbjct  315   ETNAADYVEGFLLQNQPPLD---LSFYPEPDQPRITSLVTQYGIIYVIELVKYYDNSTQE  371

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +DE+++ + + L F    +FEKDVS+ +FLNRV + E+ LR +G+WDVPHPWLNLFVP 
Sbjct  372   HVDEDVKLLVERLKFFPTFMFEKDVSYEEFLNRVHADELFLRSQGLWDVPHPWLNLFVPA  431

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRI DF+ GVF  IIL+QN T+G +++YP N+ +WDD MSAV P ++ FY V  L S+  
Sbjct  432   SRISDFDEGVFKGIILQQNITAGLVIIYPMNRTKWDDNMSAVTPHDDVFYVVSFLRSTGF  491

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             ++ EE   QN +IL++C  AG+ IKQYLP  KT E WE+ FG KW+ F+QRKA FDP  I
Sbjct  492   DKLEEFKAQNRQILQFCANAGMGIKQYLPQNKTREKWEEQFGPKWKTFKQRKAQFDPNRI  551

Query  243   LSPGQRIFS  217
             LSPGQ IF+
Sbjct  552   LSPGQGIFN  560



>ref|XP_010275527.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X1 [Nelumbo 
nucifera]
Length=535

 Score =   504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 249/437 (57%), Positives = 317/437 (73%), Gaps = 17/437 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRI-RVSWSESLGF---YADVGGHELWVDVL  1315
             ARGHGHS  GQA A +GVV+ MSS      R+ R S S  LG    Y DV G ELW+DVL
Sbjct  89    ARGHGHSISGQAQAANGVVIAMSSSISKRNRLTRPSLSLGLGHKSSYVDVWGGELWIDVL  148

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              ++L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++TCS
Sbjct  149   NSTLEHGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEILTCS  208

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-  958
                NS+LF AVLGGLGQFG+ITRARI L+ AP RVKW+R+LY  F+ FT+DQE+LIS++ 
Sbjct  209   NEQNSQLFHAVLGGLGQFGIITRARIALEPAPQRVKWIRVLYSKFSAFTKDQEYLISLNG  268

Query  957   ----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASL--ISNHGIIYSLELVKYYDD  796
                 +  DYVEG +I+ +   NNWRSSFFSP +  +I+SL   +N G++Y LE+ K YD+
Sbjct  269   HPASERFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGAAANGGVLYCLEITKNYDE  328

Query  795   ETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
              ++ T+D+E++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNL
Sbjct  329   SSSDTVDQEVEALLKKLDFIPTSVFTTDIPYVDFLDRVHKAELKLRAKGLWDVPHPWLNL  388

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH  436
             FVPKSRI DF+ GVF   IL   KTSGPIL+YP N+ +W+ R S V P+E+TFY V LL 
Sbjct  389   FVPKSRIADFDQGVFKG-ILGNKKTSGPILIYPMNRNKWNQRSSVVTPDEDTFYLVALLR  447

Query  435   SS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQR  271
             S+          + L NQN +IL++C E GIK+KQYLP+  T+E+W+ HFG KW +  +R
Sbjct  448   SALDSGEETQTLDYLSNQNRQILRFCKETGIKVKQYLPNLSTQEEWKDHFGDKWDLIVKR  507

Query  270   KALFDPKLILSPGQRIF  220
             K  FDPK IL+ GQRIF
Sbjct  508   KMEFDPKHILATGQRIF  524



>ref|XP_011083611.1| PREDICTED: LOW QUALITY PROTEIN: cytokinin dehydrogenase 5 [Sesamum 
indicum]
Length=521

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 246/430 (57%), Positives = 315/430 (73%), Gaps = 14/430 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS  GQA   +G + +MS  +      RVS       Y DV G ELW+DVLR++L
Sbjct  88    ARGHGHSINGQAMTGNGXI-QMSGSRGKPAPPRVS---EKSMYVDVWGGELWIDVLRSTL  143

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GLAP SWTDYLYL+VGGTL+NAGISGQ+F +GPQI+NV E+DV+TGKGEL+TCSK  N
Sbjct  144   EYGLAPKSWTDYLYLSVGGTLANAGISGQAFNHGPQISNVYELDVVTGKGELLTCSKEQN  203

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---DDG  952
             SEL+ AVLGGLGQFG+ITRARI L++AP RV+W+R+LY +FT FT+DQE+LIS+      
Sbjct  204   SELYDAVLGGLGQFGIITRARIALERAPRRVRWIRVLYSNFTAFTQDQEYLISLHGQPQK  263

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+SL ++ G++Y LE+ K Y +  A TID+
Sbjct  264   FDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLNADGGVLYCLEITKNYQESNADTIDQ  323

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +WDVPHPWLNLFVPKSRI 
Sbjct  324   EVEALLKKLNFIPASVFTTDLPYVDFLDRVHKAELKLRAKNLWDVPHPWLNLFVPKSRIA  383

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN---  421
             DF+ GVF  I+   N TSGPIL+YP NK +WDD+ S V P E+ FY V LL S+  N   
Sbjct  384   DFDKGVFKGIL--GNNTSGPILIYPMNKNKWDDKSSVVTPNEDVFYLVALLRSALDNGDE  441

Query  420   --EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
                 E L NQN  IL++CDEAGI +KQYLPHY T+++W +HFG+KW +F +RK  FDP+ 
Sbjct  442   TQGLEYLSNQNRGILQFCDEAGINVKQYLPHYSTQQEWMRHFGEKWSLFSRRKMEFDPRH  501

Query  246   ILSPGQRIFS  217
             IL+ GQRIF+
Sbjct  502   ILATGQRIFA  511



>ref|XP_006475550.1| PREDICTED: cytokinin dehydrogenase 3-like [Citrus sinensis]
Length=561

 Score =   505 bits (1300),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 246/431 (57%), Positives = 324/431 (75%), Gaps = 15/431 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G  HS  GQA A DGVVV+M+SL R  NG  I +S   SLGFYADVGG +LW+DVL A
Sbjct  136   AKGQAHSTWGQAQANDGVVVQMNSLNRFRNGTGILISGDRSLGFYADVGGEQLWIDVLNA  195

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GL+PVSWTDYLY TVGGTLSNAGISG +++ GPQI NV+E+DV+TGKGE +TCS  
Sbjct  196   TLTRGLSPVSWTDYLYPTVGGTLSNAGISGHTYQKGPQITNVLELDVLTGKGEFVTCSPQ  255

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---D  958
              +SELF+AVLGGLGQFG+ITRARIVL  A  RVKW+R+LY DF+ F+ DQE LIS     
Sbjct  256   KDSELFYAVLGGLGQFGIITRARIVLGPAKKRVKWLRILYSDFSSFSTDQETLISTTGPS  315

Query  957   DGL--DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
             D +  D++EG L+M QSP +     F+  S + +I  L++ +GI+Y +E+V YYD++   
Sbjct  316   DKVMPDFLEGHLLMNQSPLD-----FYPQSQRRKITFLVNQYGILYIIEVVTYYDNKNEA  370

Query  783   TIDEELQEMFKGLS-FIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
              +++++++M K L  F+ G VFEKDV++  FLNRV   E++LR+KG+WD+PHPWLN+F+P
Sbjct  371   KVNQKVKQMLKSLKGFLPGFVFEKDVTYLQFLNRVHDQEIELRKKGLWDIPHPWLNIFIP  430

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVV-PEEETFYCVGLLHSS  430
             KSRI DF+ GVF +I+L++N TS  +LVYP  +++WD+RMSAV+  EEE FY VG L +S
Sbjct  431   KSRITDFDNGVFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIAAEEEVFYFVGFLDAS  490

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               N WE   N+N++IL++C  AGIK KQYL H+ T+E+W  HFG KW  FQQRK  FDP+
Sbjct  491   ADN-WEAFDNKNKDILQFCVNAGIKFKQYLGHHATKEEWIIHFGSKWNTFQQRKTRFDPR  549

Query  249   LILSPGQRIFS  217
             +ILSPGQRIF+
Sbjct  550   MILSPGQRIFN  560



>ref|XP_006451487.1| hypothetical protein CICLE_v10010516mg, partial [Citrus clementina]
 gb|ESR64727.1| hypothetical protein CICLE_v10010516mg, partial [Citrus clementina]
Length=527

 Score =   504 bits (1297),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 243/432 (56%), Positives = 320/432 (74%), Gaps = 18/432 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G  HS  GQA A  GVVV+MSSL   RNG  I +S   S GFYADVGG +LW+DVL A
Sbjct  105   AKGQAHSTWGQAQANKGVVVQMSSLNSFRNGTGILISGDRSSGFYADVGGEQLWIDVLNA  164

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GL+PVSWTDYLYLT+GGTLSNAGISGQ++R GPQI NV+E+DV+TGKGE +TC+  
Sbjct  165   TLARGLSPVSWTDYLYLTIGGTLSNAGISGQTYRKGPQITNVLELDVLTGKGEFVTCTSQ  224

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              ++ELF+AVLGGLGQFG+ITRARIVL+ A  RVKW+R+LY DF+ F+ DQE LIS     
Sbjct  225   KDTELFYAVLGGLGQFGIITRARIVLEPAKERVKWLRILYSDFSSFSTDQETLISTTGPS  284

Query  948   -----DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
                  DY+EG L+M+QSP +     F+  S   +I SLI+ +GI+Y +E+  YYD++   
Sbjct  285   HKVMPDYLEGQLLMSQSPLD-----FYPQSQHQKITSLINQYGIVYLIEVATYYDNKNE-  338

Query  783   TIDEELQEMFKGLS-FIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
               D+ +++M K L  F+ G VFEKDV++ +FLNRV   E+ LR+KG+WD+PHPWLN+F+P
Sbjct  339   --DKRVKQMLKSLKGFVHGFVFEKDVTYLEFLNRVHDEEIVLRKKGLWDIPHPWLNIFIP  396

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP-EEETFYCVGLLHSS  430
             +SRI DF+ G   +I+L++N TS  +LVYP  +++WD+RMSAV+P EE+ FY VG L +S
Sbjct  397   RSRITDFDNGALRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIPDEEDVFYVVGFLDAS  456

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               ++WE   N+N++IL++C   GIK KQYL H+ T+E+W  HFG KW  FQQ KA FDPK
Sbjct  457   -ADDWETFDNRNKDILQFCVNGGIKFKQYLGHHATKEEWINHFGSKWNTFQQSKARFDPK  515

Query  249   LILSPGQRIFSQ  214
             +ILSPGQRIF+ 
Sbjct  516   MILSPGQRIFNN  527



>gb|EYU29892.1| hypothetical protein MIMGU_mgv1a007407mg [Erythranthe guttata]
Length=408

 Score =   498 bits (1281),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 249/412 (60%), Positives = 322/412 (78%), Gaps = 10/412 (2%)
 Frame = -3

Query  1443  AKDGVVVEMSSL--KRNGGRIRVSWSESLGFYADVGGHELWVDVLRASLPHGLAPVSWTD  1270
              + GVVVEM+SL   +NG  I V   +    YADVGG +LWVDVLRA+L  GLAPVSWTD
Sbjct  2     TRGGVVVEMTSLGNSQNGSGISVCSDQG---YADVGGDQLWVDVLRATLEQGLAPVSWTD  58

Query  1269  YLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINSELFFAVLGGL  1090
             YLYL+VGGTLSNAGISGQ+F +GPQI NV+E+DVITGKGE +TCSK+ N ELFF VLGGL
Sbjct  59    YLYLSVGGTLSNAGISGQAFLHGPQINNVLELDVITGKGEFVTCSKNENPELFFGVLGGL  118

Query  1089  GQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDYVEGSLIMTQSP  910
             GQFG+ITRARIVLDKAPTRVKWVR+LY DF   T+DQEHLISI +  +YVEG L+  ++ 
Sbjct  119   GQFGIITRARIVLDKAPTRVKWVRLLYSDFGTLTKDQEHLISI-EAPNYVEGFLVTNENT  177

Query  909   ANNWRSSFFSPSHQSQ-IASLISNHGIIYSLELVKYYDDETATTIDEELQEMFKGLSFIG  733
              N+WRSSF SPS+QS  ++S   N+G++Y++ELVKYYD++TA TID+E +++ K L+FI 
Sbjct  178   TNDWRSSFSSPSNQSDVVSSFKKNNGLLYAIELVKYYDNQTAQTIDQEFEKLLKELNFIP  237

Query  732   GLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFNVGVFVDIILR  553
             G +F  DV+FFDFLNRV + +    +K      HPWLNLF+P+SRI DFN GVF  II  
Sbjct  238   GFIFSTDVAFFDFLNRVGNLD---NEKLPLTESHPWLNLFIPRSRISDFNSGVFTTIIPE  294

Query  552   QNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELGNQNEEILKYC  373
              N+  G  + YP N+ +WDDRMSAV+P+E+ FY + LLH+S  NE++ +   N +IL++C
Sbjct  295   FNEPFGLFIFYPLNRNKWDDRMSAVIPDEDVFYTLALLHTSGANEYQTIDKFNGQILEFC  354

Query  372   DEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRIFS  217
             ++AGI++KQYLP+Y++++DW KH+G KW I Q+RKA+FDPK+ILSPGQRIF+
Sbjct  355   EKAGIEVKQYLPNYQSKQDWIKHYGSKWNIIQKRKAMFDPKMILSPGQRIFN  406



>ref|XP_006577980.1| PREDICTED: cytokinin dehydrogenase 5-like [Glycine max]
Length=524

 Score =   502 bits (1292),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 251/431 (58%), Positives = 313/431 (73%), Gaps = 15/431 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKD--GVVVEM--SSLKRNGGRIRVSWSESLGFYADVGGHELWVDVL  1315
             ARGHGHS  GQA  K+  GVV+EM  S    +G  IRVS     G Y DV G +LW+DVL
Sbjct  89    ARGHGHSINGQAMIKEKKGVVIEMGKSDSGEDGSSIRVS---EKGMYVDVWGGKLWIDVL  145

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              A+L +GLAP+SWTDYLYL+VGGTLSNAGISGQ+F +GPQI NV E+DV+TGKGEL+TCS
Sbjct  146   SATLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTGKGELVTCS  205

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-  958
             +  NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F +F +DQE+LIS+  
Sbjct  206   EDRNSELFHAVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLISLHG  265

Query  957   ----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
                 +  DYVEG +I+ +   NNWRSSFFS S+  +I SL ++ G++Y LE+ K YD   
Sbjct  266   KAARERFDYVEGFVIVDEGLINNWRSSFFSASNPVKITSLNADGGVLYCLEITKNYDQGN  325

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             A ++DEE+Q + K L+FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFV
Sbjct  326   ADSVDEEIQALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFV  385

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             PKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R S V PEE+ FY V  L S+
Sbjct  386   PKSRIGDFDKGVFKGIL--GNKTSGPILIYPMNKNKWDQRSSVVTPEEDVFYLVAFLRSA  443

Query  429   RVNE-WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
                E  E L NQN +ILK+C +  IK+KQYLPHY T+++W  HFG KW  F  RK  FDP
Sbjct  444   LDTETLEYLTNQNRQILKFCHDIEIKVKQYLPHYTTQQEWMDHFGDKWTQFNARKMQFDP  503

Query  252   KLILSPGQRIF  220
             + IL+ GQ+IF
Sbjct  504   RRILATGQQIF  514



>ref|XP_008221343.1| PREDICTED: cytokinin dehydrogenase 5 [Prunus mume]
Length=543

 Score =   503 bits (1294),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 250/439 (57%), Positives = 313/439 (71%), Gaps = 23/439 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNG--------GRIRVSWSESLGFYADVGGHELW  1327
             ARGHGHS  GQA   +GVV+EM+    +G        G  RVS     G Y D  G ELW
Sbjct  89    ARGHGHSINGQAQTNNGVVIEMNGGGSSGRVMSRVRSGSGRVS---EKGMYVDAWGGELW  145

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             +DVL ++L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI++V E+DV+TG+GEL
Sbjct  146   IDVLMSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISSVDELDVVTGRGEL  205

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
             +TCS+  N+ELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT+DQE LI
Sbjct  206   LTCSEEKNAELFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSAFTKDQEFLI  265

Query  966   SI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             S+         DYVEG +I+ +   NNWRSSFFSPS+  +I S+ S  G++Y LE+ K Y
Sbjct  266   SLHGQPSTHKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKITSINSQGGVLYCLEITKNY  325

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
              + TA TID+E++ + K L F+   VF  D+ + DFL+RV   E+KLR K +WDVPHPWL
Sbjct  326   HESTADTIDQEIECLLKKLDFVPTSVFTTDLPYVDFLDRVHKAELKLRSKSLWDVPHPWL  385

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLFVPKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R S V P+E+ FY V L
Sbjct  386   NLFVPKSRISDFDEGVFKGIL--GNKTSGPILIYPMNKDKWDQRSSVVTPDEDIFYLVAL  443

Query  441   LHSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQ  277
             L S+       +  E L NQN +ILK+CD+AGIK KQYLPHY T+E+W  HFG KW  F 
Sbjct  444   LRSALDTGDETHTLEHLTNQNRQILKFCDDAGIKAKQYLPHYTTQEEWMDHFGDKWDQFY  503

Query  276   QRKALFDPKLILSPGQRIF  220
             QRK  FDP+ IL+ GQRIF
Sbjct  504   QRKVDFDPRRILATGQRIF  522



>ref|XP_004144113.1| PREDICTED: cytokinin dehydrogenase 4-like [Cucumis sativus]
 ref|XP_004158467.1| PREDICTED: cytokinin dehydrogenase 4-like [Cucumis sativus]
Length=518

 Score =   501 bits (1289),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/428 (57%), Positives = 321/428 (75%), Gaps = 8/428 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATA-KDGVVVEMSSL---KRNGGRIRVSWSESLGFYADVGGHELWVDVL  1315
             ARG GH  RGQA   ++GVVV M+SL   ++   RI V+ +  LG YADVG  +LW+DVL
Sbjct  92    ARGQGHCVRGQALVDQNGVVVNMTSLGGLRQKTSRIVVTTTSPLGPYADVGAEQLWIDVL  151

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              A+   GL+PVSW DYL++TVGGTLSNAGISGQ+FR+GPQI NV E+DVITGKGE +TCS
Sbjct  152   HATTQKGLSPVSWVDYLHITVGGTLSNAGISGQTFRFGPQINNVYELDVITGKGESLTCS  211

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-  958
                N ELF+++LGGLGQFG+ITRARI L   PTRVKWVRMLY +F+ FT DQE LIS D 
Sbjct  212   PTNNPELFYSLLGGLGQFGIITRARIALAPTPTRVKWVRMLYTNFSSFTSDQESLISRDP  271

Query  957   -DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATT  781
              +  DY+EG L++  +  +  +SSF+    Q +I+SL+S +GI+Y LELVKYYD  ++++
Sbjct  272   SNAPDYLEGLLLLQLNAGD--KSSFYPLPDQPKISSLVSQYGIVYVLELVKYYDQHSSSS  329

Query  780   IDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKS  601
             +D+EL+ +  GL F  G+ F KD S+ +FL+RV + EV LR  G+W+VPHPW+NLFVPKS
Sbjct  330   VDQELETLLGGLKFEAGMKFVKDASYEEFLDRVHTDEVALRALGLWEVPHPWINLFVPKS  389

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN  421
             RI DF+ GVF  II ++N TSG  L YP  K +WD+R SAV+P+EE FY  G L SS   
Sbjct  390   RIADFDSGVFRGIIQKRNLTSGVFLFYPMFKNKWDERTSAVIPDEEVFYAAGFLLSSGFK  449

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
             +WE +     +ILK+C+EAGI++KQYLPH++TE+DW  HFG+KW +F+QRK++FDPK +L
Sbjct  450   DWETVDGHGRDILKFCEEAGIEVKQYLPHFETEKDWINHFGRKWSVFRQRKSMFDPKHLL  509

Query  240   SPGQRIFS  217
             SPGQ+IF+
Sbjct  510   SPGQKIFN  517



>ref|XP_010932835.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
 ref|XP_010932844.1| PREDICTED: cytokinin dehydrogenase 5-like [Elaeis guineensis]
Length=535

 Score =   500 bits (1288),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 253/435 (58%), Positives = 313/435 (72%), Gaps = 17/435 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVS--WSESLG-FYADVGGHELWVDVLR  1312
             ARGHGHS  GQA A+ GVV+EMS  +  G R R    +S SLG +Y DV G ELW+D+L 
Sbjct  89    ARGHGHSINGQARAQGGVVIEMSYDRAVGHRARSHPVYSPSLGEYYVDVWGGELWIDILN  148

Query  1311  ASLPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              +L +G LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DVITGKGE++TCS
Sbjct  149   WTLENGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYEVDVITGKGEIVTCS  208

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--  961
             +  NSELF  VLGGLGQFG+ITRAR+ L+ AP RV+W+R+LY +FT FTRDQE LIS+  
Sbjct  209   EEQNSELFHGVLGGLGQFGIITRARLALEPAPQRVRWIRVLYSNFTTFTRDQELLISLHG  268

Query  960   ---DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
                 +  DYVEG +I+ +   NNWRSSFFSP +   I+S+ +N G++Y LE+ K YDD T
Sbjct  269   THRSERFDYVEGFVIVDEGLINNWRSSFFSPRNSVNISSIGTNGGVLYCLEMTKNYDDST  328

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             A  +D+E++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFV
Sbjct  329   ADFVDQEVEALLKRLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLFV  388

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             P SRI DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY VG L S+
Sbjct  389   PASRIADFDHGVFRGIL--GNKTSGPILIYPMNKHKWDERSSAVTPDEEVFYLVGFLRSA  446

Query  429   ------RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRK  268
                        E L  QNE IL +CDEAGI++KQYLPH+ T  +W +HFG KW  F + K
Sbjct  447   LPYSGESTQSLEYLSQQNERILAFCDEAGIEVKQYLPHHLTRAEWARHFGTKWDRFLRLK  506

Query  267   ALFDPKLILSPGQRI  223
             A FDPK IL  GQ I
Sbjct  507   AEFDPKGILGSGQGI  521



>ref|XP_009124316.1| PREDICTED: cytokinin dehydrogenase 2-like [Brassica rapa]
Length=505

 Score =   499 bits (1284),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 239/423 (57%), Positives = 307/423 (73%), Gaps = 12/423 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+   GVV+ M+ L      I VS  +    YADV G  LWVDVLR + 
Sbjct  93    ARGQGHSLNGQASVSGGVVINMTCL----ADITVSEDKE---YADVAGGTLWVDVLRETA  145

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL+++VGGTLSNAGI GQ FR GPQI+NV+E+DVITGKGE + CS  +N
Sbjct  146   EQGVSPVSWTDYLHISVGGTLSNAGIGGQMFRNGPQISNVLELDVITGKGETLACSPQLN  205

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+I+RARIVL+ AP R KW +MLY DFT FT+DQE LIS+  D G+
Sbjct  206   PELFYGVLGGLGQFGIISRARIVLNHAPKRAKWFKMLYSDFTAFTKDQESLISMNNDTGV  265

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DYVEG  +M+    +   +SFF PS QS++A L+ NH IIY LE+ KYYDD T  T  + 
Sbjct  266   DYVEGQQLMSNGIVD---TSFFPPSDQSKVADLVKNHSIIYVLEVAKYYDDPTVPTTGQV  322

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             + ++ K LS++ G +   DV +FDFLNRV++ E KLR   +W+VPHPWLNL+VPK++ILD
Sbjct  323   IDKLTKTLSYLPGFISMHDVPYFDFLNRVQAEEDKLRSLALWEVPHPWLNLYVPKTQILD  382

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             F+ GV  DI+L+QN TSG  L YPTN+ +WD+RMSA++P+E+ FY VGLL S+     +E
Sbjct  383   FHNGVVKDILLKQNSTSGVALFYPTNRNKWDNRMSAMIPDEDVFYVVGLLQSASSQNVQE  442

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             + + NE I+ +C ++GIKIKQYL H+  +EDW  HFG KW  F +RK LFDPK +LSPGQ
Sbjct  443   VESVNEAIISFCKDSGIKIKQYLMHFTRKEDWVGHFGSKWGAFSKRKDLFDPKKLLSPGQ  502

Query  228   RIF  220
              IF
Sbjct  503   DIF  505



>ref|XP_007017645.1| Cytokinin oxidase 5 [Theobroma cacao]
 gb|EOY14870.1| Cytokinin oxidase 5 [Theobroma cacao]
Length=534

 Score =   499 bits (1284),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 316/438 (72%), Gaps = 24/438 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRI--------RVSWSESLGFYADVGGHELW  1327
             ARGHGHS  GQA   +GVV++MS   R  GR+        RV   ES   Y DV G ELW
Sbjct  88    ARGHGHSINGQAQTTNGVVIQMSG-SRGSGRMASGKPPQPRVWARES---YVDVWGGELW  143

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             +DVLR++L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL
Sbjct  144   IDVLRSTLGYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGEL  203

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
             +TCS+  N ELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FT DQE+LI
Sbjct  204   LTCSEEQNPELFQAVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSNFSAFTTDQEYLI  263

Query  966   SI-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             S+         DY+EG +I+ +   NNWRSSFFSP +  +I+SL +N G++Y LE+ K Y
Sbjct  264   SLQGKPTSQKFDYIEGFVIVDEGLINNWRSSFFSPRNPVKISSLGANGGVLYCLEITKNY  323

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
              + TA TID+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWL
Sbjct  324   HESTADTIDQEVESLLKKLNFIPTSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWL  383

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLFVPKS+I DF+ GVF  I+   NKTSGPIL+YP NK +WD R S V P+E+ FY V L
Sbjct  384   NLFVPKSKIADFDKGVFKGIL--GNKTSGPILIYPMNKNKWDPRSSVVTPDEDVFYLVAL  441

Query  441   LHSSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQ  277
             L S+  N       E L +QN  IL++CD+AGIK+KQYLPHY T+E+W  HFG KW  F 
Sbjct  442   LRSALDNGEETRSLECLTDQNRRILRFCDDAGIKVKQYLPHYTTQEEWMDHFGDKWDRFH  501

Query  276   QRKALFDPKLILSPGQRI  223
             Q K  FDP+ IL+ GQ+I
Sbjct  502   QMKMEFDPRHILATGQQI  519



>ref|XP_006451486.1| hypothetical protein CICLE_v10010713mg, partial [Citrus clementina]
 gb|ESR64726.1| hypothetical protein CICLE_v10010713mg, partial [Citrus clementina]
Length=482

 Score =   495 bits (1275),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 245/431 (57%), Positives = 322/431 (75%), Gaps = 18/431 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G  HS  GQA A DGVVV+M+SL R  NG  I +S   SLGFYADVGG ++W+DVL A
Sbjct  60    AKGQVHSTWGQAQANDGVVVQMNSLNRFRNGTGILISGDRSLGFYADVGGEQMWIDVLNA  119

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GL+PVSWTDYLY TVGGTLSNAGISG +++ GPQI NV+E+DV+TGKGE +TCS  
Sbjct  120   TLTRGLSPVSWTDYLYPTVGGTLSNAGISGHTYQKGPQITNVLELDVLTGKGEFVTCSPQ  179

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---D  958
              +SELF+AVLGGLGQFG+ITRARIVL  A  RVKW+R+LY DF+ F+ DQE LIS     
Sbjct  180   KDSELFYAVLGGLGQFGIITRARIVLGPAKKRVKWLRILYSDFSSFSTDQETLISTTGPS  239

Query  957   DGL--DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
             D +  D++EG L+M QSP +     F+  S + +I  L++ +GI+Y +E+V YYD++   
Sbjct  240   DKVMPDFLEGHLLMNQSPLD-----FYPQSQRRKITFLVNQYGILYIIEVVTYYDNKNEA  294

Query  783   TIDEELQEMFKGLS-FIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
                +++++M K L  F+ G VFEKDV++  FLNRV   E++LR+KG+WD+PHPWLN+F+P
Sbjct  295   ---KKVKQMLKSLKGFLPGFVFEKDVTYLQFLNRVHDQEIELRKKGLWDIPHPWLNIFIP  351

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVV-PEEETFYCVGLLHSS  430
             KSRI DF+ GVF +I+L++N TS  +LVYP  +++WD+RMSAV+  EEE FY VG L +S
Sbjct  352   KSRITDFDNGVFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIAAEEEVFYFVGFLDAS  411

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               N WE   N+N++IL++C  AGIK KQYL H+ T+E+W  HFG KW  FQQRK  FDP+
Sbjct  412   ADN-WEAFDNKNKDILQFCVNAGIKFKQYLGHHATKEEWIIHFGSKWNTFQQRKTRFDPR  470

Query  249   LILSPGQRIFS  217
             +ILSPGQRIF+
Sbjct  471   MILSPGQRIFN  481



>gb|KDO40371.1| hypothetical protein CISIN_1g044784mg, partial [Citrus sinensis]
Length=482

 Score =   495 bits (1275),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 245/431 (57%), Positives = 321/431 (74%), Gaps = 18/431 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             A+G  HS  GQA A DGVVV+M+SL R  NG  I +S   S GFYADVGG +LW+DVL A
Sbjct  60    AKGQAHSTWGQAQANDGVVVQMNSLNRFRNGTGILISGDRSSGFYADVGGEQLWIDVLNA  119

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GL+PVSWTDYLY TVGGTLSNAGISG +++ GPQI NV+E+DV+TGKGE +TCS  
Sbjct  120   TLTRGLSPVSWTDYLYPTVGGTLSNAGISGHTYQKGPQITNVLELDVLTGKGEFVTCSPQ  179

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---D  958
              +SELF+AVLGGLGQFG+ITRARIVL  A  RVKW+R+LY DF+ F+ DQE LIS     
Sbjct  180   KDSELFYAVLGGLGQFGIITRARIVLGPAKKRVKWLRILYSDFSSFSTDQETLISTTGPS  239

Query  957   DGL--DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
             D +  D++EG L+M QSP +     F+  S + +I  L++ +GI+Y +E+V YYD++   
Sbjct  240   DKVMPDFLEGHLLMNQSPLD-----FYPQSQRRKITFLVNQYGILYIIEVVTYYDNKNEA  294

Query  783   TIDEELQEMFKGLS-FIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
                +++++M K L  F+ G VFEKDV++  FLNRV   E++LR+KG+WD+PHPWLN+F+P
Sbjct  295   ---KKVKQMLKSLKGFLPGFVFEKDVTYLQFLNRVHDQEIELRKKGLWDIPHPWLNIFIP  351

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVV-PEEETFYCVGLLHSS  430
             KSRI DF+ GVF +I+L++N TS  +LVYP  +++WD+RMSAV+  EEE FY VG L +S
Sbjct  352   KSRITDFDNGVFRNILLKRNFTSSTVLVYPLLRSKWDERMSAVIAAEEEVFYFVGFLDAS  411

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               N WE   N+N++IL++C  AGIK KQYL H+ T+E+W  HFG KW  FQQRK  FDP+
Sbjct  412   ADN-WEAFDNKNKDILQFCVNAGIKFKQYLGHHATKEEWIIHFGSKWNTFQQRKTRFDPR  470

Query  249   LILSPGQRIFS  217
             +ILSPGQRIF+
Sbjct  471   MILSPGQRIFN  481



>emb|CAC17752.1| cytokinin oxidase [Dendrobium hybrid cultivar]
 emb|CAC17753.1| cytokinin oxidase [Dendrobium hybrid cultivar]
Length=536

 Score =   497 bits (1279),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 242/437 (55%), Positives = 312/437 (71%), Gaps = 21/437 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A  G+V+ M SL    G I VS     G + D G  ++W+DVLR +L
Sbjct  97    ARGLGHSTRGQAQAFGGIVINMPSLD---GGITVSID---GMFVDAGAEQMWIDVLRETL  150

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL P SWTDYLYLT+GGTLSN GISGQ+F +GPQI+NV E+D++TGKGE++TCS+  N
Sbjct  151   RHGLTPKSWTDYLYLTLGGTLSNGGISGQAFLHGPQISNVHELDIVTGKGEMVTCSESNN  210

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD----  955
              +LFF+VLGGLGQFG+ITRARI L+KAP  V+W+R++Y DF  FT+DQE LISI      
Sbjct  211   PDLFFSVLGGLGQFGIITRARIALEKAPQSVRWMRLMYTDFELFTKDQELLISIKAEGEG  270

Query  954   -GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLIS-NHGIIYSLELVKYYD------  799
               L+YVEGSL+M  S  +NWRS FFS     +I  L S N G+IY LE   YYD      
Sbjct  271   WKLNYVEGSLLMEHSLKSNWRSPFFSEKDLKKIKKLASGNEGVIYCLEASFYYDYGHEMN  330

Query  798   --DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPW  625
                     +D++++E+ + LSF+ G  F  DVS+  FLNRV  GE+KLR  G+WDVPHPW
Sbjct  331   FSRADKAQMDQDIEELLRKLSFVSGFAFRNDVSYMGFLNRVHDGELKLRAMGLWDVPHPW  390

Query  624   LNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG  445
             LNLFV KS I+DF++GVF   I++ +K+ GPILVYPT +++WD RMS  +P+EE FY +G
Sbjct  391   LNLFVSKSNIMDFHIGVFKG-IMKNSKSMGPILVYPTKRSKWDKRMSTSIPDEEVFYSIG  449

Query  444   LLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
             +L SS +N+ E L + N EILK+CD+ G+  KQYLPHY + EDW+KHFGKKW+ F + K+
Sbjct  450   ILLSSEMNDLEHLESHNAEILKFCDQQGMNYKQYLPHYTSIEDWKKHFGKKWERFVEMKS  509

Query  264   LFDPKLILSPGQRIFSQ  214
              +DPK ILSPGQ+IF+ 
Sbjct  510   RYDPKAILSPGQKIFTH  526



>ref|XP_004488074.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=526

 Score =   496 bits (1278),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 242/431 (56%), Positives = 319/431 (74%), Gaps = 14/431 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSE---SLGFYADVGGHELWVDVL  1315
             RG  HS  GQA A++GVVV M+ L   RNG  I VS  +    L  Y DVGG +LW+DVL
Sbjct  98    RGKAHSVLGQAMAQNGVVVNMTQLNGFRNGSGIVVSNCDVKSPLDCYVDVGGEQLWIDVL  157

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              A+   GLAP+SWTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV+E+DVITG+GE +TCS
Sbjct  158   HATTKLGLAPLSWTDYLYLTVGGTLSNAGISGQTFRFGPQISNVLELDVITGQGEFVTCS  217

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD  955
             +  NSELF++VLGGLGQFGVITRAR+ L  +PTR KW+R++YDDF+KF+ DQEHLIS ++
Sbjct  218   REKNSELFYSVLGGLGQFGVITRARLPLGPSPTRAKWLRLIYDDFSKFSTDQEHLISFNN  277

Query  954   GLD-----YVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
               D     YVEG L+  +   +    SF+    Q +I SL++  GI Y +ELVKYYD  +
Sbjct  278   KNDTNAANYVEGILLFNKPLLD---LSFYPTPDQPRIKSLVTKSGIAYVIELVKYYDTNS  334

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
                +DEE+  + KGL+F+   +F+KDV++ +FL+RV   E+ LR KG+W+VPHPWLN+F+
Sbjct  335   QPRVDEEVDNLIKGLNFVPTFMFQKDVTYEEFLDRVHVEELVLRSKGLWEVPHPWLNMFI  394

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH-S  433
             PKSRI DFN GVF DIIL+QN T   +L YP N+ +WDD+MSAV+P E+ FY +GLL+ +
Sbjct  395   PKSRISDFNEGVFKDIILKQNLTPVILLFYPMNRNKWDDKMSAVIPNEDVFYTLGLLNAA  454

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             S ++E +    Q ++IL++C+++GI+IKQYL   KT + W +HFG KWQ+F+ RKA FDP
Sbjct  455   SGLDEVKAFEAQIQQILQFCNDSGIEIKQYLTRNKTPQQWIQHFGTKWQLFEDRKAKFDP  514

Query  252   KLILSPGQRIF  220
             K ILSPGQ IF
Sbjct  515   KRILSPGQGIF  525



>dbj|BAM74648.1| cytokinin oxidase/dehydrogenase [Torenia fournieri]
Length=531

 Score =   496 bits (1277),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 250/436 (57%), Positives = 319/436 (73%), Gaps = 18/436 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMS--SLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA A +G+V++MS  S+  +    +V W + +  Y DV G ELWVDVLR+
Sbjct  89    ARGHGHSINGQAMASNGIVIQMSGGSVHDHEATTKV-WEKLM--YVDVWGGELWVDVLRS  145

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL+TCSK 
Sbjct  146   TLRHGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELLTCSKD  205

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---D  958
              NSEL++AVLGGLGQFG+ITRARI L+KAPTRV+W+R+LY +FT FT DQE+LIS+    
Sbjct  206   ENSELYYAVLGGLGQFGIITRARIALEKAPTRVRWIRVLYSNFTAFTEDQEYLISLHGQS  265

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNH--GIIYSLELVKYYDDETAT  784
             +  DYVEG +I+ +   NNWRSSFFSP +  +++SL S+   G++Y LE+ K Y +  A 
Sbjct  266   EMFDYVEGFVIVDEGLINNWRSSFFSPRNPVKVSSLKSDDEGGVLYCLEVTKNYHESNAD  325

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              ID+E+  + K L+FI   VF  D+ + DFL+RV   E+KLR K +WDVPHPWLNLFVPK
Sbjct  326   FIDQEVDALLKKLNFIPSSVFTTDLPYVDFLDRVHKAELKLRAKNLWDVPHPWLNLFVPK  385

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRI DF+ GVF   IL  NKTSGPIL+YP NK +WD++ S V P E+ FY V LL S+  
Sbjct  386   SRIHDFDKGVFKG-ILGNNKTSGPILIYPMNKNKWDEKTSVVTPNEDVFYLVALLRSALD  444

Query  423   NEWEE------LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKA  265
             N  +E      L NQN  IL +C + GI  KQYLPHY T+++W+ HFG  KW+ F +RK 
Sbjct  445   NGDDEMQTLDYLSNQNRRILGFCQDQGIGCKQYLPHYTTQQEWKLHFGDDKWKQFNKRKT  504

Query  264   LFDPKLILSPGQRIFS  217
              FDP+ IL+ GQRIF+
Sbjct  505   EFDPRHILATGQRIFT  520



>ref|XP_008804537.1| PREDICTED: cytokinin dehydrogenase 5-like [Phoenix dactylifera]
Length=538

 Score =   496 bits (1276),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 251/432 (58%), Positives = 308/432 (71%), Gaps = 14/432 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVS--WSESLG-FYADVGGHELWVDVLR  1312
             ARGHGHS  GQA A  GVV+EMS  +  G R R    +S SLG +Y DV G ELW+DVL 
Sbjct  89    ARGHGHSINGQARAPGGVVIEMSHDRAAGHRPRSRPVYSPSLGEYYVDVWGGELWIDVLN  148

Query  1311  ASLPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              +L +G  AP SWTDYLYL+VGGTLSNAGISGQ+F +GPQ++NV E DV+TGKGE++TCS
Sbjct  149   WTLDNGGRAPKSWTDYLYLSVGGTLSNAGISGQTFHHGPQLSNVYEFDVVTGKGEIVTCS  208

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD  955
             +  NSELF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY +FT FTRDQE LIS+  
Sbjct  209   EEQNSELFHGVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFTTFTRDQELLISLHG  268

Query  954   G--LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATT  781
                 DYVEG +I+ +   NNWRSSFFSP +   I+S+ +N G++Y LE+ K YDD TA  
Sbjct  269   THRFDYVEGFVIVDEGLINNWRSSFFSPRNSVNISSIGANGGVLYCLEMTKNYDDSTAAF  328

Query  780   IDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKS  601
             +D+E++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVP S
Sbjct  329   VDQEVEALLKRLEFIPASVFTTDLPYVDFLDRVHKAELKLRAKGLWDVPHPWLNLFVPAS  388

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS---  430
             RI DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY VG L S+   
Sbjct  389   RIADFDRGVFRGIL--GNKTSGPILIYPMNKHKWDERSSAVTPDEEVFYLVGFLRSALPD  446

Query  429   ---RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALF  259
                     E L  QNE IL +CD AGI++KQYLPH+ T  +W +HFG KW  F + KA F
Sbjct  447   SGESTQSLEYLSQQNERILAFCDAAGIEVKQYLPHHLTRAEWARHFGAKWDRFIRLKAEF  506

Query  258   DPKLILSPGQRI  223
             DPK IL  GQ I
Sbjct  507   DPKGILGSGQGI  518



>ref|XP_010254443.1| PREDICTED: cytokinin dehydrogenase 3-like [Nelumbo nucifera]
Length=517

 Score =   494 bits (1273),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 250/434 (58%), Positives = 322/434 (74%), Gaps = 24/434 (6%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSL--KRNGGRIRVSWSES---LGFYADVGGHELWVDV  1318
             A+G GHS  GQA A DGVVV M SL  + NG RI VS S +   + +Y D GG +LW+DV
Sbjct  94    AKGMGHSVNGQAMAPDGVVVNMRSLNNEENGSRINVSRSTTSMAINWYVDAGGEQLWIDV  153

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             LRA+L +GLAP SWTD+LYLTVGGTLSNAGISGQ+FRYGPQI+NV E+DV+TGKGEL+TC
Sbjct  154   LRATLEYGLAPRSWTDFLYLTVGGTLSNAGISGQTFRYGPQISNVYELDVVTGKGELVTC  213

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-  961
             SKH NS+LF+AVLGGLGQFG+ITRARI L+KAP+ VKW+ + Y DF  FTRDQE LIS  
Sbjct  214   SKHTNSKLFYAVLGGLGQFGIITRARIALEKAPSTVKWMSLYYVDFFAFTRDQEILISTH  273

Query  960   ----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                 +   DY+EG+L+M    +++ R           I SL   +GI+Y++E+ KYYDD 
Sbjct  274   TSHENKTFDYIEGTLVMQHDTSDDPR-----------ITSLAKQYGIVYTIEVAKYYDDL  322

Query  792   TAT--TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
             T    T+DEEL+ + +GLSFI G++   DVS+ DFLNRVRS  +K++ +   DV HPWLN
Sbjct  323   TINQDTVDEELKLLLEGLSFIPGMITTTDVSYLDFLNRVRSKALKVQSQEQGDVLHPWLN  382

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LF+PKSRI DFN GVF  I+L+QNKT+     YP N+ +W+ RMS+V+P+E+ FY + LL
Sbjct  383   LFIPKSRIFDFNSGVFKGILLKQNKTALNRF-YPMNRNKWEGRMSSVIPDEDIFYHLALL  441

Query  438   HSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALF  259
              SS +++ E    QN EIL++CD+AGI+IKQYLPH++++ +W KHFG KW  F+ RKA+F
Sbjct  442   RSSGIHDLEFFQRQNREILEFCDKAGIEIKQYLPHHESKAEWIKHFGPKWNTFKARKAMF  501

Query  258   DPKLILSPGQRIFS  217
             DPK ILSPGQRIF+
Sbjct  502   DPKAILSPGQRIFN  515



>ref|XP_006412813.1| hypothetical protein EUTSA_v10024918mg [Eutrema salsugineum]
 gb|ESQ54266.1| hypothetical protein EUTSA_v10024918mg [Eutrema salsugineum]
Length=524

 Score =   494 bits (1273),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 238/425 (56%), Positives = 319/425 (75%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  G+VV M+ L +      V  S   G YADV    +WV+VL  ++
Sbjct  104   ARGQGHSLRGQASAPGGIVVNMTCLAKAAKPAAVVVSAD-GTYADVAAGTMWVEVLETAV  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKGE++TCS  +N
Sbjct  163   ERGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
             +ELF+ VLGGLGQFG+ITRARI LD AP RVKW+R+LY+DF+ FTRDQE LIS+  D  +
Sbjct  223   TELFYGVLGGLGQFGIITRARIALDHAPKRVKWLRILYNDFSDFTRDQERLISMVNDIRV  282

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ KYYD  T   I++ 
Sbjct  283   DFLEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDTTTLPIINQV  339

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L FI G +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVP+SRI D
Sbjct  340   IDMLTRTLGFIPGFMFMRDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPRSRIQD  399

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ G+   ++L Q  TSG  L YPTN+ +W++RMSA++P+E+ FY +GLLHS+  ++ WE
Sbjct  400   FHDGIIKGLLLNQTSTSGVTLFYPTNRNKWNNRMSAMIPDEDVFYVIGLLHSAGGSQNWE  459

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++I+ +CD +GIKIK+YL HY  +EDW +HFG KW  F +RK +FDPK +LSPG
Sbjct  460   ELDNLNDKIIHFCDTSGIKIKEYLMHYTRKEDWVQHFGPKWGDFLRRKIMFDPKKLLSPG  519

Query  231   QRIFS  217
             Q IFS
Sbjct  520   QDIFS  524



>gb|AAG30907.1|AF303980_1 cytokinin oxidase [Arabidopsis thaliana]
Length=524

 Score =   494 bits (1272),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 314/425 (74%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  GVVV M+ L        V  S   G YADV    +WVDVL+A++
Sbjct  104   ARGQGHSLRGQASAPGGVVVNMTCLAMAAKPAAVVISAD-GTYADVAAGTMWVDVLKAAV  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKGE++TCS  +N
Sbjct  163   DRGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARI LD APTRVKW R+LY DF+ F RDQE LIS+  D G+
Sbjct  223   PELFYGVLGGLGQFGIITRARIALDHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGV  282

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ KYYD  T   ID+ 
Sbjct  283   DFLEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDRTTLPIIDQV  339

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F  G +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVP SRI D
Sbjct  340   IDTLSRTLGFAPGFMFVQDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPGSRIQD  399

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ GV   ++L Q  TSG  L YPTN+ +W++RMS + P+E+ FY +GLL S+  ++ W+
Sbjct  400   FHDGVINGLLLNQTSTSGVTLFYPTNRNKWNNRMSTMTPDEDVFYVIGLLQSAGGSQNWQ  459

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++++++C+ +GIKIK+YL HY  +EDW KHFG KW  F ++K +FDPK +LSPG
Sbjct  460   ELENLNDKVIQFCENSGIKIKEYLMHYTRKEDWVKHFGPKWDDFLRKKIMFDPKRLLSPG  519

Query  231   QRIFS  217
             Q IF+
Sbjct  520   QDIFN  524



>ref|NP_194703.1| cytokinin dehydrogenase 4 [Arabidopsis thaliana]
 sp|Q9FUJ2.2|CKX4_ARATH RecName: Full=Cytokinin dehydrogenase 4; AltName: Full=Cytokinin 
oxidase 4; Short=AtCKX4; Short=CKO 4; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB45334.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 emb|CAB79732.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 gb|AAK96652.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 gb|AAN15498.1| cytokinin oxidase-like protein [Arabidopsis thaliana]
 gb|AEE85669.1| cytokinin dehydrogenase 4 [Arabidopsis thaliana]
Length=524

 Score =   494 bits (1271),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 314/425 (74%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  GVVV M+ L        V  S   G YADV    +WVDVL+A++
Sbjct  104   ARGQGHSLRGQASAPGGVVVNMTCLAMAAKPAAVVISAD-GTYADVAAGTMWVDVLKAAV  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKGE++TCS  +N
Sbjct  163   DRGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARI LD APTRVKW R+LY DF+ F RDQE LIS+  D G+
Sbjct  223   PELFYGVLGGLGQFGIITRARIALDHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGV  282

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ KYYD  T   ID+ 
Sbjct  283   DFLEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDRTTLPIIDQV  339

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F  G +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVP SRI D
Sbjct  340   IDTLSRTLGFAPGFMFVQDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPGSRIQD  399

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ GV   ++L Q  TSG  L YPTN+ +W++RMS + P+E+ FY +GLL S+  ++ W+
Sbjct  400   FHDGVINGLLLNQTSTSGVTLFYPTNRNKWNNRMSTMTPDEDVFYVIGLLQSAGGSQNWQ  459

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++++++C+ +GIKIK+YL HY  +EDW KHFG KW  F ++K +FDPK +LSPG
Sbjct  460   ELENLNDKVIQFCENSGIKIKEYLMHYTRKEDWVKHFGPKWDDFLRKKIMFDPKRLLSPG  519

Query  231   QRIFS  217
             Q IF+
Sbjct  520   QDIFN  524



>ref|XP_007136628.1| hypothetical protein PHAVU_009G060200g [Phaseolus vulgaris]
 gb|ESW08622.1| hypothetical protein PHAVU_009G060200g [Phaseolus vulgaris]
Length=550

 Score =   494 bits (1273),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 247/429 (58%), Positives = 308/429 (72%), Gaps = 16/429 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQAT--AKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARGHGHS  GQA    K GVV+EM    + G  +RV      G Y DV G ELW++VL A
Sbjct  116   ARGHGHSINGQALIREKKGVVIEMG---KGGSGVRVC---EKGMYVDVWGGELWIEVLSA  169

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L +GLAP+SWTDYLYL+VGGTLSNAGISGQ+F +GPQI NV E+DV+TGKGEL+TCS+ 
Sbjct  170   TLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVFELDVVTGKGELVTCSED  229

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              NSELF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY DF +F  DQE+LIS+    
Sbjct  230   RNSELFHAVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSDFGRFCEDQEYLISLHGKP  289

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               +  DYVEG +I+ +   NNWRSSFFSP +   I SL ++ G++Y LE+ K YD   A 
Sbjct  290   GRERFDYVEGFVIVDEGLINNWRSSFFSPINPVNITSLNADGGVLYCLEITKNYDHHNAD  349

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             ++DEE+Q + K L F+   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVPK
Sbjct  350   SVDEEIQGLLKKLHFLSTSVFTSDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPK  409

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SRI DF+ GVF  I+   NKTSGPIL+YP NK++WD R S V PEE+ FY V  L S+  
Sbjct  410   SRIGDFDKGVFKGIL--GNKTSGPILIYPMNKSKWDHRSSVVTPEEDVFYLVAFLRSALD  467

Query  423   NE-WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
              E  E L NQN +IL++C  + IK+KQYLPHY T+++W  HFG KW  F  RK  FDP+ 
Sbjct  468   TETLEYLTNQNRQILRFCHGSEIKVKQYLPHYTTQQEWMDHFGDKWTQFNARKMQFDPRR  527

Query  246   ILSPGQRIF  220
             IL+ GQ+IF
Sbjct  528   ILATGQQIF  536



>ref|NP_001274957.1| cytokinin oxidase/dehydrogenase precursor [Solanum tuberosum]
 gb|ACP40988.1| cytokinin oxidase/dehydrogenase [Solanum tuberosum]
Length=526

 Score =   493 bits (1269),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/436 (57%), Positives = 314/436 (72%), Gaps = 17/436 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGF-YADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA   +GVVV+MS     GG      + S  F YADV G ELW+DVL ++
Sbjct  88    ARGHGHSINGQAMTTNGVVVQMSG---GGGSKNKMLTISEKFMYADVWGGELWIDVLTST  144

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL+TCS+  
Sbjct  145   LEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGELLTCSEKE  204

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----  961
             NSELF AVLGGLGQFG+ITRARI L++AP RV+W+R+LY +F+ FT+DQE+LIS+     
Sbjct  205   NSELFQAVLGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTQDQEYLISLHGKPA  264

Query  960   DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATT  781
                 DYVEG +I+ +   NNWRSSFFSPS+  +I+SL +  G++Y LE+ K Y    A T
Sbjct  265   SQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSLKAEGGVLYCLEITKNYHLSNADT  324

Query  780   IDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKS  601
             ID+E++ + K L++I    F  D+ + DFL+RV   E+KLR KG+W+VPHPWLNLFVPKS
Sbjct  325   IDQEIEILLKKLNYIPASEFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKS  384

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN  421
             RI +F+ GVF  I+   NKTSGPIL+YP NK +WDDR S V PEE+ FY V  L S+  N
Sbjct  385   RIAEFDKGVFKGIL--GNKTSGPILIYPMNKNKWDDRSSVVTPEEDVFYLVAFLRSALEN  442

Query  420   EWEE-----LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKK-WQIFQQRKALF  259
               E      L NQN EILK+C++  I +KQYLPHY  + +W  HFG+K W  FQQRK  F
Sbjct  443   GDETQTLDYLSNQNYEILKFCEDEKINVKQYLPHYDNQREWRDHFGEKYWTRFQQRKLEF  502

Query  258   DPKLILSPGQRIFSQS  211
             DP+ IL+ GQ+IF  S
Sbjct  503   DPRHILATGQKIFIPS  518



>ref|NP_001266251.1| cytokinin oxidase/dehydrogenase-like precursor [Solanum lycopersicum]
 dbj|BAM09006.1| cytokinin oxidase/dehydrogenase-like [Solanum lycopersicum]
Length=524

 Score =   493 bits (1269),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 246/435 (57%), Positives = 313/435 (72%), Gaps = 17/435 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS  GQA  ++GVVV+MS   +N     ++ SE    YADV G ELW+DVL ++L
Sbjct  88    ARGHGHSINGQAMTRNGVVVQMSGGLKNK---MLTVSEKF-MYADVWGGELWIDVLTSTL  143

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL+TCS+  N
Sbjct  144   EYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVHELDVVTGKGELLTCSEKEN  203

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----D  958
             SELF AVLGGLGQFG+ITRARI L++AP RV+W+R+LY +F+ FT DQE+LIS+      
Sbjct  204   SELFQAVLGGLGQFGIITRARIALEQAPQRVRWIRVLYSNFSTFTHDQEYLISLHGKPSS  263

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
                DYVEG +I+ +   NNWRSS FSPS+  +++SL +  G++Y LE+ K Y    A TI
Sbjct  264   QKFDYVEGFVIVDEGLINNWRSSIFSPSNPVKVSSLKAEGGVLYCLEITKNYHLTNADTI  323

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+E++ + K L++I    F  D+ + DFL+RV   E+KLR KG+W+VPHPWLNLFVPKSR
Sbjct  324   DQEIEILLKKLNYIPASEFTTDLPYVDFLDRVHKAELKLRSKGLWEVPHPWLNLFVPKSR  383

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS----  430
             I +F+ GVF  I+   NKTSGPIL+YP NK +WDDR S V PEE+ FY V  L S+    
Sbjct  384   IAEFDKGVFKGIL--GNKTSGPILIYPMNKNKWDDRSSVVTPEEDVFYLVAFLRSALESG  441

Query  429   -RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKK-WQIFQQRKALFD  256
                   + L NQN EILK+C++  I +KQYLPHY  + +W  HFG+K W  FQQRK  FD
Sbjct  442   DETQTLDYLSNQNNEILKFCEDESINVKQYLPHYDNQREWRDHFGEKYWTRFQQRKLEFD  501

Query  255   PKLILSPGQRIFSQS  211
             P+ IL+ GQRIF  S
Sbjct  502   PRHILATGQRIFMPS  516



>ref|XP_009402032.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=524

 Score =   492 bits (1267),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/428 (58%), Positives = 313/428 (73%), Gaps = 5/428 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKR-NGGRIRVSWSESLGF-YADVGGHELWVDVLRA  1309
             ARG GHS RGQA A  GVVV+M SL R    RI VS  +   F Y DVGG +LW+DVL  
Sbjct  82    ARGCGHSVRGQALAPGGVVVDMPSLGRGRDDRINVSRGDGSSFWYVDVGGEQLWIDVLHE  141

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAP SWTDYL+LTVGGTLSNAG+SGQ+FR+GPQI+NV E++V+TGKGE++ CS +
Sbjct  142   TLKHGLAPRSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVYELEVVTGKGEMMICSHN  201

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-DDG  952
              N  LF+ VLGGLGQ G+ITRARI ++ AP RV+W R++Y DF  FTRDQE LIS+ ++G
Sbjct  202   ENPALFYGVLGGLGQLGIITRARIAVEPAPERVRWARLIYTDFVSFTRDQELLISMSEEG  261

Query  951   LDYVEGSLIMT-QSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
              DYVEGSL+M   S   NWRSSFFS     ++  L S  G IY LE   YY+  TA+++D
Sbjct  262   FDYVEGSLLMMDHSLIGNWRSSFFSDRDWEKVKLLASQFGAIYCLEGAVYYELATASSVD  321

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             ++L    K LSF+ G  F KDVS+  FL+RV  GE+KLR  G+WDVPHPWLN+FVPKSRI
Sbjct  322   QKLDSFLKQLSFVPGFAFAKDVSYMAFLDRVHDGEMKLRSMGLWDVPHPWLNIFVPKSRI  381

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW  415
              DF +GVF   IL+ N + GP+L+YP  K +WD++MSAV+P+EE FY +GLL S+ + +W
Sbjct  382   RDFEIGVFKG-ILKPNNSMGPVLIYPLKKNKWDEKMSAVIPDEEIFYSIGLLRSAIMGDW  440

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             E L +QN+EIL++C   GI+ KQYLPHY  + DW KHFG KW +F   K  +DPKL+LSP
Sbjct  441   EHLDDQNDEILRFCHREGIEYKQYLPHYTAQTDWMKHFGLKWNVFVDLKRRYDPKLVLSP  500

Query  234   GQRIFSQS  211
             G RIF+ S
Sbjct  501   GHRIFTSS  508



>ref|XP_007138721.1| hypothetical protein PHAVU_009G231800g [Phaseolus vulgaris]
 gb|ESW10715.1| hypothetical protein PHAVU_009G231800g [Phaseolus vulgaris]
Length=516

 Score =   492 bits (1266),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 236/424 (56%), Positives = 317/424 (75%), Gaps = 10/424 (2%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSE---SLGFYADVGGHELWVDVLRA  1309
             RG  HS  GQA   +GVV+ M++L  NG  I VS  +    L  YADVGG  +W+DVL A
Sbjct  90    RGKAHSILGQALTGNGVVLNMTNL--NGSLIFVSKCDGENPLNCYADVGGEVVWIDVLHA  147

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L  GL P+SWTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV+E+DV+TGKG+L++CS+ 
Sbjct  148   TLERGLTPLSWTDYLYLTVGGTLSNAGISGQAFRFGPQISNVLELDVVTGKGDLVSCSRE  207

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
               SELF+ VLGGLGQFGVITRARI+L  APTRVKW+ +LY++FT F+ DQEHLIS     
Sbjct  208   KESELFYGVLGGLGQFGVITRARILLGPAPTRVKWLHLLYNNFTAFSSDQEHLISF-TAA  266

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DYVEG L++ Q P +    SF+  S   +I SL++ +GIIY +ELVKYYD+ +   ++++
Sbjct  267   DYVEGMLLLNQPPLD---LSFYPDSDHQRITSLVTQNGIIYIIELVKYYDNNSNAFVEKD  323

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             + ++ KGL+F+   +FEKD S+ DFLNRV + E+ LR KG+W+VPHPWLN+++P+SRI D
Sbjct  324   VADLVKGLNFVPTFIFEKDASYEDFLNRVLAEELFLRSKGLWEVPHPWLNIWIPRSRISD  383

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEW-E  412
             FN GVF +IIL QN +SG  L+YP N+ +WDD+MS V PEE+ FY V LL ++   +  +
Sbjct  384   FNEGVFKNIILAQNLSSGIALIYPMNRNKWDDKMSPVTPEEDVFYAVSLLRATSSRDMVK  443

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             +L +QN++IL++C +AGI+I +YL   KT++ W +HFG KW++F  RK  FDPK ILSPG
Sbjct  444   KLQDQNQQILQFCKDAGIQITEYLTGNKTQQQWMEHFGSKWELFADRKDQFDPKRILSPG  503

Query  231   QRIF  220
             Q IF
Sbjct  504   QGIF  507



>emb|CDP07468.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   492 bits (1267),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 246/443 (56%), Positives = 313/443 (71%), Gaps = 21/443 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLG-------FYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV++MSS   +G R R+     +         Y DV G ELW+
Sbjct  88    ARGHGHSINGQAMTTNGVVIQMSS--GSGERRRLGIGRPVAPRVYEKFMYVDVWGGELWI  145

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVLR++L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGEL+
Sbjct  146   DVLRSTLEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFNHGPQISNVYELDVVTGKGELL  205

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCS+  NS+LF AVLGGLGQFG+ITRARI L+ AP  V+W+R+LY +F+ FT DQE+LIS
Sbjct  206   TCSEEENSDLFHAVLGGLGQFGIITRARIALEPAPQMVRWIRVLYSNFSTFTHDQEYLIS  265

Query  963   I-----DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLIS--NHGIIYSLELVKY  805
             +         DYVEG  I+ +   NNWRSSFFSP +  +I+S+ +  N G++Y LE+ + 
Sbjct  266   LHGQSDSQKFDYVEGFAIVDEGLINNWRSSFFSPRNPVKISSIDAKGNGGVLYCLEVTRN  325

Query  804   YDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPW  625
             Y    A TIDEE+  +   L+FI   VF  D+ + DFL+RV   E+ LR KG+WDVPHPW
Sbjct  326   YGGLDADTIDEEVDALLTKLNFIPNTVFTTDLPYVDFLDRVHKAELTLRSKGLWDVPHPW  385

Query  624   LNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG  445
             LNLFVPKSRI DF+ GVF  I+  +N+TSGPIL+YP NK +WD++ SAV PEE+ FY V 
Sbjct  386   LNLFVPKSRIADFDRGVFKGILGSKNRTSGPILIYPMNKNKWDEKTSAVTPEEDVFYLVA  445

Query  444   LLHSSRVNEWEE-----LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIF  280
             LL S+  N  E      L +QN  IL++CD+AGI +KQYLP+Y T++ W  HFG KW  F
Sbjct  446   LLRSALDNGDETQTLDYLSDQNRRILRFCDDAGINVKQYLPYYTTQQQWRDHFGHKWAQF  505

Query  279   QQRKALFDPKLILSPGQRIFSQS  211
              QRK  FDP+ IL+ GQRIF  S
Sbjct  506   YQRKLEFDPRHILATGQRIFKPS  528



>ref|XP_006409043.1| hypothetical protein EUTSA_v10023158mg [Eutrema salsugineum]
 gb|ESQ50496.1| hypothetical protein EUTSA_v10023158mg [Eutrema salsugineum]
Length=505

 Score =   491 bits (1263),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 234/423 (55%), Positives = 307/423 (73%), Gaps = 12/423 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+   GV++ M+ L      + VS  +    YADV    LWVDVL+ + 
Sbjct  92    ARGQGHSLNGQASVSGGVIINMTCLSG----VVVSEDKK---YADVAAGTLWVDVLKETA  144

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL+++VGGTLSNAGI GQ FR GPQI+NV+E+DVITGKGE++ CS+ +N
Sbjct  145   EKGVSPVSWTDYLHVSVGGTLSNAGIGGQVFRNGPQISNVLELDVITGKGEMLVCSRRLN  204

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRAR+ L+ AP RVKW RMLY DFT FT DQE LIS+  D G+
Sbjct  205   RELFYGVLGGLGQFGIITRARVFLNHAPKRVKWFRMLYSDFTAFTNDQERLISMANDIGI  264

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG L+++        ++FF PS QS++  L+ NHGIIY LE+ KYYDD T   I + 
Sbjct  265   DYLEGQLMLSNGIV---ETTFFPPSDQSKVTDLVKNHGIIYVLEVAKYYDDPTLPLIGQV  321

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             ++++ K LS++ G +   DV +FDFLNRV++ E KLR  G+W+VPHPWLNL+VPKS+I  
Sbjct  322   IEKLIKTLSYLPGFITMHDVPYFDFLNRVQNEEDKLRSLGLWEVPHPWLNLYVPKSQIHA  381

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             F+ GV  DI+L+QN TSG  L+YPTN+ +WD+RMSA +P  +  Y VG+LHS+   +  E
Sbjct  382   FHNGVIKDILLKQNSTSGLALIYPTNRNKWDNRMSATIPNGDVIYIVGILHSTSPKKLPE  441

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             + + NE+I+ +C E+GIKIKQYL HY  +EDW +HFG KW  F +RK LFDPK +LSPGQ
Sbjct  442   VESINEKIISFCKESGIKIKQYLMHYTRKEDWIQHFGSKWSDFSKRKDLFDPKKLLSPGQ  501

Query  228   RIF  220
              IF
Sbjct  502   DIF  504



>ref|XP_002869416.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=525

 Score =   491 bits (1263),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 236/426 (55%), Positives = 316/426 (74%), Gaps = 8/426 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  GVVV M+ L +      V  S   G YADV    +WVDVL+A++
Sbjct  104   ARGQGHSLRGQASAPGGVVVNMTCLAKAAKPAAVVISAD-GTYADVAAGTMWVDVLKAAV  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTD+LYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKGE++TCS  +N
Sbjct  163   ERGVSPVSWTDFLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD---G  952
              ELF+ VLGGLGQFG+ITRARI LD APTRVKW R+LY DF+ F RDQE LIS+ +   G
Sbjct  223   PELFYGVLGGLGQFGIITRARIALDHAPTRVKWSRILYSDFSTFKRDQERLISMTNDRGG  282

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
             +D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ KYYD  T   ID+
Sbjct  283   VDFLEGQLMMSNGFVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDRTTLPIIDQ  339

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
              +  + + L F  G +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVP SRIL
Sbjct  340   VIDMLTRTLGFAPGFMFVQDVPYFDFLNRVRNEEDKLRSLGLWEVPHPWLNIFVPGSRIL  399

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-W  415
             DF+ GV   ++L Q  T+G  L YPTN+ +W++RMS + P+E+ FY +GLL S+  ++ W
Sbjct  400   DFHDGVINGLLLNQTSTTGVTLFYPTNRNKWNNRMSTMTPDEDVFYVIGLLQSAGGSQNW  459

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             +EL N N++++++C+ +GIKIK+YL HY  +EDW KHFG KW  F ++K +FDPK +LSP
Sbjct  460   QELENLNDKVIQFCENSGIKIKEYLMHYTRKEDWVKHFGPKWDDFLRKKIMFDPKRLLSP  519

Query  234   GQRIFS  217
             GQ IF+
Sbjct  520   GQDIFN  525



>ref|XP_006294012.1| hypothetical protein CARUB_v10023000mg [Capsella rubella]
 gb|EOA26910.1| hypothetical protein CARUB_v10023000mg [Capsella rubella]
Length=524

 Score =   490 bits (1262),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 313/425 (74%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  GVVV M+ L        V  S   G YADV    +WVDVL+A+L
Sbjct  104   ARGQGHSLRGQASAPGGVVVNMTCLAMAAKPAAVVISAD-GTYADVAAGTMWVDVLKAAL  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKGE++TCS  +N
Sbjct  163   ERGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSLKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARI L  APTRVKW R+LY DF+ F RDQE LIS+  D G+
Sbjct  223   PELFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERLISMTKDLGV  282

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ KYYD  T   ID+ 
Sbjct  283   DFLEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDSTTLPIIDQV  339

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F  GL+F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVP SRI D
Sbjct  340   MDMLSRSLGFAPGLMFVQDVPYFDFLNRVRTEEEKLRSLGLWEVPHPWLNIFVPGSRIQD  399

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ GV   ++L Q  T+G  L YPTN+ +W++ MS + P+E+ FY +G+L S+  ++ W+
Sbjct  400   FHDGVINGLLLNQTSTAGVTLFYPTNRNKWNNGMSTMSPDEDVFYVIGILQSAGGSQNWQ  459

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++I+++C+ +GIKIK+YL HY  +EDW KHFG KW  F +RK +FDPK +LSPG
Sbjct  460   ELENLNDKIIQFCENSGIKIKEYLMHYTRKEDWIKHFGPKWGDFVRRKIMFDPKRLLSPG  519

Query  231   QRIFS  217
             Q IF+
Sbjct  520   QDIFN  524



>ref|XP_010447814.1| PREDICTED: cytokinin dehydrogenase 4-like [Camelina sativa]
Length=524

 Score =   490 bits (1262),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 313/425 (74%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  G+VV M+ L        V  S   G YADV    +WVDVL+A++
Sbjct  104   ARGQGHSLRGQASAPGGIVVNMTCLAMAAKPAAVVISAD-GTYADVAAGTMWVDVLKAAV  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKG+L+TCS  +N
Sbjct  163   ERGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGDLMTCSPKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARI L  APTRVKW R+LY DF+ F RDQE LIS+  D G+
Sbjct  223   PELFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGV  282

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ KYYD  T   I+  
Sbjct  283   DFLEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDSTTLPIINLV  339

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + K L F  G +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVPKSRILD
Sbjct  340   MDMLSKTLGFAPGFMFIQDVPYFDFLNRVRNEEEKLRSLGLWEVPHPWLNIFVPKSRILD  399

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ GV   ++L Q  T+G  L YPTN+ +W++ MS + P+E+ FY +GLL S+  ++ W+
Sbjct  400   FHDGVISGLLLNQTATAGVTLFYPTNRNKWNNLMSTMSPDEDVFYVIGLLQSAGGSQNWQ  459

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++I+++C+ +GIKIK+YL HY  +EDW KHFG KW  F +RK +FDPK +LSPG
Sbjct  460   ELENLNDKIIQFCENSGIKIKEYLMHYTRKEDWIKHFGPKWYDFLRRKIMFDPKRLLSPG  519

Query  231   QRIFS  217
             Q IF+
Sbjct  520   QDIFN  524



>emb|CDY30204.1| BnaA03g49660D [Brassica napus]
Length=516

 Score =   489 bits (1259),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 235/425 (55%), Positives = 310/425 (73%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  GVVV M+ L +      V  S   G YADV    +WV+VL A+L
Sbjct  96    ARGQGHSLRGQASAPGGVVVNMTCLAKTATPAAVVVSAD-GTYADVAAGAMWVEVLEAAL  154

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV++TDYLYL+VGGTLSNAGI GQ FR+GPQI+NV E+DVITGKG+++TCS  +N
Sbjct  155   ARGVSPVTFTDYLYLSVGGTLSNAGIGGQVFRHGPQISNVHELDVITGKGDMVTCSPKLN  214

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL--  949
              ELF+ VLGGLGQFG+ITRARI LD APTRVKW+R+LY DF+ FTRDQE LIS+ + L  
Sbjct  215   PELFYGVLGGLGQFGIITRARIALDHAPTRVKWLRILYSDFSAFTRDQERLISMANDLRV  274

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL++ H IIY LE+ KYYD  T   ID+ 
Sbjct  275   DFLEGQLMMSNGIVD---TSFFPLSDQTRVASLVNEHRIIYVLEVAKYYDTTTLPIIDQV  331

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F    +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVPKSR+LD
Sbjct  332   IDTLTRTLGFTSEFMFMQDVPYFDFLNRVRNEEDKLRSIGLWEVPHPWLNMFVPKSRVLD  391

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-RVNEWE  412
             F+ GV   ++L Q  TSG  L YPTN+ +W++ MSA++P E+ FY VG L S+   + +E
Sbjct  392   FHEGVIKGLLLNQTATSGVTLFYPTNRNKWNNLMSAMIPNEDVFYVVGFLQSAGGSHNFE  451

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL + N+ I+ +C+ +GIKIK+YL HY  +EDW KHFG KW  F +RK +FDP+ +LSPG
Sbjct  452   ELESLNDRIINFCNNSGIKIKEYLMHYTKKEDWIKHFGPKWSDFSRRKMMFDPEKLLSPG  511

Query  231   QRIFS  217
             Q IF+
Sbjct  512   QDIFN  516



>ref|NP_565455.1| cytokinin oxidase 2 [Arabidopsis thaliana]
 sp|Q9FUJ3.2|CKX2_ARATH RecName: Full=Cytokinin dehydrogenase 2; AltName: Full=Cytokinin 
oxidase 2; Short=AtCKX2; Short=CKO 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD10149.2| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AAO42130.1| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AAO64073.1| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AEC06889.1| cytokinin oxidase 2 [Arabidopsis thaliana]
Length=501

 Score =   488 bits (1255),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/425 (55%), Positives = 307/425 (72%), Gaps = 14/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+   GV+V M+ +      + VS  +    YADV    LWVDVL+ + 
Sbjct  87    ARGQGHSLNGQASVSGGVIVNMTCITD----VVVSKDKK---YADVAAGTLWVDVLKKTA  139

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL++TVGGTLSN GI GQ FR GP ++NV+E+DVITGKGE++TCS+ +N
Sbjct  140   EKGVSPVSWTDYLHITVGGTLSNGGIGGQVFRNGPLVSNVLELDVITGKGEMLTCSRQLN  199

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARIVLD AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  200   PELFYGVLGGLGQFGIITRARIVLDHAPKRAKWFRMLYSDFTTFTKDQERLISMANDIGV  259

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG + ++    +   +SFF PS QS++A L+  HGIIY LE+ KYYDD     I + 
Sbjct  260   DYLEGQIFLSNGVVD---TSFFPPSDQSKVADLVKQHGIIYVLEVAKYYDDPNLPIISKV  316

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + K LS++ G +   DV++FDFLNRV   E KLR  G+W++PHPWLNL+VPKSRILD
Sbjct  317   IDTLTKTLSYLPGFISMHDVAYFDFLNRVHVEENKLRSLGLWELPHPWLNLYVPKSRILD  376

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE--EETFYCVGLLHSSRVNEW  415
             F+ GV  DI+L+Q   SG  L+YPTN+ +WD+RMSA++PE  E+  Y +GLL S+   + 
Sbjct  377   FHNGVVKDILLKQKSASGLALLYPTNRNKWDNRMSAMIPEIDEDVIYIIGLLQSATPKDL  436

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
              E+ + NE+I+++C ++GIKIKQYL HY ++EDW +HFG KW  F +RK LFDPK +LSP
Sbjct  437   PEVESVNEKIIRFCKDSGIKIKQYLMHYTSKEDWIEHFGSKWDDFSKRKDLFDPKKLLSP  496

Query  234   GQRIF  220
             GQ IF
Sbjct  497   GQDIF  501



>ref|XP_010433070.1| PREDICTED: cytokinin dehydrogenase 4 [Camelina sativa]
Length=525

 Score =   488 bits (1257),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 235/425 (55%), Positives = 313/425 (74%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  G+VV M+ L        V  S   G YADV    +WVDVL+A++
Sbjct  105   ARGQGHSLRGQASAPGGIVVNMTCLAMAAKPAAVVVSAD-GTYADVAAGTMWVDVLKAAV  163

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKG+++TCS  +N
Sbjct  164   ERGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGKMMTCSPKLN  223

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARI L  APTRVKW R+LY DF+ F RDQE LIS+  D G+
Sbjct  224   PELFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGV  283

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ KYYD  T   I + 
Sbjct  284   DFLEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKYYDSTTLPIIGQV  340

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F  G +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVP+SRI D
Sbjct  341   MDMLSRTLGFAPGFMFIQDVPYFDFLNRVRNEEEKLRSLGLWEVPHPWLNIFVPESRIQD  400

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ GV   ++L Q  T+G  L YPTN+ +W+DRMS + P+E+ FY +GLL S+  ++ W+
Sbjct  401   FHDGVINGLLLNQTATAGVTLFYPTNRNKWNDRMSTMSPDEDVFYVIGLLQSAGGSQNWQ  460

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++I+++C+ +GIKIK+YL HY  +EDW KHFG KW  F +RK +FDPK +LSPG
Sbjct  461   ELENLNDKIIQFCENSGIKIKEYLMHYIRKEDWVKHFGPKWDDFLRRKIMFDPKRLLSPG  520

Query  231   QRIFS  217
             Q IF+
Sbjct  521   QDIFN  525



>gb|KCW60467.1| hypothetical protein EUGRSUZ_H03190, partial [Eucalyptus grandis]
Length=462

 Score =   486 bits (1251),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/411 (55%), Positives = 304/411 (74%), Gaps = 7/411 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G    VS+S+SLG YADVGGH++W +VL  +L
Sbjct  54    ARGRGHSVRGQAMARDGVVVDMTSLGNKGHGTTVSYSQSLGHYADVGGHQIWFNVLEHTL  113

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAPV+ TDY Y TVGGTLSNAGI G++FR GPQI NV EMDVITG G+ +TCS H N
Sbjct  114   KHGLAPVTLTDYQYATVGGTLSNAGIGGEAFRNGPQITNVHEMDVITGTGDFLTCSPHKN  173

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----ID  958
              +LF++VLGGLGQFG+ITRARI L  AP R KWVRMLY DF+ FT D E LIS      D
Sbjct  174   PDLFYSVLGGLGQFGIITRARIALRPAPKRAKWVRMLYSDFSAFTTDHERLISRHQRDQD  233

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LD+VEG L+M ++  ++W SSF    H  ++ SL++ H ++Y ++  KYYD++T +T+
Sbjct  234   EALDFVEGCLLMHRN-MDSWISSFPLSDH-PRLMSLLTEHKLLYCIKAAKYYDEQTESTV  291

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             +++L+ + K L+ +    FEKDV+F DFLNR+R  E++LR++G+W++PHPWLNLFVPKS 
Sbjct  292   EKDLEIILKDLNHVPEFKFEKDVAFIDFLNRMRVAELQLREQGLWNIPHPWLNLFVPKSH  351

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             + D N G+F DI L+ N T+G +L+YP NK +WDDRMSAV P+E+ FY V   H+S   +
Sbjct  352   MADINTGIFKDIALKNNITTGYVLIYPMNKNKWDDRMSAVTPDEDIFYTVEFFHASGFGD  411

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
             W+E   QN+E+L +    GIK K+YLP+Y+TE +W +HFG KW+ FQ+ KA
Sbjct  412   WQECELQNKEMLSFLKVNGIKFKRYLPNYRTEREWMEHFGPKWRTFQESKA  462



>ref|XP_010438272.1| PREDICTED: cytokinin dehydrogenase 4-like [Camelina sativa]
Length=524

 Score =   488 bits (1256),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 235/425 (55%), Positives = 313/425 (74%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  G+VV M+ L        V  S   G YADV    +WVDVL+A++
Sbjct  104   ARGQGHSLRGQASAPGGIVVNMTCLAMAAKPAAVVISAD-GTYADVAAGTMWVDVLKAAV  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKGE+++CS  +N
Sbjct  163   ERGVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMSCSPKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARI L  APTRVKW R+LY DF+ F RDQE LIS+  D G+
Sbjct  223   PELFYGVLGGLGQFGIITRARIALGHAPTRVKWSRILYSDFSAFKRDQERLISMTNDLGV  282

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL+++H IIY LE+ K YD +T    D  
Sbjct  283   DFLEGQLMMSNGIVD---TSFFPLSDQTRVASLVNDHRIIYVLEVAKCYDSKTLPITDLV  339

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F  G +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVPKSRILD
Sbjct  340   MDMLSRTLGFAPGFMFIQDVPYFDFLNRVRNEEEKLRSLGLWEVPHPWLNIFVPKSRILD  399

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ GV   ++L Q  T+G  L YPTN+ +W++RMS + P+E+ FY +GLL S+  ++ W+
Sbjct  400   FHDGVIHGLLLNQTATAGVTLFYPTNRNKWNNRMSTMSPDEDVFYVIGLLQSAGGSQNWQ  459

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++I+++C+ +GIKIK+YL HY  +EDW KHFG KW  F +RK +FDPK +LSPG
Sbjct  460   ELENLNDKIIQFCENSGIKIKEYLMHYTRKEDWIKHFGPKWDDFLRRKIMFDPKRLLSPG  519

Query  231   QRIFS  217
             Q IF+
Sbjct  520   QDIFN  524



>ref|XP_003527677.1| PREDICTED: cytokinin dehydrogenase 5-like [Glycine max]
Length=549

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/435 (56%), Positives = 311/435 (71%), Gaps = 17/435 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKD--GVVVEM------SSLKRNGGRIRVSWSESLGFYADVGGHELW  1327
             ARGHGHS  GQA  K+  GVV+EM       +   NG    +   E  G Y DV G +LW
Sbjct  105   ARGHGHSINGQALIKEKKGVVIEMGKSDSGDNNDHNGDSNIIRVCEK-GMYVDVWGGKLW  163

Query  1326  VDVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGEL  1147
             +DVL A+L +GLAP+SWTDYLYL+VGGTLSNAGISGQ+F +GPQI NV E+DV+TGKGEL
Sbjct  164   IDVLSATLEYGLAPMSWTDYLYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTGKGEL  223

Query  1146  ITCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI  967
             +TCS+  NSELF +VLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F +F +DQE+LI
Sbjct  224   VTCSEDRNSELFHSVLGGLGQFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLI  283

Query  966   SID-----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY  802
             S+      +  DYVEG +I+ +   NNWRSSFF+ S+  +I SL ++ G++Y LE+ K Y
Sbjct  284   SLHGKAARERFDYVEGFVIVDEGLINNWRSSFFAASNPVKITSLNADGGVLYCLEITKNY  343

Query  801   DDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWL  622
             D   A ++DEE+Q + K L+FI   VF  D+ + DFL+RV   E+KL+ KG+WDVPHPWL
Sbjct  344   DQGNADSVDEEIQALLKKLNFIPTSVFTTDLPYVDFLDRVHKAELKLKSKGLWDVPHPWL  403

Query  621   NLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGL  442
             NLFVPKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R S V PEE+ FY V  
Sbjct  404   NLFVPKSRIEDFDKGVFKGIL--GNKTSGPILIYPMNKNKWDHRSSVVTPEEDVFYLVAF  461

Query  441   LHSSRVNE-WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
             L S+   E  E L NQN +IL++C ++ IK+KQYLPHY T+++W  HFG KW  F  RK 
Sbjct  462   LRSALDTETLEYLTNQNRQILRFCHDSEIKVKQYLPHYTTQQEWMDHFGDKWTQFNARKM  521

Query  264   LFDPKLILSPGQRIF  220
              FDP+ IL  GQ+IF
Sbjct  522   QFDPRRILGTGQQIF  536



>ref|XP_006390301.1| hypothetical protein EUTSA_v10018378mg [Eutrema salsugineum]
 gb|ESQ27587.1| hypothetical protein EUTSA_v10018378mg [Eutrema salsugineum]
Length=535

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 243/429 (57%), Positives = 309/429 (72%), Gaps = 13/429 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQA-TAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA T ++GVVVEM+  K       V   E    Y DV G ELWVDVL+ +
Sbjct  94    ARGHGHSINGQAATGRNGVVVEMNHRKTGTPEPLVRPEE---MYVDVWGGELWVDVLKKT  150

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV+E+DV+TGKGE++ CS+  
Sbjct  151   LEYGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEEQ  210

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL-  949
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+   L 
Sbjct  211   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQLK  270

Query  948   -DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y D  + T+D+
Sbjct  271   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSDTVDQ  330

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  331   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  390

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP N  +WD+R SAV P+EE FY V LL S+      
Sbjct  391   DFDKGVFKGIL--GNKTSGPILIYPMNNDKWDERSSAVTPDEEVFYLVALLRSALSDGEE  448

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L NQN  IL++CD+A I +KQYLPH+ T+E+W  HFG KW+ F+  KA FDP+ 
Sbjct  449   TQKLEYLKNQNRRILEFCDKAKISVKQYLPHHATQEEWVAHFGDKWERFRSMKAEFDPRH  508

Query  246   ILSPGQRIF  220
             IL+ GQRIF
Sbjct  509   ILATGQRIF  517



>ref|XP_002889026.1| hypothetical protein ARALYDRAFT_476695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65285.1| hypothetical protein ARALYDRAFT_476695 [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score =   488 bits (1256),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 244/433 (56%), Positives = 311/433 (72%), Gaps = 13/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATA-KDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA A ++GVVVEM+          V   E    Y DV G ELWVDVL+ +
Sbjct  97    ARGHGHSINGQAAAGRNGVVVEMNHGVTGTPESLVRPDE---MYVDVWGGELWVDVLKKT  153

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV+E+DV+TGKGE++ CS+  
Sbjct  154   LEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEEE  213

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL-  949
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+   L 
Sbjct  214   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQLK  273

Query  948   -DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y D  + T+D+
Sbjct  274   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSETVDQ  333

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  334   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  393

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+      
Sbjct  394   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEE  451

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN  IL++C++A I +KQYLPH+ T+E+WE HFG KW  F++ KA FDP+ 
Sbjct  452   TQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWEAHFGDKWDRFRRLKAEFDPRH  511

Query  246   ILSPGQRIFSQSS  208
             IL+ GQRIF   S
Sbjct  512   ILATGQRIFQNPS  524



>ref|XP_009137860.1| PREDICTED: cytokinin dehydrogenase 4 [Brassica rapa]
Length=524

 Score =   487 bits (1254),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 235/425 (55%), Positives = 309/425 (73%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  GVVV M+ L +      V  S   G YADV    +WV+VL A+L
Sbjct  104   ARGQGHSLRGQASAPGGVVVNMTCLAKTATPAAVVVSTH-GTYADVAAGAMWVEVLEAAL  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV++TDYLYL+VGGTLSNAGI GQ FR+GPQI+NV E+DVITGKG ++TCS  +N
Sbjct  163   ARGVSPVTFTDYLYLSVGGTLSNAGIGGQVFRHGPQISNVHELDVITGKGGMVTCSPKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL--  949
              ELF+ VLGGLGQFG+ITRARI LD APTRVKW+R+LY DF+ FTRDQE LIS+ + L  
Sbjct  223   PELFYGVLGGLGQFGIITRARIALDHAPTRVKWLRILYSDFSAFTRDQERLISMANDLRV  282

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ASL++ H IIY LE+ KYYD  T   ID+ 
Sbjct  283   DFLEGQLMMSNGIVD---TSFFPLSDQTRVASLVNEHRIIYVLEVAKYYDTTTLPIIDQV  339

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F    +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVPKSR+LD
Sbjct  340   IDTLTRTLGFTSEFMFMQDVPYFDFLNRVRNEEDKLRSIGLWEVPHPWLNMFVPKSRVLD  399

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-RVNEWE  412
             F+ GV   ++L Q  TSG  L YPTN+ +W++ MSA++P E+ FY VG L S+   + +E
Sbjct  400   FHEGVIKGLLLNQTATSGVTLFYPTNRNKWNNLMSAMIPNEDVFYVVGFLQSAGGSHNFE  459

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL + N+ I+ +C+ +GIKIK+YL HY  +EDW KHFG KW  F +RK +FDP+ +LSPG
Sbjct  460   ELESLNDRIINFCNNSGIKIKEYLMHYTKKEDWIKHFGPKWSDFSRRKMMFDPEKLLSPG  519

Query  231   QRIFS  217
             Q IF+
Sbjct  520   QDIFN  524



>gb|KHN45882.1| Cytokinin dehydrogenase 5 [Glycine soja]
Length=424

 Score =   483 bits (1243),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 302/415 (73%), Gaps = 13/415 (3%)
 Frame = -3

Query  1440  KDGVVVEM--SSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASLPHGLAPVSWTDY  1267
             K GVV+EM  S    +G  IRVS     G Y DV G +LW+DVL A+L +GLAP+SWTDY
Sbjct  5     KKGVVIEMGKSDSGEDGSSIRVS---EKGMYVDVWGGKLWIDVLSATLEYGLAPMSWTDY  61

Query  1266  LYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINSELFFAVLGGLG  1087
             LYL+VGGTLSNAGISGQ+F +GPQI NV E+DV+TGKGEL+TCS+  NSELF AVLGGLG
Sbjct  62    LYLSVGGTLSNAGISGQTFNHGPQITNVYELDVVTGKGELVTCSEDRNSELFHAVLGGLG  121

Query  1086  QFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-----DGLDYVEGSLIM  922
             QFG+ITRARI L+ AP RV+W+R+LY +F +F +DQE+LIS+      +  DYVEG +I+
Sbjct  122   QFGIITRARIALEPAPHRVRWIRVLYSNFARFCKDQEYLISLHGKAARERFDYVEGFVIV  181

Query  921   TQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQEMFKGLS  742
              +   NNWRSSFFS S+  +I SL ++ G++Y LE+ K YD   A ++DEE+Q + K L+
Sbjct  182   DEGLINNWRSSFFSASNPVKITSLNADGGVLYCLEITKNYDQGNADSVDEEIQALLKKLN  241

Query  741   FIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFNVGVFVDI  562
             FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLFVPKSRI DF+ GVF  I
Sbjct  242   FIPTSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVPKSRIGDFDKGVFKGI  301

Query  561   ILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WEELGNQNEEI  385
             +   NKTSGPIL+YP NK +WD R S V PEE+ FY V  L S+   E  E L NQN +I
Sbjct  302   L--GNKTSGPILIYPMNKNKWDQRSSVVTPEEDVFYLVAFLRSALDTETLEYLTNQNRQI  359

Query  384   LKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQRIF  220
             LK+C +  IK+KQYLPHY T+++W  HFG KW  F  RK  FDP+ IL+ GQ+IF
Sbjct  360   LKFCHDIEIKVKQYLPHYTTQQEWMDHFGDKWPQFNARKMQFDPRRILATGQQIF  414



>ref|XP_009112608.1| PREDICTED: cytokinin dehydrogenase 2 [Brassica rapa]
Length=502

 Score =   486 bits (1251),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 237/424 (56%), Positives = 310/424 (73%), Gaps = 13/424 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA   DGV++ M+ L        V  S+ +  YADV G  LWVDVL+ + 
Sbjct  89    ARGQGHSLMGQAGVPDGVIINMTCLAG------VVVSDDMK-YADVAGGTLWVDVLKKTA  141

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL+++VGGTLSNAGI G+ FR GPQI+NV+E+DVITGKGE++ CS  +N
Sbjct  142   EKGVSPVSWTDYLHVSVGGTLSNAGIGGEVFRNGPQISNVLELDVITGKGEMLACSPQLN  201

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
             SELF+ VLGGLGQFG+ITRARIVL+ AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  202   SELFYGVLGGLGQFGIITRARIVLNHAPKRAKWFRMLYSDFTAFTKDQERLISMANDTGV  261

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG L M+    +   +SFF  S QS+IA L+ +HGIIY LE+ K+YDD T   I + 
Sbjct  262   DYLEGQLFMSNGVVD---TSFFPQSDQSKIADLVKSHGIIYVLEVAKFYDDPTLPIIGQV  318

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + K LS++ G +   DV++FDFLNRV++ E KLR  G+W+VPHPWLNL+VPKS+ILD
Sbjct  319   VDMLTKTLSYLPGFISVHDVAYFDFLNRVKAEENKLRSLGLWEVPHPWLNLYVPKSQILD  378

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP-EEETFYCVGLLHSSRVNEWE  412
             F+ GV  DI+L+QN TSG  L+YP+N+ +WD+RMSA+V  EE+  Y +G+L S+      
Sbjct  379   FHNGVVKDILLKQNSTSGLTLLYPSNRNKWDNRMSAMVTDEEDVVYIIGILQSATPQNVP  438

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             E+ + N+ I++ C ++GIKIKQYL HY  +EDW +HFG KW+ F +RK LFDPK +LSPG
Sbjct  439   EVESLNDSIIRVCKDSGIKIKQYLMHYTRKEDWVEHFGTKWRDFSKRKDLFDPKKLLSPG  498

Query  231   QRIF  220
             Q IF
Sbjct  499   QDIF  502



>ref|XP_004488073.1| PREDICTED: cytokinin dehydrogenase 3-like [Cicer arietinum]
Length=526

 Score =   486 bits (1252),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 239/431 (55%), Positives = 316/431 (73%), Gaps = 14/431 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSE---SLGFYADVGGHELWVDVL  1315
             RG  HS  GQA A++GVVV M+ L   RNG  I VS  +    L  Y DVGG +LW+DVL
Sbjct  98    RGKAHSVLGQAMAQNGVVVNMTQLNGFRNGSGIVVSNCDVKSPLDCYVDVGGEQLWIDVL  157

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
              A+   GLAP+SWTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV+E+DVITG+GE +TCS
Sbjct  158   HATTKLGLAPLSWTDYLYLTVGGTLSNAGISGQTFRFGPQISNVLELDVITGEGEFVTCS  217

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-  958
             +  NSELF++VLGGLGQFGVITRAR+ L  +PTR KW+R++YD+F+ F+ DQEHLIS + 
Sbjct  218   RENNSELFYSVLGGLGQFGVITRARLPLGPSPTRAKWLRLIYDNFSIFSADQEHLISFNN  277

Query  957   ----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
                 +  DYVEG L+  +   +    SF+    Q +I SL++  GI Y +ELVKYYD  T
Sbjct  278   KNDTNAADYVEGILLFNKPLLD---LSFYPTPDQPRIKSLVTKCGIAYVIELVKYYDTNT  334

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
              + +DEE+  + K L+F+   +FEKDV++ +FL+RV   E+ LR KG+W+VPHPWLN+FV
Sbjct  335   QSRVDEEVDNLVKELNFVPTFMFEKDVTYEEFLDRVHVEELVLRSKGLWEVPHPWLNMFV  394

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH-S  433
             PKSRI DFN GVF  IIL+QN T   +L YP N+ +WDD+MSAV+P E+ FY + LL+ +
Sbjct  395   PKSRISDFNEGVFKGIILKQNLTPAILLFYPMNQNKWDDKMSAVIPNEDVFYTLSLLNAA  454

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             S ++E +    Q ++IL++C+++GI+I+QYL   KT + W +HFG KWQ+F+ RKA FDP
Sbjct  455   SGLDEVKAFEAQIQQILQFCNDSGIEIRQYLIGNKTPQQWIQHFGTKWQLFEDRKAKFDP  514

Query  252   KLILSPGQRIF  220
             K ILSPGQ IF
Sbjct  515   KRILSPGQGIF  525



>gb|KCW60664.1| hypothetical protein EUGRSUZ_H03393, partial [Eucalyptus grandis]
Length=474

 Score =   484 bits (1247),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 228/381 (60%), Positives = 296/381 (78%), Gaps = 10/381 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A+DGVVV+M+SL   G +  VSWS+SLG YADVGG +LW++VL  +L
Sbjct  99    ARGCGHSVRGQAMARDGVVVDMTSL---GNKTAVSWSQSLGHYADVGGQQLWINVLEETL  155

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HG+ PVSWTDYLYLTVGGTLSNAGISG++FRYGPQI+NV EMDVITG G   TCS H N
Sbjct  156   KHGVTPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGHFFTCSPHKN  215

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----D  958
              ELF++VLGGLGQFG+ITRARI L +AP R  WVRMLY DF+ FT DQE LIS+     D
Sbjct  216   PELFYSVLGGLGQFGIITRARIALGQAPNRAIWVRMLYSDFSAFTTDQERLISLHGRDQD  275

Query  957   DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
             + LDYVEG L M ++ +++W  SFFS S + ++ SL++ H ++Y +E+ K+YD+ T +T+
Sbjct  276   EALDYVEGQLFMRRN-SDSW-ISFFSLSDRPRLMSLLTEHELLYCIEVAKFYDERTRSTV  333

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+ + K LS +   +F+KDV + DFLNRVR+ E+ LR+ G+W+VPHPWLNLFVPKSR
Sbjct  334   DKDLKTILKDLSHVPEFLFQKDVGYVDFLNRVRAEELTLRELGLWNVPHPWLNLFVPKSR  393

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFN GVF +I+LR+N T+GP+L+YP N  +WDDRMSAV+P+E+ FY VG L SS   +
Sbjct  394   IADFNTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLLSSGFKD  453

Query  417   WEELGNQNEEILKYCDEAGIK  355
             W+E   QN+E+L +C++ GIK
Sbjct  454   WQEFDLQNKEVLLFCEDNGIK  474



>ref|XP_006297443.1| hypothetical protein CARUB_v10013466mg, partial [Capsella rubella]
 gb|EOA30341.1| hypothetical protein CARUB_v10013466mg, partial [Capsella rubella]
Length=516

 Score =   485 bits (1249),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 304/425 (72%), Gaps = 13/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+   GVVV M+ L  +   + VS  +    YADV    LWVDVL+ + 
Sbjct  101   ARGQGHSLNGQASVSGGVVVNMTCLADD---VVVSKDKK---YADVAAGTLWVDVLKKTA  154

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL+++VGGTLSN GI GQ FR GP I+NV+E+DVITGKGE++TCS  +N
Sbjct  155   EEGVSPVSWTDYLHISVGGTLSNGGIGGQVFRNGPLISNVLELDVITGKGEMLTCSPKLN  214

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
             SELF+ VLGGLGQFG+ITRARIVLD AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  215   SELFYGVLGGLGQFGIITRARIVLDHAPKRAKWFRMLYSDFTAFTKDQERLISMANDIGV  274

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG + M+    +   +SFF PS QS++  L+  HGIIY LE  KYYDD     I E 
Sbjct  275   DYLEGQIFMSNGVVD---TSFFPPSDQSKVTDLVKKHGIIYVLETAKYYDDPNLPIIREV  331

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             + ++ + LS++ G +   DVS+FDFLNRV+  E KLR  G+W+VPHPWLNL+VPKSRILD
Sbjct  332   VDKLKQSLSYLPGFISMHDVSYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRILD  391

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE--EETFYCVGLLHSSRVNEW  415
             F+ GV  DI+L+Q   SG  L+YPTN+ +WD+RMSA++PE  E+  Y +GLL S+     
Sbjct  392   FHNGVVKDILLKQKTASGLALLYPTNRNKWDNRMSAMIPEIDEDVIYVIGLLQSATPQTL  451

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
              E+ + N +I+++C ++GIKIKQYL  Y  +EDW +HFG KW  F +RK LFDPK +LSP
Sbjct  452   PEMESVNAKIIRFCKDSGIKIKQYLMRYTRKEDWIEHFGSKWNDFSKRKELFDPKKLLSP  511

Query  234   GQRIF  220
             GQ IF
Sbjct  512   GQDIF  516



>gb|KFK41981.1| hypothetical protein AALP_AA2G196900 [Arabis alpina]
Length=534

 Score =   486 bits (1250),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 241/429 (56%), Positives = 307/429 (72%), Gaps = 13/429 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQAT-AKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA   ++GVVVEM+  +       V   E    Y DV G ELWVDVL+ +
Sbjct  94    ARGHGHSINGQAAVGRNGVVVEMNHREAGTPEPLVRLKE---MYVDVWGGELWVDVLKKT  150

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV+E+DV+TGKGE++ CS+  
Sbjct  151   LEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMKCSEEE  210

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDG  952
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+     
Sbjct  211   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQSK  270

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y D  + TID+
Sbjct  271   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSESETIDQ  330

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W VPHPWLNLFVPKSRI 
Sbjct  331   EIEILMKKLNFIPTSVFTTDLQYIDFLDRVHKAELKLRSKNLWGVPHPWLNLFVPKSRIS  390

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WDDR SAV P+EE FY V LL S+      
Sbjct  391   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDDRSSAVTPDEEIFYLVALLRSALSDGEE  448

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN +IL++C++A I +KQYLPH+ T+E+W +HFG KW  F+  K  FDP+ 
Sbjct  449   TQKLEYLKDQNRKILEFCEQAKINVKQYLPHHATQEEWVEHFGDKWDRFRSMKTEFDPRH  508

Query  246   ILSPGQRIF  220
             IL+ GQRIF
Sbjct  509   ILATGQRIF  517



>ref|XP_010672675.1| PREDICTED: cytokinin dehydrogenase 5 [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   485 bits (1249),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 249/437 (57%), Positives = 312/437 (71%), Gaps = 24/437 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN----GGRIRVSWSESLGFYADVGGHELWVDVL  1315
             ARGHGHS  GQA   DGVV+EM  +K N    GG +     E    Y DV G ELWVDVL
Sbjct  82    ARGHGHSINGQAHTSDGVVIEMG-IKGNKSGPGGPVVNEIEE----YVDVWGGELWVDVL  136

Query  1314  RASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCS  1135
             + +L +GLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV E+DV+TG GEL+TCS
Sbjct  137   KCTLEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFNHGPQISNVFELDVVTGNGELVTCS  196

Query  1134  KHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD  955
             +  NSELF AVLGGLGQFG+ITRARI L+ +P RV+W+R+LY +FT FT+DQE+LIS+ D
Sbjct  197   EKKNSELFHAVLGGLGQFGIITRARIALEPSPQRVRWIRVLYSNFTAFTKDQEYLISLHD  256

Query  954   -----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASL-ISNHG-IIYSLELVKYYDD  796
                    DYVEG +I+ +   NNWRSSFFSPS+  +I+SL  SN+G ++Y LE+ K Y D
Sbjct  257   RPSSQKFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSLGASNNGDVLYCLEITKNYFD  316

Query  795   ETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
              ++ ++DEE++ + K L FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLNL
Sbjct  317   -SSESVDEEIEALLKKLDFIPASVFTTDLPYMDFLDRVHKAELKLRSKGLWEVPHPWLNL  375

Query  615   FVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLH  436
             FVPKS I +F+ GVF  I+   NKTSGPIL+YP NK +WD+  S V P EE FY V LL 
Sbjct  376   FVPKSSIAEFDKGVFKGIL--GNKTSGPILIYPMNKRKWDNSTSVVTPNEEVFYLVALLR  433

Query  435   SSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQR  271
             ++  N       E L +QN +IL +C +A I +KQYLPHY T+++W  HFG KW  F + 
Sbjct  434   TALENGEETQTLEYLTSQNRKILNFCKQAKIGVKQYLPHYTTQQEWIDHFGDKWDRFYKM  493

Query  270   KALFDPKLILSPGQRIF  220
             K  FDPK ILS GQRIF
Sbjct  494   KMQFDPKHILSTGQRIF  510



>gb|AAG30905.1|AF303978_1 cytokinin oxidase [Arabidopsis thaliana]
Length=501

 Score =   484 bits (1247),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 233/425 (55%), Positives = 306/425 (72%), Gaps = 14/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+   GV+V M+ +      + VS  +    YADV    LWVDVL+ + 
Sbjct  87    ARGQGHSLNGQASVSGGVIVNMTCITD----VVVSKDKK---YADVAAGTLWVDVLKKTA  139

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL++TV GTLSN GI GQ FR GP ++NV+E+DVITGKGE++TCS+ +N
Sbjct  140   EKGVSPVSWTDYLHITVRGTLSNGGIGGQVFRNGPLVSNVLELDVITGKGEMLTCSRQLN  199

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARIVLD AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  200   PELFYGVLGGLGQFGIITRARIVLDHAPKRAKWFRMLYSDFTTFTKDQERLISMANDIGV  259

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG + ++    +   +SFF PS QS++A L+  HGIIY LE+ KYYDD     I + 
Sbjct  260   DYLEGQIFLSNGVVD---TSFFPPSDQSKVADLVKQHGIIYVLEVAKYYDDPNLPIISKV  316

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + K LS++ G +   DV++FDFLNRV   E KLR  G+W++PHPWLNL+VPKSRILD
Sbjct  317   IDTLTKTLSYLPGFISMHDVAYFDFLNRVHVEENKLRSLGLWELPHPWLNLYVPKSRILD  376

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE--EETFYCVGLLHSSRVNEW  415
             F+ GV  DI+L+Q   SG  L+YPTN+ +WD+RMSA++PE  E+  Y +GLL S+   + 
Sbjct  377   FHNGVVKDILLKQKSASGLALLYPTNRNKWDNRMSAMIPEIDEDVIYIIGLLQSATPKDL  436

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
              E+ + NE+I+++C ++GIKIKQYL HY ++EDW +HFG KW  F +RK LFDPK +LSP
Sbjct  437   PEVESVNEKIIRFCKDSGIKIKQYLMHYTSKEDWIEHFGSKWDDFSKRKDLFDPKKLLSP  496

Query  234   GQRIF  220
             GQ IF
Sbjct  497   GQDIF  501



>ref|XP_010061263.1| PREDICTED: cytokinin dehydrogenase 5 [Eucalyptus grandis]
 gb|KCW68188.1| hypothetical protein EUGRSUZ_F01857 [Eucalyptus grandis]
Length=534

 Score =   485 bits (1249),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 243/437 (56%), Positives = 307/437 (70%), Gaps = 21/437 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSL---KRNGGRIRVSWSESLGFYADVGGHELWVDVLR  1312
             ARGHGHS  GQA A  GVV++MS      ++    RV+  E    Y D  G ELW+DVLR
Sbjct  89    ARGHGHSINGQAQAAGGVVLKMSGAGPAAQSRPAPRVAAEER---YVDAWGGELWIDVLR  145

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             ++L  GLAP SWTDYLYL+VGGTLSN GISGQ+F +GPQI+NV E+DV+TGKG+++TCS+
Sbjct  146   STLERGLAPKSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVYELDVVTGKGDIVTCSE  205

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---  961
               NS+LF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY +F+ FTRDQE+L S+   
Sbjct  206   EKNSQLFHAVLGGLGQFGIITRARIALEPAPQRVRWIRVLYSNFSSFTRDQEYLTSLHGE  265

Query  960   --DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETA  787
                   DYVEG +I+ +   NNWRSSFFSP +  +I+SL ++ G++Y LE+ K YD+  A
Sbjct  266   PASKKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISSLGTDGGVLYCLEVTKNYDESKA  325

Query  786   TTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
              T+D+E++ + K L FI   VF  D+ + DFL+RV   E KLR K +WDVPHPWLNLFVP
Sbjct  326   DTVDQEVEYLLKDLDFIPTSVFTTDIPYVDFLDRVHKAESKLRAKNLWDVPHPWLNLFVP  385

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR  427
             +SRI DF+ GVF  I+   +K SGPIL+YP NK +WD R S V PEE+ FY V LL S+ 
Sbjct  386   RSRIADFDRGVFKGIL--GDKASGPILIYPMNKNKWDQRSSVVTPEEDVFYLVALLRSAT  443

Query  426   VN-------EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQR  271
             V+         E L +QN  ILK+C + GI++KQYLPHY T E+W  HFG  KW  F Q 
Sbjct  444   VDGSGDASRRLEHLADQNRRILKFCGDEGIEVKQYLPHYSTREEWTGHFGDDKWARFYQN  503

Query  270   KALFDPKLILSPGQRIF  220
             K  FDPK ILS GQRIF
Sbjct  504   KMEFDPKQILSTGQRIF  520



>ref|XP_002883987.1| hypothetical protein ARALYDRAFT_480522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60246.1| hypothetical protein ARALYDRAFT_480522 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   484 bits (1245),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 235/425 (55%), Positives = 303/425 (71%), Gaps = 14/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+   GV+V M+ L      + VS  +    YADV    LWV+VL+ + 
Sbjct  89    ARGQGHSLNGQASVSGGVIVNMTCLTS----VVVSKDKK---YADVAAGTLWVNVLKKTA  141

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL++TVGGTLSN GI GQ FR GP I NV+E+DVITGKGE++TCS+ +N
Sbjct  142   EEGVSPVSWTDYLHITVGGTLSNGGIGGQVFRNGPLIRNVLELDVITGKGEVLTCSRQLN  201

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARIVLD AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  202   PELFYGVLGGLGQFGIITRARIVLDHAPKRAKWFRMLYSDFTTFTKDQERLISMVNDIGV  261

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG + ++    +   +SFF PS QS++A L+  HG+IY LE+ KYYDD     I + 
Sbjct  262   DYLEGQIFLSNGVVD---TSFFPPSDQSKVADLVKEHGVIYVLEVAKYYDDPNLPIISKV  318

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + K LS++ G +   DV +FDFLNRV+  E KLR  G+W+VPHPWLNL+VPKSRI D
Sbjct  319   IDTLTKSLSYLPGFISMHDVPYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRIRD  378

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE--EETFYCVGLLHSSRVNEW  415
             F+ GV  DI+L+Q   SG  L+YPTN+ +WD+RMSA++PE  E+  Y +GLL S+     
Sbjct  379   FHDGVVKDILLKQKTASGLALLYPTNRNKWDNRMSAMIPEIDEDVIYIIGLLQSATPQNL  438

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
              E+ + NEEI+++C ++GIKIKQYL HY  +EDW +HFG KW  F +RK LFDPK +LSP
Sbjct  439   PEMESVNEEIIRFCKDSGIKIKQYLMHYTRKEDWIEHFGSKWDDFSKRKDLFDPKKLLSP  498

Query  234   GQRIF  220
             GQ IF
Sbjct  499   GQDIF  503



>gb|KFK29530.1| hypothetical protein AALP_AA7G146300 [Arabis alpina]
Length=522

 Score =   484 bits (1246),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 233/425 (55%), Positives = 317/425 (75%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  G+VV M+ L +      V  S     YADV    +WV+VL A++
Sbjct  102   ARGQGHSLRGQASAPGGIVVNMTCLAKAAKPAAVVVSADRT-YADVAAGTMWVEVLEAAV  160

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
                ++PV+WTDYLYL+VGGTLSNAGI GQ+FR+GPQI+NV E+DVITGKGE++TCS ++N
Sbjct  161   EREVSPVTWTDYLYLSVGGTLSNAGIGGQTFRHGPQISNVHELDVITGKGEMMTCSPNLN  220

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARI LD APTRVKW+R+LY DF+ FTRDQE L+S+  D G+
Sbjct  221   PELFYGVLGGLGQFGIITRARIALDHAPTRVKWLRILYSDFSAFTRDQERLVSMANDLGV  280

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S ++++ASL+++H IIY LE+ KYYD  T   ID+ 
Sbjct  281   DFLEGQLMMSNGFVD---TSFFPLSDRTRVASLVNDHRIIYVLEVAKYYDTTTLPIIDKV  337

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L F+ G +F +DV +FDFLNRVR  E KL   G+W+VPHPWLN+FVP+SRILD
Sbjct  338   IDILTRTLGFVPGFMFMQDVPYFDFLNRVRIEEEKLSSLGLWEVPHPWLNMFVPRSRILD  397

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE-WE  412
             F+ GV   ++L +  TSG  L YPTN+ +W++ MSA++PEE+ FY +G L S+  ++ W+
Sbjct  398   FHNGVIKGLLLNRTSTSGVTLFYPTNRHKWNNLMSAMIPEEDVFYVIGFLQSAGGSQNWQ  457

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N++I+++CD++GIKIK+YL HY  +EDW KHFG KW  F ++K +FDPK +LSPG
Sbjct  458   ELENVNDKIIQFCDDSGIKIKEYLMHYTRKEDWIKHFGAKWDDFLRKKIMFDPKKLLSPG  517

Query  231   QRIFS  217
             Q IF+
Sbjct  518   QDIFN  522



>ref|XP_009106198.1| PREDICTED: cytokinin dehydrogenase 5 [Brassica rapa]
Length=535

 Score =   484 bits (1246),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 310/433 (72%), Gaps = 13/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQA-TAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA T ++GVVVEMS   RN G       E    Y DV G ELWVDVL+ +
Sbjct  93    ARGHGHSINGQASTGRNGVVVEMS--HRNIGTPE-PLVEPEEMYVDVWGGELWVDVLKKT  149

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV+E+DV+TG+GE++ CS+  
Sbjct  150   LEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEVMRCSEEE  209

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDG  952
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+     
Sbjct  210   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQSK  269

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y +  + T+D+
Sbjct  270   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHESESDTVDQ  329

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  330   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  389

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+      
Sbjct  390   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALSDGEE  447

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN  IL++C++A I +KQYLPH+ T+E+W  H+G KW  F+  KA FDP+ 
Sbjct  448   TQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHYGDKWDQFRSMKAEFDPRH  507

Query  246   ILSPGQRIFSQSS  208
             IL+ GQ+IF   S
Sbjct  508   ILATGQKIFQNPS  520



>emb|CDY47521.1| BnaAnng09190D [Brassica napus]
Length=531

 Score =   484 bits (1245),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 310/433 (72%), Gaps = 13/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQA-TAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA T ++GVVVEMS   RN G       E    Y DV G ELWVDVL+ +
Sbjct  89    ARGHGHSINGQASTGRNGVVVEMS--HRNIGTPE-PLVEPEEMYVDVWGGELWVDVLKKT  145

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV+E+DV+TG+GE++ CS+  
Sbjct  146   LEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEVMRCSEEE  205

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDG  952
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+     
Sbjct  206   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQSK  265

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y +  + T+D+
Sbjct  266   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHESESDTVDQ  325

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  326   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  385

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+      
Sbjct  386   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALSDGEE  443

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN  IL++C++A I +KQYLPH+ T+E+W  H+G KW  F+  KA FDP+ 
Sbjct  444   TQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHYGDKWDQFRSMKAEFDPRH  503

Query  246   ILSPGQRIFSQSS  208
             IL+ GQ+IF   S
Sbjct  504   ILATGQKIFQNPS  516



>ref|XP_009408782.1| PREDICTED: cytokinin dehydrogenase 5-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   484 bits (1245),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 245/439 (56%), Positives = 309/439 (70%), Gaps = 16/439 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLG-FYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA +  GVVV+MS   R   R   ++S S G +Y DV G +LWVDVL  +
Sbjct  90    ARGHGHSTNGQALSPGGVVVQMSR-GRIAPRPVPAYSPSTGEYYVDVWGGDLWVDVLNWT  148

Query  1305  LPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             L +G LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGELITCS+ 
Sbjct  149   LANGGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGELITCSEE  208

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI----  961
              NSELF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY DF  FTRDQE L+S+    
Sbjct  209   QNSELFHGVLGGLGQFGIITRARIALETAPHRVRWIRVLYSDFAAFTRDQELLVSLHGAH  268

Query  960   -DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               +  DYVEG +I+ +   NNWRSSFFSP +  +I+S+ +N G++Y LE+ K YD   A 
Sbjct  269   RSERFDYVEGFVIVDEGLINNWRSSFFSPKNPVKISSVHANAGLLYCLEMTKNYDSSAAD  328

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
             +IDE ++ +   L +I   VF  D+ + DFL+RV   E++LR KG+W VPHPWLNLFVP 
Sbjct  329   SIDEVVEALLGQLGYIPASVFTTDLPYVDFLDRVHKAEMRLRAKGLWAVPHPWLNLFVPA  388

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS--  430
             SRI DFN GVF  I+   NK+SGPIL+YP NK +WDDR S V P E+TFY V  L S+  
Sbjct  389   SRIADFNRGVFRGIL--GNKSSGPILIYPMNKHKWDDRSSVVTPHEDTFYLVAFLRSALP  446

Query  429   ----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKAL  262
                      E L  QN++IL++CD+AGI+IKQYLP +++   W +HFG KW  F +RK  
Sbjct  447   DSGDPTQSLEYLSRQNKKILEFCDDAGIEIKQYLPDHRSRAKWARHFGPKWGRFLRRKDR  506

Query  261   FDPKLILSPGQRIFSQSSS  205
             FDPK +L+ GQ I   SSS
Sbjct  507   FDPKCMLATGQGILPPSSS  525



>gb|KEH32514.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=518

 Score =   483 bits (1243),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 231/430 (54%), Positives = 311/430 (72%), Gaps = 15/430 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK---RNGGRIRVSWSESLGFYADVGGHELWVDVLR  1312
             ARG GHS  GQ+   DG+VV M+ L    RN G   V + +    Y DVGG + W+DVL 
Sbjct  96    ARGQGHSVNGQSMTNDGIVVNMTELNNELRNNGNGIVVFDK----YVDVGGGQRWIDVLH  151

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             ASL  GL P+SWTDYLYL+VGGTLSNAGISGQ+FR+GPQI+NV E+DV+TGKG+L+TCS 
Sbjct  152   ASLEKGLTPLSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVHELDVVTGKGDLVTCST  211

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID--  958
               NSELF+AVLGGLGQFG+ITRARI L  AP RVKW+R+LY+DF+ F+ DQEHLIS++  
Sbjct  212   EKNSELFYAVLGGLGQFGIITRARIALGPAPKRVKWLRLLYNDFSAFSGDQEHLISLNGI  271

Query  957   ---DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETA  787
                +  +YVEG L++ Q P +    SFF    Q +I SL++ +GIIY +EL KYYD+ + 
Sbjct  272   DETNAPNYVEGFLLLNQPPLD---LSFFPEIDQPRITSLVTQYGIIYIVELAKYYDENSQ  328

Query  786   TTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
               +D+E++ + +GL F+    FEKDVS+ +FL+RV + E+ LR +G+W++PHPWL+LFVP
Sbjct  329   DHVDQEIEILLQGLKFVPTFKFEKDVSYEEFLDRVHTDELTLRAQGLWNIPHPWLDLFVP  388

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR  427
              SR+ +FN GV   IIL+QN T+G ++VYP N+ +WDD+MSAV P EE FY V  L ++ 
Sbjct  389   GSRMSEFNEGVLKGIILKQNITAGLVIVYPMNRTKWDDKMSAVTPNEEIFYVVDFLRATG  448

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
              +  E   +QN++IL++C + GI+IK YLP  +T E+W + +G KW  F++RK  FDP  
Sbjct  449   FDNLEAYKSQNQQILQFCKDVGIEIKHYLPLNRTHEEWVEQYGLKWNAFEKRKNQFDPNK  508

Query  246   ILSPGQRIFS  217
             ILSPGQ IF+
Sbjct  509   ILSPGQGIFN  518



>ref|NP_177678.2| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
 sp|Q67YU0.1|CKX5_ARATH RecName: Full=Cytokinin dehydrogenase 5; AltName: Full=Cytokinin 
oxidase 5; Short=AtCKX5; Short=AtCKX6; Short=CKO5; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAD44141.1| cytokinin oxidase (CKX6) [Arabidopsis thaliana]
 gb|AEE35721.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
Length=540

 Score =   484 bits (1245),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 242/429 (56%), Positives = 308/429 (72%), Gaps = 13/429 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATA-KDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA A ++GVVVEM+       +  V   E    Y DV G ELWVDVL+ +
Sbjct  97    ARGHGHSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDE---MYVDVWGGELWVDVLKKT  153

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV+E+DV+TGKGE++ CS+  
Sbjct  154   LEHGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCSEEE  213

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL-  949
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+   L 
Sbjct  214   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQLK  273

Query  948   -DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y D  +  +D+
Sbjct  274   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSEIVDQ  333

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  334   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  393

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+      
Sbjct  394   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEE  451

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN  IL++C++A I +KQYLPH+ T+E+W  HFG KW  F+  KA FDP+ 
Sbjct  452   TQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRH  511

Query  246   ILSPGQRIF  220
             IL+ GQRIF
Sbjct  512   ILATGQRIF  520



>ref|XP_002513399.1| gulonolactone oxidase, putative [Ricinus communis]
 gb|EEF48802.1| gulonolactone oxidase, putative [Ricinus communis]
Length=511

 Score =   483 bits (1242),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 232/429 (54%), Positives = 308/429 (72%), Gaps = 17/429 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG+GHS RGQ  A +GVV++M+ L+  RNG  I +S       Y DVGG +LWVDVL A
Sbjct  91    ARGNGHSTRGQGMAYNGVVIDMNVLRDNRNGTGINISKDP---LYVDVGGEQLWVDVLNA  147

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             ++   +APVSWTD+L LTVGGTLSNAGISGQ+FR+GPQI+NV EMDVITGKGE +TCS +
Sbjct  148   TVTEDVAPVSWTDFLGLTVGGTLSNAGISGQTFRFGPQISNVHEMDVITGKGEFVTCSAN  207

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS-----  964
              NSELF+AVLGGLGQFG+ITRARI L  A  R  W ++LY +F+ FTRDQE  I+     
Sbjct  208   NNSELFYAVLGGLGQFGIITRARISLGPAFKRAVWAQILYSNFSAFTRDQERFIAGHAKK  267

Query  963   IDDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + + Y+EG+L++     N WR+SFF  S   +I SLI  HGI+YSLE+   +D+ T  
Sbjct  268   EGNAISYLEGALLLDNGTPNTWRTSFFPKSDIPRITSLIKQHGILYSLEIANSFDELTNK  327

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              + EE+++  K LS     ++  +VS+ +FLNRV+  + + +        HPWLNLF+PK
Sbjct  328   AVQEEMKDFIKALSSKPDYIYHTNVSYLEFLNRVQIPDEQSQA-------HPWLNLFIPK  380

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             S I DFN GVF DI+L++N T+GP+L YP  + +WD+RMS  +P+E+ FY   LL+SS +
Sbjct  381   SNISDFNSGVFRDIVLQRNITTGPVLFYPMMRNKWDNRMSVAIPDEDIFYTAALLYSSGL  440

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             NEW+   +QN+EIL++CD+AGI+ KQYLP+Y T+E+W K FG  W  F+QRKALFDPK+I
Sbjct  441   NEWQVYDDQNKEILEFCDKAGIQGKQYLPNYATKEEWTKQFGSNWTTFEQRKALFDPKMI  500

Query  243   LSPGQRIFS  217
             LSPGQRIF+
Sbjct  501   LSPGQRIFN  509



>gb|ABM98099.2| cytokinin oxidase [Dendrobium huoshanense]
Length=537

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/437 (54%), Positives = 310/437 (71%), Gaps = 21/437 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA A  G+V+ M SL  +   I VS   + G + D GG  +W+DVLR +L
Sbjct  97    ARGLGHSTRGQAQASAGIVINMPSLDSS---ITVS---TDGMFVDAGGERMWIDVLRETL  150

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GL P SWTDYLYLT+GGTLSN GISGQ+F +GPQI+NV E+D+ITGKGE+++CS+  N
Sbjct  151   RYGLTPKSWTDYLYLTLGGTLSNGGISGQAFLHGPQISNVHELDIITGKGEMVSCSESAN  210

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID-DG--  952
              +LFF+VLGGLGQFG+ITRARI L+ AP  V+W+R++Y DF  FT+DQE LISI  +G  
Sbjct  211   PDLFFSVLGGLGQFGIITRARIALENAPKSVRWMRLMYTDFELFTKDQELLISIKAEGEG  270

Query  951   --LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLI-SNHGIIYSLELVKYYD------  799
               L+YVEGSL+M  S  +NWRS FFS     +I  L   N G+IY LE   YYD      
Sbjct  271   WRLNYVEGSLLMEHSLKSNWRSPFFSEKDLKRIKKLAYGNEGVIYCLEASFYYDFHHGRN  330

Query  798   --DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPW  625
                   T +D++++E+ + L F+ G  F  DV++  FLNRV  GE+KLR  G+WDVPHPW
Sbjct  331   FSRADKTQMDQDIEELLRKLRFVSGFAFGNDVTYMSFLNRVHDGELKLRAMGLWDVPHPW  390

Query  624   LNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVG  445
             LNL V KS I+DF +GV    I++ +K+ GPILVYPT +++WD+RMS  +P+EE FY +G
Sbjct  391   LNLLVSKSNIMDFYIGVLKG-IMKTSKSMGPILVYPTKRSKWDERMSTAIPDEEVFYSIG  449

Query  444   LLHSSRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
             +L SS +N+ E L NQN EILK+ D+ G+  KQYLPHY + E W+KHFGKKW+ F + K+
Sbjct  450   ILLSSEMNDLEHLENQNAEILKFSDQQGLNYKQYLPHYTSMEGWKKHFGKKWEGFVEMKS  509

Query  264   LFDPKLILSPGQRIFSQ  214
              +DPK ILSPGQ+IF+ 
Sbjct  510   RYDPKAILSPGQKIFAH  526



>emb|CDY54283.1| BnaC07g50850D [Brassica napus]
Length=516

 Score =   483 bits (1242),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/425 (54%), Positives = 307/425 (72%), Gaps = 7/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS RGQA+A  GVVV M+ L +      V      G YADV    +WV+VL A+L
Sbjct  96    ARGQGHSLRGQASAPGGVVVNMTCLAKTAKPAAVVVLAD-GTYADVAAGAMWVEVLEAAL  154

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV++TDYLYL+VGGTLSNAGI GQ FR+GPQI+NV E+DVITGKG+++TCS  +N
Sbjct  155   ARGVSPVTFTDYLYLSVGGTLSNAGIGGQVFRHGPQISNVHELDVITGKGDMVTCSPKLN  214

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL--  949
              ELF+ VLGGLGQFG+ITRARI L+ APTR KW+R+LY DF+ FTRDQE LIS+ + L  
Sbjct  215   PELFYGVLGGLGQFGIITRARIALEHAPTRAKWIRILYSDFSAFTRDQERLISMANDLRV  274

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             D++EG L+M+    +   +SFF  S Q+++ SL+++H IIY LE+ KYYD  T   I++ 
Sbjct  275   DFLEGQLMMSNGIVD---TSFFPLSDQTRVVSLVNDHRIIYVLEVAKYYDTTTLPIIEQV  331

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + + L      +F +DV +FDFLNRVR+ E KLR  G+W+VPHPWLN+FVP+SRILD
Sbjct  332   IDRLTRTLGITSEFMFVQDVPYFDFLNRVRNEEDKLRSIGLWEVPHPWLNMFVPRSRILD  391

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-RVNEWE  412
             F+ GV   ++L Q  TSG  L YPTN+ +W++ MSA++P E+ FY +G L S+   + +E
Sbjct  392   FHEGVIKGLLLNQTATSGVTLFYPTNRKKWNNLMSAMIPNEDVFYVIGFLQSAGGSHNFE  451

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             EL N N+ I+ +CD +GIKIK+YL HY  +EDW KHFG KW  F +RK +FDP+ +LSPG
Sbjct  452   ELENLNDRIINFCDNSGIKIKEYLMHYTRKEDWIKHFGPKWNDFSRRKMMFDPEKLLSPG  511

Query  231   QRIFS  217
             Q IFS
Sbjct  512   QDIFS  516



>ref|XP_010415434.1| PREDICTED: cytokinin dehydrogenase 2 [Camelina sativa]
Length=506

 Score =   481 bits (1239),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 233/425 (55%), Positives = 304/425 (72%), Gaps = 14/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS +GQA+   GVVV M+ L      + VS  +    YADV    LWVDVL+ + 
Sbjct  92    ARGQGHSLKGQASVSGGVVVNMTCL----SDVVVSKDKK---YADVAAGTLWVDVLKKTA  144

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV WTDYL+++VGGTLSN GI GQ FR GP I+NV+E+DVITGKGE++TCS  +N
Sbjct  145   EKGVSPVCWTDYLHISVGGTLSNGGIGGQVFRNGPLISNVLELDVITGKGEMLTCSPKLN  204

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
             SELF+ VLGGLGQFG+ITRARIVLD AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  205   SELFYGVLGGLGQFGIITRARIVLDHAPKRAKWFRMLYSDFTAFTKDQERLISMANDIGV  264

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG + M+    +   +SFF PS QS++A L+  HGIIY LE  KYYDD     I   
Sbjct  265   DYLEGQIFMSNGVVD---TSFFPPSDQSKVADLVKKHGIIYVLEAAKYYDDPNLPIIHTV  321

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             + ++ K LS++ G +   DV++FDFLNRV+  E KLR  G+W+VPHPWLNL+VPKSRI D
Sbjct  322   IDKLNKSLSYLPGFISMHDVTYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRIHD  381

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE--EETFYCVGLLHSSRVNEW  415
             F+ GV  +I+ +Q  T+G  L+YPTN+ +W++RMSA++PE  E+  Y +GLL S+     
Sbjct  382   FHNGVVKNILYKQKSTTGLALLYPTNRNKWNNRMSAMIPEVDEDVIYVIGLLQSATPQNL  441

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             +E+ + NE+I+++C ++GIKIKQYL HY  +EDW  HFG KW  F ++K LFDPK +LSP
Sbjct  442   QEMESVNEKIIRFCKDSGIKIKQYLMHYTRKEDWIDHFGSKWNDFSKKKELFDPKKLLSP  501

Query  234   GQRIF  220
             GQ IF
Sbjct  502   GQDIF  506



>gb|KEH36208.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=532

 Score =   482 bits (1241),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 243/430 (57%), Positives = 306/430 (71%), Gaps = 16/430 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQA-TAKDGVVVEMSSLKRNGGRIR--VSWSESLGFYADVGGHELWVDVLR  1312
             ARGHGHS  GQA T   GVV+EM    + G  I+  + W + +  Y DV G ELW+ VL+
Sbjct  100   ARGHGHSINGQADTRMKGVVIEMG---KGGVGIKGPLVWEKEM--YVDVWGGELWIHVLK  154

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             A+L +GLAP+SWTDYLYL+VGGTLSN GISGQ+F +GPQI+NV E+DV+TGKGE++TCS+
Sbjct  155   ATLEYGLAPMSWTDYLYLSVGGTLSNGGISGQTFNHGPQISNVFELDVVTGKGEVLTCSE  214

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---  961
               NS+LF +VLGGLGQFG+ITRARI L  AP RV+W+R LY +F+ F +DQE LIS+   
Sbjct  215   DRNSDLFHSVLGGLGQFGIITRARIALQPAPQRVRWIRALYSNFSTFCKDQEFLISLHGK  274

Query  960   --DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETA  787
                   DYVEG +I+ +   NNWRSSFFSPS+  +I+SL ++ G++Y LE+ K Y    A
Sbjct  275   PASQRFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSLNADGGVLYCLEVTKNYHQGNA  334

Query  786   TTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
              ++DEE+Q + K L FI   VF  DV + DFL+RV   E+KLR KG+WDVPHPWLNLFVP
Sbjct  335   DSVDEEIQALLKKLDFIDTSVFTTDVPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFVP  394

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR  427
             KSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R SAV P+EE FY V  L S+ 
Sbjct  395   KSRIEDFDKGVFKGIL--GNKTSGPILIYPMNKNKWDHRSSAVTPDEEVFYLVAFLRSAL  452

Query  426   VNE-WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               E  E L NQN +IL +C ++ I +KQYLPHY T ++W  HFG KW  F   K  FDP+
Sbjct  453   DAETLEHLTNQNRQILGFCHDSKIGVKQYLPHYTTMQEWMDHFGDKWTQFNAMKMQFDPQ  512

Query  249   LILSPGQRIF  220
              IL+ GQRIF
Sbjct  513   RILATGQRIF  522



>gb|AAG30909.1|AF303982_1 cytokinin oxidase [Arabidopsis thaliana]
Length=540

 Score =   482 bits (1240),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 241/429 (56%), Positives = 307/429 (72%), Gaps = 13/429 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATA-KDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA A ++GVVVEM+       +  V   E    Y DV G ELWVDVL+ +
Sbjct  97    ARGHGHSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDE---MYVDVWGGELWVDVLKKT  153

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGLAP SWTDYLYLTVGGTLSNAGISGQ+  +GPQI+NV+E+DV+TGKGE++ CS+  
Sbjct  154   LEHGLAPKSWTDYLYLTVGGTLSNAGISGQALHHGPQISNVLELDVVTGKGEVMRCSEEE  213

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL-  949
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+   L 
Sbjct  214   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQLK  273

Query  948   -DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y D  +  +D+
Sbjct  274   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSEIVDQ  333

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  334   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  393

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+      
Sbjct  394   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGEE  451

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN  IL++C++A I +KQYLPH+ T+E+W  HFG KW  F+  KA FDP+ 
Sbjct  452   TQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRH  511

Query  246   ILSPGQRIF  220
             IL+ GQRIF
Sbjct  512   ILATGQRIF  520



>emb|CDX73174.1| BnaC06g36220D [Brassica napus]
Length=535

 Score =   481 bits (1238),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/433 (55%), Positives = 310/433 (72%), Gaps = 13/433 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQA-TAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA T ++GVVVEMS   RN G +     E    Y DV G ELWVDVL+ +
Sbjct  93    ARGHGHSINGQASTGRNGVVVEMS--HRNIGTLE-PLVEPEEMYVDVWGGELWVDVLKKT  149

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV+E+DV+TG+GE++ CS+  
Sbjct  150   LEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVLELDVVTGRGEVMRCSEEE  209

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDG  952
             N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+     
Sbjct  210   NTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFEVFTDDQEYLISMHGHSK  269

Query  951   LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y +  + T+D+
Sbjct  270   FDYVEGFVIVDEGLVNNWRSSFFSPHNPVKISSVSSNGSVLYCLEITKNYHESESDTVDQ  329

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  330   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  389

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+      
Sbjct  390   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALSDGEE  447

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN  IL++C++A I +KQYLPH+ T+E+W  H+G +W  F+  K  FDP+ 
Sbjct  448   TQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWVDHYGDRWDQFRSMKTEFDPRH  507

Query  246   ILSPGQRIFSQSS  208
             IL+ GQ+IF   S
Sbjct  508   ILATGQKIFQNPS  520



>ref|XP_010467897.1| PREDICTED: cytokinin dehydrogenase 2-like [Camelina sativa]
Length=506

 Score =   479 bits (1234),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 232/425 (55%), Positives = 302/425 (71%), Gaps = 14/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS +GQA+   GVVV M+ L      + VS  +    YADV    LWVDVL+ + 
Sbjct  92    ARGQGHSLKGQASVSGGVVVNMTCL----SDVVVSKDKK---YADVAAGTLWVDVLKKTA  144

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV WTDYL+++VGGTLSN GI GQ FR GP I+NV+E+DVITGKGEL+TCS  +N
Sbjct  145   EKGVSPVCWTDYLHISVGGTLSNGGIGGQVFRNGPLISNVLELDVITGKGELLTCSPKLN  204

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
             SELF+ VLGGLGQFG+ITRARIVLD AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  205   SELFYGVLGGLGQFGIITRARIVLDHAPKRAKWFRMLYSDFTAFTKDQERLISMANDSGV  264

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG + M+    +   +SFF PS QS++A L+  HGIIY LE  KYYDD     I   
Sbjct  265   DYLEGQIFMSNGVVD---TSFFPPSDQSKVADLVKKHGIIYVLEAAKYYDDPNLPIIHTV  321

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             + ++ K  S++ G +   DV++FDFLNRV+  E KLR  G+W+VPHPWLNL+VPKSRILD
Sbjct  322   IDKLNKSQSYLPGFISMHDVTYFDFLNRVQVEENKLRSLGLWEVPHPWLNLYVPKSRILD  381

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPE--EETFYCVGLLHSSRVNEW  415
             F+ G   +I+ +Q   SG  L+YP N+ +W++RMSA++PE  E+  Y +GLL S+     
Sbjct  382   FHEGAVKNILSKQKSASGLALLYPINRNKWNNRMSAMIPEVDEDVIYVIGLLQSATPQNL  441

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             +E+ + NE+I+++C ++GIKIKQYL HY  +EDW +HFG KW  F ++K LFDPK +LSP
Sbjct  442   QEMESVNEKIIRFCKDSGIKIKQYLMHYTKKEDWIEHFGSKWNDFSKKKELFDPKKLLSP  501

Query  234   GQRIF  220
             GQ IF
Sbjct  502   GQDIF  506



>ref|NP_001185402.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
 gb|AEE35722.1| cytokinin dehydrogenase 5 [Arabidopsis thaliana]
Length=537

 Score =   479 bits (1233),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 242/430 (56%), Positives = 308/430 (72%), Gaps = 14/430 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATA-KDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA A ++GVVVEM+       +  V   E    Y DV G ELWVDVL+ +
Sbjct  93    ARGHGHSINGQAAAGRNGVVVEMNHGVTGTPKPLVRPDE---MYVDVWGGELWVDVLKKT  149

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVIT-GKGELITCSKH  1129
             L HGLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV+E+DV+T GKGE++ CS+ 
Sbjct  150   LEHGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLELDVVTVGKGEVMRCSEE  209

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              N+ LF  VLGGLGQFG+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+   L
Sbjct  210   ENTRLFHGVLGGLGQFGIITRARISLEPAPQRVRWIRVLYSSFKVFTEDQEYLISMHGQL  269

Query  948   --DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTID  775
               DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y D  +  +D
Sbjct  270   KFDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSEIVD  329

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
             +E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI
Sbjct  330   QEVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRI  389

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----  430
              DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+     
Sbjct  390   SDFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEVFYLVALLRSALTDGE  447

Query  429   RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
                + E L +QN  IL++C++A I +KQYLPH+ T+E+W  HFG KW  F+  KA FDP+
Sbjct  448   ETQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPR  507

Query  249   LILSPGQRIF  220
              IL+ GQRIF
Sbjct  508   HILATGQRIF  517



>ref|XP_008444755.1| PREDICTED: cytokinin dehydrogenase 5 [Cucumis melo]
Length=546

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 310/442 (70%), Gaps = 23/442 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMS----SLKRNGGR---IRVSWSESLGFYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV+EMS      +R GGR     V      G + DV G ELW+
Sbjct  95    ARGHGHSINGQAQTGNGVVIEMSGGGRQHRRVGGRGVSPPVPVVSEKGRFVDVWGGELWI  154

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVL+ +L +GLAP SWTDYLYL+VGGTLSN GISGQ+F +GPQI+NV E+DV+TG GE++
Sbjct  155   DVLKWTLEYGLAPRSWTDYLYLSVGGTLSNGGISGQAFNHGPQISNVHELDVVTGNGEIV  214

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
              CS   N+ELF  VLGGLGQFG+ITRARI+L+ AP RV+W+R+LY +F  FT+DQE LIS
Sbjct  215   KCSNEDNAELFHGVLGGLGQFGIITRARIILEPAPQRVRWIRVLYSNFEAFTKDQEWLIS  274

Query  963   I------DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNH---GIIYSLELV  811
             +       +  DYVEG +I+ +   NNWRSSFFSP++  +I+S   N     ++Y LE+ 
Sbjct  275   LHSKTNSKEKFDYVEGFVIVDEGLINNWRSSFFSPANPVKISSFSKNKSDGAVLYCLEIT  334

Query  810   KYYDDETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPH  631
             K Y + ++ T+D+E++ + K L++I   VF  D+ + DFL+RV   E+KLR KG+WDVPH
Sbjct  335   KNYHESSSHTLDQEVEALMKQLNYIPESVFTTDLGYVDFLDRVHKAELKLRSKGLWDVPH  394

Query  630   PWLNLFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYC  451
             PWLNLFVPKSRI DF+ GVF  I+   N TSGPIL+YP NK +WD R SAV PE++ FY 
Sbjct  395   PWLNLFVPKSRIADFDRGVFKGIL--GNNTSGPILIYPMNKHKWDPRTSAVTPEDDVFYL  452

Query  450   VGLLHSSRVN-----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQ  286
             V LL S+  N       E L +QN +IL++C E+GI++KQYLPHY TEE+W  HFG KW 
Sbjct  453   VALLRSALDNGEPTQSLEYLSHQNHQILEFCYESGIEVKQYLPHYTTEEEWADHFGDKWP  512

Query  285   IFQQRKALFDPKLILSPGQRIF  220
              FQ RK  FDP  IL+ GQ+IF
Sbjct  513   EFQARKMKFDPHHILATGQKIF  534



>gb|KHN06617.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=509

 Score =   476 bits (1225),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 305/432 (71%), Gaps = 29/432 (7%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRV----SWSESLGFYADVGGHELWVDV  1318
             RG  HS  GQA   DGVVV M+ L   RNG  I V    + + ++G YADVGG ++W+DV
Sbjct  96    RGQAHSIHGQAMTNDGVVVNMTELNGFRNGDGIIVVSDDTTATTIGPYADVGGEQIWIDV  155

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L A+L  GL P+SWTDYLYL+VGGTLSNAGISGQ+FR+GPQI+NV E+DV+TGKG+L+TC
Sbjct  156   LHATLERGLTPLSWTDYLYLSVGGTLSNAGISGQTFRFGPQISNVHELDVVTGKGDLVTC  215

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S   NSELF+AVLGGLGQFG+ITRARI L  APTR                +QE+LIS++
Sbjct  216   SAENNSELFYAVLGGLGQFGIITRARIALGPAPTRA---------------NQEYLISVN  260

Query  957   -----DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
                  +  DYVEG L++ Q P +    SF+      +I SL++ +GIIY +ELVKYYD+ 
Sbjct  261   GRNETNAADYVEGFLLLNQPPQD---LSFYPEPDHPRITSLVTQYGIIYVIELVKYYDNS  317

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             T   +DE++    + L F+   +FEKDVS+ +FLNRV + E+ LR +G+WD+PHPWLNLF
Sbjct  318   TQEHVDEDVNFWVEELKFVPTFMFEKDVSYEEFLNRVHADELFLRSQGLWDIPHPWLNLF  377

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             VP SRI DF+ GVF  IIL+QN T+G +++YP N+ +WDD MSAV P ++ FY V  LHS
Sbjct  378   VPASRISDFDEGVFKGIILQQNITAGLVIIYPMNRTKWDDNMSAVTPHDDVFYVVSFLHS  437

Query  432   SRVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDP  253
             +  ++ EE   QN++IL++C  AGI IKQYLP  KT E+WEK FG KW+ F++RKA FDP
Sbjct  438   TGFDKLEEFQAQNQQILQFCANAGIGIKQYLPQNKTREEWEKQFGPKWKTFKERKAQFDP  497

Query  252   KLILSPGQRIFS  217
               ILSPGQ IF+
Sbjct  498   NSILSPGQGIFN  509



>gb|KFK40311.1| hypothetical protein AALP_AA3G358400 [Arabis alpina]
Length=504

 Score =   475 bits (1223),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 231/425 (54%), Positives = 308/425 (72%), Gaps = 14/425 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+   GVV+ M+ L      + +S  +    YADV G  LWVDVL+ + 
Sbjct  90    ARGQGHSLDGQASVPGGVVINMTCL----ADVVISDDKK---YADVAGGALWVDVLKKTA  142

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PV+WTDYL ++VGGTLSNAGI G  FR+GPQI+NV+E+DVITGKG+++TCS  +N
Sbjct  143   EKGVSPVTWTDYLKVSVGGTLSNAGIGGHVFRHGPQISNVLELDVITGKGKMLTCSPQLN  202

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARIVLD AP R KW RMLY DF  FT+DQE LIS+  D G+
Sbjct  203   RELFYGVLGGLGQFGIITRARIVLDHAPKRAKWFRMLYSDFNAFTKDQERLISLSNDFGV  262

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG ++M+    +   +SFF  S QS+IA+L+ +HGIIY LE+ KYYDD T   I + 
Sbjct  263   DYLEGQILMSNGFVD---TSFFPTSQQSKIANLVKDHGIIYVLEVAKYYDDPTLPIIGQV  319

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             + ++ K LS++ G +   DV  FDFLNRV++ E  LR  G+WDVPHPWLNL++PKSRI D
Sbjct  320   IDKLTKNLSYLPGFIAMHDVPIFDFLNRVQTEENTLRSAGLWDVPHPWLNLYIPKSRIRD  379

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP-EEETFYCVGLL-HSSRVNEW  415
             F+ GVF +I+L++   SG  L+YPTN  +WD+RMSAV+P +E+  Y VG+L +S+   + 
Sbjct  380   FHDGVFKNILLKEASISGIALLYPTNIDKWDNRMSAVIPNDEDVIYIVGILQYSTNQEKL  439

Query  414   EELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSP  235
             +E+ + NE+I+++C  +GIKIKQYL HY  +EDW +HFG KW  F +RK +FDPK +LSP
Sbjct  440   QEIKSVNEKIIRFCKNSGIKIKQYLMHYSRKEDWVEHFGSKWSDFSKRKDMFDPKKLLSP  499

Query  234   GQRIF  220
             G  IF
Sbjct  500   GHDIF  504



>emb|CDY67088.1| BnaA09g52930D [Brassica napus]
Length=484

 Score =   474 bits (1220),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 232/424 (55%), Positives = 299/424 (71%), Gaps = 31/424 (7%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA   DG                         YADV G  LWVDVL+ + 
Sbjct  89    ARGQGHSLMGQAGVPDG-------------------------YADVAGGTLWVDVLKKTA  123

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL+++VGGTLSNAGI G+ FR GPQI+NV+E+DVITGKGE++ CS  +N
Sbjct  124   EKGVSPVSWTDYLHVSVGGTLSNAGIGGEVFRNGPQISNVLELDVITGKGEMLACSPQLN  183

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
             SELF+ VLGGLGQFG+ITRARIVL+ AP R KW RMLY DFT FT+DQE LIS+  D G+
Sbjct  184   SELFYGVLGGLGQFGIITRARIVLNHAPKRAKWFRMLYSDFTAFTKDQERLISMANDTGV  243

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DY+EG L M+    +   +SFF  S QS+IA L+ +HGIIY LE+ K+YDD T   I + 
Sbjct  244   DYLEGQLFMSNGVVD---TSFFPQSDQSKIADLVKSHGIIYVLEVAKFYDDPTLPIIGQV  300

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  + K LS++ G +   DV++FDFLNRV++ E KLR  G+W+VPHPWLNL+VPKS+ILD
Sbjct  301   VDMLTKTLSYLPGFISMHDVAYFDFLNRVKAEEDKLRSLGLWEVPHPWLNLYVPKSQILD  360

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP-EEETFYCVGLLHSSRVNEWE  412
             F+ GV  DI+L+QN TSG  L+YP+N+ +WD+RMSA+V  EE+  Y +G+L S+      
Sbjct  361   FHNGVVKDILLKQNSTSGLTLLYPSNRNKWDNRMSAMVTDEEDVVYIIGILQSATPQNVP  420

Query  411   ELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPG  232
             E+ + N+ I++ C ++GIKIKQYL HY  +EDW +HFG KW  F +RK LFDPK +LSPG
Sbjct  421   EVESLNDSIIRVCKDSGIKIKQYLMHYTRKEDWVEHFGTKWSAFSKRKDLFDPKKLLSPG  480

Query  231   QRIF  220
             Q IF
Sbjct  481   QDIF  484



>ref|XP_009381235.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   475 bits (1223),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 234/426 (55%), Positives = 306/426 (72%), Gaps = 12/426 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN-GGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             A GHGHS RGQA    GVVV+M+SL R    RI VS      +Y D GG +LW+DVLR +
Sbjct  104   AHGHGHSIRGQALVPGGVVVDMASLGRGRSDRINVSSD----WYVDAGGEQLWIDVLRET  159

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGL+P SWTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV E+DVITGKG+ ITCS+  
Sbjct  160   LKHGLSPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVYELDVITGKGDTITCSREE  219

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL-  949
             NS+LF+ VLGGLGQFG+ITRARI L+ AP RV+W+R+ Y DF+ FT DQE L+S+ + + 
Sbjct  220   NSDLFYGVLGGLGQFGIITRARIALEPAPQRVRWLRLFYTDFSSFTGDQELLVSMTEKVF  279

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DYVEG L+  +   N   SSFFS +   ++  L + +G IY +E   YY+  TA+ +D++
Sbjct  280   DYVEGQLLTEKDVGN---SSFFSDTDTEKVKMLAAEYGRIYFVEGGVYYEPATASMVDQK  336

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             L+ + K LSF+ G  F KDV++  FLNRV+  E         +V HPWLN+FVPKSRI D
Sbjct  337   LETLLKRLSFVPGFAFTKDVAYISFLNRVQEEET--HSTAPENVLHPWLNMFVPKSRIRD  394

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             F +GVF   IL+ N   G +L+YP NK +WDD+MSA +P+EE FY +GLL S+ V++W+ 
Sbjct  395   FEMGVFKG-ILKNNNPIGLVLIYPFNKNKWDDKMSAAIPDEEVFYTIGLLPSATVDDWKY  453

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             L +QN+EIL++C + GI  KQYLPHY T+ DW+ HFG KW +F + K  +DP+ +LSPGQ
Sbjct  454   LDSQNDEILRFCQQEGIDFKQYLPHYTTQTDWKNHFGLKWDVFVRLKRRYDPQALLSPGQ  513

Query  228   RIFSQS  211
             RIF+ S
Sbjct  514   RIFTSS  519



>ref|XP_004970152.1| PREDICTED: cytokinin dehydrogenase 5-like [Setaria italica]
Length=538

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 237/438 (54%), Positives = 305/438 (70%), Gaps = 12/438 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLG-FYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA    GVVV+MS       R   ++S +LG  Y DV G ELWVDVL  +
Sbjct  94    ARGHGHSISGQAQVPGGVVVDMSHGPGAAARALPAYSAALGGHYVDVWGGELWVDVLNWT  153

Query  1305  LPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             L HG LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++TCS+ 
Sbjct  154   LSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSET  213

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL  949
              N +LFF  LGGLGQFG+ITRARI L++AP RV+W+R LY +F++FT DQE LIS+  G+
Sbjct  214   ENPDLFFGALGGLGQFGIITRARIALERAPQRVRWIRALYSNFSEFTADQERLISLGAGV  273

Query  948   ---DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTI  778
                DYVEG ++  +   NNWRSSFFSP +  +++SL  + G++Y LE+ K YDD TA ++
Sbjct  274   RRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDDATAASV  333

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D+++  +   L+F+ G VF  D+ + DFL+RV   E+KLR KGMW+VPHPWLNLFVP SR
Sbjct  334   DQDVDALLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRTKGMWEVPHPWLNLFVPASR  393

Query  597   ILDFNVGVFVDII-LRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN  421
             I DF+ GVF  I+  R     GPIL+YP NK +WD R S V P+EE FY V  L S+   
Sbjct  394   IADFDRGVFRGILGGRTAGAGGPILIYPMNKHKWDPRSSVVTPDEEVFYLVAFLRSALPG  453

Query  420   -----EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKALF  259
                    E L  QN+ IL +C+EAGI  KQYLP++K + +W +HFG  +W+ F + KA F
Sbjct  454   VPESLSTEALARQNQMILDFCEEAGIGAKQYLPNHKGQHEWAEHFGAARWERFARLKAEF  513

Query  258   DPKLILSPGQRIFSQSSS  205
             DP+ IL+ GQ IF    S
Sbjct  514   DPRAILATGQGIFPPPGS  531



>gb|AFK48435.1| unknown [Lotus japonicus]
Length=525

 Score =   475 bits (1223),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 227/428 (53%), Positives = 317/428 (74%), Gaps = 12/428 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             RG GH++ GQA  + GVVV M++L   RNG  I V   +    Y DVGG ++W+DVLRA+
Sbjct  103   RGQGHASYGQAMTRGGVVVNMTALNDYRNGSGIVVHHDKQTP-YVDVGGEQIWIDVLRAT  161

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
               HGL P +WTDYLYL++G TLSN GI+G++FR+GPQI+NV E+DV+TGKG+L+TCS + 
Sbjct  162   FVHGLTPFAWTDYLYLSIGATLSNGGINGRAFRFGPQISNVHELDVVTGKGDLVTCSANK  221

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI-----  961
             NS+LF+AVLGGLGQFG+ITRARI L  APTRVKWV MLY+DF+ F++DQEHLI+      
Sbjct  222   NSDLFYAVLGGLGQFGIITRARIPLGPAPTRVKWVHMLYNDFSTFSKDQEHLITFKGRNG  281

Query  960   DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATT  781
             ++  D+VEG L++ Q P+ +   SF+  S Q +I SL++ + IIY +ELVKYYDD T   
Sbjct  282   NNQADFVEGVLMLNQ-PSQDL--SFYPESDQPRIISLVTQYDIIYVMELVKYYDDNTQDQ  338

Query  780   IDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKS  601
             +D+E++++  GL FI    F+K+ S+ +F NR+R+ E+ L+  G+WDVPHPWL+L+VP S
Sbjct  339   VDQEIEDLIHGLKFIPTFKFDKNASYEEFQNRIRTIELTLKPLGLWDVPHPWLDLYVPGS  398

Query  600   RILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN  421
             RI+DF+ GVF  IIL+QN T+  ILVY TN+ +WDD+ SA+ P+E+ FY V +L S+R +
Sbjct  399   RIMDFDEGVFKGIILKQNITARRILVYATNQKKWDDKTSAMTPDED-FYIVSILPSTRFD  457

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
               E    QN+++L++C++AGI  KQY PH KT+E+W +++G KW+  QQRK  FDP  +L
Sbjct  458   NLELYLAQNQQVLQFCEDAGIGAKQYTPHNKTQEEWVEYYGPKWKTIQQRKLQFDPNKLL  517

Query  240   SPGQRIFS  217
             +PGQ IF+
Sbjct  518   APGQGIFN  525



>ref|XP_010533263.1| PREDICTED: cytokinin dehydrogenase 5 [Tarenaya hassleriana]
Length=543

 Score =   475 bits (1223),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 245/435 (56%), Positives = 318/435 (73%), Gaps = 19/435 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATA-KDGVVVEM------SSLKRNGGRIRVSWSESLGFYADVGGHELWV  1324
             ARGHGHS  GQA A K+GVVVEM      S   RN     VS   + G + DV G ELW+
Sbjct  94    ARGHGHSINGQAKAGKNGVVVEMGRREIISGAGRNPPEPEVS---AEGMHVDVWGGELWI  150

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVL+ +L +GLAP SWTDYLYLTVGGT+SNAGISGQ+F +GPQI+NV+E+DV+TGKGE++
Sbjct  151   DVLKKTLEYGLAPKSWTDYLYLTVGGTISNAGISGQAFHHGPQISNVLELDVVTGKGEVM  210

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
              CS+  NSELF  VLGGLGQ G+ITRARI L+ +P RV+W+R+LY +F+ FTRDQE LIS
Sbjct  211   KCSEEENSELFHGVLGGLGQLGIITRARIALEPSPQRVRWIRVLYSNFSVFTRDQEQLIS  270

Query  963   I--DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
             +      DYVEG +I+ +   NNWRSSFFSP +  +I++L  + G++Y LE+ K YD+ +
Sbjct  271   LHGPPKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKISALGGDGGVLYCLEVTKNYDESS  330

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             A T+D+E++++ K L+FI G VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFV
Sbjct  331   ADTVDQEMEQLMKKLNFIPGSVFTTDLPYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFV  390

Query  609   PKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS  430
             PKSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV+PEEE FY V LL S+
Sbjct  391   PKSRIGDFDRGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVIPEEEVFYLVALLRSA  448

Query  429   -----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKA  265
                       E L +QN  IL++C+E+GI+ KQYLPHY T+E W +HFG KW+ F   KA
Sbjct  449   LSDGDETQRLEYLEDQNRRILRFCEESGIEAKQYLPHYVTQEQWMRHFGDKWERFSHLKA  508

Query  264   LFDPKLILSPGQRIF  220
              +DP+ IL+ GQ++F
Sbjct  509   EYDPRHILATGQKVF  523



>ref|XP_003534915.2| PREDICTED: cytokinin dehydrogenase 3-like [Glycine max]
Length=527

 Score =   474 bits (1221),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 311/433 (72%), Gaps = 16/433 (4%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLK---RNGGRIRVSWSESLG---FYADVGGHELWVDV  1318
             RG  HS  GQA  KDGVV+ M++L    +NG  + VS  +  G    YADVGG ++W+DV
Sbjct  97    RGKAHSVHGQAMTKDGVVLNMTNLNSSFQNGLGVLVSACDGKGPLICYADVGGGQMWIDV  156

Query  1317  LRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
             L ASL  GL P+S TDY+Y TVGGTLSNAG+ G SFR+GPQI+NV+E+DVITGKG+L+TC
Sbjct  157   LHASLERGLTPLSLTDYMYATVGGTLSNAGMGGMSFRFGPQISNVLELDVITGKGDLVTC  216

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             SK  NSE F+A LGGLGQFGVITRARI L  APTRVKW+R+LY++FT F+RDQEHLIS  
Sbjct  217   SKEQNSEAFYAALGGLGQFGVITRARIPLGPAPTRVKWLRLLYNNFTAFSRDQEHLISFS  276

Query  957   D-----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDE  793
             +       DYVEG L++ Q P +     F+  S   ++ SL++ +GIIY LEL KYY + 
Sbjct  277   ERNDIATADYVEGMLLLNQPPLDLL---FYPASDHQRVTSLVTQYGIIYILELAKYYYNN  333

Query  792   TATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLF  613
             +   ++EE+  + KGL+F+   VFE+DVS+ +F+NRV   E  LR +G+W+VPHPWLNL+
Sbjct  334   SQAHVNEEVAYLLKGLNFVHTFVFERDVSYEEFVNRVYPLEQMLRSEGLWEVPHPWLNLW  393

Query  612   VPKSRILDFNVGVFVDIILRQNKTSGPILVYPTN-KARWDDRMSAVVPEEETFYCVGLLH  436
             VP+SRI DF+ GVF DI+L+QN T G  LVYPTN + +WDDRM+ + P+E+ FY V  L 
Sbjct  394   VPRSRISDFDEGVFKDIVLKQNITGGSFLVYPTNRRNKWDDRMTPITPDEDVFYVVDFLR  453

Query  435   SSRV-NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALF  259
              ++  +  ++L  QN++IL++C++AGIKI +YL   KT + W +HFG KW++F  RK  F
Sbjct  454   VAKTFDVVDKLQVQNKQILRFCNDAGIKITEYLIGNKTHQQWVEHFGPKWKLFADRKTEF  513

Query  258   DPKLILSPGQRIF  220
             DPK ILSPG  IF
Sbjct  514   DPKKILSPGHGIF  526



>gb|AFK79779.1| cytokinin oxidase/dehydrogenase [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   474 bits (1221),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 302/441 (68%), Gaps = 15/441 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASLP  1300
             RG GHS RGQ+ A  GVVV+M +L R   RI VS       Y D GG +LWVDVLR +L 
Sbjct  98    RGQGHSVRGQSLAPGGVVVDMRALGRGDHRINVSAD-----YVDAGGEQLWVDVLRGTLT  152

Query  1299  HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINS  1120
             HGLAP +WTDYL LTVGGTLSNAGI GQ+FR+GPQIANV E+DV+TG GE++TCS H   
Sbjct  153   HGLAPCAWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVHELDVVTGTGEMVTCSPHKRK  212

Query  1119  ELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS---IDDGL  949
             +LFFAVLGGLGQFG+ITRARI L+ AP +V+WVR+ Y D   FTRDQE LIS    + G 
Sbjct  213   DLFFAVLGGLGQFGIITRARIALEPAPKQVRWVRLAYSDVVAFTRDQELLISKQASEAGF  272

Query  948   DYVEGSLIMTQSPANNWRSS-FFSPSHQSQIASLISNHG--IIYSLELVKYYDDETATTI  778
             DYVEG + + ++     +S+ FFS +  +++ASL S  G   IY +E   YYD+ TA  +
Sbjct  273   DYVEGQVQLNRTLTEGPKSTPFFSEADINRLASLASETGSRAIYFIEAAMYYDETTAPYV  332

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+ +   LSF+ G VF KDV++  FL+RVR  EV LR  G+WDVPHPWLNLF+P+SR
Sbjct  333   DQKLETVLAQLSFVPGFVFTKDVTYLQFLDRVRVEEVVLRSAGVWDVPHPWLNLFIPRSR  392

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP--EEETFYCVGLLHSS-R  427
             ILDF+ GV   I+   N   G IL+YP N A+W+ +M+AV P   E+ FY VGLL S+  
Sbjct  393   ILDFDAGVLKGILGGDNPV-GLILMYPMNTAKWNSQMTAVTPPTREDVFYTVGLLRSALS  451

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
              NE E L  +N+ +L +CD+ GI+ KQYLPHY  ++ W +HFG KW+   Q KA +DP  
Sbjct  452   TNELERLQRENQSVLAFCDKEGIECKQYLPHYTCQDGWRRHFGPKWRKITQLKAKYDPHA  511

Query  246   ILSPGQRIFSQSSSWVWSIDA  184
             I+SPGQRIF   S    S  A
Sbjct  512   IMSPGQRIFQLPSVPTTSTTA  532



>ref|XP_004500976.1| PREDICTED: cytokinin dehydrogenase 5-like isoform X1 [Cicer arietinum]
Length=528

 Score =   474 bits (1219),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 239/430 (56%), Positives = 304/430 (71%), Gaps = 14/430 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAK-DGVVVEMSS--LKRNGGRIRVSWSESLGFYADVGGHELWVDVLR  1312
             ARGHGHS  GQA  +  GVV+EM    ++ +    RV W + +  Y DV G ELW+ VL+
Sbjct  94    ARGHGHSINGQADTRVKGVVIEMGKGGVESSNNPPRV-WEKEM--YVDVWGGELWIHVLK  150

Query  1311  ASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSK  1132
             A+L +GLAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV ++DV+TGKGE++TCS+
Sbjct  151   ATLEYGLAPKSWTDYLYLSVGGTLSNAGISGQTFNHGPQISNVFQLDVVTGKGEVLTCSE  210

Query  1131  HINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI---  961
               NS+LF AVLGGLGQFG+ITRARI L  AP RV+W+R+LY +F+ F +DQE LIS+   
Sbjct  211   DRNSDLFHAVLGGLGQFGIITRARIALQPAPQRVRWIRVLYSNFSTFCKDQEFLISLHGK  270

Query  960   --DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETA  787
                   DYVEG +I+ +   NNWRSSFFSPS+  +I+SL ++ G++Y LE+ K Y    A
Sbjct  271   PATQRFDYVEGFVIVDEGLINNWRSSFFSPSNPVKISSLNADGGVLYCLEITKNYHQGNA  330

Query  786   TTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVP  607
              ++DEE+Q + K L FI   VF  D+ + DFL+RV   E+KLR KG+WDVPHPWLNLF+P
Sbjct  331   DSVDEEIQPLLKKLDFIPKSVFTTDLPYVDFLDRVHKAELKLRSKGLWDVPHPWLNLFIP  390

Query  606   KSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR  427
             KSRI DF+ GVF  I+   NKTSGPIL+YP NK +WD R S V P+EE FY V  L S+ 
Sbjct  391   KSRIEDFDKGVFKGIL--GNKTSGPILIYPMNKNKWDHRSSVVTPDEEVFYLVAFLRSAL  448

Query  426   VNE-WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPK  250
               E  E L NQN +IL++C ++ IK+KQYLPHY        HFG KW  F   K  FDP+
Sbjct  449   DAETLEYLTNQNRQILRFCHDSKIKVKQYLPHYXXXXXXXDHFGDKWTQFNAMKMQFDPR  508

Query  249   LILSPGQRIF  220
              IL+ GQRIF
Sbjct  509   RILATGQRIF  518



>ref|XP_006843486.1| hypothetical protein AMTR_s00053p00208790 [Amborella trichopoda]
 gb|ERN05161.1| hypothetical protein AMTR_s00053p00208790 [Amborella trichopoda]
Length=514

 Score =   473 bits (1218),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 303/429 (71%), Gaps = 5/429 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGH HS RGQA A  G+VV M SL     R      +S   Y +V G ELW+DVLR +L
Sbjct  90    ARGHAHSLRGQAQAPHGIVVNMESLADPKKRRVHEGGKSP--YVEVSGGELWIDVLRQTL  147

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GLAP SWTDYL+LTVGGTLSNAGISGQ+FRYGPQI+NV +++V+TGKGE++ CS   N
Sbjct  148   KCGLAPRSWTDYLHLTVGGTLSNAGISGQAFRYGPQISNVYQLEVVTGKGEVVNCSAQKN  207

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             ++LF AVLGGLGQFG+IT+ARI L+ AP  VKW+R+LY DF+ FT+DQE LIS++ G DY
Sbjct  208   ADLFHAVLGGLGQFGIITKARIALEPAPEMVKWIRVLYSDFSLFTKDQELLISLEKGFDY  267

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEG +I+ ++   NNWRSSFF+P +  Q +   SN   +Y LE+ K +D   A   D+E+
Sbjct  268   VEGFVIINRNGILNNWRSSFFTPENPIQASRFNSNGRTLYCLEIAKNFDFNNANATDQEV  327

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
             + +   LSFI   +F  ++ + DFL+RV + EVKLR +G+W+VPHPWLNL +P+S I DF
Sbjct  328   ESLLAQLSFIPSTLFSSELPYLDFLDRVHASEVKLRAQGLWEVPHPWLNLLIPQSTIHDF  387

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEEL  406
                +F  ++   + ++GPIL+YP NK +WD+R SAV P E+ FY V  L SS V+  E  
Sbjct  388   AEEIFGKLL--TDSSNGPILIYPLNKEKWDNRTSAVTPNEDIFYLVAFLSSSTVDSLEHS  445

Query  405   GNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQR  226
              +QN  IL++C++ GI +KQYLPHY T+ +W  HF  +WQ F +RKA +DP  IL+PGQR
Sbjct  446   LSQNRRILEFCEKQGIGMKQYLPHYTTKSEWAAHFSHRWQEFVRRKAAYDPLAILAPGQR  505

Query  225   IFSQSSSWV  199
             IF +++++ 
Sbjct  506   IFPKANAFA  514



>ref|XP_008672378.1| PREDICTED: cytokinin dehydrogenase 4 isoform X1 [Zea mays]
 tpg|DAA57393.1| TPA: hypothetical protein ZEAMMB73_142129 [Zea mays]
Length=541

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 305/447 (68%), Gaps = 14/447 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSW---SESLG-FYADVGGHELWVDVL  1315
             ARGHGHS  GQA A  GVVV+MS  +  G  +  +    S +LG  Y DV G ELWVDVL
Sbjct  95    ARGHGHSISGQAQAAGGVVVDMSRGRGPGAAVARALPVHSAALGGHYVDVWGGELWVDVL  154

Query  1314  RASLPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
               +L HG LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++TC
Sbjct  155   NWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTC  214

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S+  N +LFF VLGGLGQFG+ITRARI L++AP RV+W+R LY +F++FT DQE LIS+ 
Sbjct  215   SETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLG  274

Query  957   DG----LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
              G     DYVEG ++  +   NNWRSSFFSP +  ++ SL  +  ++Y LE+ K YDDET
Sbjct  275   SGGGRRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLTSLKHHSSVLYCLEVTKNYDDET  334

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             A ++D+++  +   L+F+ G VF  D+ + DFL+RV   E+KLR KGMW+VPHPWLNLFV
Sbjct  335   AGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFV  394

Query  609   PKSRILDFNVGVFVDII-LRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             P SRI DF+ GVF  ++  R     GP+L+YP NK +WD R SAV P+EE FY V  L S
Sbjct  395   PASRIADFDRGVFRGVLGGRTAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRS  454

Query  432   S---RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKA  265
             +        E L  QN+ IL +C  AGI  KQYLP +K   +W +HFG  +W  F + KA
Sbjct  455   ALPGAPESLEALARQNQRILDFCAGAGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKA  514

Query  264   LFDPKLILSPGQRIFSQSSSWVWSIDA  184
              FDP+ IL+ GQ IF    S   + D+
Sbjct  515   EFDPRAILAAGQGIFRPPGSPALAADS  541



>ref|XP_011015952.1| PREDICTED: cytokinin dehydrogenase 3-like [Populus euphratica]
Length=512

 Score =   469 bits (1207),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 229/427 (54%), Positives = 306/427 (72%), Gaps = 15/427 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN--GGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
              RG+GHS  GQ  A+DGVVV+M SL+ N  G +IRVS +     +ADVGG +LW+DVL  
Sbjct  94    VRGNGHSVNGQDMARDGVVVDMKSLRENKTGIKIRVSRNH---LFADVGGEQLWIDVLHT  150

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +   GL+PVSWTD+LYL+VGGTLSNAGISGQ+F +GPQI+NV E+DVITGKGEL+TCSK 
Sbjct  151   TAAQGLSPVSWTDFLYLSVGGTLSNAGISGQTFLHGPQISNVYELDVITGKGELVTCSKR  210

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI--SIDD  955
              NS+LF +VLGGLGQFG+ITRARI L  APT+V+W R  Y +F+ F RDQE ++     D
Sbjct  211   NNSDLFDSVLGGLGQFGIITRARIALRSAPTKVRWSRAFYSNFSDFIRDQERIVRGGHRD  270

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY-DDETATTI  778
               +Y+EGSL++       W +SFF P+   QI SL+  +GIIY LEL KYY  ++  + I
Sbjct  271   VANYLEGSLVLDNGTPTEWITSFFHPTQLPQIMSLVKTYGIIYCLELTKYYFIEDIESEI  330

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++LQE+FK  + + G +  K VS  +FL RV + E + +        HPW NLF+PKSR
Sbjct  331   DQDLQEVFKQFAHVPGFIDAKFVSHQEFLTRVPNAENESQT-------HPWQNLFIPKSR  383

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFNVGV  DI+L++N T+GP+L YP N+ +WD ++SAV+P+E+ FY    LH+  ++ 
Sbjct  384   ISDFNVGVLRDIVLKRNITTGPVLFYPLNRHKWDAQLSAVIPDEDIFYTTSFLHTGGIDN  443

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+   +QN+ I+K+C+EAGIKI +YL  Y T E+W KHFG KW  F++RKA +DPK ILS
Sbjct  444   WQVYEDQNKAIIKFCEEAGIKIVKYLADYTTIEEWIKHFGSKWTTFRERKAKYDPKNILS  503

Query  237   PGQRIFS  217
             PGQ+IF+
Sbjct  504   PGQKIFN  510



>ref|XP_011015519.1| PREDICTED: cytokinin dehydrogenase 3-like [Populus euphratica]
Length=512

 Score =   469 bits (1206),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 229/427 (54%), Positives = 306/427 (72%), Gaps = 15/427 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRN--GGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
              RG+GHS  GQ  A+DGVVV+M SL+ N  G +IRVS +     +ADVGG +LW+DVL  
Sbjct  94    VRGNGHSVNGQDMARDGVVVDMKSLRENKTGIKIRVSRNH---LFADVGGEQLWIDVLHT  150

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +   GL+PVSWTD+LYL+VGGTLSNAGISGQ+F +GPQI+NV E+DVITGKGEL+TCSK 
Sbjct  151   TAAQGLSPVSWTDFLYLSVGGTLSNAGISGQTFLHGPQISNVYELDVITGKGELVTCSKR  210

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI--SIDD  955
              NS+LF +VLGGLGQFG+ITRARI L  APT+V+W R  Y +F+ F RDQE ++     D
Sbjct  211   NNSDLFDSVLGGLGQFGIITRARIALRSAPTKVRWSRAFYSNFSDFIRDQERIVRGGHRD  270

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY-DDETATTI  778
               +Y+EGSL++       W +SFF P+   QI SL+  +GIIY LEL KYY  ++  + I
Sbjct  271   VANYLEGSLVLDNGTPTEWITSFFHPTQLPQIMSLVKTYGIIYCLELTKYYFIEDIESEI  330

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++LQE+FK  + + G +  K VS  +FL RV + E + +        HPW NLF+PKSR
Sbjct  331   DQDLQEVFKHFAHVPGFIDAKFVSHQEFLTRVPNAENESQT-------HPWQNLFIPKSR  383

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFNVGV  DI+L++N T+GP+L YP N+ +WD ++SAV+P+E+ FY    LH+  ++ 
Sbjct  384   ISDFNVGVLRDIVLKRNITTGPVLFYPLNRHKWDAQLSAVIPDEDIFYTTSFLHTGGIDN  443

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+   +QN+ I+K+C+EAGIKI +YL  Y T E+W KHFG KW  F++RKA +DPK ILS
Sbjct  444   WQVYEDQNKAIIKFCEEAGIKIVKYLADYTTIEEWIKHFGSKWTTFRERKAKYDPKNILS  503

Query  237   PGQRIFS  217
             PGQ+IF+
Sbjct  504   PGQKIFN  510



>ref|XP_003599606.1| Cytokinin dehydrogenase [Medicago truncatula]
 gb|AES69857.1| cytokinin oxidase/dehydrogenase-like protein [Medicago truncatula]
Length=547

 Score =   470 bits (1209),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 316/429 (74%), Gaps = 9/429 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A++GVV+ M SL  N   I+V   E    Y DV G ELW+ +L  +L
Sbjct  125   ARGHGHSLQGQAQAEEGVVINMESL--NVEEIKVYGGEFP--YVDVSGGELWIKILHETL  180

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GLAP SWTDYL+LTVGGTLSNAG+SGQ+FR+GPQI+NV +M+++TG GE++ CS+  N
Sbjct  181   KYGLAPRSWTDYLHLTVGGTLSNAGVSGQAFRHGPQISNVQKMEIVTGTGEVVNCSEEQN  240

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELF++VLGGLGQFG+ITRARI+L+ APT VKW+R+LY DFT FT+DQE LI  +   DY
Sbjct  241   GELFYSVLGGLGQFGIITRARILLEPAPTMVKWIRVLYSDFTAFTKDQEKLIFAEKAFDY  300

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             +EG +I  ++   NNWR SF +P    Q +   S+   ++ LEL KY++ E    +++++
Sbjct  301   IEGFVIKNRTGLLNNWRLSF-NPQDPVQASKFKSDGRTLFCLELAKYFNMEETLEVNQDI  359

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
             Q+    L+FI   +F+ +V++ DFL+RV   EVKLR KG+WDVPHPWLNLF+PKS+I +F
Sbjct  360   QKHLSHLNFIPSTLFQTEVTYVDFLDRVHISEVKLRSKGLWDVPHPWLNLFIPKSKIHNF  419

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSR-VNEWEE  409
                VF +I+  +  ++GP+L+YP +K++WD R S V+P+E+ FY VG L SS   +E E 
Sbjct  420   AEVVFGNIV--KETSNGPVLIYPVHKSKWDKRTSVVIPDEDIFYLVGFLASSSGPDELEH  477

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             + +QN+ IL+YC+ A + +KQYLPHY T+E+W+ H+G KW+IF+QRK+++DP  IL+PGQ
Sbjct  478   ILSQNKRILEYCERAHLGVKQYLPHYTTQEEWQTHYGHKWEIFKQRKSIYDPLAILAPGQ  537

Query  228   RIFSQSSSW  202
              IFS+S ++
Sbjct  538   GIFSKSITF  546



>gb|ADP38079.1| cytokinin dehydrogenase 4 [Zea mays]
Length=541

 Score =   469 bits (1208),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 237/447 (53%), Positives = 304/447 (68%), Gaps = 14/447 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSW---SESLG-FYADVGGHELWVDVL  1315
             ARGHGHS  GQA A  GVVV+MS  +  G  +  +    S +LG  Y DV G ELWVDVL
Sbjct  95    ARGHGHSISGQAQAAGGVVVDMSRGRGPGAAVARALPVHSAALGGHYVDVWGGELWVDVL  154

Query  1314  RASLPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITC  1138
               +L HG LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++TC
Sbjct  155   NWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTC  214

Query  1137  SKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID  958
             S+  N +LFF VLGGLGQFG+ITRARI L++AP RV+W+R LY +F++FT DQE LIS+ 
Sbjct  215   SETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLG  274

Query  957   DG----LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDET  790
              G     DYVEG ++  +   NNWRSSFFSP +  ++ SL  +  ++Y LE+ K YDDET
Sbjct  275   SGGGRRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLTSLKHHSSVLYCLEVTKNYDDET  334

Query  789   ATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFV  610
             A ++D+++  +   L+F+ G VF  D+ + DFL+RV   E+KLR KGMW+VPHPWLNLFV
Sbjct  335   AGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFV  394

Query  609   PKSRILDFNVGVFVDII-LRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHS  433
             P SRI DF+ GVF  ++  R     GP+L+YP NK +WD R SAV P+EE FY V  L S
Sbjct  395   PASRIADFDRGVFRGVLGGRTAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRS  454

Query  432   S---RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKA  265
             +        E L  QN+ IL +C   GI  KQYLP +K   +W +HFG  +W  F + KA
Sbjct  455   ALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKA  514

Query  264   LFDPKLILSPGQRIFSQSSSWVWSIDA  184
              FDP+ IL+ GQ IF    S   + D+
Sbjct  515   EFDPRAILAAGQGIFRPPGSPALAADS  541



>ref|XP_009389713.1| PREDICTED: cytokinin dehydrogenase 6-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   468 bits (1205),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/431 (55%), Positives = 312/431 (72%), Gaps = 10/431 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGR-----IRVSWSE-SLGFYADVGGHELWVD  1321
             ARGHGHS RGQA A  GVVV+M+SL           I+V   +     Y D GG +LW+D
Sbjct  103   ARGHGHSIRGQAFAPGGVVVDMASLGGGRRARRRDRIKVPLDDVHRLLYVDAGGEQLWID  162

Query  1320  VLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELIT  1141
             VLR +L HG+AP SWTDYLYLTVGGTLSNAGISGQ+FR+GPQI+NV E+DVITGKG+++T
Sbjct  163   VLRETLEHGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVHELDVITGKGDMVT  222

Query  1140  CSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI  961
              S+ +NS+LF+ VLGGLGQ G+ITRARI ++ AP RV+WVR +Y DF  F  DQE LISI
Sbjct  223   SSRDVNSDLFYGVLGGLGQLGIITRARIAVEPAPQRVRWVRFIYTDFGSFINDQELLISI  282

Query  960   -DDGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
              ++G DYVEG L+M    AN   SSFFS     +I  L +  G+IY LE   YY+  TA+
Sbjct  283   SEEGFDYVEGQLLMKNGAAN---SSFFSERDSEKIKVLAAEFGVIYFLEGAIYYELATAS  339

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D++L+ + K LSF+ G  F KDVS+  FL+RV   E+KLR  G+WDVPHPWLNLFVPK
Sbjct  340   LVDQKLKLLLKKLSFVPGFAFTKDVSYLRFLDRVHHDEIKLRPMGLWDVPHPWLNLFVPK  399

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRV  424
             SR+ DF  G+F  I++  N     +L+ P N+++WD++MS  +P+E+ FY +G+L S+ +
Sbjct  400   SRMRDFETGIFRGILIENNTPMATVLISPMNRSKWDEKMSVTIPDEDIFYAIGILRSATM  459

Query  423   NEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLI  244
             ++W+ L +QN+EIL++C++AGI+ KQYLPHY T+ DW+KHFG KW  F Q K  +DPK +
Sbjct  460   DDWKHLDDQNDEILRFCNQAGIEFKQYLPHYTTQADWKKHFGLKWDTFVQLKRRYDPKAL  519

Query  243   LSPGQRIFSQS  211
             LSPGQ+IF+ S
Sbjct  520   LSPGQQIFTTS  530



>emb|CDY50467.1| BnaA10g28940D [Brassica napus]
Length=478

 Score =   466 bits (1200),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 280/367 (76%), Gaps = 3/367 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  101   ARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLWIEVLNKTL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYLYLTVGGTLSN GISGQ+FRYGPQI+NV+EMDVITGKGE+ TCSK +N
Sbjct  158   ELGLTPVSWTDYLYLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEIATCSKDMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LF+A LGGLGQFG+ITRARI L+ AP + KW+R LY DF++FTRDQE LIS  +G  +
Sbjct  218   SDLFYAALGGLGQFGIITRARIKLELAPKKAKWLRFLYTDFSEFTRDQERLISETNGPHF  277

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD+ +  +++EE++
Sbjct  278   LEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQHSVNEEME  337

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+   L++  G V+EKDV++ DFLNRVR+GE+KL+ KG WDVPHPWLNLFVPKS+I  F 
Sbjct  338   ELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGKWDVPHPWLNLFVPKSQISRFE  397

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N T+GP+LVYP N+ +W+DRMS V+PEE+ FY VG L S+  + W++  
Sbjct  398   YGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVIPEEDVFYAVGFLRSASFDNWDDYE  457

Query  402   NQNEEIL  382
              +N E+ 
Sbjct  458   KENMELF  464



>emb|CDY60734.1| BnaA07g35940D [Brassica napus]
Length=768

 Score =   476 bits (1225),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 232/423 (55%), Positives = 295/423 (70%), Gaps = 28/423 (7%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARG GHS  GQA+  +                          YADV G  LWVDVLR + 
Sbjct  372   ARGQGHSLNGQASVSED-----------------------KEYADVAGGTLWVDVLRETA  408

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               G++PVSWTDYL+++VGGTLSNAGI GQ FR GPQI+NV+E+DVITGKGE + CS  +N
Sbjct  409   EQGVSPVSWTDYLHISVGGTLSNAGIGGQMFRNGPQISNVLELDVITGKGETLACSPQLN  468

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI--DDGL  949
              ELF+ VLGGLGQFG+ITRARIVL+ AP R KW +MLY DFT FT+DQE LIS+  D G+
Sbjct  469   PELFYGVLGGLGQFGIITRARIVLNHAPRRAKWFKMLYSDFTAFTKDQESLISMNNDTGV  528

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DYVEG L+M+    +   +SFF PS QS++A L+ NH IIY LE+ KYYDD T  T    
Sbjct  529   DYVEGQLLMSNGIVD---TSFFPPSDQSKVADLVKNHSIIYVLEVAKYYDDPTVPTTGLV  585

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             + ++ K LS++ G +   DV +FDFLNRV+  E KLR   +W+VPHPWLNL+VPK++ILD
Sbjct  586   IDKLTKTLSYLPGFISMHDVPYFDFLNRVQVEEDKLRSLALWEVPHPWLNLYVPKTQILD  645

Query  588   FNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEE  409
             F+ GV  DI+L+QN TSG  L YPTN+ +WD+RMSA++P+E  FY VGLL S+     +E
Sbjct  646   FHNGVVKDILLKQNSTSGVALFYPTNRNKWDNRMSAMIPDENVFYVVGLLQSASSQNVQE  705

Query  408   LGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQ  229
             + + NE I+++C ++ IKIKQYL H+  +EDW  HFG KW  F +RK LFDPK +LSPGQ
Sbjct  706   VESVNEAIIRFCKDSDIKIKQYLMHFTRKEDWVGHFGSKWGAFSKRKDLFDPKKLLSPGQ  765

Query  228   RIF  220
              IF
Sbjct  766   DIF  768



>dbj|BAG16379.1| cytokinin oxidase family protein [Brassica rapa var. perviridis]
Length=524

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/426 (51%), Positives = 303/426 (71%), Gaps = 8/426 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  GVV+ M SL     +I     +    Y DV G ELW+++L+ +L
Sbjct  98    ARGHGHSLQGQALAHQGVVINMESLPSPDIKIY----KGTQPYVDVSGGELWINILKETL  153

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL+P SWTDYL+LTVGGTLSNAGISGQ+F++GPQI NV +++++TGKGE +TCSK +N
Sbjct  154   KHGLSPKSWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEAVTCSKKLN  213

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELF +VLGGLGQFG+ITRARI L  AP  VKW+R+LY DF+ F+RDQEHLIS   G D+
Sbjct  214   PELFHSVLGGLGQFGIITRARISLGPAPHMVKWIRVLYSDFSTFSRDQEHLISKKKGFDF  273

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEGS+ + ++   NNWRSSF +P+  ++ +   S+   +Y LE+VKY++ E A ++++E 
Sbjct  274   VEGSVTINRTDLLNNWRSSF-TPNDSTEASQFKSDGKTLYCLEVVKYFNKEEANSMNQET  332

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
             +++   LS+I   +F   V + +FL+RV  GE+KLR KG+W+VPHPWLNL VPKS I +F
Sbjct  333   EKLLSELSYIPSTLFSSVVPYIEFLDRVHLGEIKLRAKGLWEVPHPWLNLLVPKSSIFEF  392

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEEL  406
                VF +I+   N  +GPIL+YP N+++W+ R S + P E+ FY V  L S+  N+ E L
Sbjct  393   ATEVFNNILTSNN--NGPILIYPVNQSKWNKRTSLITPSEDIFYLVAFLPSALQNDLEHL  450

Query  405   GNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQR  226
               QN+ +L +C+EA + +KQYLPHY+T+ +W  HFG KW+ F + K  +DP  IL+PG R
Sbjct  451   LRQNQRVLNFCEEAKMNVKQYLPHYETQREWRSHFGNKWETFAKIKHEYDPLAILAPGHR  510

Query  225   IFSQSS  208
             IF +++
Sbjct  511   IFQKAT  516



>gb|EAY85042.1| hypothetical protein OsI_06399 [Oryza sativa Indica Group]
Length=524

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 300/434 (69%), Gaps = 10/434 (2%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASLP  1300
             RG GHSARGQ+ A  GVVV+M +L    GR+ VS   +   Y D GG +LWVDVLRA+L 
Sbjct  90    RGQGHSARGQSLAPGGVVVDMRALASRRGRVNVSAGAAP--YVDAGGEQLWVDVLRATLE  147

Query  1299  HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINS  1120
             HGLAP  WTDYL +TV GTLSNAGI GQ+FR+GPQIANV+E+DVITG G+++TCS+  +S
Sbjct  148   HGLAPRVWTDYLRITVAGTLSNAGIGGQAFRHGPQIANVLELDVITGTGDMVTCSRDKDS  207

Query  1119  ELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS---IDDGL  949
             +LFFAVLGGLGQFG+ITRARI L  AP RV+WVR+ Y D   FT+DQE LIS    + G 
Sbjct  208   DLFFAVLGGLGQFGIITRARIGLMPAPKRVRWVRLAYSDVATFTKDQELLISKRASEAGF  267

Query  948   DYVEGSLIMTQSPANNWRSS-FFSPSHQSQIASLISN--HGIIYSLELVKYYDDETATTI  778
             DYVEG + + ++     +S+ FFS S   ++A L S    G+IY +E   YY++ T+TT+
Sbjct  268   DYVEGQVQLNRTLTEGPKSTPFFSSSDIGRLAGLASKSESGVIYVIECAMYYNESTSTTM  327

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+ +   LSF  G VF KDV +  FL+RVR  E  LR  GMWDVPHPWLNLFVP+SR
Sbjct  328   DQKLESILGQLSFEEGFVFTKDVRYVQFLDRVREEERVLRSIGMWDVPHPWLNLFVPRSR  387

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-RVN  421
             ILDF+ GVF  +    N   G IL+YP N+  WDDRM AV  + + FY VGLL S+  V+
Sbjct  388   ILDFDAGVFKGVFAGANPV-GVILMYPMNRNMWDDRMMAVASDNDVFYAVGLLRSAVVVD  446

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
             + E L  +NE +L +C    I+ KQYLP+Y +++ W++HFG KW      KA +DP  IL
Sbjct  447   DVERLEKENEAVLAFCHNEDIECKQYLPYYTSQDGWQRHFGAKWSRVADLKAKYDPHRIL  506

Query  240   SPGQRIFSQSSSWV  199
             SPGQRIFS  +S V
Sbjct  507   SPGQRIFSSPASMV  520



>ref|XP_002458582.1| hypothetical protein SORBIDRAFT_03g036160 [Sorghum bicolor]
 gb|EES03702.1| hypothetical protein SORBIDRAFT_03g036160 [Sorghum bicolor]
Length=548

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 238/442 (54%), Positives = 306/442 (69%), Gaps = 16/442 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMS----SLKRNGGRIRVSWSESLG-FYADVGGHELWVDV  1318
             ARGHGHS  GQA A  GVVV+MS    +  R   R    +S +LG  Y DV G +LW+DV
Sbjct  100   ARGHGHSISGQAQAPGGVVVDMSHGPGAAARARARALPVYSPALGGHYVDVWGGDLWIDV  159

Query  1317  LRASLPHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELIT  1141
             L  +L HG LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++T
Sbjct  160   LNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVT  219

Query  1140  CSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISI  961
             CS   N +LFF  LGGLGQFG+ITRARI L++AP RV+W+R LY +FT+FT DQE LIS+
Sbjct  220   CSATENPDLFFGALGGLGQFGIITRARIALERAPQRVRWIRALYSNFTEFTADQERLISL  279

Query  960   DDG-----LDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDD  796
               G      DYVEG ++  +   NNWRSSFFSP +  +++SL  + G++Y LE+ K YDD
Sbjct  280   GSGSGGRRFDYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDD  339

Query  795   ETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNL  616
             +TA ++D+++  +   L+F+ G VF  D+ + DFL+RV   E+KLR KGMW+VPHPWLNL
Sbjct  340   DTAGSVDQDVDALLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNL  399

Query  615   FVPKSRILDFNVGVFVDII-LRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             FVP SRI DF+ GVF  ++  R     GPIL+YP NK +WD R S V P+EE FY V  L
Sbjct  400   FVPASRIADFDRGVFRGVLGGRTAGAGGPILIYPMNKHKWDPRSSVVTPDEEVFYLVAFL  459

Query  438   HSS---RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQR  271
              S+        E L  QN+ IL +C EAGI  KQYLP++K + +W +HFG  +W+ FQ+ 
Sbjct  460   RSALPGAPESLEALVRQNQRILDFCAEAGISAKQYLPNHKAQHEWAEHFGAARWERFQRL  519

Query  270   KALFDPKLILSPGQRIFSQSSS  205
             KA FDP+ IL+ GQ IF    S
Sbjct  520   KAEFDPRAILATGQGIFRPPGS  541



>emb|CDY51023.1| BnaC09g33450D [Brassica napus]
Length=478

 Score =   466 bits (1198),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 280/367 (76%), Gaps = 3/367 (1%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS RGQA AKDGVVV M S+      I+VS +   G YADV    LW++VL  +L
Sbjct  101   ARGHGHSHRGQAAAKDGVVVNMRSMVNRDRGIKVSRT---GLYADVDSAWLWIEVLNKTL  157

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
               GL PVSWTDYL+LTVGGTLSN GISGQ+FRYGPQI+NV+EMDVITGKGE+ TCSK +N
Sbjct  158   ELGLTPVSWTDYLHLTVGGTLSNGGISGQTFRYGPQISNVLEMDVITGKGEIATCSKDMN  217

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             S+LF+A LGGLGQFG+ITRARI L+ AP   KW+R LY DF++FTRDQE LIS  +GL +
Sbjct  218   SDLFYAALGGLGQFGIITRARIKLELAPKNAKWLRFLYTDFSEFTRDQERLISETNGLHF  277

Query  942   VEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEELQ  763
             +EGS+++   P +NWRS+++ PS   +I S++  H +IY LE+VKYYD+ +  +++EE++
Sbjct  278   LEGSVMLDHGPPDNWRSTYYPPSEHMRIVSMVKQHRVIYCLEVVKYYDETSQHSVNEEME  337

Query  762   EMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDFN  583
             E+   L++  G V+EKDV++ DFLNRVR+GE+KL+ KG WDVPHPWLNLFVPKS+I  F 
Sbjct  338   ELSDSLNYERGFVYEKDVTYMDFLNRVRTGELKLKSKGQWDVPHPWLNLFVPKSQISRFE  397

Query  582   VGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEELG  403
              GVF  IILR N T+GP+LVYP N+ +W+DRMS V+PEE+ FY VG L S+  + W++  
Sbjct  398   YGVFKGIILRNNITTGPLLVYPMNRNKWNDRMSTVLPEEDVFYAVGFLRSASFDNWDDYE  457

Query  402   NQNEEIL  382
              +N E+ 
Sbjct  458   KENMELF  464



>emb|CDX79932.1| BnaA05g02240D [Brassica napus]
Length=533

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 218/426 (51%), Positives = 301/426 (71%), Gaps = 8/426 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  GVV+ M SL     +I     +    Y DV G ELW+++LR +L
Sbjct  107   ARGHGHSLQGQALAHQGVVINMESLPSPDIKIY----KGTQPYVDVSGGELWINILRETL  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL+P SWTDYL+LTVGGTLSNAGISGQ+F++GPQI NV +++++TGKGE +TCSK +N
Sbjct  163   KHGLSPKSWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEAVTCSKKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELF +VLGGLGQFG+ITRARI L  AP  VKW+R+LY DF+ F+RDQEHLIS   G D+
Sbjct  223   PELFHSVLGGLGQFGIITRARISLGPAPHMVKWIRVLYSDFSTFSRDQEHLISKKKGFDF  282

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEGS+ + ++   NNWRSSF +P+  ++ +   S+   +Y LE+VKY++ E A ++++E+
Sbjct  283   VEGSVTINRTDLLNNWRSSF-TPNDSTEASQFKSDGKTLYCLEVVKYFNKEEANSMNQEI  341

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
               +   LS+I   +F   V + +FL+RV  GE+KLR KG+W+VPHPWLNL VPKS I +F
Sbjct  342   DSLLSELSYIPSTLFSSVVPYIEFLDRVHLGEIKLRAKGLWEVPHPWLNLLVPKSSIFEF  401

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEEL  406
                VF +I+   N  +GPIL+YP N+++W+ R S + P E+ FY V  L S+  N+ E L
Sbjct  402   ATEVFNNILTSNN--NGPILIYPVNQSKWNKRTSLITPSEDIFYLVAFLPSAVQNDLEHL  459

Query  405   GNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQR  226
               QN+ +L +C EA + +KQYLPHY+T+ +W  HFG KW+ F + K  +DP  IL+PG R
Sbjct  460   LRQNQRVLNFCAEAKMDVKQYLPHYETQREWRSHFGNKWETFAKMKHEYDPLAILAPGHR  519

Query  225   IFSQSS  208
             IF +++
Sbjct  520   IFQKAT  525



>ref|XP_003571719.1| PREDICTED: cytokinin dehydrogenase 7-like [Brachypodium distachyon]
Length=532

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/432 (54%), Positives = 302/432 (70%), Gaps = 13/432 (3%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASLP  1300
             RG GHSARGQ+ A  GVVV+M +L R   RI VS       Y D GG +LW+DVLRA+L 
Sbjct  101   RGQGHSARGQSLAPGGVVVDMRALGRGHRRINVSAGAG---YVDAGGEQLWIDVLRATLE  157

Query  1299  HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHINS  1120
             HGLAP +WTDYL LTVGGTLSNAGI GQ+FR+GPQIANV E+DV+TG GEL+TCS+  +S
Sbjct  158   HGLAPRAWTDYLRLTVGGTLSNAGIGGQAFRHGPQIANVRELDVVTGTGELVTCSREESS  217

Query  1119  ELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS---IDDGL  949
             +LFFAVLGGLGQFGVITRARI L+ AP R +WVR+ Y D T FT DQE LIS    + G 
Sbjct  218   DLFFAVLGGLGQFGVITRARIALEPAPKRARWVRLAYTDVTVFTGDQELLISKKASEAGF  277

Query  948   DYVEGSLIMTQSPANNWRSS-FFSPSHQSQIASLI--SNHGIIYSLELVKYYDDETATTI  778
             DYVEG + + ++  +   S+ FFS +  +++A L+  S  G IY +E   YYD+ TA+++
Sbjct  278   DYVEGQVQLNRTLIDGPESTPFFSGADINRLAGLVSRSGSGAIYFIEAAMYYDEATASSV  337

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++L+ + + LSF  G VF KDV++  FL+RVR  E  LR  G+WDVPHPWLNLF+P+SR
Sbjct  338   DQKLEAVLEQLSFTPGFVFTKDVTYVQFLDRVRVEEEVLRSVGVWDVPHPWLNLFIPRSR  397

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVP--EEETFYCVGLLHSS-R  427
             I+ F+ GV   I+   N   G IL+YP N  +WDDRM+AV P  EE+ FY V LL S+  
Sbjct  398   IIGFDTGVLKGILGGTNPV-GVILMYPMNTNKWDDRMTAVTPQTEEDVFYAVSLLRSAVA  456

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
             V + E L  +NE +L +C    I+ KQYLPHY +E+ W +HFG KW+   + KA +DP+ 
Sbjct  457   VGDVERLERENEAVLAFCTREAIRCKQYLPHYTSEDGWRRHFGTKWERIAELKAKYDPQT  516

Query  246   ILSPGQRIFSQS  211
             I++PGQRIF  S
Sbjct  517   IMAPGQRIFQSS  528



>ref|XP_009142753.1| PREDICTED: cytokinin dehydrogenase 1-like [Brassica rapa]
Length=533

 Score =   466 bits (1200),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 216/426 (51%), Positives = 302/426 (71%), Gaps = 8/426 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  GVV+ M SL     +I     +    Y DV G ELW+++L+ +L
Sbjct  107   ARGHGHSLQGQALAHQGVVINMESLPSPDIKIY----KGTQPYVDVSGGELWINILKETL  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL+P SWTDYL+LTVGGTLSNAGI GQ+F++GPQI NV +++++TGKGE +TCSK +N
Sbjct  163   KHGLSPKSWTDYLHLTVGGTLSNAGIGGQAFKHGPQINNVYQLEIVTGKGEAVTCSKKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELF +VLGGLGQFG+ITRARI L  AP  VKW+R+LY DF+ F+RDQEHLIS   G D+
Sbjct  223   PELFHSVLGGLGQFGIITRARISLGPAPHMVKWIRVLYSDFSTFSRDQEHLISKKKGFDF  282

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEGS+ + ++   NNWRSSF +P+  ++ +   S+   +Y LE+VKY++ E A ++++E 
Sbjct  283   VEGSVTINRTELLNNWRSSF-TPNDSTEASQFKSDGKTLYCLEVVKYFNKEEANSMNQET  341

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
             +++   LS+I   +F   V + +FL+RV  GE+KLR KG+W+VPHPWLNL VPKS I +F
Sbjct  342   EKLLSELSYIPSTLFSSVVPYIEFLDRVHLGEIKLRAKGLWEVPHPWLNLLVPKSSIFEF  401

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEEL  406
                VF +I+   N  +GPIL+YP N+++W+ R S + P E+ FY V  L S+  N+ E L
Sbjct  402   ATEVFNNILTSNN--NGPILIYPVNQSKWNKRTSLITPSEDIFYLVAFLPSALQNDLEHL  459

Query  405   GNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQR  226
               QN+ +L +C+EA + +KQYLPHY+T+ +W  HFG KW+ F + K  +DP  IL+PG R
Sbjct  460   LRQNQRVLNFCEEAKMNVKQYLPHYETQREWRSHFGNKWETFAKIKHEYDPLAILAPGHR  519

Query  225   IFSQSS  208
             IF +++
Sbjct  520   IFQKAT  525



>ref|XP_002310104.2| hypothetical protein POPTR_0007s08360g [Populus trichocarpa]
 gb|EEE90554.2| hypothetical protein POPTR_0007s08360g [Populus trichocarpa]
Length=524

 Score =   466 bits (1199),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 224/424 (53%), Positives = 306/424 (72%), Gaps = 15/424 (4%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
              RG+GHS  GQ  A+DGVVV+M SL+  +NG +IRVS +     +ADVGG +LW+DVL  
Sbjct  94    VRGNGHSVNGQDMARDGVVVDMKSLREDKNGIKIRVSKNH---LFADVGGEQLWIDVLHT  150

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +   GL+PVSWTD+LYL+VGGTLSNAG+SGQ+F +GPQI+NV E+DVITGKGEL+TCSK 
Sbjct  151   TAAQGLSPVSWTDFLYLSVGGTLSNAGVSGQTFLHGPQISNVYELDVITGKGELVTCSKR  210

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLI--SIDD  955
              NS+LF +VLGGLGQFG+ITRARI L  APT+V+W R  Y +F+ F RDQE ++     D
Sbjct  211   NNSDLFDSVLGGLGQFGIITRARIALRSAPTKVRWSRAFYSNFSDFIRDQERIVRGGQRD  270

Query  954   GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYY-DDETATTI  778
               +Y+EGSL++       W +SFF P+   QI SL+  +GIIY LEL KYY  ++  + I
Sbjct  271   VANYLEGSLMLDNGTPTEWITSFFHPTQLPQIMSLVKTYGIIYCLELTKYYFIEDIESEI  330

Query  777   DEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSR  598
             D++LQ++FK  S + GL+  K VS+ +FL RV + E + +        HPW NLF+P+SR
Sbjct  331   DQDLQQVFKDFSHVPGLINAKFVSYQEFLTRVPNAENESQT-------HPWQNLFIPQSR  383

Query  597   ILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNE  418
             I DFNVGV  DI+L++N T+GP+L YP N+ +WD  +SAV+P+E+ FY    LH+S ++ 
Sbjct  384   ISDFNVGVLRDIVLKRNITTGPVLFYPLNRHKWDAELSAVIPDEDIFYTTSFLHTSGIDN  443

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
             W+   +QN+ ++K+C+EAGIK+ +YL  Y T E+W KHFG KW  F++RKA +DPK ILS
Sbjct  444   WQVYEDQNQAVIKFCEEAGIKMVKYLADYTTIEEWIKHFGSKWTTFRERKAQYDPKNILS  503

Query  237   PGQR  226
             PG++
Sbjct  504   PGKK  507



>ref|XP_004295395.1| PREDICTED: cytokinin dehydrogenase 6-like [Fragaria vesca subsp. 
vesca]
Length=495

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 225/431 (52%), Positives = 305/431 (71%), Gaps = 10/431 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQ+ A  GVVV M SLKR    I V+++ +   YADV G ELW+++L  SL
Sbjct  65    ARGHGHSLQGQSQAHRGVVVNMESLKRPID-IHVNFTGNFS-YADVSGGELWINILHESL  122

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GLAP SWTDYL+LTVGGTLSNAGISGQ+FR+GPQI+NV ++ V+TGKGE++TCS+  N
Sbjct  123   NYGLAPKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLQVVTGKGEIVTCSEKQN  182

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              +LF  VLGGLGQFG+ITRARI+L+ AP RVKW+R+LY DFT FTRDQEHLISI +  +Y
Sbjct  183   HDLFHGVLGGLGQFGIITRARILLEAAPARVKWIRVLYSDFTAFTRDQEHLISIQNTFNY  242

Query  942   VEGSLIMTQSP-ANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEG +I+ ++   NNWRS  FSP    Q +   S+   +Y LEL KY++ +    I++E+
Sbjct  243   VEGFVIINRTGLLNNWRSYSFSPKDPVQASQFKSDGRTLYCLELAKYFNLDKTDIINQEV  302

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
              ++   LS+I   +F   V++ DFL+RV   E+KLR K +WD+PHPW+NL +PKS+I  F
Sbjct  303   DKLLSQLSYIPSTLFVSQVTYTDFLDRVHVSEMKLRSKHLWDIPHPWINLLIPKSKIHTF  362

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL-----HSSRVN  421
               GVF +I+     ++GPIL+YP N+++WD+R S V PEE  FY V  L      S+  +
Sbjct  363   ARGVFGNIVTA--TSNGPILIYPVNRSKWDNRTSVVTPEEHIFYLVAFLTSAVPSSTGTD  420

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
               E +  QN+ IL +C+ A + +KQYLPHY  +E+W+ HFG  W+ F QRK+ +DP  IL
Sbjct  421   GLEHMLIQNKRILDFCETANLGVKQYLPHYTKQEEWQSHFGSHWEKFVQRKSTYDPLAIL  480

Query  240   SPGQRIFSQSS  208
             +PGQRIF + +
Sbjct  481   APGQRIFQKGN  491



>gb|KDO84681.1| hypothetical protein CISIN_1g042782mg, partial [Citrus sinensis]
Length=527

 Score =   464 bits (1195),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 292/405 (72%), Gaps = 21/405 (5%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESL-------GFYADVGGHELWV  1324
             ARGHGHS  GQA   +GVV++MS  +  G R+  S   +L         Y DV G ELW+
Sbjct  127   ARGHGHSINGQAQTSNGVVIQMSGSR--GRRLGSSTPAALRPHVYEKERYVDVWGGELWI  184

Query  1323  DVLRASLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELI  1144
             DVLR++L HGLAP SWTDYLYL+VGGTLSNAGISGQ+F  GPQI NV E+DV+TGKGEL+
Sbjct  185   DVLRSTLEHGLAPKSWTDYLYLSVGGTLSNAGISGQAFHQGPQITNVHELDVVTGKGELL  244

Query  1143  TCSKHINSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLIS  964
             TCS+  NS LF AVLGGLGQFG+ITRARI L+ AP RV+W+R+LY DF+ FTRDQE+LIS
Sbjct  245   TCSEEQNSGLFHAVLGGLGQFGIITRARISLEPAPKRVRWIRVLYSDFSTFTRDQEYLIS  304

Query  963   IDD-----GLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYD  799
             + +       DYVEG +I+ +   NNWRSSFFSP +  +I SL ++ G++Y LE+ K YD
Sbjct  305   LHELPASQKFDYVEGFVIVDEGLINNWRSSFFSPRNPVKITSLGTDGGVLYCLEITKNYD  364

Query  798   DETATTIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLN  619
             + TA T D+E++ + K L+FI   VF  D+ + DFL+RV   E+KLR KG+W+VPHPWLN
Sbjct  365   ESTADTTDQEVESLLKKLNFIQSSVFTTDLLYVDFLDRVHKAELKLRSKGLWEVPHPWLN  424

Query  618   LFVPKSRILDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL  439
             LF+PKSRI DF+ GVF  I+   NKT GPIL+YP NK +WD+R S V P+E+ FY V  L
Sbjct  425   LFIPKSRIADFDKGVFKGIL--GNKTGGPILIYPMNKHKWDNRSSVVTPDEDVFYLVAFL  482

Query  438   HSS-----RVNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEE  319
              S+      +   E L +QN +ILK+CDEAGIK KQYLPHY T+E
Sbjct  483   RSALDNGEEMQSLEYLNHQNRQILKFCDEAGIKAKQYLPHYTTQE  527



>gb|KHN17673.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=377

 Score =   458 bits (1178),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 216/334 (65%), Positives = 269/334 (81%), Gaps = 7/334 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A+DG+VV+M+SL+  RNG  I VS    +G YADVGG +LW+DVL A
Sbjct  44    ARGQGHSTHGQAMARDGIVVDMASLRKQRNGVAISVSKDPLMGHYADVGGEQLWIDVLHA  103

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L +GLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQI+NV EMDVITGKGE +TCS  
Sbjct  104   TLEYGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSSQ  163

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              N ELF AVLGGLGQFGVI RARI L+ AP RVKWVR+LY DF+ FT+DQE LISI+   
Sbjct  164   KNLELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFSAFTKDQERLISINGRK  223

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LD++EG L+M Q P NNWRSSFF  S   +IASLI+ H I+Y LE+ KYYD++T  
Sbjct  224   QKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRIASLITEHSILYCLEVAKYYDEQTEL  283

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D+E++ + +GL++I G  +EK+VS+ +FLNRVRSGE+KL+ +G+W+VPHPWLNLF+PK
Sbjct  284   NVDKEIEVLLQGLAYIPGFNYEKNVSYVEFLNRVRSGELKLQSQGLWEVPHPWLNLFIPK  343

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKAR  502
             S+ILDFN GVF DI+L++N +SGP+LVYP N+ +
Sbjct  344   SQILDFNSGVFKDIVLKRNISSGPVLVYPMNRNK  377



>dbj|BAG16373.1| cytokinin oxidase family protein [Brassica oleracea var. italica]
Length=524

 Score =   463 bits (1191),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 215/425 (51%), Positives = 304/425 (72%), Gaps = 8/425 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  GVV+ M SL+    +I   + E    Y DV G ELW+++L+ +L
Sbjct  107   ARGHGHSLQGQALAHQGVVINMESLQNPDIKI---YREKQP-YVDVSGGELWINILKETL  162

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGL+P SWTDYL+LTVGGTLSNAGISGQ+F++GPQI NV +++++TGKGE++TCS+ +N
Sbjct  163   KHGLSPKSWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKLN  222

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
              ELF +VLGGLGQFG+ITRARI L  AP  VKW+R+LY +F+ F+RDQEHLIS   G DY
Sbjct  223   PELFHSVLGGLGQFGIITRARISLGPAPHMVKWIRVLYSNFSTFSRDQEHLISKKKGFDY  282

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEG + + ++   NNWRSSF SP+  ++ +   S+   +Y LE VKY++ E A ++++E 
Sbjct  283   VEGFVSINRTDLLNNWRSSF-SPNDSTEASQFKSDGKTLYCLEAVKYFNKEEANSMNQET  341

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
             +++   LS+I   +F   V + +FL+RV  GE+KLR KG+W+VPHPWLNL VPKS I++F
Sbjct  342   EKLLSELSYIPSTLFSSVVPYIEFLDRVHHGEIKLRAKGLWEVPHPWLNLLVPKSSIIEF  401

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVNEWEEL  406
                VF +I+   N  +GPIL+YP N+++W+ + S + P E+ FY V  L S+  N+ E L
Sbjct  402   ATEVFNNILTSNN--NGPILIYPVNQSKWNKQTSLITPSEDIFYLVAFLPSAVQNDLEHL  459

Query  405   GNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILSPGQR  226
               QN+ +L +C+EA + +KQYLPHY+T+ +W  HFG +W+ F + K  +DP  IL+PG R
Sbjct  460   LRQNQRVLNFCEEANMDVKQYLPHYETQREWRSHFGNRWETFAKMKHEYDPLAILAPGHR  519

Query  225   IFSQS  211
             IF ++
Sbjct  520   IFQKA  524



>ref|XP_010505935.1| PREDICTED: cytokinin dehydrogenase 1 [Camelina sativa]
Length=577

 Score =   465 bits (1196),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/432 (50%), Positives = 306/432 (71%), Gaps = 13/432 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  GVV++M SL+    RI          Y DV G ELW+++LR +L
Sbjct  120   ARGHGHSLQGQALAHQGVVIKMESLRNPNIRIHKGKQP----YVDVSGGELWINILRETL  175

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GL+P SWTDYL+LTVGGTLSNAGISGQ+F+YGPQI NV +++++TGKGE++TCS+  N
Sbjct  176   KYGLSPKSWTDYLHLTVGGTLSNAGISGQAFKYGPQINNVYQLEIVTGKGEVVTCSEKRN  235

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             SELF++VLGGLGQFG+ITRARI L+ AP  VKW+R+LY DF+ F+RDQEHLIS +   DY
Sbjct  236   SELFYSVLGGLGQFGIITRARISLEPAPHMVKWIRVLYSDFSVFSRDQEHLISKEKTFDY  295

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEG +I+ ++   NNWRSSF  P+  ++ +   S+   +Y LE+VKY++ E A ++ +E 
Sbjct  296   VEGFVIINRTDLLNNWRSSF-RPNDSTEASKFKSDGKTLYCLEVVKYFNTEEANSMHKET  354

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
              ++   L++I   +F  +V + +FL+RV   E KLR KG+W+VPHPWLNL +PKS I  F
Sbjct  355   GKLLSELNYIPSTLFTSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSISKF  414

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL-----HSSRVN  421
                VF +II   N  +GPIL+YP N+++W+ + S + P E+ FY V  L      SS  N
Sbjct  415   ATEVFHNIITSNN--NGPILIYPVNQSKWNKQTSLITPNEDIFYLVAFLPSAVPKSSGKN  472

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
             + E L  QN+ ++ +C  A + +KQYLPHY+T+++W+ HFGK+W+ F QRK  +DP  IL
Sbjct  473   DLEYLLKQNQRVMNFCTTANLHVKQYLPHYETQQEWKSHFGKRWETFSQRKHAYDPLTIL  532

Query  240   SPGQRIFSQSSS  205
             +PGQRIF ++++
Sbjct  533   APGQRIFQKTTT  544



>gb|AFW84922.1| hypothetical protein ZEAMMB73_083779 [Zea mays]
Length=534

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/433 (54%), Positives = 296/433 (68%), Gaps = 7/433 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS  GQA A  GVVV+M         + V      G Y DV G ELWVDVL  +L
Sbjct  95    ARGHGHSISGQAQAPGGVVVDMGHGGAVARALPVHSPALGGHYVDVWGGELWVDVLNWTL  154

Query  1302  PHG-LAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
              HG LAP SWTDYLYL+VGGTLSNAGISGQ+F +GPQI+NV E+DV+TGKGE++TCS+  
Sbjct  155   SHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETE  214

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDD-GL  949
             N +LFF VLGGLGQFG+ITRARI L++AP RV+W+R LY +FT+FT DQE LIS+     
Sbjct  215   NPDLFFGVLGGLGQFGIITRARIALERAPQRVRWIRALYSNFTEFTADQERLISLGSRRF  274

Query  948   DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEE  769
             DYVEG ++  +   NNWRSSFFSP +  +++SL  + G++Y LE+ K YDD TA +++++
Sbjct  275   DYVEGFVVAAEGLINNWRSSFFSPQNPVKLSSLKHHSGVLYCLEVTKNYDDATAGSVEQD  334

Query  768   LQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILD  589
             +  +   L+FI G VF  D+ + DFL+RV   E+KLR KGMW+VPHPWLNLFVP SRI D
Sbjct  335   VDALLGELNFIPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIAD  394

Query  588   FNVGVFVDII-LRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS---RVN  421
             F+ GVF  ++        GPIL+YP NK RWD R S V P+E+ FY V  L S+      
Sbjct  395   FDRGVFRGVLGGGTAGAGGPILIYPMNKHRWDPRSSVVTPDEDVFYLVAFLRSALPGAPE  454

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFG-KKWQIFQQRKALFDPKLI  244
               E L  QN  +L +C EAGI  KQYLP++K   +W +HFG  +W+ F + KA FDP+ I
Sbjct  455   SLEALARQNRRVLDFCAEAGIGAKQYLPNHKAPGEWAEHFGAARWERFARLKAQFDPRAI  514

Query  243   LSPGQRIFSQSSS  205
             L+ GQ IF    S
Sbjct  515   LAAGQGIFRPPGS  527



>gb|EMT16465.1| Cytokinin dehydrogenase 1 [Aegilops tauschii]
Length=532

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 231/429 (54%), Positives = 293/429 (68%), Gaps = 10/429 (2%)
 Frame = -3

Query  1479  RGHGHSARGQATAKDGVVVEMSSLKR--NGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             RG GHS+RGQA A  G+VV+M SL R  +G R+ VS     G Y DVGG +LW DVL A+
Sbjct  96    RGKGHSSRGQALAPGGIVVDMPSLGRGDHGHRVNVSID---GMYVDVGGEQLWFDVLHAT  152

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L HGL P  WTDYL +TVGGTLSNAGI GQ FR+GPQI+NV E+DV+TG G++ITCS   
Sbjct  153   LKHGLTPRVWTDYLRITVGGTLSNAGIGGQVFRHGPQISNVRELDVVTGTGDMITCSPGN  212

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLD  946
             NS+LF+  LGGLGQFGVITRAR+ L++AP RVKWVR+ Y D  +FT DQE LIS   G D
Sbjct  213   NSDLFYGALGGLGQFGVITRARVGLERAPKRVKWVRLAYTDVHQFTADQELLISNGAGFD  272

Query  945   YVEGSLIMTQSPANNWR-SSFFSPSHQSQIASLISNHG--IIYSLELVKYYDDETATTID  775
             YVEG + + ++     R SSFFS +  +++  L    G   +Y +E   YYDD +A+T+D
Sbjct  273   YVEGQVQLNRTLTEGRRSSSFFSAAELARLTELALGTGSSAVYYIEGAMYYDDGSASTVD  332

Query  774   EELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRI  595
              +L+ + + LSF+ G  F +D S+  FL+RV   E KLR  G WDVPHPWLNLFVP+SRI
Sbjct  333   RKLEALLEELSFVPGFAFVRDASYVQFLDRVGQEEQKLRSAGAWDVPHPWLNLFVPRSRI  392

Query  594   LDFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-RVNE  418
              DF  GVF D +LR  +  G IL+YP N+ RWDDRM+ V P+E+ FY VGLL S+    +
Sbjct  393   HDFAAGVF-DGVLRGTRPVGLILMYPMNRDRWDDRMTTVTPDEDVFYAVGLLRSAVAAGD  451

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
              E L  +NE +L  CD AGI  KQYLPH+ +++ W +HFG KW      KA +DP+ ILS
Sbjct  452   LERLERENEAVLGLCDRAGIGCKQYLPHHASQDGWRRHFGAKWDRVAALKATYDPRAILS  511

Query  237   PGQRIFSQS  211
             PGQ IF  +
Sbjct  512   PGQGIFPAA  520



>ref|NP_181682.1| cytokinin dehydrogenase 1 [Arabidopsis thaliana]
 sp|O22213.1|CKX1_ARATH RecName: Full=Cytokinin dehydrogenase 1; AltName: Full=Cytokinin 
oxidase 1; Short=AtCKX1; Short=CKO 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAB84333.1| putative cytokinin oxidase [Arabidopsis thaliana]
 gb|AEC09992.1| cytokinin dehydrogenase 1 [Arabidopsis thaliana]
Length=575

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 218/431 (51%), Positives = 307/431 (71%), Gaps = 13/431 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  GVV++M SL+    RI          Y DV G E+W+++LR +L
Sbjct  120   ARGHGHSLQGQALAHQGVVIKMESLRSPDIRIYKGKQP----YVDVSGGEIWINILRETL  175

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GL+P SWTDYL+LTVGGTLSNAGISGQ+F++GPQI NV +++++TGKGE++TCS+  N
Sbjct  176   KYGLSPKSWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKRN  235

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             SELFF+VLGGLGQFG+ITRARI L+ AP  VKW+R+LY DF+ F+RDQE+LIS +   DY
Sbjct  236   SELFFSVLGGLGQFGIITRARISLEPAPHMVKWIRVLYSDFSAFSRDQEYLISKEKTFDY  295

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEG +I+ ++   NNWRSSF SP+  +Q +   S+   +Y LE+VKY++ E A+++D+E 
Sbjct  296   VEGFVIINRTDLLNNWRSSF-SPNDSTQASRFKSDGKTLYCLEVVKYFNPEEASSMDQET  354

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
              ++   L++I   +F  +V + +FL+RV   E KLR KG+W+VPHPWLNL +PKS I  F
Sbjct  355   GKLLSELNYIPSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSIYQF  414

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL-----HSSRVN  421
                VF +I+   N  +GPIL+YP N+++W    S + P E+ FY V  L     +SS  N
Sbjct  415   ATEVFNNILTSNN--NGPILIYPVNQSKWKKHTSLITPNEDIFYLVAFLPSAVPNSSGKN  472

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
             + E L  QN+ ++ +C  A + +KQYLPHY+T+++W+ HFGK+W+ F QRK  +DP  IL
Sbjct  473   DLEYLLKQNQRVMNFCAAANLNVKQYLPHYETQKEWKSHFGKRWETFAQRKQAYDPLAIL  532

Query  240   SPGQRIFSQSS  208
             +PGQRIF +++
Sbjct  533   APGQRIFQKTT  543



>ref|XP_008796239.1| PREDICTED: cytokinin dehydrogenase 9-like [Phoenix dactylifera]
Length=528

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/429 (51%), Positives = 306/429 (71%), Gaps = 12/429 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  G+V++M SL+    R+ V  S     Y D  G ELW+DVL  SL
Sbjct  103   ARGHGHSLQGQAQAPGGIVIQMESLREPETRVHVGDSP----YLDASGGELWIDVLLESL  158

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              HGLAP SWTDYL+LTVGGTLSNAGISGQ FR+GPQI+NV ++ V+TG+GE++ CS   N
Sbjct  159   KHGLAPKSWTDYLHLTVGGTLSNAGISGQVFRHGPQISNVHQLQVVTGEGEIVNCSAEEN  218

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             ++LF+ VLGGLGQFG+IT ARI L+ AP  VKW+R+LY DFT FT DQE LIS +   DY
Sbjct  219   ADLFYGVLGGLGQFGIITSARIALEPAPKMVKWIRVLYSDFTSFTEDQEMLISAEKTFDY  278

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             +EG +++ ++   NNWRSSF +P    Q +   S+  I++ LE+ K ++ + +  +++E+
Sbjct  279   IEGFVMINRTGLLNNWRSSF-NPQDPVQASQFNSDGRILFCLEMTKNFNPDESDVMNQEV  337

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
               +   L +I   +F  +VS+ +FL+RV   EVKLR +G+W+VPHPWLNLF+P++RI DF
Sbjct  338   GTLLSKLRYIPSTLFRSEVSYLEFLDRVHVSEVKLRSQGLWEVPHPWLNLFIPRTRIHDF  397

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSSRVN----E  418
                VF  I+   + ++GPIL+YP NK++WD+R SAV+P+EE FY V  L S+  +     
Sbjct  398   AKEVFGKIL--PDSSNGPILLYPLNKSKWDNRTSAVIPDEEVFYLVAFLSSAPPSSDHAS  455

Query  417   WEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLILS  238
              E    QN++IL +C++AGI++KQYLPHY T+E+W+ HFG  W+IF +RKA++DP  IL+
Sbjct  456   LELALKQNDKILDFCEKAGIQVKQYLPHYTTKEEWKAHFGASWEIFARRKAIYDPLAILT  515

Query  237   PGQRIFSQS  211
             PGQRIF ++
Sbjct  516   PGQRIFQKA  524



>ref|XP_010428567.1| PREDICTED: cytokinin dehydrogenase 5 isoform X1 [Camelina sativa]
 ref|XP_010428568.1| PREDICTED: cytokinin dehydrogenase 5 isoform X2 [Camelina sativa]
Length=532

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 242/429 (56%), Positives = 308/429 (72%), Gaps = 13/429 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATA-KDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRAS  1306
             ARGHGHS  GQA A ++GVVVEM+          V   E    Y DV G ELWVDVL+ +
Sbjct  89    ARGHGHSINGQAAAGRNGVVVEMNHGVTGTPEPLVRPDE---LYVDVWGGELWVDVLKKT  145

Query  1305  LPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHI  1126
             L +GLAP SWTDYLYLTVGGTLSNAGISGQ+F +GPQI+NV+EMDV+TGKGE++ CS+  
Sbjct  146   LEYGLAPKSWTDYLYLTVGGTLSNAGISGQAFHHGPQISNVLEMDVVTGKGEVMRCSEEE  205

Query  1125  NSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGL-  949
             N++LF  VLGGLGQ G+ITRARI L+ AP RV+W+R+LY  F  FT DQE+LIS+   L 
Sbjct  206   NTKLFHGVLGGLGQLGIITRARISLEPAPQRVRWIRVLYSSFEVFTEDQEYLISMHGQLK  265

Query  948   -DYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDE  772
              DYVEG +I+ +   NNWRSSFFSP +  +I+S+ SN  ++Y LE+ K Y D  + T+D+
Sbjct  266   FDYVEGFVIVDEGLVNNWRSSFFSPRNPVKISSVSSNGSVLYCLEITKNYHDSDSETVDQ  325

Query  771   ELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRIL  592
             E++ + K L+FI   VF  D+ + DFL+RV   E+KLR K +W+VPHPWLNLFVPKSRI 
Sbjct  326   EVEILMKKLNFIPTSVFTTDLQYVDFLDRVHKAELKLRSKNLWEVPHPWLNLFVPKSRIS  385

Query  591   DFNVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLLHSS-----R  427
             DF+ GVF  I+   NKTSGPIL+YP NK +WD+R SAV P+EE FY V LL S+      
Sbjct  386   DFDKGVFKGIL--GNKTSGPILIYPMNKDKWDERSSAVTPDEEIFYLVALLRSALTDGEE  443

Query  426   VNEWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKL  247
               + E L +QN  IL++C++A I +KQYLPH+ T+E+W  HFG KW  F+  KA FDP+ 
Sbjct  444   TQKLEYLKDQNRRILEFCEQAKINVKQYLPHHATQEEWVAHFGDKWDRFRSLKAEFDPRH  503

Query  246   ILSPGQRIF  220
             IL+ GQRIF
Sbjct  504   ILATGQRIF  512



>ref|XP_006293839.1| hypothetical protein CARUB_v10022823mg [Capsella rubella]
 gb|EOA26737.1| hypothetical protein CARUB_v10022823mg [Capsella rubella]
Length=626

 Score =   465 bits (1197),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 218/432 (50%), Positives = 309/432 (72%), Gaps = 13/432 (3%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLKRNGGRIRVSWSESLGFYADVGGHELWVDVLRASL  1303
             ARGHGHS +GQA A  GVV++M SL+    RI     E    Y DV G ELW+++LR +L
Sbjct  180   ARGHGHSLQGQALAHQGVVIKMESLRSPDIRIY----EGKQPYVDVSGGELWINILRETL  235

Query  1302  PHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKHIN  1123
              +GL+P SWTDYL+LTVGGTLSNAGISGQ+F++GPQI NV +++++TGKGE++TCS+  N
Sbjct  236   KYGLSPKSWTDYLHLTVGGTLSNAGISGQAFKHGPQINNVYQLEIVTGKGEVVTCSEKRN  295

Query  1122  SELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISIDDGLDY  943
             SELF++VLGGLGQFG+ITRARI L+ AP  VKW+R+LY DF+ F+RDQEHLIS +   DY
Sbjct  296   SELFYSVLGGLGQFGIITRARIFLEPAPHMVKWIRVLYSDFSAFSRDQEHLISKEKTFDY  355

Query  942   VEGSLIMTQSPA-NNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETATTIDEEL  766
             VEG +I+ ++   NNWRSSF SP+  +Q +   S+   +Y LE+VKY++ E A+++++E 
Sbjct  356   VEGFVIINRTDLLNNWRSSF-SPNDSTQASKFKSDGKTLYCLEVVKYFNPEEASSMNQET  414

Query  765   QEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPKSRILDF  586
              ++   L++I   +F  +V + +FL+RV   E KLR KG+W+VPHPWLNL +PKS I  F
Sbjct  415   SKLLSELNYIRSTLFSSEVPYIEFLDRVHIAERKLRAKGLWEVPHPWLNLLIPKSSIFRF  474

Query  585   NVGVFVDIILRQNKTSGPILVYPTNKARWDDRMSAVVPEEETFYCVGLL-----HSSRVN  421
                VF +II   N  +GPIL+YP N+++W    S + P E+ FY V  L     +SS  N
Sbjct  475   ATEVFNNIIRSNN--NGPILIYPVNQSKWIKHTSLITPNEDVFYLVAFLPSAVPNSSGKN  532

Query  420   EWEELGNQNEEILKYCDEAGIKIKQYLPHYKTEEDWEKHFGKKWQIFQQRKALFDPKLIL  241
             + E L  QN+ ++ +C  A + +KQYLPHY+T+++W+ HF K+W+ F +RK ++DP  IL
Sbjct  533   DLEYLLKQNQRVMNFCRAANLHVKQYLPHYETQQEWKSHFSKRWETFAERKHVYDPLAIL  592

Query  240   SPGQRIFSQSSS  205
             +PGQRIF ++++
Sbjct  593   APGQRIFQKTTT  604



>gb|KHN06618.1| Cytokinin dehydrogenase 3 [Glycine soja]
Length=433

 Score =   457 bits (1177),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 267/334 (80%), Gaps = 7/334 (2%)
 Frame = -3

Query  1482  ARGHGHSARGQATAKDGVVVEMSSLK--RNGGRIRVSWSESLGFYADVGGHELWVDVLRA  1309
             ARG GHS  GQA A+DGVVV+M++L+  RNG  I VS    +G YADVGG +LW+DVL  
Sbjct  100   ARGQGHSTHGQAMARDGVVVDMANLRKQRNGVAISVSKDPLMGHYADVGGEQLWIDVLHT  159

Query  1308  SLPHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQIANVIEMDVITGKGELITCSKH  1129
             +L HGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQI+NV EMDVITGKGE +TCS  
Sbjct  160   TLKHGLAPVSWTDYLYLTVGGTLSNAGISGQSFRYGPQISNVHEMDVITGKGEFVTCSSQ  219

Query  1128  INSELFFAVLGGLGQFGVITRARIVLDKAPTRVKWVRMLYDDFTKFTRDQEHLISID---  958
              N ELF AVLGGLGQFGVI RARI L+ AP RVKWVR+LY DF  FT+DQE LISI+   
Sbjct  220   KNLELFHAVLGGLGQFGVIARARIALEPAPKRVKWVRLLYSDFFAFTKDQERLISINGRK  279

Query  957   --DGLDYVEGSLIMTQSPANNWRSSFFSPSHQSQIASLISNHGIIYSLELVKYYDDETAT  784
               + LD++EG L+M Q P NNWRSSFF  S   +I+SLI+ H I+Y LE+ KYYD++T  
Sbjct  280   QKNALDFLEGMLLMNQGPINNWRSSFFPLSDHPRISSLITEHSILYCLEVAKYYDEQTEI  339

Query  783   TIDEELQEMFKGLSFIGGLVFEKDVSFFDFLNRVRSGEVKLRQKGMWDVPHPWLNLFVPK  604
              +D+E+Q + +GL++I G  +EK+VS+ +FLNRVRSGE+KL+ +G+WDVPHPWLNLF+PK
Sbjct  340   NVDKEIQVLLQGLAYIPGFYYEKNVSYVEFLNRVRSGELKLQSQGLWDVPHPWLNLFIPK  399

Query  603   SRILDFNVGVFVDIILRQNKTSGPILVYPTNKAR  502
             S+ILDFN  VF DI+L++N +SGP+LVYPTN+ +
Sbjct  400   SQILDFNSRVFKDIVLKRNISSGPVLVYPTNRNK  433



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4054079720394