BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33093_g1_i1 len=1749 path=[1727:0-1748]

Length=1749
                                                                      Score     E

ref|XP_009610758.1|  PREDICTED: putative receptor-like protein ki...    643   0.0      
ref|XP_009769768.1|  PREDICTED: serine/threonine-protein kinase A...    640   0.0      
gb|AAP03880.2|  Avr9/Cf-9 induced kinase 1                              638   0.0      Nicotiana tabacum [American tobacco]
emb|CDP03082.1|  unnamed protein product                                619   0.0      
ref|XP_006355769.1|  PREDICTED: putative receptor-like protein ki...    617   0.0      
ref|XP_009596087.1|  PREDICTED: serine/threonine-protein kinase A...    615   0.0      
ref|XP_004243705.1|  PREDICTED: serine/threonine-protein kinase A...    613   0.0      
ref|XP_004239317.1|  PREDICTED: putative receptor-like protein ki...    610   0.0      
ref|XP_009777205.1|  PREDICTED: serine/threonine-protein kinase A...    611   0.0      
ref|XP_006342386.1|  PREDICTED: putative receptor-like protein ki...    609   0.0      
ref|XP_002277991.1|  PREDICTED: serine/threonine-protein kinase A...    599   0.0      Vitis vinifera
ref|XP_010090162.1|  Serine/threonine-protein kinase                    598   0.0      
ref|XP_011046009.1|  PREDICTED: serine/threonine-protein kinase A...    593   0.0      
ref|XP_006381619.1|  kinase family protein                              590   0.0      
ref|XP_011094012.1|  PREDICTED: serine/threonine-protein kinase A...    588   0.0      
ref|XP_002516271.1|  Protein kinase APK1B, chloroplast precursor,...    588   0.0      Ricinus communis
gb|KHN12282.1|  Serine/threonine-protein kinase                         588   0.0      
ref|XP_008242244.1|  PREDICTED: serine/threonine-protein kinase A...    587   0.0      
ref|XP_010049350.1|  PREDICTED: serine/threonine-protein kinase A...    587   0.0      
ref|XP_003533786.2|  PREDICTED: serine/threonine-protein kinase A...    587   0.0      
ref|XP_007154576.1|  hypothetical protein PHAVU_003G130400g             585   0.0      
ref|XP_004287640.1|  PREDICTED: putative receptor-like protein ki...    583   0.0      
ref|XP_003547504.1|  PREDICTED: serine/threonine-protein kinase A...    583   0.0      
ref|XP_010047471.1|  PREDICTED: serine/threonine-protein kinase A...    582   0.0      
ref|XP_010049411.1|  PREDICTED: serine/threonine-protein kinase A...    581   0.0      
gb|KDO73907.1|  hypothetical protein CISIN_1g012832mg                   581   0.0      
ref|XP_004507998.1|  PREDICTED: putative receptor-like protein ki...    583   0.0      
ref|XP_007203720.1|  hypothetical protein PRUPE_ppa019028mg             578   0.0      
gb|KHN06069.1|  Serine/threonine-protein kinase                         581   0.0      
ref|XP_011078207.1|  PREDICTED: serine/threonine-protein kinase A...    578   0.0      
ref|XP_006474726.1|  PREDICTED: serine/threonine-protein kinase A...    580   0.0      
ref|XP_003542362.1|  PREDICTED: putative receptor-like protein ki...    578   0.0      
gb|KEH32432.1|  receptor-like kinase                                    580   0.0      
ref|XP_006452809.1|  hypothetical protein CICLE_v10008248mg             577   0.0      
ref|XP_008337855.1|  PREDICTED: serine/threonine-protein kinase A...    578   0.0      
ref|XP_009359732.1|  PREDICTED: serine/threonine-protein kinase A...    577   0.0      
gb|KDP33918.1|  hypothetical protein JCGZ_07489                         576   0.0      
ref|NP_001238581.1|  kinase-like protein                                575   0.0      
gb|KHG00343.1|  hypothetical protein F383_18271                         574   0.0      
ref|XP_007012630.1|  Kinase superfamily protein                         573   0.0      
ref|NP_178651.1|  RPM1-induced protein kinase                           573   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885808.1|  hypothetical protein ARALYDRAFT_899389             572   0.0      
ref|XP_006297624.1|  hypothetical protein CARUB_v10013644mg             568   0.0      
ref|XP_010467109.1|  PREDICTED: serine/threonine-protein kinase A...    568   0.0      
ref|XP_010488784.1|  PREDICTED: serine/threonine-protein kinase A...    567   0.0      
ref|XP_010412805.1|  PREDICTED: serine/threonine-protein kinase A...    567   0.0      
ref|XP_008459841.1|  PREDICTED: serine/threonine-protein kinase A...    563   0.0      
gb|KGN60504.1|  hypothetical protein Csa_2G000130                       563   0.0      
ref|XP_004141072.1|  PREDICTED: putative receptor-like protein ki...    561   0.0      
ref|XP_004157966.1|  PREDICTED: putative receptor-like protein ki...    560   0.0      
ref|XP_010666301.1|  PREDICTED: serine/threonine-protein kinase A...    564   0.0      
ref|XP_010488785.1|  PREDICTED: serine/threonine-protein kinase A...    562   0.0      
gb|EPS67912.1|  hypothetical protein M569_06861                         559   0.0      
gb|KFK39885.1|  hypothetical protein AALP_AA3G301300                    562   0.0      
gb|KHG27920.1|  hypothetical protein F383_06954                         561   0.0      
ref|XP_010533019.1|  PREDICTED: serine/threonine-protein kinase A...    560   0.0      
ref|XP_010273843.1|  PREDICTED: serine/threonine-protein kinase A...    560   0.0      
ref|XP_006396126.1|  hypothetical protein EUTSA_v10002520mg             556   0.0      
gb|KHG16004.1|  hypothetical protein F383_02714                         554   0.0      
ref|XP_004488084.1|  PREDICTED: putative receptor-like protein ki...    553   0.0      
ref|XP_004144034.1|  PREDICTED: serine/threonine-protein kinase A...    549   0.0      
ref|XP_009102353.1|  PREDICTED: serine/threonine-protein kinase A...    550   0.0      
emb|CDY33401.1|  BnaA07g04380D                                          550   0.0      
emb|CDY65349.1|  BnaCnng46760D                                          549   0.0      
gb|KFK22322.1|  hypothetical protein AALP_AAs55656U000100               548   0.0      
ref|XP_010261848.1|  PREDICTED: serine/threonine-protein kinase A...    549   0.0      
ref|XP_003595279.1|  Kinase-like protein                                551   0.0      
ref|XP_002280196.1|  PREDICTED: serine/threonine-protein kinase A...    546   0.0      Vitis vinifera
ref|XP_010541992.1|  PREDICTED: serine/threonine-protein kinase A...    541   0.0      
ref|XP_006395963.1|  hypothetical protein EUTSA_v10004211mg             541   0.0      
ref|XP_009124269.1|  PREDICTED: serine/threonine-protein kinase A...    540   0.0      
ref|XP_009409118.1|  PREDICTED: serine/threonine-protein kinase A...    538   0.0      
ref|XP_009762767.1|  PREDICTED: putative receptor-like protein ki...    535   0.0      
ref|XP_006282611.1|  hypothetical protein CARUB_v10004829mg             533   0.0      
ref|XP_010450389.1|  PREDICTED: serine/threonine-protein kinase A...    533   0.0      
ref|XP_010440738.1|  PREDICTED: serine/threonine-protein kinase A...    532   0.0      
ref|XP_010435442.1|  PREDICTED: serine/threonine-protein kinase A...    532   0.0      
ref|XP_008802464.1|  PREDICTED: serine/threonine-protein kinase A...    530   0.0      
ref|XP_006452974.1|  hypothetical protein CICLE_v10010608mg             527   7e-180   
ref|XP_011072653.1|  PREDICTED: putative receptor-like protein ki...    528   1e-179   
ref|XP_011019325.1|  PREDICTED: serine/threonine-protein kinase A...    525   7e-179   
ref|XP_011036441.1|  PREDICTED: putative receptor-like protein ki...    525   1e-178   
ref|XP_002309457.2|  hypothetical protein POPTR_0006s23590g             525   1e-178   Populus trichocarpa [western balsam poplar]
ref|XP_007012454.1|  Root-specific kinase 1                             524   2e-178   
ref|XP_009612481.1|  PREDICTED: putative receptor-like protein ki...    525   2e-178   
gb|EYU28327.1|  hypothetical protein MIMGU_mgv1a006430mg                524   2e-178   
ref|XP_002868426.1|  hypothetical protein ARALYDRAFT_355547             524   3e-178   
ref|XP_011035727.1|  PREDICTED: putative receptor-like protein ki...    524   3e-178   
gb|KDO73664.1|  hypothetical protein CISIN_1g040050mg                   521   4e-178   
ref|XP_009419910.1|  PREDICTED: serine/threonine-protein kinase A...    523   5e-178   
ref|NP_001234561.1|  auxin-regulated dual specificity cytosolic k...    523   6e-178   
ref|XP_002304131.1|  hypothetical protein POPTR_0003s06450g             522   1e-177   Populus trichocarpa [western balsam poplar]
ref|XP_008778596.1|  PREDICTED: serine/threonine-protein kinase A...    521   2e-177   
ref|XP_006369136.1|  hypothetical protein POPTR_0001s16810g             521   3e-177   
emb|CDO97843.1|  unnamed protein product                                523   3e-177   
ref|XP_008782588.1|  PREDICTED: serine/threonine-protein kinase A...    521   4e-177   
ref|XP_006357404.1|  PREDICTED: putative receptor-like protein ki...    520   1e-176   
ref|XP_006474675.1|  PREDICTED: putative receptor-like protein ki...    518   2e-176   
ref|XP_009390860.1|  PREDICTED: serine/threonine-protein kinase A...    519   2e-176   
ref|XP_010937336.1|  PREDICTED: serine/threonine-protein kinase A...    518   4e-176   
gb|KHG06741.1|  hypothetical protein F383_33276                         517   4e-176   
gb|KDP34015.1|  hypothetical protein JCGZ_07586                         516   2e-175   
ref|XP_010939901.1|  PREDICTED: serine/threonine-protein kinase A...    516   2e-175   
ref|XP_004498840.1|  PREDICTED: putative receptor-like protein ki...    513   4e-175   
ref|XP_006849707.1|  hypothetical protein AMTR_s00024p00242070          514   9e-175   
ref|XP_009408404.1|  PREDICTED: serine/threonine-protein kinase A...    514   9e-175   
ref|XP_009390859.1|  PREDICTED: serine/threonine-protein kinase A...    514   1e-174   
dbj|BAB09992.1|  serine/threonine protein kinase-like                   515   2e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521318.1|  Protein kinase APK1B, chloroplast precursor,...    514   2e-174   Ricinus communis
gb|KHN20154.1|  Putative receptor-like protein kinase                   511   2e-174   
ref|XP_010917227.1|  PREDICTED: serine/threonine-protein kinase A...    513   4e-174   
ref|NP_198408.2|  Ser/Thr protein kinase ACIK1b                         515   4e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009599916.1|  PREDICTED: putative receptor-like protein ki...    514   5e-174   
ref|XP_002516154.1|  Protein kinase APK1A, chloroplast precursor,...    513   7e-174   Ricinus communis
ref|XP_009403379.1|  PREDICTED: serine/threonine-protein kinase A...    510   5e-173   
ref|XP_003588903.1|  Protein kinase 2B                                  508   7e-173   
ref|XP_010086797.1|  Putative receptor-like protein kinase              510   8e-173   
gb|KHN05281.1|  Serine/threonine-protein kinase                         507   1e-172   
dbj|BAD94092.1|  serine/threonine protein kinase-like                   511   2e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544585.2|  PREDICTED: putative receptor-like protein ki...    506   2e-172   
gb|EYU21319.1|  hypothetical protein MIMGU_mgv1a006343mg                508   3e-172   
dbj|BAO45889.1|  receptor-like protein kinase                           506   3e-172   
gb|KDP40693.1|  hypothetical protein JCGZ_24692                         507   1e-171   
ref|XP_009402133.1|  PREDICTED: serine/threonine-protein kinase A...    505   2e-171   
ref|XP_010098385.1|  Serine/threonine-protein kinase                    504   8e-171   
ref|XP_002272911.2|  PREDICTED: serine/threonine-protein kinase A...    504   9e-171   Vitis vinifera
ref|XP_009414115.1|  PREDICTED: serine/threonine-protein kinase A...    504   9e-171   
ref|XP_007216399.1|  hypothetical protein PRUPE_ppa022600mg             505   1e-170   
ref|XP_004305755.1|  PREDICTED: putative receptor-like protein ki...    503   3e-170   
ref|XP_007161127.1|  hypothetical protein PHAVU_001G044900g             501   3e-170   
ref|XP_008228357.1|  PREDICTED: putative receptor-like protein ki...    503   5e-170   
gb|KHG16114.1|  hypothetical protein F383_07817                         501   5e-170   
ref|XP_004252518.1|  PREDICTED: putative receptor-like protein ki...    501   6e-170   
ref|XP_006361336.1|  PREDICTED: putative receptor-like protein ki...    501   1e-169   
ref|XP_008220586.1|  PREDICTED: serine/threonine-protein kinase A...    499   1e-169   
ref|XP_003603231.1|  Kinase-like protein                                498   4e-169   
emb|CAN77773.1|  hypothetical protein VITISV_021885                     499   1e-168   Vitis vinifera
ref|XP_004501421.1|  PREDICTED: putative receptor-like protein ki...    496   2e-168   
ref|XP_010932408.1|  PREDICTED: serine/threonine-protein kinase A...    497   3e-168   
ref|XP_010064028.1|  PREDICTED: putative receptor-like protein ki...    498   9e-168   
ref|XP_007223042.1|  hypothetical protein PRUPE_ppa006919mg             493   4e-167   
ref|XP_003527759.1|  PREDICTED: serine/threonine-protein kinase A...    493   4e-167   
gb|KHN32159.1|  Serine/threonine-protein kinase                         491   2e-166   
ref|XP_004303452.1|  PREDICTED: serine/threonine-protein kinase A...    492   3e-166   
ref|XP_007136897.1|  hypothetical protein PHAVU_009G083300g             491   4e-166   
ref|XP_003528552.1|  PREDICTED: putative receptor-like protein ki...    493   5e-166   
ref|XP_003547753.1|  PREDICTED: putative receptor-like protein ki...    489   1e-164   
ref|XP_009375471.1|  PREDICTED: putative receptor-like protein ki...    489   2e-164   
ref|XP_009362909.1|  PREDICTED: serine/threonine-protein kinase A...    486   2e-164   
gb|ABR16273.1|  unknown                                                 488   3e-164   Picea sitchensis
ref|XP_007024642.1|  Kinase superfamily protein                         488   4e-164   
ref|XP_008342636.1|  PREDICTED: putative receptor-like protein ki...    488   6e-164   
ref|XP_010548490.1|  PREDICTED: serine/threonine-protein kinase A...    486   6e-164   
ref|XP_009414114.1|  PREDICTED: serine/threonine-protein kinase A...    488   8e-164   
ref|XP_003523655.1|  PREDICTED: serine/threonine-protein kinase A...    483   2e-163   
emb|CAN82003.1|  hypothetical protein VITISV_023198                     485   4e-163   Vitis vinifera
ref|NP_001235224.1|  Avr9/Cf-9 induced kinase                           479   7e-163   
gb|KDP40692.1|  hypothetical protein JCGZ_24691                         482   2e-162   
ref|XP_007135433.1|  hypothetical protein PHAVU_010G129000g             484   2e-162   
ref|XP_004510479.1|  PREDICTED: putative receptor-like protein ki...    484   2e-162   
ref|XP_002461008.1|  hypothetical protein SORBIDRAFT_02g039110          483   3e-162   Sorghum bicolor [broomcorn]
ref|XP_004985497.1|  PREDICTED: serine/threonine-protein kinase A...    482   3e-162   
ref|XP_008393577.1|  PREDICTED: serine/threonine-protein kinase A...    481   4e-162   
ref|XP_009337171.1|  PREDICTED: serine/threonine-protein kinase A...    480   8e-162   
ref|XP_010685306.1|  PREDICTED: putative receptor-like protein ki...    481   1e-161   
ref|XP_003558674.1|  PREDICTED: serine/threonine-protein kinase A...    481   1e-161   
ref|NP_001064525.1|  Os10g0395000                                       479   1e-161   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008653340.1|  PREDICTED: serine/threonine-protein kinase A...    480   7e-161   
gb|AAP12978.1|  putative serine/threonine protein kinase                479   8e-161   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009800306.1|  PREDICTED: serine/threonine-protein kinase A...    479   8e-161   
gb|EEC75449.1|  hypothetical protein OsI_11987                          479   8e-161   Oryza sativa Indica Group [Indian rice]
ref|NP_001049156.1|  Os03g0179400                                       477   4e-160   Oryza sativa Japonica Group [Japonica rice]
ref|NP_180197.1|  root-specific kinase 1                                476   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001050336.1|  Os03g0407900                                       479   5e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561556.1|  PREDICTED: serine/threonine-protein kinase A...    477   1e-159   
ref|XP_009600575.1|  PREDICTED: serine/threonine-protein kinase A...    476   1e-159   
ref|XP_004245036.1|  PREDICTED: serine/threonine-protein kinase A...    475   2e-159   
ref|XP_008377919.1|  PREDICTED: serine/threonine-protein kinase A...    474   2e-159   
ref|XP_006426670.1|  hypothetical protein CICLE_v10025595mg             476   2e-159   
ref|XP_006353843.1|  PREDICTED: serine/threonine-protein kinase A...    474   4e-159   
ref|XP_006294280.1|  hypothetical protein CARUB_v10023277mg             474   5e-159   
ref|XP_006368257.1|  kinase family protein                              473   1e-158   
ref|XP_004958293.1|  PREDICTED: serine/threonine-protein kinase A...    473   2e-158   
ref|XP_011018376.1|  PREDICTED: serine/threonine-protein kinase A...    471   3e-158   
ref|XP_008651532.1|  PREDICTED: serine/threonine-protein kinase A...    472   6e-158   
ref|XP_006465910.1|  PREDICTED: putative receptor-like protein ki...    471   1e-157   
ref|XP_004954103.1|  PREDICTED: serine/threonine-protein kinase A...    470   2e-157   
ref|XP_002880775.1|  root-specific kinase 1                             469   4e-157   
ref|XP_003627303.1|  Kinase-like protein                                471   5e-157   
ref|XP_006649093.1|  PREDICTED: serine/threonine-protein kinase A...    469   6e-157   
ref|XP_010417417.1|  PREDICTED: serine/threonine-protein kinase A...    468   8e-157   
dbj|BAJ94670.1|  predicted protein                                      469   8e-157   
ref|XP_009140739.1|  PREDICTED: serine/threonine-protein kinase A...    468   1e-156   
ref|XP_010244204.1|  PREDICTED: serine/threonine-protein kinase A...    467   1e-156   
dbj|BAK01570.1|  predicted protein                                      468   2e-156   
ref|XP_010429651.1|  PREDICTED: serine/threonine-protein kinase A...    467   3e-156   
ref|XP_008442306.1|  PREDICTED: serine/threonine-protein kinase A...    467   3e-156   
ref|XP_002519898.1|  receptor serine-threonine protein kinase, pu...    466   3e-156   Ricinus communis
ref|XP_010112273.1|  Serine/threonine-protein kinase                    467   3e-156   
gb|KDP39727.1|  hypothetical protein JCGZ_02747                         466   3e-156   
ref|XP_006651489.1|  PREDICTED: serine/threonine-protein kinase A...    470   4e-156   
gb|EAY88776.1|  hypothetical protein OsI_10252                          467   6e-156   Oryza sativa Indica Group [Indian rice]
ref|XP_009410482.1|  PREDICTED: serine/threonine-protein kinase A...    465   8e-156   
gb|KDO46394.1|  hypothetical protein CISIN_1g014736mg                   465   8e-156   
ref|XP_006661741.1|  PREDICTED: serine/threonine-protein kinase A...    464   9e-156   
ref|XP_009410484.1|  PREDICTED: serine/threonine-protein kinase A...    464   1e-155   
ref|XP_007161128.1|  hypothetical protein PHAVU_001G044900g             463   1e-155   
ref|XP_011018915.1|  PREDICTED: serine/threonine-protein kinase A...    465   2e-155   
ref|XP_009388437.1|  PREDICTED: serine/threonine-protein kinase A...    464   2e-155   
ref|XP_004984060.1|  PREDICTED: serine/threonine-protein kinase A...    466   2e-155   
ref|XP_009370852.1|  PREDICTED: serine/threonine-protein kinase A...    464   2e-155   
ref|XP_004137666.1|  PREDICTED: serine/threonine-protein kinase A...    464   2e-155   
gb|AAO13471.1|  Putative serine/threonine protein kinase                465   2e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004160326.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    464   2e-155   
ref|XP_006432865.1|  hypothetical protein CICLE_v10003320mg             464   3e-155   
emb|CBI20734.3|  unnamed protein product                                463   3e-155   
ref|XP_003516498.1|  PREDICTED: serine/threonine-protein kinase A...    464   3e-155   
ref|XP_006586718.1|  PREDICTED: serine/threonine-protein kinase A...    464   3e-155   
gb|EAZ24810.1|  hypothetical protein OsJ_08589                          465   4e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010931422.1|  PREDICTED: serine/threonine-protein kinase A...    463   4e-155   
ref|NP_001240045.1|  serine/threonine-protein kinase At5g01020-like     464   4e-155   
ref|XP_010537625.1|  PREDICTED: putative receptor-like protein ki...    464   5e-155   
gb|EAY87739.1|  hypothetical protein OsI_09153                          464   6e-155   Oryza sativa Indica Group [Indian rice]
ref|XP_008388407.1|  PREDICTED: serine/threonine-protein kinase A...    463   7e-155   
ref|XP_009383280.1|  PREDICTED: serine/threonine-protein kinase A...    462   7e-155   
ref|XP_003612555.1|  Protein kinase 2B                                  463   7e-155   
ref|XP_002519978.1|  Protein kinase APK1B, chloroplast precursor,...    467   7e-155   Ricinus communis
ref|XP_003572269.1|  PREDICTED: serine/threonine-protein kinase A...    465   8e-155   
ref|XP_008370313.1|  PREDICTED: serine/threonine-protein kinase A...    462   1e-154   
ref|XP_010693043.1|  PREDICTED: serine/threonine-protein kinase A...    464   1e-154   
ref|XP_006362327.1|  PREDICTED: serine/threonine-protein kinase A...    462   1e-154   
ref|XP_003559971.1|  PREDICTED: serine/threonine-protein kinase A...    463   1e-154   
ref|XP_009381351.1|  PREDICTED: serine/threonine-protein kinase A...    462   1e-154   
ref|XP_010553184.1|  PREDICTED: serine/threonine-protein kinase A...    461   2e-154   
ref|XP_010044463.1|  PREDICTED: serine/threonine-protein kinase A...    462   2e-154   
ref|XP_007158107.1|  hypothetical protein PHAVU_002G124700g             461   3e-154   
ref|XP_006842637.1|  hypothetical protein AMTR_s00077p00187600          461   3e-154   
ref|XP_009337839.1|  PREDICTED: serine/threonine-protein kinase A...    461   4e-154   
ref|XP_007205277.1|  hypothetical protein PRUPE_ppa006509mg             461   4e-154   
ref|XP_010278903.1|  PREDICTED: serine/threonine-protein kinase A...    461   4e-154   
gb|AFW68830.1|  putative protein kinase superfamily protein             459   4e-154   
ref|XP_006408732.1|  hypothetical protein EUTSA_v10002290mg             461   5e-154   
ref|XP_006381288.1|  hypothetical protein POPTR_0006s11430g             461   5e-154   
ref|XP_002265437.1|  PREDICTED: serine/threonine-protein kinase A...    461   6e-154   Vitis vinifera
gb|KDP21817.1|  hypothetical protein JCGZ_00604                         461   7e-154   
ref|XP_004249015.1|  PREDICTED: serine/threonine-protein kinase A...    460   9e-154   
ref|XP_007040918.1|  Kinase superfamily protein                         460   9e-154   
ref|XP_011006228.1|  PREDICTED: serine/threonine-protein kinase A...    461   9e-154   
ref|XP_008244257.1|  PREDICTED: serine/threonine-protein kinase A...    460   1e-153   
ref|XP_008681384.1|  PREDICTED: uncharacterized LOC100272518 isof...    459   1e-153   
ref|XP_008804652.1|  PREDICTED: serine/threonine-protein kinase A...    459   1e-153   
ref|XP_010922836.1|  PREDICTED: serine/threonine-protein kinase A...    459   1e-153   
ref|XP_008802984.1|  PREDICTED: serine/threonine-protein kinase A...    459   1e-153   
ref|XP_011077494.1|  PREDICTED: serine/threonine-protein kinase A...    460   1e-153   
gb|KGN58674.1|  hypothetical protein Csa_3G727920                       464   2e-153   
ref|XP_004512358.1|  PREDICTED: serine/threonine-protein kinase A...    459   2e-153   
ref|XP_010922837.1|  PREDICTED: serine/threonine-protein kinase A...    459   2e-153   
emb|CDP16592.1|  unnamed protein product                                459   2e-153   
ref|XP_011027996.1|  PREDICTED: serine/threonine-protein kinase A...    459   3e-153   
gb|EMT28350.1|  Putative serine/threonine-protein kinase NAK            459   4e-153   
gb|EEC82434.1|  hypothetical protein OsI_26847                          460   5e-153   Oryza sativa Indica Group [Indian rice]
ref|NP_001060256.1|  Os07g0613500                                       460   5e-153   Oryza sativa Japonica Group [Japonica rice]
emb|CAQ58633.1|  ATP binding / serine-threonine kinase                  458   5e-153   Vitis vinifera
ref|XP_003534620.1|  PREDICTED: serine/threonine-protein kinase A...    459   5e-153   
ref|XP_009606105.1|  PREDICTED: serine/threonine-protein kinase A...    458   5e-153   
ref|XP_009606106.1|  PREDICTED: serine/threonine-protein kinase A...    458   5e-153   
ref|XP_007032291.1|  Kinase superfamily protein isoform 2               457   6e-153   
gb|AFK33487.1|  unknown                                                 459   6e-153   
ref|XP_009801690.1|  PREDICTED: serine/threonine-protein kinase A...    458   8e-153   
ref|XP_008238029.1|  PREDICTED: serine/threonine-protein kinase A...    457   9e-153   
ref|XP_004302496.1|  PREDICTED: serine/threonine-protein kinase A...    457   9e-153   
ref|XP_010933044.1|  PREDICTED: serine/threonine-protein kinase A...    457   1e-152   
gb|EYU26700.1|  hypothetical protein MIMGU_mgv1a006846mg                458   1e-152   
gb|KFK24698.1|  hypothetical protein AALP_AA8G013200                    457   1e-152   
ref|XP_003578188.1|  PREDICTED: serine/threonine-protein kinase A...    459   1e-152   
ref|XP_006602747.1|  PREDICTED: serine/threonine-protein kinase A...    458   1e-152   
gb|EMT28626.1|  Putative serine/threonine-protein kinase NAK            458   1e-152   
ref|XP_004492609.1|  PREDICTED: serine/threonine-protein kinase A...    458   1e-152   
gb|EMT16881.1|  Putative serine/threonine-protein kinase NAK            458   2e-152   
ref|XP_007140016.1|  hypothetical protein PHAVU_008G077200g             457   2e-152   
ref|XP_002303478.1|  kinase family protein                              456   2e-152   
ref|XP_003623694.1|  Protein kinase 2B                                  457   2e-152   
ref|XP_002265959.2|  PREDICTED: serine/threonine-protein kinase A...    456   3e-152   
ref|XP_004983114.1|  PREDICTED: serine/threonine-protein kinase A...    454   4e-152   
ref|XP_002872982.1|  kinase family protein                              456   4e-152   
ref|XP_004300399.1|  PREDICTED: serine/threonine-protein kinase A...    456   4e-152   
ref|XP_002438022.1|  hypothetical protein SORBIDRAFT_10g006630          457   5e-152   
ref|XP_010424023.1|  PREDICTED: serine/threonine-protein kinase A...    455   5e-152   
emb|CDP06356.1|  unnamed protein product                                457   5e-152   
ref|XP_008681383.1|  PREDICTED: uncharacterized LOC100272518 isof...    455   6e-152   
emb|CDX72925.1|  BnaC06g33730D                                          457   6e-152   
ref|NP_195722.2|  serine/threonine-protein kinase                       455   6e-152   
ref|XP_006651097.1|  PREDICTED: serine/threonine-protein kinase A...    454   7e-152   
ref|XP_006429669.1|  hypothetical protein CICLE_v10011776mg             456   8e-152   
ref|XP_006398549.1|  hypothetical protein EUTSA_v10013688mg             454   9e-152   
ref|XP_003577860.1|  PREDICTED: serine/threonine-protein kinase A...    454   9e-152   
ref|XP_003579009.1|  PREDICTED: serine/threonine-protein kinase A...    454   1e-151   
ref|XP_006279336.1|  hypothetical protein CARUB_v10012732mg             454   1e-151   
ref|XP_010050427.1|  PREDICTED: serine/threonine-protein kinase A...    452   1e-151   
ref|XP_002441774.1|  hypothetical protein SORBIDRAFT_08g002100          454   2e-151   
dbj|BAK05812.1|  predicted protein                                      454   2e-151   
gb|KHN41751.1|  Serine/threonine-protein kinase                         454   3e-151   
ref|XP_010056140.1|  PREDICTED: serine/threonine-protein kinase A...    453   5e-151   
emb|CDY68189.1|  BnaCnng57950D                                          451   6e-151   
ref|XP_002454653.1|  hypothetical protein SORBIDRAFT_04g034840          454   7e-151   
ref|XP_007211110.1|  hypothetical protein PRUPE_ppa024820mg             452   7e-151   
ref|XP_004964946.1|  PREDICTED: serine/threonine-protein kinase A...    454   8e-151   
gb|EYU26701.1|  hypothetical protein MIMGU_mgv1a006846mg                453   8e-151   
ref|XP_007032290.1|  Kinase superfamily protein isoform 1               452   1e-150   
ref|XP_004956941.1|  PREDICTED: serine/threonine-protein kinase A...    454   1e-150   
emb|CDX83496.1|  BnaA03g20100D                                          452   1e-150   
ref|XP_009133583.1|  PREDICTED: serine/threonine-protein kinase A...    451   1e-150   
ref|XP_006662686.1|  PREDICTED: serine/threonine-protein kinase A...    452   1e-150   
ref|XP_009104852.1|  PREDICTED: putative receptor-like protein ki...    451   1e-150   
ref|XP_011082139.1|  PREDICTED: serine/threonine-protein kinase A...    452   1e-150   
ref|XP_002888882.1|  predicted protein                                  453   2e-150   
gb|EYU37458.1|  hypothetical protein MIMGU_mgv1a006653mg                452   2e-150   
gb|EPS64243.1|  hypothetical protein M569_10538                         451   2e-150   
gb|AFW85410.1|  putative protein kinase superfamily protein             452   3e-150   
dbj|BAK03276.1|  predicted protein                                      452   3e-150   
ref|NP_177398.1|  putative receptor-like protein kinase                 452   3e-150   
emb|CDX96417.1|  BnaA07g30280D                                          452   4e-150   
ref|XP_010685307.1|  PREDICTED: putative receptor-like protein ki...    452   6e-150   
ref|XP_009105915.1|  PREDICTED: putative receptor-like protein ki...    451   8e-150   
ref|XP_008462296.1|  PREDICTED: putative receptor-like protein ki...    450   1e-149   
ref|XP_006301468.1|  hypothetical protein CARUB_v10021890mg             451   1e-149   
ref|XP_010428142.1|  PREDICTED: putative receptor-like protein ki...    451   1e-149   
emb|CDX68261.1|  BnaA07g23010D                                          449   1e-149   
gb|AFW64652.1|  putative protein kinase superfamily protein             447   2e-149   
emb|CAN69043.1|  hypothetical protein VITISV_022341                     449   2e-149   
ref|NP_001140687.1|  uncharacterized LOC100272762                       449   2e-149   
ref|NP_001149711.1|  serine/threonine-protein kinase NAK                448   2e-149   
ref|XP_006390647.1|  hypothetical protein EUTSA_v10018537mg             450   2e-149   
dbj|BAJ90477.1|  predicted protein                                      450   3e-149   
gb|EMT26195.1|  Putative serine/threonine-protein kinase NAK            450   3e-149   
ref|NP_001065612.1|  Os11g0121400                                       447   5e-149   
gb|ACN35685.1|  unknown                                                 448   7e-149   
gb|EEC68754.1|  hypothetical protein OsI_37277                          447   8e-149   
ref|XP_002450171.1|  hypothetical protein SORBIDRAFT_05g001450          447   9e-149   
ref|XP_004141814.1|  PREDICTED: putative receptor-like protein ki...    446   2e-148   
gb|EAZ44891.1|  hypothetical protein OsJ_29532                          446   2e-148   
ref|XP_006661281.1|  PREDICTED: serine/threonine-protein kinase A...    446   2e-148   
dbj|BAK01485.1|  predicted protein                                      447   2e-148   
ref|XP_009127940.1|  PREDICTED: putative receptor-like protein ki...    447   2e-148   
emb|CDY65019.1|  BnaCnng45720D                                          445   2e-148   
ref|XP_009343208.1|  PREDICTED: serine/threonine-protein kinase A...    446   3e-148   
ref|XP_006655891.1|  PREDICTED: serine/threonine-protein kinase A...    446   3e-148   
ref|XP_010471281.1|  PREDICTED: putative receptor-like protein ki...    447   3e-148   
ref|XP_009801603.1|  PREDICTED: serine/threonine-protein kinase A...    446   4e-148   
ref|XP_006658806.1|  PREDICTED: serine/threonine-protein kinase A...    444   4e-148   
gb|KGN45483.1|  hypothetical protein Csa_7G449430                       446   6e-148   
ref|XP_003570518.1|  PREDICTED: serine/threonine-protein kinase A...    445   6e-148   
ref|NP_001066022.2|  Os12g0121100                                       443   7e-148   
gb|KFK41680.1|  hypothetical protein AALP_AA2G158900                    446   7e-148   
gb|EAZ09264.1|  hypothetical protein OsI_31537                          446   8e-148   
gb|EEE52663.1|  hypothetical protein OsJ_35037                          444   8e-148   
ref|NP_001063288.1|  Os09g0442100                                       446   1e-147   
ref|XP_008373497.1|  PREDICTED: serine/threonine-protein kinase A...    445   1e-147   
ref|XP_002444473.1|  hypothetical protein SORBIDRAFT_07g022410          447   1e-147   
ref|XP_002462457.1|  hypothetical protein SORBIDRAFT_02g025910          446   1e-147   
ref|NP_001057083.1|  Os06g0202900                                       444   2e-147   
ref|XP_009598888.1|  PREDICTED: serine/threonine-protein kinase A...    444   2e-147   
ref|XP_002464678.1|  hypothetical protein SORBIDRAFT_01g023180          439   4e-147   
emb|CAB99493.1|  protein kinase-like protein                            442   6e-147   
ref|XP_008451906.1|  PREDICTED: serine/threonine-protein kinase A...    442   8e-147   
ref|NP_176353.1|  putative receptor-like cytoplasmic kinase             442   1e-146   
ref|NP_001061968.1|  Os08g0457400                                       444   1e-146   
ref|XP_006408733.1|  hypothetical protein EUTSA_v10002210mg             442   2e-146   
gb|AAA81538.1|  serine/threonine protein kinase                         441   2e-146   
ref|XP_008656742.1|  PREDICTED: serine/threonine-protein kinase A...    443   2e-146   
ref|XP_010416008.1|  PREDICTED: putative receptor-like protein ki...    442   3e-146   
ref|XP_010677528.1|  PREDICTED: serine/threonine-protein kinase A...    441   3e-146   
ref|XP_006854242.1|  hypothetical protein AMTR_s00048p00230600          440   4e-146   
ref|XP_010416007.1|  PREDICTED: putative receptor-like protein ki...    442   4e-146   
ref|XP_004149002.1|  PREDICTED: serine/threonine-protein kinase A...    441   4e-146   
ref|XP_002445600.1|  hypothetical protein SORBIDRAFT_07g022400          442   7e-146   
ref|XP_009371832.1|  PREDICTED: serine/threonine-protein kinase A...    440   7e-146   
ref|XP_004246044.1|  PREDICTED: serine/threonine-protein kinase A...    439   1e-145   
ref|XP_006659472.1|  PREDICTED: putative receptor-like protein ki...    441   1e-145   
emb|CDY49854.1|  BnaA02g16030D                                          439   2e-145   
gb|EEE59233.1|  hypothetical protein OsJ_11215                          439   3e-145   
ref|XP_006363868.1|  PREDICTED: serine/threonine-protein kinase A...    438   5e-145   
ref|XP_010418127.1|  PREDICTED: serine/threonine-protein kinase A...    437   9e-145   
gb|AFW76641.1|  putative protein kinase superfamily protein             438   9e-145   
ref|XP_006302292.1|  hypothetical protein CARUB_v10020339mg             437   2e-144   
ref|XP_006465911.1|  PREDICTED: putative receptor-like protein ki...    436   2e-144   
ref|XP_010473366.1|  PREDICTED: serine/threonine-protein kinase A...    436   2e-144   
ref|XP_008451160.1|  PREDICTED: serine/threonine-protein kinase A...    431   5e-144   
ref|NP_001130591.1|  uncharacterized LOC100191690                       437   6e-144   
ref|XP_002523402.1|  Protein kinase APK1B, chloroplast precursor,...    434   6e-144   
ref|XP_010228588.1|  PREDICTED: serine/threonine-protein kinase A...    436   7e-144   
emb|CAQ58609.1|  ATP binding / kinase/ protein kinase/ protein se...    434   9e-144   
ref|XP_011089173.1|  PREDICTED: probable receptor-like protein ki...    433   1e-143   
gb|ACG28007.1|  protein kinase APK1B                                    436   1e-143   
ref|XP_002465151.1|  hypothetical protein SORBIDRAFT_01g032820          436   1e-143   
gb|KFK40688.1|  hypothetical protein AALP_AA2G028500                    434   2e-143   
ref|XP_008351966.1|  PREDICTED: probable receptor-like protein ki...    430   2e-143   
ref|XP_001758139.1|  predicted protein                                  435   2e-143   
ref|XP_006391990.1|  hypothetical protein EUTSA_v10023477mg             433   3e-143   
ref|XP_006850988.1|  hypothetical protein AMTR_s00025p00212270          437   3e-143   
ref|XP_009376055.1|  PREDICTED: probable receptor-like protein ki...    432   3e-143   
ref|XP_010245738.1|  PREDICTED: serine/threonine-protein kinase A...    435   3e-143   
ref|XP_010245737.1|  PREDICTED: serine/threonine-protein kinase A...    435   4e-143   
emb|CDP18581.1|  unnamed protein product                                431   6e-143   
ref|XP_009339196.1|  PREDICTED: probable receptor-like protein ki...    431   7e-143   
ref|XP_010540703.1|  PREDICTED: serine/threonine-protein kinase A...    432   9e-143   
ref|XP_001776496.1|  predicted protein                                  432   1e-142   
ref|XP_010536824.1|  PREDICTED: probable receptor-like protein ki...    431   1e-142   
ref|XP_010227886.1|  PREDICTED: serine/threonine-protein kinase A...    432   2e-142   
ref|XP_008647231.1|  PREDICTED: serine/threonine-protein kinase A...    430   2e-142   
ref|XP_008452794.1|  PREDICTED: putative receptor-like protein ki...    431   3e-142   
dbj|BAK00266.1|  predicted protein                                      430   5e-142   
gb|AFW73727.1|  putative protein kinase superfamily protein             431   6e-142   
ref|XP_002886527.1|  hypothetical protein ARALYDRAFT_475168             430   7e-142   
dbj|BAK02435.1|  predicted protein                                      429   1e-141   
ref|XP_009124635.1|  PREDICTED: serine/threonine-protein kinase A...    429   1e-141   
ref|XP_004294946.1|  PREDICTED: probable receptor-like protein ki...    427   2e-141   
ref|XP_006445568.1|  hypothetical protein CICLE_v10015549mg             427   2e-141   
ref|XP_008384377.1|  PREDICTED: probable receptor-like protein ki...    427   3e-141   
gb|EMT00388.1|  Protein kinase APK1B, chloroplastic                     429   3e-141   
ref|NP_001235470.1|  serine/threonine protein kinase-like protein       430   5e-141   
ref|XP_007205337.1|  hypothetical protein PRUPE_ppa007026mg             426   5e-141   
ref|XP_010928727.1|  PREDICTED: serine/threonine-protein kinase A...    426   7e-141   
ref|XP_008221745.1|  PREDICTED: probable receptor-like protein ki...    426   7e-141   
emb|CDY47586.1|  BnaA01g22720D                                          427   7e-141   
gb|KDO54485.1|  hypothetical protein CISIN_1g014189mg                   427   9e-141   
emb|CDY26353.1|  BnaA03g60290D                                          427   9e-141   
ref|XP_008789617.1|  PREDICTED: serine/threonine-protein kinase A...    425   2e-140   
ref|XP_004141437.1|  PREDICTED: putative receptor-like protein ki...    426   2e-140   
gb|AET04401.2|  receptor Serine/Threonine kinase                        424   2e-140   
ref|XP_006842103.1|  hypothetical protein AMTR_s00078p00087780          428   2e-140   
ref|XP_010032848.1|  PREDICTED: probable receptor-like protein ki...    424   3e-140   
ref|XP_010108963.1|  putative receptor-like protein kinase              428   3e-140   
ref|XP_007014086.1|  Kinase superfamily protein isoform 1               426   3e-140   
ref|XP_010032847.1|  PREDICTED: probable receptor-like protein ki...    424   3e-140   
ref|XP_003548706.1|  PREDICTED: serine/threonine-protein kinase A...    425   4e-140   
ref|XP_011089708.1|  PREDICTED: probable receptor-like protein ki...    423   4e-140   
ref|XP_010915105.1|  PREDICTED: probable receptor-like protein ki...    427   6e-140   
ref|XP_010915102.1|  PREDICTED: probable receptor-like protein ki...    427   6e-140   
ref|XP_009104830.1|  PREDICTED: serine/threonine-protein kinase A...    424   6e-140   
ref|XP_010032846.1|  PREDICTED: probable receptor-like protein ki...    423   7e-140   
ref|XP_004973617.1|  PREDICTED: serine/threonine-protein kinase A...    427   9e-140   
ref|XP_006646050.1|  PREDICTED: probable receptor-like protein ki...    425   1e-139   
ref|XP_010276402.1|  PREDICTED: probable receptor-like protein ki...    423   1e-139   
ref|XP_004228947.1|  PREDICTED: probable receptor-like protein ki...    422   1e-139   
gb|AGW45463.1|  kinase-like protein                                     422   1e-139   
ref|NP_001050171.1|  Os03g0364400                                       425   1e-139   
ref|XP_004984290.1|  PREDICTED: serine/threonine-protein kinase A...    424   2e-139   
ref|XP_008793500.1|  PREDICTED: probable receptor-like protein ki...    426   2e-139   
ref|XP_009415296.1|  PREDICTED: probable receptor-like protein ki...    422   2e-139   
ref|XP_010245739.1|  PREDICTED: serine/threonine-protein kinase A...    422   2e-139   
ref|XP_011025119.1|  PREDICTED: probable receptor-like protein ki...    422   3e-139   
ref|NP_001239855.1|  probable receptor-like protein kinase At5g56...    421   3e-139   
ref|XP_006359196.1|  PREDICTED: probable receptor-like protein ki...    421   4e-139   
emb|CAN77488.1|  hypothetical protein VITISV_020249                     421   4e-139   
ref|XP_003517927.1|  PREDICTED: probable receptor-like protein ki...    425   5e-139   
gb|ACU18671.1|  unknown                                                 421   5e-139   
ref|XP_010917721.1|  PREDICTED: probable receptor-like protein ki...    420   7e-139   
ref|XP_002297616.2|  kinase family protein                              421   9e-139   
ref|XP_010651398.1|  PREDICTED: probable receptor-like protein ki...    419   9e-139   
gb|EMT24219.1|  Protein kinase APK1A, chloroplastic                     422   1e-138   
ref|XP_002467815.1|  hypothetical protein SORBIDRAFT_01g034570          422   1e-138   
ref|XP_009392754.1|  PREDICTED: serine/threonine-protein kinase A...    422   1e-138   
gb|ABR16311.1|  unknown                                                 422   1e-138   
ref|XP_009419222.1|  PREDICTED: probable receptor-like protein ki...    419   1e-138   
gb|KDP30626.1|  hypothetical protein JCGZ_16191                         420   1e-138   
ref|XP_010103098.1|  putative receptor-like protein kinase              420   2e-138   
ref|XP_003551987.1|  PREDICTED: probable receptor-like protein ki...    423   2e-138   
ref|XP_009386615.1|  PREDICTED: probable receptor-like protein ki...    423   2e-138   
emb|CDP02215.1|  unnamed protein product                                425   2e-138   
dbj|BAJ91316.1|  predicted protein                                      422   2e-138   
ref|XP_002285747.1|  PREDICTED: probable receptor-like protein ki...    419   2e-138   
ref|XP_007160211.1|  hypothetical protein PHAVU_002G302300g             419   2e-138   
ref|NP_001146371.1|  hypothetical protein                               421   3e-138   
gb|KEH21307.1|  Serine/Threonine kinase family protein                  419   3e-138   
ref|XP_008797332.1|  PREDICTED: probable receptor-like protein ki...    418   3e-138   
gb|KHG05986.1|  hypothetical protein F383_32908                         423   3e-138   
ref|XP_010931968.1|  PREDICTED: probable receptor-like protein ki...    421   3e-138   
emb|CDP00286.1|  unnamed protein product                                422   3e-138   
ref|XP_004503560.1|  PREDICTED: serine/threonine-protein kinase A...    419   3e-138   
ref|XP_003633841.1|  PREDICTED: probable receptor-like protein ki...    422   3e-138   
gb|KDO82762.1|  hypothetical protein CISIN_1g010432mg                   420   3e-138   
ref|XP_009797575.1|  PREDICTED: probable receptor-like protein ki...    422   4e-138   
ref|XP_004503561.1|  PREDICTED: serine/threonine-protein kinase A...    419   4e-138   
ref|XP_009587494.1|  PREDICTED: probable receptor-like protein ki...    422   4e-138   
ref|XP_010096340.1|  putative receptor-like protein kinase              422   5e-138   
ref|XP_007217345.1|  hypothetical protein PRUPE_ppa019180mg             422   5e-138   
emb|CDM83073.1|  unnamed protein product                                422   6e-138   
ref|XP_010931889.1|  PREDICTED: probable receptor-like protein ki...    422   6e-138   
ref|XP_010256394.1|  PREDICTED: probable receptor-like protein ki...    422   6e-138   
ref|XP_003613590.1|  Serine/threonine protein kinase-like protein       422   7e-138   
emb|CBW30202.1|  Protein kinase APK1B                                   421   7e-138   
ref|XP_002517468.1|  Protein kinase APK1B, chloroplast precursor,...    421   7e-138   
ref|XP_011034212.1|  PREDICTED: probable receptor-like protein ki...    421   8e-138   
ref|XP_006431067.1|  hypothetical protein CICLE_v10011575mg             422   8e-138   
ref|XP_007046228.1|  Kinase superfamily protein                         422   9e-138   
ref|XP_007222609.1|  hypothetical protein PRUPE_ppa004933mg             421   9e-138   
ref|XP_009405653.1|  PREDICTED: probable receptor-like protein ki...    417   9e-138   
ref|XP_003524997.1|  PREDICTED: probable receptor-like protein ki...    417   9e-138   
ref|XP_006431066.1|  hypothetical protein CICLE_v10011575mg             422   1e-137   



>ref|XP_009610758.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
tomentosiformis]
Length=438

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/468 (72%), Positives = 383/468 (82%), Gaps = 31/468 (7%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR-EAITKQASFTRIPATelsssalsedl  1424
             MKIT +S+   CF+     G +  P    KP+  + +TKQ+SF RI  ++ S+S +SEDL
Sbjct  1     MKITWESLVPSCFK-----GENPKP----KPKEIKVVTKQSSFHRISISDFSASTISEDL  51

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             SISLAGSN+H FTL+ELKVITQ+FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL
Sbjct  52    SISLAGSNLHIFTLEELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  111

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDLDG+QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLL YEYMPRGSLENQLFRRY
Sbjct  112   LDLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRY  171

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGP
Sbjct  172   SVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGP  231

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGDDTHVSTRVMGT GYAAPEY+MTGHLTAASDVYSFG+VLLELLTGRR++DKT+PNREQ
Sbjct  232   EGDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQ  291

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NLADWARPQLKDPRKLRRI+DPRLEG++SE GAQKAAL+AY+CLSHR K+RP M++VVKT
Sbjct  292   NLADWARPQLKDPRKLRRIMDPRLEGLYSEEGAQKAALVAYQCLSHRPKARPEMTSVVKT  351

Query  523   LEPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkgeeekkelkkeneehrhkhhhqhhh  344
             LEPLKDYKD+S++TFVY AP E                    +K+  +E+  +   +   
Sbjct  352   LEPLKDYKDISNMTFVYIAPAE--------------------VKELCKENGKEDQKKTIK  391

Query  343   hhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSNNSPLHHGMKRA  200
               +   HH H  +   RSP ++T+YSE AL +KL   NSPLH+   RA
Sbjct  392   KENSPYHHHHLDRKHRRSPQNSTIYSEKALHKKL-GPNSPLHNDFHRA  438



>ref|XP_009769768.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
sylvestris]
Length=442

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/467 (72%), Positives = 381/467 (82%), Gaps = 25/467 (5%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             MKIT +S+   CF+             PK    + +TKQ+SF RI  ++ S+S +SEDLS
Sbjct  1     MKITWESLVPSCFKGENP--------KPKAKEIKVVTKQSSFHRISISDFSASTISEDLS  52

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             ISLAGSN++ FTLQELKVITQ+FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL
Sbjct  53    ISLAGSNLYIFTLQELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  112

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDG+QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLL YEYMPRGSLENQLFRRYS
Sbjct  113   DLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYS  172

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWSTRMKIA+GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPE
Sbjct  173   VSLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPE  232

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             GDDTHVSTRVMGT GYAAPEY+MTGHLTAASDVYSFG+VLLELLTGRR++DKT+PNREQN
Sbjct  233   GDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQN  292

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             L DWARPQLKDPRKLRRI+DPRLEG++SE GAQKAAL+AY+CLSHR K+RP MS+VVKTL
Sbjct  293   LVDWARPQLKDPRKLRRIMDPRLEGLYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTL  352

Query  520   EPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkgeeekkelkkeneehrhkhhhqhhhh  341
             EPLKDYKD+S++TFVY AP E                 K+  K+  +E + K   + +  
Sbjct  353   EPLKDYKDISNMTFVYIAPAE----------------VKEMCKESEKEDQKKTIKKENSP  396

Query  340   hhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSNNSPLHHGMKRA  200
             +HQ  HH H  +   RSP ++T+YSE AL +KL   NSPL +   RA
Sbjct  397   YHQKHHHHHLDRKHRRSPQNSTIYSEKALHKKL-GPNSPLRNDFHRA  442



>gb|AAP03880.2| Avr9/Cf-9 induced kinase 1 [Nicotiana tabacum]
Length=442

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/467 (72%), Positives = 380/467 (81%), Gaps = 25/467 (5%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             MKIT +S+   CF+             PK    + +TKQ+SF RI  ++ S+S +SEDLS
Sbjct  1     MKITWESLVPSCFKGENP--------KPKAKEIKVVTKQSSFHRISISDFSASTISEDLS  52

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             ISLAGSN++ FTLQELKVITQ+FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL
Sbjct  53    ISLAGSNLYIFTLQELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  112

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDG+QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLL YEYMPRGSLENQLFRRYS
Sbjct  113   DLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYS  172

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWSTRMKIA+GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPE
Sbjct  173   VSLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPE  232

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             GDDTHVSTRVMGT GYAAPEY+MTGHLTAASDVYSFG+VLLELLTGRR++DKT+PNREQN
Sbjct  233   GDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQN  292

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             L DWARPQLKDPRKLRRI+DPRLEG++SE GAQKAAL+AY+CLSHR K+RP MS+VVKTL
Sbjct  293   LVDWARPQLKDPRKLRRIMDPRLEGLYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTL  352

Query  520   EPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkgeeekkelkkeneehrhkhhhqhhhh  341
             EPLKDYKD+S++ FVY AP E                 K+  K+  +E + K   + +  
Sbjct  353   EPLKDYKDISNMIFVYIAPAE----------------VKEMCKESEKEDQKKTIKKENSP  396

Query  340   hhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSNNSPLHHGMKRA  200
             +HQ  HH H  +   RSP ++T+YSE AL +KL   NSPL +   RA
Sbjct  397   YHQKHHHHHLDRKHRRSPQNSTIYSEKALHKKL-GPNSPLRNDFHRA  442



>emb|CDP03082.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/430 (76%), Positives = 356/430 (83%), Gaps = 16/430 (4%)
 Frame = -3

Query  1486  QASFTRIPATelsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVH  1307
             Q SF R+  ++ SSS +SEDLSISLAGSNIH FTLQELKVITQSFSS NFLGEGGFGPVH
Sbjct  32    QTSFHRLSMSDFSSSTISEDLSISLAGSNIHIFTLQELKVITQSFSSCNFLGEGGFGPVH  91

Query  1306  KGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEH  1127
             KGFIDDKLRPGLKAQPVAVKLLDLDGSQGH+EWLTEVIFLGQLRHP+LVKLIGYCCEEEH
Sbjct  92    KGFIDDKLRPGLKAQPVAVKLLDLDGSQGHKEWLTEVIFLGQLRHPNLVKLIGYCCEEEH  151

Query  1126  RLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASN  947
             RLLVYEYMPRGSLENQLFRRYS SLPWS RMKIALGAAKGLAFLHEAEKPVIYRDFKASN
Sbjct  152   RLLVYEYMPRGSLENQLFRRYSVSLPWSARMKIALGAAKGLAFLHEAEKPVIYRDFKASN  211

Query  946   ILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGI  767
             ILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEY+MTGHLTAASDVYSFG+
Sbjct  212   ILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYVMTGHLTAASDVYSFGV  271

Query  766   VLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALL  587
             VLLELLTGRR++DKT+P+REQNLADWARP LKD RKL RI+DPRLEGM+SE GAQ+AA L
Sbjct  272   VLLELLTGRRSVDKTRPSREQNLADWARPMLKDSRKLSRIMDPRLEGMYSEEGAQQAAAL  331

Query  586   AYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkgeee  407
             AY CLSHR K+RP MS +VKTLEPLKDY D S  TFVYT P E D K  S ++    ++ 
Sbjct  332   AYHCLSHRPKNRPNMSDIVKTLEPLKDYNDTSIGTFVYTVPVETDLKKESEKESEGKKKV  391

Query  406   kkelkkeneehrhkhhhqhhhhhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSN-N  230
             KKE     ++HR  HH+                     +PNS T+YSET LQQ+++   N
Sbjct  392   KKENGHHQQKHRLHHHNHKRSFG---------------TPNSPTIYSETQLQQRVKDGIN  436

Query  229   SPLHHGMKRA  200
             SPLH  +KR 
Sbjct  437   SPLHQRLKRV  446



>ref|XP_006355769.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=412

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/387 (77%), Positives = 333/387 (86%), Gaps = 13/387 (3%)
 Frame = -3

Query  1600  MKITLDSIF-TGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             MKIT +S+  + C    P          PK  + + +TKQ+SF RI  ++ S S      
Sbjct  1     MKITWESLVPSCCISENPK---------PKPKQSKLVTKQSSFHRISVSDFSGSEDLSIS  51

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
                  GSN+H F++QELKVITQ+FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL
Sbjct  52    LA---GSNLHIFSVQELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  108

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDLDG+QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLL YEYMPRGSLENQLFRRY
Sbjct  109   LDLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRY  168

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY+ KLSDFGLAKDGP
Sbjct  169   SVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGP  228

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGDDTHVSTRVMGT GYAAPEY+MTGHLTAASDVYSFG+VLLELLTGRR++DK++PNREQ
Sbjct  229   EGDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKSRPNREQ  288

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NLADWARPQLKD RKL RI+DPRLEG++SE G QKAAL+AY+CLSHR K+RP MSTVVKT
Sbjct  289   NLADWARPQLKDARKLGRIIDPRLEGLYSEEGVQKAALVAYQCLSHRPKARPDMSTVVKT  348

Query  523   LEPLKDYKDVSSVTFVYTAPTEKDTKT  443
             LE LKDYKD+S++TFVY AP ++  ++
Sbjct  349   LETLKDYKDISTMTFVYIAPVDQHKQS  375



>ref|XP_009596087.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/384 (80%), Positives = 335/384 (87%), Gaps = 9/384 (2%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             MKI  +S+   C +            T K P+ + I  Q SF  IP +++SSS LS DLS
Sbjct  4     MKIAWESLVPSCIKPDQN--------TKKNPKEKVIRTQISFHGIPVSDISSSTLSSDLS  55

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             ISLAGSNIH+F LQEL+VITQ+FS+SNF+GEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL
Sbjct  56    ISLAGSNIHSFNLQELRVITQNFSTSNFIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  115

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS
Sbjct  116   DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  175

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWSTRMKIALGAAKGLAFLHEA+KPVIYRDFKASNILLDSDY  KLSDFGLAKDGPE
Sbjct  176   VSLPWSTRMKIALGAAKGLAFLHEAKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPE  235

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFG+VLLELLTGRR++DK +P+REQN
Sbjct  236   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGVVLLELLTGRRSVDKNRPHREQN  295

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             L DWARPQLKDPRKLRRI+DPRLEGM+SE G Q AAL+AY+CLSHR K+RP MSTVVKTL
Sbjct  296   LVDWARPQLKDPRKLRRIMDPRLEGMYSEEGIQNAALVAYQCLSHRPKARPDMSTVVKTL  355

Query  520   EPLKDYKDVSS-VTFVYTAPTEKD  452
             EPL +Y D SS VTFVY A  E +
Sbjct  356   EPLMNYDDSSSMVTFVYRARAESN  379



>ref|XP_004243705.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Solanum 
lycopersicum]
Length=434

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/469 (68%), Positives = 375/469 (80%), Gaps = 37/469 (8%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             MKI  +S+   C ++     +++    PK   + ++TKQ SF  IP ++LSSS +S DLS
Sbjct  1     MKIGWESLVPSCIKS-----HENSKKNPKM-VKVSVTKQISFHGIPVSDLSSSTISSDLS  54

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRP-GLKAQPVAVKL  1244
             ISLAGSNIHAFT QEL+VITQ+FS+SNF+GEGGFGPVHKGFIDDKLRP  +KAQPVAVK 
Sbjct  55    ISLAGSNIHAFTQQELRVITQNFSTSNFIGEGGFGPVHKGFIDDKLRPNAIKAQPVAVKN  114

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEE++RLLVYEYMPRGSLENQLFRRY
Sbjct  115   LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEDNRLLVYEYMPRGSLENQLFRRY  174

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S SLPWSTRMKIA+GAAKGLAFLHEA+KPVIYRDFKASNILLDSDY  KLSDFGLAKDGP
Sbjct  175   SVSLPWSTRMKIAIGAAKGLAFLHEAKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGP  234

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFG+VLLELLTGRR++DK +P+REQ
Sbjct  235   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGVVLLELLTGRRSVDKGRPHREQ  294

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NL DWARPQLKDPRKLRRI+DPRLEGM+SE G QKAAL+AY+CLSHR K+RP MS VV T
Sbjct  295   NLVDWARPQLKDPRKLRRIMDPRLEGMYSEEGVQKAALVAYQCLSHRPKARPDMSNVVTT  354

Query  523   LEPLKDYKDVSSVTFVYTAPT-EKDTKTVSTekdnkgeeekkelkkeneehrhkhhhqhh  347
             LEPLKDY+D S VTFVYTAPT ++  K +++   +   ++++    +             
Sbjct  355   LEPLKDYEDNSMVTFVYTAPTDDQQVKQITSASPHHHHQKQQHHNHKRRS----------  404

Query  346   hhhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSNNSPLHHGMKRA  200
                               +P+S T++SET + ++L + NSPL +G KR+
Sbjct  405   ------------------TPSSPTIHSETTIHKRL-TPNSPLQNGFKRS  434



>ref|XP_004239317.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Solanum 
lycopersicum]
Length=408

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/380 (79%), Positives = 337/380 (89%), Gaps = 12/380 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             MKIT +S+   C  +       + P T K      ++KQ++F RI A++ S+S +SEDLS
Sbjct  1     MKITWESLVPRCCIS-------EKPKTSK-----LVSKQSTFHRISASDFSNSTISEDLS  48

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             ISLAGSN+H F++QELKVITQ+FSSSNFLGEGGFGPVHKGFIDDKLRPGLK QPVAVK L
Sbjct  49    ISLAGSNLHVFSVQELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKPQPVAVKFL  108

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDG+QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS
Sbjct  109   DLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  168

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY+ KLSDFGLAKDGP+
Sbjct  169   VSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPQ  228

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             GDDTHVSTRVMGT GYAAPEY+MTGHLTAASD+YSFG+VLLELLTGRR++DKT+PNREQN
Sbjct  229   GDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDIYSFGVVLLELLTGRRSVDKTRPNREQN  288

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             LADWARPQLKD RKL R++DPRLEG++S  G QKAA +AY+CLSHR K+RP M+TVVKTL
Sbjct  289   LADWARPQLKDARKLARVIDPRLEGLYSSEGVQKAAYVAYQCLSHRPKARPDMTTVVKTL  348

Query  520   EPLKDYKDVSSVTFVYTAPT  461
             E LKDYKD+S++TFVY AP 
Sbjct  349   ETLKDYKDISTMTFVYIAPV  368



>ref|XP_009777205.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
sylvestris]
Length=436

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/382 (81%), Positives = 336/382 (88%), Gaps = 8/382 (2%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             MKI  +S+   C +      + +    PK+  ++ I  Q SF  IP +++SSS LS DLS
Sbjct  4     MKIAWESLVPNCIKP-----DQNTKKNPKE--KKVIRTQISFHGIPVSDISSSTLSSDLS  56

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             ISLAGSNIH+F LQEL+VITQ+FS+SNF+GEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL
Sbjct  57    ISLAGSNIHSFNLQELRVITQNFSTSNFIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  116

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDGSQGHREWLTEVIFLGQL HPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS
Sbjct  117   DLDGSQGHREWLTEVIFLGQLSHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  176

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWSTRMKIALGAAKGLAFLHEA+KPVIYRDFKASNILLDSDY  KLSDFGLAKDGPE
Sbjct  177   VSLPWSTRMKIALGAAKGLAFLHEAKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPE  236

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFG+VLLELLTGRR++DK +P+REQN
Sbjct  237   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGVVLLELLTGRRSVDKNRPHREQN  296

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             L DWARPQLKDPRKLRRI+DPRLEGM+SE G Q AAL+AY+CLSHR K+RP MSTVVKTL
Sbjct  297   LVDWARPQLKDPRKLRRIMDPRLEGMYSEEGIQNAALVAYQCLSHRPKARPDMSTVVKTL  356

Query  520   EPLKDYKDVSS-VTFVYTAPTE  458
             EPL +Y D SS VTFVYTA  E
Sbjct  357   EPLMNYDDSSSMVTFVYTARAE  378



>ref|XP_006342386.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=439

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/468 (68%), Positives = 373/468 (80%), Gaps = 33/468 (7%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             MKI  +S+   C ++   +  +       K  + ++TKQ SF  IP +++SSS +S DLS
Sbjct  4     MKIGWESLVPRCIKSQENSKRN------PKIVKVSVTKQLSFHGIPVSDISSSTISSDLS  57

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRP-GLKAQPVAVKL  1244
             ISLAGSNIHAFT QEL+VITQ+FS+SNF+GEGGFGPVHKGFIDDKLRP  +KAQPVAVK 
Sbjct  58    ISLAGSNIHAFTQQELRVITQNFSTSNFIGEGGFGPVHKGFIDDKLRPNAIKAQPVAVKN  117

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDLDG+QGHREWLTEVIFLGQLRHPHLVKLIGYCCEE++RLLVYEYMPRGSLENQLFRRY
Sbjct  118   LDLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEDNRLLVYEYMPRGSLENQLFRRY  177

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S SLPWSTRMKIA+GAAKGLAFLHEA+KPVIYRDFKASNILLDSDY  KLSDFGLAKDGP
Sbjct  178   SVSLPWSTRMKIAIGAAKGLAFLHEAKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGP  237

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFG+VLLELLTGRR++DK +P+REQ
Sbjct  238   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGVVLLELLTGRRSVDKGRPHREQ  297

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NL DWARPQLKDPRKLRRI+DPRLEGM+SE G QKAAL+AY+CLS+R K+RP MS VV T
Sbjct  298   NLVDWARPQLKDPRKLRRIMDPRLEGMYSEEGVQKAALVAYQCLSNRPKARPDMSNVVTT  357

Query  523   LEPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkgeeekkelkkeneehrhkhhhqhhh  344
             LEPLKDY+D S VTFVYTAPT+ D + V  ++ +       + +  +  +R         
Sbjct  358   LEPLKDYEDNSMVTFVYTAPTD-DQQEVKVKESSASPHHHHQKQHHHHHNRRS-------  409

Query  343   hhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSNNSPLHHGMKRA  200
                              +P+S T++SET + ++L + NSPL +G KR+
Sbjct  410   -----------------TPSSPTIHSETTIHKRL-TPNSPLQNGFKRS  439



>ref|XP_002277991.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 emb|CBI27806.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/463 (70%), Positives = 360/463 (78%), Gaps = 34/463 (7%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelss--salsedl  1424
             KIT  S+F  C+      G++ M +  K+ +   + KQ SF RI  ++LS+  S LSEDL
Sbjct  5     KITWRSVFPACY------GSEKMAS--KRRKAAVVAKQTSFQRISISDLSNPGSTLSEDL  56

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S SL GSN+H FTL ELKVI Q+FSS+NF+GEGGFGPVHKGFIDDKLRPGLKAQPVAVKL
Sbjct  57    STSLMGSNLHVFTLTELKVICQNFSSNNFIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  116

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDL+G QGHREWLTEVIFLGQLRHPHLVKLIGYCCE+EHRLLVYEYMPRGSLENQLFRRY
Sbjct  117   LDLEGLQGHREWLTEVIFLGQLRHPHLVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRY  176

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSD+  KLSDFGLAKDGP
Sbjct  177   SVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDHTPKLSDFGLAKDGP  236

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DKT+PNREQ
Sbjct  237   EGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKTRPNREQ  296

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NLA+WARPQL D RKL RI+DPRLEG +SEAGAQ AA LAY+CLSHR K RPTMSTVVKT
Sbjct  297   NLAEWARPQLNDSRKLARIMDPRLEGQYSEAGAQSAAALAYQCLSHRPKHRPTMSTVVKT  356

Query  523   LEPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkgeeekkelkkeneehrhkhhhqhhh  344
             LEPL+DY ++   TFVYT P+E D     T                              
Sbjct  357   LEPLQDYNEIPVGTFVYTVPSENDLPKEET-----------------------KEGGEAQ  393

Query  343   hhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLR-SNNSPLH  218
                +        +HR RSP S T+YSETAL+Q LR S NSPLH
Sbjct  394   KEPKKESSHQGHRHRMRSPKSPTIYSETALRQNLRNSPNSPLH  436



>ref|XP_010090162.1| Serine/threonine-protein kinase [Morus notabilis]
 gb|EXB38959.1| Serine/threonine-protein kinase [Morus notabilis]
Length=452

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/469 (70%), Positives = 366/469 (78%), Gaps = 24/469 (5%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsedl  1424
             K T  S+ T C++A       D   T  KP+R  + KQ SF R+  ++LS  SS  SEDL
Sbjct  5     KSTWRSMVTSCYKA-------DCAPTTTKPKR-VVAKQTSFQRLSLSDLSFPSSNFSEDL  56

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             SISLAGSN+H FTL ELKVITQSFSSSNFLGEGGFGPVHKGF+DDK+RPGLKAQPVAVKL
Sbjct  57    SISLAGSNLHVFTLAELKVITQSFSSSNFLGEGGFGPVHKGFVDDKIRPGLKAQPVAVKL  116

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDLDGSQGH+EWLTEVIFLGQLRHP+LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY
Sbjct  117   LDLDGSQGHKEWLTEVIFLGQLRHPYLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  176

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S SLPWS RMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGP
Sbjct  177   SVSLPWSARMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGP  236

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGD+THVSTRVMGT GYAAPEY+MTGHLTA SDVYSFG+VLLE++TGRR++DK++P REQ
Sbjct  237   EGDETHVSTRVMGTQGYAAPEYVMTGHLTAMSDVYSFGVVLLEMITGRRSVDKSRPTREQ  296

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NL +WARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RPTMSTVV+T
Sbjct  297   NLVEWARPMLCDPRKLGRIMDPRLEGQYSETGARKAAALAYQCLSHRPKQRPTMSTVVET  356

Query  523   LEPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkgeeekkelkkeneehrhkhhhqhhh  344
             LEPLKD+ DV+   FVYT PTE                  KE  K+      K  + H H
Sbjct  357   LEPLKDFDDVAIAPFVYTVPTE-------------IANSNKEEAKKECLSEVKKENGHRH  403

Query  343   hhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSN-NSPLHHGMKRA  200
             H H   +  H++  R RSP S   +SE   +Q  R+  NSPLHHG + A
Sbjct  404   HSHSPHNGHHNKHRRMRSPRSPNFHSENGPRQNQRNGLNSPLHHGGRGA  452



>ref|XP_011046009.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
 ref|XP_011016671.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
Length=454

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/467 (69%), Positives = 364/467 (78%), Gaps = 33/467 (7%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelss-salsedls  1421
             K T  S+F+ CF+      N+  P+ PKK     +TKQ SF R+  ++LS+ S LSEDLS
Sbjct  5     KTTWRSMFSSCFKP-----NEISPSKPKK----VVTKQTSFQRLSMSDLSNPSTLSEDLS  55

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             ISLAGSN+H FTL ELKVITQ+F++SNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL
Sbjct  56    ISLAGSNLHVFTLPELKVITQNFAASNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  115

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDGSQGHREWL EVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS
Sbjct  116   DLDGSQGHREWLAEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  175

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWS R KIA+GAAKGLAFLHE+EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPE
Sbjct  176   VSLPWSARTKIAVGAAKGLAFLHESEKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPE  235

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             G DTHVSTRVMGT GYAAPEYIMTGHLT+ SDVYSFG+VLLELLTGRR++DK++P REQN
Sbjct  236   GSDTHVSTRVMGTQGYAAPEYIMTGHLTSRSDVYSFGVVLLELLTGRRSVDKSRPQREQN  295

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             LA+WARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RPTMS VV TL
Sbjct  296   LAEWARPMLNDPRKLSRIMDPRLEGQYSETGARKAAALAYQCLSHRPKLRPTMSIVVSTL  355

Query  520   EPLKDYKDVSSVTFVYTAPTEK----DTKTVSTekdnkgeeekkelkkeneehrhkhhhq  353
             +PL D++DV    FVYT PTE     D K   T++D   +E+  +  ++++ HR +    
Sbjct  356   DPLMDFEDVPIGPFVYTVPTENLKEDDNKECQTKRDQTKKEKNGQQHQKHQLHRGQKRQG  415

Query  352   hhhhhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSN-NSPLHH  215
                                  P S T++SETAL Q   +  +SPLHH
Sbjct  416   RSR------------------PRSPTIHSETALSQNHGNGLHSPLHH  444



>ref|XP_006381619.1| kinase family protein [Populus trichocarpa]
 gb|ERP59416.1| kinase family protein [Populus trichocarpa]
Length=456

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/467 (69%), Positives = 362/467 (78%), Gaps = 33/467 (7%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelss-salsedls  1421
             K T  S+ + CF+      N+  P+ PKK     +TKQ SF RI  ++LS+ S LSEDLS
Sbjct  7     KTTWRSMVSSCFKP-----NEISPSKPKK----IVTKQTSFQRISMSDLSNPSTLSEDLS  57

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             ISLAGSN+H FTL ELKVITQ+F++SNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL
Sbjct  58    ISLAGSNLHVFTLPELKVITQNFAASNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  117

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDGSQGHREWL EVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS
Sbjct  118   DLDGSQGHREWLAEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  177

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWS R KIA+GAAKGLAFLHE+EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPE
Sbjct  178   VSLPWSARTKIAVGAAKGLAFLHESEKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPE  237

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             G DTHVSTRVMGT GYAAPEYIMTGHLT+ SDVYSFG+VLLELLTGRR++DK++P REQN
Sbjct  238   GSDTHVSTRVMGTQGYAAPEYIMTGHLTSRSDVYSFGVVLLELLTGRRSVDKSRPQREQN  297

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             L +WARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RPTMS VV TL
Sbjct  298   LVEWARPMLNDPRKLGRIMDPRLEGQYSETGARKAAELAYQCLSHRPKHRPTMSIVVNTL  357

Query  520   EPLKDYKDVSSVTFVYTAPTEK----DTKTVSTekdnkgeeekkelkkeneehrhkhhhq  353
             +PLKD++DV    FVYT PTE     D K   T++D   +E+  +  + ++ HR +    
Sbjct  358   DPLKDFEDVPIGPFVYTVPTENLKEDDNKECETKRDETKKEKNGQQHQRHQLHRGQKRQG  417

Query  352   hhhhhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLRSN-NSPLHH  215
                                  P S T++SETAL Q   +  +SPLHH
Sbjct  418   RSR------------------PRSPTIHSETALSQNHGNGLHSPLHH  446



>ref|XP_011094012.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Sesamum 
indicum]
Length=431

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/389 (76%), Positives = 326/389 (84%), Gaps = 3/389 (1%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssals  1433
             + +K K+     F  CFRA             KKP      + +S  RI  ++LSSS LS
Sbjct  1     MAVKKKMRWQQYFPNCFRADGPGPGPIPIPDQKKP---VSNQSSSIPRISLSDLSSSTLS  57

Query  1432  edlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVA  1253
             EDLSISLAGSN+H FTLQELKVITQ FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVA
Sbjct  58    EDLSISLAGSNLHVFTLQELKVITQHFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVA  117

Query  1252  VKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLF  1073
             VKLLDLDGSQGHREWLTEVIFLGQLRH HLVKLIGYCCEEEHRLLVYEYMPRGSLENQLF
Sbjct  118   VKLLDLDGSQGHREWLTEVIFLGQLRHAHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLF  177

Query  1072  RRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAK  893
             RR+S SLPW+ RMKIALGAAKGLAFLHEAEKPVIYRDFK SNILLDSDY  KLSDFGLAK
Sbjct  178   RRFSVSLPWAARMKIALGAAKGLAFLHEAEKPVIYRDFKGSNILLDSDYTAKLSDFGLAK  237

Query  892   DGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPN  713
             DGPEGDDTHVSTRVMGTHGYAAPEY+MTGHLTAASDVYSFG+VLLELLTGR+++DK++P+
Sbjct  238   DGPEGDDTHVSTRVMGTHGYAAPEYVMTGHLTAASDVYSFGVVLLELLTGRKSVDKSRPH  297

Query  712   REQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTV  533
             REQNL +WARP LK+PRKL R++DPRLEG + E GAQ AA LAY+CLSHR K RPTM+ V
Sbjct  298   REQNLVEWARPMLKNPRKLSRVMDPRLEGQYPEIGAQNAAALAYQCLSHRPKLRPTMNEV  357

Query  532   VKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
             +K LEPLKD  D+   TFV+   T+ D++
Sbjct  358   IKVLEPLKDLNDIQVGTFVFAVSTDSDSQ  386



>ref|XP_002516271.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF46273.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=451

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/379 (79%), Positives = 327/379 (86%), Gaps = 8/379 (2%)
 Frame = -3

Query  1582  SIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelss-salsedlsislAG  1406
             S+ + CF+        +     K P++E +TKQ SFTR+  ++LS+ S+LSEDLSISLAG
Sbjct  10    SMVSSCFKPL------EQKRALKAPKKE-VTKQTSFTRLSLSDLSNPSSLSEDLSISLAG  62

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             SN+H FTL ELKVITQ+FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG 
Sbjct  63    SNLHVFTLAELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGL  122

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS SLPW
Sbjct  123   QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPW  182

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             STRMKIALGAAKGLAFLHE+EK VIYRDFKASNILLDSDY+ KLSDFGLAKDGP+G DTH
Sbjct  183   STRMKIALGAAKGLAFLHESEKSVIYRDFKASNILLDSDYNAKLSDFGLAKDGPQGSDTH  242

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK++P REQ LA+WA
Sbjct  243   VSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKSRPQREQKLAEWA  302

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP L DPRKL RI+DPRLEG +SE GA+KAA LAY CLSHR K RP MS VVKTLE  KD
Sbjct  303   RPMLNDPRKLGRIMDPRLEGQYSETGARKAAALAYLCLSHRPKQRPIMSIVVKTLESFKD  362

Query  505   YKDVSSVTFVYTAPTEKDT  449
             ++D+    FVYT PTE D 
Sbjct  363   FEDIPVGPFVYTVPTESDN  381



>gb|KHN12282.1| Serine/threonine-protein kinase [Glycine soja]
Length=463

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/388 (76%), Positives = 334/388 (86%), Gaps = 11/388 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MKI   S+F GC++        + P+   KP++   TK  S  RI  T+LS  S+ LSED
Sbjct  4     MKILWKSLFPGCYKG-------EYPSP--KPKKVVATKPNSSHRISVTDLSYPSTTLSED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LSISLAG+N+H F++ ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDKLR GLKAQPVAVK
Sbjct  55    LSISLAGTNLHVFSIAELKIITQQFSSSNFLGEGGFGPVHKGFIDDKLRHGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDLDGSQGH+EWLTEV+FLGQLRHPHLVKLIGYCCEEEHR+LVYEY+PRGSLENQLFRR
Sbjct  115   LLDLDGSQGHKEWLTEVVFLGQLRHPHLVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             +SASLPWSTRMKIA+GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY+ KLSDFGLAKDG
Sbjct  175   FSASLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYNAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGTHGYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DK +P RE
Sbjct  235   PEGDDTHVSTRVMGTHGYAAPEYVMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRPPRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L D RKL RI+DPRLEG +SE G +KAA LAY+CLSHR +SRP+MSTVVK
Sbjct  295   QNLVEWARPMLNDSRKLSRIMDPRLEGQYSEMGTKKAAALAYQCLSHRPRSRPSMSTVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKDTKT  443
             TLEPL+D+ D+   TFVYTAP + + + 
Sbjct  355   TLEPLQDFDDIPIGTFVYTAPPDNNNEV  382



>ref|XP_008242244.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
Length=444

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/385 (76%), Positives = 328/385 (85%), Gaps = 12/385 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl--  1424
             K+T  SI   C+++       + P++  K  ++ + KQ SF R+  ++LS+ + +     
Sbjct  5     KLTWRSIVPYCYKS-------ERPSS--KASKKVVAKQTSFQRLSLSDLSNPSSTFSEDL  55

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             SISLAGSN+H FTL ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL AQPVAVKL
Sbjct  56    SISLAGSNLHIFTLGELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLTAQPVAVKL  115

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCE+EHRLLVYEYMPRGSLENQLFRRY
Sbjct  116   LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRY  175

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGP
Sbjct  176   SVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGP  235

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P+REQ
Sbjct  236   EGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRPHREQ  295

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NL +WA+P L +PRKL RI+DPRLEG +SE GA+KAA LAY+C+SHR K RP +S VVK 
Sbjct  296   NLVEWAKPMLNEPRKLSRIMDPRLEGQYSEIGARKAAALAYQCISHRPKQRPKISDVVKI  355

Query  523   LEPLKDYKDVSSVTFVYTAPTEKDT  449
             LEPLKD+ D+  + FVYT PTE D+
Sbjct  356   LEPLKDFDDI-PIAFVYTVPTESDS  379



>ref|XP_010049350.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Eucalyptus 
grandis]
 gb|KCW81895.1| hypothetical protein EUGRSUZ_C03262 [Eucalyptus grandis]
Length=450

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/358 (81%), Positives = 322/358 (90%), Gaps = 4/358 (1%)
 Frame = -3

Query  1513  KPRREAITKQASFTRIPA---TelsssalsedlsislAGSNIHAFTLQELKVITQSFSSS  1343
             KP++E +TKQ SF R+     +  SS+ LSEDLSISLAGSN+H F LQELK+ITQSFSSS
Sbjct  26    KPKKE-VTKQNSFQRLSLLDLSNPSSTTLSEDLSISLAGSNLHVFALQELKLITQSFSSS  84

Query  1342  NFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHL  1163
             NFLG+GGFGPVHKGFIDDKLRPGLKAQPVAVKLLDL+G QGHREWLTEVI LGQLRHPHL
Sbjct  85    NFLGQGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGMQGHREWLTEVILLGQLRHPHL  144

Query  1162  VKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAE  983
             VKLIGYCCE+EHRLLVYEYMPRGSLENQLFRRY+A+LPWS RMKIA+GAAKGLAFLHEAE
Sbjct  145   VKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYAATLPWSARMKIAVGAAKGLAFLHEAE  204

Query  982   KPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGH  803
              PVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGH
Sbjct  205   NPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGH  264

Query  802   LTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGM  623
             LTA SDVYSFG+VLLELLTGR+++DK +P+REQNLA+WARP L D +KL R++DPRLEG 
Sbjct  265   LTAMSDVYSFGVVLLELLTGRKSVDKNRPHREQNLAEWARPMLNDSKKLSRLMDPRLEGQ  324

Query  622   FSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
             +SE+GA+KAA LAY+CLSHR K RPTMSTVVKTLEPLK++ D+ S  FVYT P E D+
Sbjct  325   YSESGARKAATLAYQCLSHRPKMRPTMSTVVKTLEPLKNFDDIPSGPFVYTVPMEIDS  382



>ref|XP_003533786.2| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=463

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/388 (76%), Positives = 334/388 (86%), Gaps = 11/388 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MKI   S+F GC++        + P+   KP++   TK  S  RI  T+LS  S+ LSED
Sbjct  4     MKILWKSLFPGCYKG-------EYPSP--KPKKVVATKPNSSHRISVTDLSYPSTTLSED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LSISLAG+N+H F++ ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDKLR GLKAQPVAVK
Sbjct  55    LSISLAGTNLHVFSIAELKIITQQFSSSNFLGEGGFGPVHKGFIDDKLRHGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LL+LDGSQGH+EWLTEV+FLGQLRHPHLVKLIGYCCEEEHR+LVYEY+PRGSLENQLFRR
Sbjct  115   LLNLDGSQGHKEWLTEVVFLGQLRHPHLVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             +SASLPWSTRMKIA+GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY+ KLSDFGLAKDG
Sbjct  175   FSASLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYNAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGTHGYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DK +P RE
Sbjct  235   PEGDDTHVSTRVMGTHGYAAPEYVMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRPPRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L D RKL RI+DPRLEG +SE G +KAA LAY+CLSHR +SRP+MSTVVK
Sbjct  295   QNLVEWARPMLNDSRKLSRIMDPRLEGQYSEMGTKKAAALAYQCLSHRPRSRPSMSTVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKDTKT  443
             TLEPL+D+ D+   TFVYTAP + + + 
Sbjct  355   TLEPLQDFDDIPIGTFVYTAPPDNNNEV  382



>ref|XP_007154576.1| hypothetical protein PHAVU_003G130400g [Phaseolus vulgaris]
 gb|ESW26570.1| hypothetical protein PHAVU_003G130400g [Phaseolus vulgaris]
Length=480

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/385 (76%), Positives = 328/385 (85%), Gaps = 9/385 (2%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             M I   SIF+ CF++      D +  +PK P +E  TK +S  R+   +LS   S LSED
Sbjct  1     MTIAWGSIFSICFKS------DSVSLSPK-PTKEVATKGSSSNRVSIMDLSFPGSTLSED  53

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS+SL GSN+H F+L ELK+ITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL+AQPVAVK
Sbjct  54    LSVSLVGSNLHVFSLAELKIITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLEAQPVAVK  113

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDLDGSQGHREWLTEV+FLGQLRH HLVKLIGYCCEEEHRLLVYEY+PRGSLENQLFRR
Sbjct  114   LLDLDGSQGHREWLTEVVFLGQLRHQHLVKLIGYCCEEEHRLLVYEYLPRGSLENQLFRR  173

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             ++ASL WSTRMKIA GAAKGLAFLHEA+KPVIYRDFKASNILLDSDYD KLSDFGLAKDG
Sbjct  174   FTASLTWSTRMKIAAGAAKGLAFLHEAKKPVIYRDFKASNILLDSDYDAKLSDFGLAKDG  233

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLE+LTGRR++DK +P RE
Sbjct  234   PEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLEILTGRRSVDKGRPPRE  293

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR ++RP MSTVV 
Sbjct  294   QNLVEWARPVLNDPRKLSRIMDPRLEGQYSEEGARKAAALAYQCLSHRPRNRPLMSTVVS  353

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKD  452
              LEPLKD+ DV    FVYT PT+ +
Sbjct  354   VLEPLKDFDDVPIGPFVYTVPTDHN  378



>ref|XP_004287640.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Fragaria vesca subsp. vesca]
Length=451

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/389 (74%), Positives = 323/389 (83%), Gaps = 12/389 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl--  1424
             KIT  S+   C+++   A  +         + + + KQ SF R+  ++LS+ + +     
Sbjct  5     KITCWSVLPSCYKSEFRAPQN---------KAKVVAKQTSFQRLSLSDLSNPSSTTLSED  55

Query  1423  -sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
              SISLAGSN+H FTL ELKVITQSFSSSNF+GEGGFGPVHKGFIDDKLRPGL AQPVAVK
Sbjct  56    LSISLAGSNLHVFTLGELKVITQSFSSSNFIGEGGFGPVHKGFIDDKLRPGLAAQPVAVK  115

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
              LDLDGSQGHREWLTEV+FLGQLRH HLVKLIGYCC +EHRLLVYEYMPRGSLENQLFRR
Sbjct  116   FLDLDGSQGHREWLTEVMFLGQLRHAHLVKLIGYCCVDEHRLLVYEYMPRGSLENQLFRR  175

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDG
Sbjct  176   YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTPKLSDFGLAKDG  235

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P+RE
Sbjct  236   PEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRPHRE  295

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L +PRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RP M  VVK
Sbjct  296   QNLVEWARPMLNEPRKLSRIMDPRLEGQYSEMGARKAAALAYQCLSHRPKQRPKMCEVVK  355

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKDTKTV  440
             TLEPLKD+ D+    FVYT PT+K   ++
Sbjct  356   TLEPLKDFDDIPIGPFVYTVPTDKSDNSI  384



>ref|XP_003547504.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=458

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/385 (77%), Positives = 330/385 (86%), Gaps = 11/385 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MK    SIF GC++        + P+   KP++   TK  S  RI  T+LS  S+ LSED
Sbjct  4     MKTLWKSIFPGCYKG-------EYPSP--KPKKVVATKPNSSHRISVTDLSYPSTTLSED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LSISLAG+N+H F+L ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDKLR GLKAQPVAVK
Sbjct  55    LSISLAGTNLHVFSLAELKIITQQFSSSNFLGEGGFGPVHKGFIDDKLRHGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDLDGSQGH+EWLTEV+FLGQLRHPHLVKLIGYCCEEEHR+LVYEY+PRGSLENQLFRR
Sbjct  115   LLDLDGSQGHKEWLTEVVFLGQLRHPHLVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             +SASL WSTRMKIA+GAAKGLAFLHEAEKPVIYRDFKASNILL SDY+ KLSDFGLAKDG
Sbjct  175   FSASLSWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLGSDYNAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P RE
Sbjct  235   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRPPRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L D RKL RI+DPRLEG +SE G +KAA LAY+CLSHR +SRP+MSTVVK
Sbjct  295   QNLVEWARPMLNDSRKLSRIMDPRLEGQYSEMGTKKAAALAYQCLSHRPRSRPSMSTVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKD  452
             TLEPL+D+ D+   TFVYTAP + +
Sbjct  355   TLEPLQDFDDIPIGTFVYTAPPDNN  379



>ref|XP_010047471.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Eucalyptus 
grandis]
 gb|KCW79393.1| hypothetical protein EUGRSUZ_C00802 [Eucalyptus grandis]
Length=441

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/356 (80%), Positives = 319/356 (90%), Gaps = 3/356 (1%)
 Frame = -3

Query  1513  KPRREAITKQASFTRIPATelsssalsedl--sislAGSNIHAFTLQELKVITQSFSSSN  1340
             KP++  ++KQ+SF RI  ++LS+ +L+     SISLAGSN+H FTLQELK+ITQ FSSSN
Sbjct  24    KPKK-VVSKQSSFQRISLSDLSNPSLTLSEDLSISLAGSNLHVFTLQELKLITQGFSSSN  82

Query  1339  FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLV  1160
             F+GEGGFGPVHKGFIDDKLRPGLK QPVAVKLLDLDG QGHREWLTEVIFLGQLRHPHLV
Sbjct  83    FIGEGGFGPVHKGFIDDKLRPGLKVQPVAVKLLDLDGLQGHREWLTEVIFLGQLRHPHLV  142

Query  1159  KLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEK  980
             KLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS SLPWS RMKIALGAAKGLAFLHEAEK
Sbjct  143   KLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSVSLPWSARMKIALGAAKGLAFLHEAEK  202

Query  979   PVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHL  800
             PVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEY+MTGHL
Sbjct  203   PVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTGHL  262

Query  799   TAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMF  620
             TA SDVYSFG+VLLELLTGR+++DKT+P REQ LA+WARP L+DPRKL RI+DPRLEG +
Sbjct  263   TAMSDVYSFGVVLLELLTGRKSVDKTRPAREQKLAEWARPMLRDPRKLGRIMDPRLEGQY  322

Query  619   SEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKD  452
             SEAGA+KAA +AY+CLSHR K RPT+ TVV+TLEPL+D+ D+   TFV+T P + D
Sbjct  323   SEAGARKAAEVAYQCLSHRPKQRPTVGTVVETLEPLQDFNDLPMGTFVFTFPPDGD  378



>ref|XP_010049411.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Eucalyptus 
grandis]
 gb|KCW81961.1| hypothetical protein EUGRSUZ_C03327 [Eucalyptus grandis]
Length=450

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/358 (80%), Positives = 321/358 (90%), Gaps = 4/358 (1%)
 Frame = -3

Query  1513  KPRREAITKQASFTRIPA---TelsssalsedlsislAGSNIHAFTLQELKVITQSFSSS  1343
             KP++E +TKQ SF R+     +  SS+ LSEDLSISLAGSN+H F LQELK+ITQSFSSS
Sbjct  26    KPKKE-VTKQNSFQRLSLMDLSNPSSTTLSEDLSISLAGSNLHVFALQELKLITQSFSSS  84

Query  1342  NFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHL  1163
             NFLG+GGFGPVHKGFID+KLRPGLKAQPVAVKLLDL+G QGHREWLTEVI LGQLRHPHL
Sbjct  85    NFLGQGGFGPVHKGFIDEKLRPGLKAQPVAVKLLDLEGMQGHREWLTEVILLGQLRHPHL  144

Query  1162  VKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAE  983
             VKLIGYCCE+EHRLLVYEYMPRGSLENQLFRRY+A+LPWS RMKIA+GAAKGLAFLHEAE
Sbjct  145   VKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYAATLPWSARMKIAVGAAKGLAFLHEAE  204

Query  982   KPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGH  803
              PVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGH
Sbjct  205   NPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGH  264

Query  802   LTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGM  623
             LTA SDVYSFG+VLLELLTGR++++K +P+REQNLA+WARP L D +KL R++DPRLEG 
Sbjct  265   LTAMSDVYSFGVVLLELLTGRKSVEKNRPHREQNLAEWARPMLNDSKKLSRLMDPRLEGQ  324

Query  622   FSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
             +SE+GA+KAA LAY+CLSHR K RPTMSTVVKTLEPLK++ D+    FVYT P E D+
Sbjct  325   YSESGARKAATLAYQCLSHRPKMRPTMSTVVKTLEPLKNFDDIPIGPFVYTVPMEIDS  382



>gb|KDO73907.1| hypothetical protein CISIN_1g012832mg [Citrus sinensis]
Length=455

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/387 (76%), Positives = 328/387 (85%), Gaps = 12/387 (3%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIP---ATelsssal  1436
             + +KIT  SI   CF    +   ++    PKK    A+ KQ+S  RI     +  SS+ L
Sbjct  1     MTVKITWRSIVPNCF----SIQEEEKACKPKK----AVKKQSSIQRISFVDLSNPSSTTL  52

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             SEDLSISLAGSN+H FTL ELKV TQSFSSSNFLGEGGFG VHKGFIDDKLRPGL+AQPV
Sbjct  53    SEDLSISLAGSNLHVFTLAELKVTTQSFSSSNFLGEGGFGAVHKGFIDDKLRPGLQAQPV  112

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVK LDL+G QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL
Sbjct  113   AVKNLDLEGLQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  172

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FRRYS SLPWSTRMKIALGAAKGLAFLH+AEKPVIYRDFKASNILLDSDY  KLSDFGLA
Sbjct  173   FRRYSVSLPWSTRMKIALGAAKGLAFLHDAEKPVIYRDFKASNILLDSDYTAKLSDFGLA  232

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEGDDTHVSTRVMGT GYAAPEY+MTGHLT+ SDVYSFG+VLLELL+GR+++DK++P
Sbjct  233   KDGPEGDDTHVSTRVMGTQGYAAPEYVMTGHLTSMSDVYSFGVVLLELLSGRKSVDKSRP  292

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQ+L +WARP L D RKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RPTMST
Sbjct  293   QREQSLVEWARPMLNDARKLGRIMDPRLEGQYSETGARKAAALAYQCLSHRPKQRPTMST  352

Query  535   VVKTLEPLKDY-KDVSSVTFVYTAPTE  458
             VVKTLEPLKD+  D++  TFV+T PTE
Sbjct  353   VVKTLEPLKDFDDDIAIGTFVFTVPTE  379



>ref|XP_004507998.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=505

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/391 (73%), Positives = 330/391 (84%), Gaps = 11/391 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAI-TKQASFTRIPATe----lsssal  1436
             MKI   SIF  C++      +++  ++PK    + + TK  SF RI  T+     +++  
Sbjct  4     MKINWKSIFPSCYK------DENGYSSPKPAATKVVATKTNSFNRISLTDLSFPSATTLS  57

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             +EDLSISL GSN++ FTL ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDK+RPGL+ QPV
Sbjct  58    AEDLSISLVGSNLYVFTLAELKIITQGFSSSNFLGEGGFGPVHKGFIDDKVRPGLEPQPV  117

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVKLLDLDGSQGH+EWLTEV+FLGQLRHPHLVKLIGYCCEEEHRLLVYEY+PRGSLENQL
Sbjct  118   AVKLLDLDGSQGHKEWLTEVVFLGQLRHPHLVKLIGYCCEEEHRLLVYEYLPRGSLENQL  177

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FRRYSASLPWSTRMKIA+GAAKGLAFLH+A+KPVIYRDFKASNILLDSDY+ KLSDFGLA
Sbjct  178   FRRYSASLPWSTRMKIAVGAAKGLAFLHDAKKPVIYRDFKASNILLDSDYNAKLSDFGLA  237

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLE+LTGRR++DK +P
Sbjct  238   KDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLEILTGRRSVDKVRP  297

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQNL +WARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR ++RPTMS 
Sbjct  298   PREQNLVEWARPVLNDPRKLSRIMDPRLEGQYSEMGARKAAALAYQCLSHRPRNRPTMSN  357

Query  535   VVKTLEPLKDYKDVSSVTFVYTAPTEKDTKT  443
             VV TLEPL+D+ D+    FVYT P + + + 
Sbjct  358   VVNTLEPLQDFDDIPIGPFVYTVPNDVNNEV  388



>ref|XP_007203720.1| hypothetical protein PRUPE_ppa019028mg, partial [Prunus persica]
 gb|EMJ04919.1| hypothetical protein PRUPE_ppa019028mg, partial [Prunus persica]
Length=391

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/320 (85%), Positives = 292/320 (91%), Gaps = 1/320 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FTL ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL AQPVAVKLLDLDG
Sbjct  24    GSNLHIFTLGELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLTAQPVAVKLLDLDG  83

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGHREWLTEVIFLGQLRHPHLVKLIGYCCE+EHRLLVYEYMPRGSLENQLFRRYS SLP
Sbjct  84    SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEDEHRLLVYEYMPRGSLENQLFRRYSVSLP  143

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  144   WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPEGDDT  203

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P+REQNL +W
Sbjct  204   HVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRPHREQNLVEW  263

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L +PRKL RI+DPRLEG +SE GA+KAA LAY+C+SHR K RP +  VVK LEPLK
Sbjct  264   AKPMLNEPRKLSRIMDPRLEGQYSEIGARKAAALAYQCISHRPKQRPKICDVVKILEPLK  323

Query  508   DYKDVSSVTFVYTAPTEKDT  449
             D+ D+  + FVYT PTE D+
Sbjct  324   DFDDI-PIAFVYTVPTESDS  342



>gb|KHN06069.1| Serine/threonine-protein kinase [Glycine soja]
Length=460

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/385 (76%), Positives = 330/385 (86%), Gaps = 11/385 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MK    SIF GC++        + P+   KP++   TK  S  RI  T+LS  S+ LSED
Sbjct  4     MKTLWKSIFPGCYKG-------EYPSP--KPKKVVATKPNSSHRISVTDLSYPSTTLSED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LSISLAG+N+H F+L ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDKLR GLKAQPVAVK
Sbjct  55    LSISLAGTNLHVFSLAELKIITQQFSSSNFLGEGGFGPVHKGFIDDKLRHGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDLDGSQGH+EWLTEV+FLGQLRHPHLVKLIGYCCEEEHR+LVYEY+PRGSLENQLFRR
Sbjct  115   LLDLDGSQGHKEWLTEVVFLGQLRHPHLVKLIGYCCEEEHRVLVYEYLPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             +SASL WSTRMKIA+GAAKGLAFLHEAEKPVIYRDFKASNILL SDY+ KLSDFGLAKDG
Sbjct  175   FSASLSWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLGSDYNAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P RE
Sbjct  235   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRPPRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L D RKL RI+DPRLEG +SE G +KAA LA++CLSHR +SRP+MSTVVK
Sbjct  295   QNLVEWARPMLNDSRKLSRIMDPRLEGQYSEMGTKKAAALAFQCLSHRPRSRPSMSTVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKD  452
             TLEPL+D+ D+   TFVYTAP + +
Sbjct  355   TLEPLQDFDDIPIGTFVYTAPPDNN  379



>ref|XP_011078207.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Sesamum 
indicum]
Length=406

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/389 (75%), Positives = 329/389 (85%), Gaps = 10/389 (3%)
 Frame = -3

Query  1615  GIELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssal  1436
              +  K K+     F  CF+  P A N D     KKP    + KQ SF  I  ++ SSS L
Sbjct  2     AVNKKRKMKWQHRFRSCFK--PDAPNPDQ----KKP----VLKQPSFQGISLSDFSSSTL  51

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             SEDLSISLAGSN+H FTLQELK+ITQ+FSS+NFLG+GGFGPVHKGFIDDK+RPGLKAQPV
Sbjct  52    SEDLSISLAGSNLHVFTLQELKLITQNFSSTNFLGQGGFGPVHKGFIDDKMRPGLKAQPV  111

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVKLLDLDG+QGHREWLTEVIFLGQLRH +LVKLIGYCCEEEHRLLVYEYMPRGSLENQL
Sbjct  112   AVKLLDLDGAQGHREWLTEVIFLGQLRHRNLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  171

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FRR+S SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFK SNILLDSDY  KLSDFGLA
Sbjct  172   FRRFSVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDYTAKLSDFGLA  231

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             K+GPEGD+THVSTR+MGTHGYAAPEYIMTGHLTAASDVYSFG+VLLELL GR+++DK++P
Sbjct  232   KNGPEGDNTHVSTRIMGTHGYAAPEYIMTGHLTAASDVYSFGVVLLELLAGRKSVDKSRP  291

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
             +REQNLA+WARP LK+PRKL R++DPRLEG +SE GAQKAA +A+ CLSHR K RPTMS 
Sbjct  292   HREQNLAEWARPMLKNPRKLSRVMDPRLEGQYSEIGAQKAAAIAHRCLSHRPKLRPTMSQ  351

Query  535   VVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
             V+K LEPLKD  D+ + TFV     + D+
Sbjct  352   VIKVLEPLKDLDDIQTGTFVLAVSPDGDS  380



>ref|XP_006474726.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Citrus 
sinensis]
Length=455

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/387 (76%), Positives = 327/387 (84%), Gaps = 12/387 (3%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIP---ATelsssal  1436
             + +KIT  SI   CF    +   ++    PKK    A+ KQ+S  RI     +  SS+ L
Sbjct  1     MTVKITWRSIVPNCF----SIQEEEKACKPKK----AVKKQSSIQRISFVDLSNPSSTTL  52

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             SEDLSISLAGSN+H FTL ELKV TQSFSSSNFLGEGGFG VHKGFIDDKLRPGL+AQPV
Sbjct  53    SEDLSISLAGSNLHVFTLAELKVTTQSFSSSNFLGEGGFGAVHKGFIDDKLRPGLQAQPV  112

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVK LDL+G QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL
Sbjct  113   AVKNLDLEGLQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  172

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FRRYS SLPWSTRMKIALGAAKGLAFLH+AEKPVIYRDFKASNILLDSDY  KLSDFGLA
Sbjct  173   FRRYSVSLPWSTRMKIALGAAKGLAFLHDAEKPVIYRDFKASNILLDSDYTAKLSDFGLA  232

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEGDDTHVSTRVMGT GYAAPEY+MTGHLT+ SDVYSFG+VLLELL+GR+++DK++P
Sbjct  233   KDGPEGDDTHVSTRVMGTQGYAAPEYVMTGHLTSMSDVYSFGVVLLELLSGRKSVDKSRP  292

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQ+L +WARP L D RKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RP MST
Sbjct  293   QREQSLVEWARPMLNDARKLGRIMDPRLEGQYSETGARKAAALAYQCLSHRPKQRPAMST  352

Query  535   VVKTLEPLKDY-KDVSSVTFVYTAPTE  458
             VVKTLEPLKD+  D++  TFV+T PTE
Sbjct  353   VVKTLEPLKDFDDDIAIGTFVFTVPTE  379



>ref|XP_003542362.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
isoform 1 [Glycine max]
 gb|KHN07896.1| Putative receptor-like protein kinase [Glycine soja]
Length=451

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/318 (84%), Positives = 291/318 (92%), Gaps = 0/318 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F+L ELK+ITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL+AQPVAVKLLDLDG
Sbjct  57    GSNLHVFSLSELKIITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLEAQPVAVKLLDLDG  116

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGH+EWLTEV+FLGQLRHPHLVKLIGYCCEEEHRLLVYEY+PRGSLENQLFRRY+ASLP
Sbjct  117   SQGHKEWLTEVVFLGQLRHPHLVKLIGYCCEEEHRLLVYEYLPRGSLENQLFRRYTASLP  176

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIA GAAKGLAFLHEA+KPVIYRDFKASNILLDSDY+ KLSDFGLAKDGPEGDDT
Sbjct  177   WSTRMKIAAGAAKGLAFLHEAKKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDT  236

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P REQNL +W
Sbjct  237   HVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKGRPQREQNLVEW  296

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D RKL RI+DPRLEG +SE GA+KAA LAY+CLSHR +SRP MSTVV  LEPL+
Sbjct  297   ARPALNDSRKLGRIMDPRLEGQYSEVGARKAAALAYQCLSHRPRSRPLMSTVVNVLEPLQ  356

Query  508   DYKDVSSVTFVYTAPTEK  455
             D+ DV    FVYT P E+
Sbjct  357   DFDDVPIGPFVYTVPAEQ  374



>gb|KEH32432.1| receptor-like kinase [Medicago truncatula]
Length=514

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/392 (75%), Positives = 331/392 (84%), Gaps = 8/392 (2%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMP-ATPKKPRREAI-TKQASFTRIPATels---ssal  1436
             MKIT  SIF+ C++     G    P AT K+   + + TK +SF RI  T+LS   ++ L
Sbjct  1     MKITWKSIFSSCYQGE---GEYTSPKATTKETSTKVVATKTSSFNRISLTDLSFPSATTL  57

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             SEDLSISLAGSN++ FTL ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDK+R GL+ QPV
Sbjct  58    SEDLSISLAGSNLYVFTLAELKIITQGFSSSNFLGEGGFGPVHKGFIDDKVRAGLEPQPV  117

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVKLLDLDG+QGHREWLTEV+FLGQLRH HLVKLIGYCCEEEHRLLVYEY+PRGSLENQL
Sbjct  118   AVKLLDLDGTQGHREWLTEVVFLGQLRHQHLVKLIGYCCEEEHRLLVYEYLPRGSLENQL  177

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             F+RYS SLPWSTRMKIA+GAAKGLAFLH+A+KPVIYRDFK SNILLDSDY+ KLSDFGLA
Sbjct  178   FKRYSTSLPWSTRMKIAVGAAKGLAFLHDAKKPVIYRDFKGSNILLDSDYNAKLSDFGLA  237

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P
Sbjct  238   KDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKVRP  297

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQNL +WARP L D RKL RI+DPRLEG +SE GA+KAA LAY+CLSHR ++RPTMST
Sbjct  298   PREQNLVEWARPVLNDARKLSRIMDPRLEGQYSEMGARKAAALAYQCLSHRPRNRPTMST  357

Query  535   VVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTV  440
             VV TLEPLKD+ D+    FVYT PT+     V
Sbjct  358   VVNTLEPLKDFDDIPIGPFVYTVPTDVSNNEV  389



>ref|XP_006452809.1| hypothetical protein CICLE_v10008248mg [Citrus clementina]
 gb|ESR66049.1| hypothetical protein CICLE_v10008248mg [Citrus clementina]
Length=456

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/386 (76%), Positives = 327/386 (85%), Gaps = 12/386 (3%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIP---ATelsssal  1436
             + +KIT  SI   CF    +   ++    PKK    A+ KQ+S  RI     +  SS+ L
Sbjct  1     MTVKITWRSIVPNCF----SIQEEEKACKPKK----AVKKQSSIKRISFVDLSNPSSTTL  52

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             SEDLSISLAGSN+H FTL ELKV TQSFSSSNFLGEGGFG VHKGFIDDKLRPGL+AQPV
Sbjct  53    SEDLSISLAGSNLHVFTLAELKVTTQSFSSSNFLGEGGFGAVHKGFIDDKLRPGLQAQPV  112

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVK LDL+G QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL
Sbjct  113   AVKNLDLEGLQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  172

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FRRYS SLPWSTRMKIALGAAKGLAFLH+AEKPVIYRDFKASNILLDSDY  KLSDFGLA
Sbjct  173   FRRYSVSLPWSTRMKIALGAAKGLAFLHDAEKPVIYRDFKASNILLDSDYTAKLSDFGLA  232

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEGDDTHVSTRVMGT GYAAPEY+MTGHLT+ SDVYSFG+VLLELL+GR+++DK++P
Sbjct  233   KDGPEGDDTHVSTRVMGTQGYAAPEYVMTGHLTSMSDVYSFGVVLLELLSGRKSVDKSRP  292

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQ+L +WARP L D RKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RPTMST
Sbjct  293   QREQSLVEWARPMLNDARKLGRIMDPRLEGQYSETGARKAAALAYQCLSHRPKQRPTMST  352

Query  535   VVKTLEPLKDY-KDVSSVTFVYTAPT  461
             VVKTLEPLKD+  D++  TFV+T PT
Sbjct  353   VVKTLEPLKDFDDDIAIGTFVFTVPT  378



>ref|XP_008337855.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Malus domestica]
Length=479

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/390 (75%), Positives = 325/390 (83%), Gaps = 12/390 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssals  1433
             + +K   T  SI   C+++            PKK  ++  +KQ SF R+  T+LS+ + +
Sbjct  1     MAVKKVFTWRSILPDCYKSG---------VPPKKSSKKVASKQTSFQRLSLTDLSNPSTT  51

Query  1432  edl--sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQP  1259
                  SISLAGSN+H FTL ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL AQP
Sbjct  52    FSEDLSISLAGSNLHIFTLGELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLAAQP  111

Query  1258  VAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQ  1079
             VAVKLLDLDG+QGHREWLTEV+FLGQLRHPHLVKLIGYCCE+EHRLLVYEYMPRGSLENQ
Sbjct  112   VAVKLLDLDGTQGHREWLTEVVFLGQLRHPHLVKLIGYCCEDEHRLLVYEYMPRGSLENQ  171

Query  1078  LFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGL  899
             LFRRYS SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGL
Sbjct  172   LFRRYSVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTPKLSDFGL  231

Query  898   AKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTK  719
             AKDGPEGD+THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +
Sbjct  232   AKDGPEGDETHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNR  291

Query  718   PNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMS  539
             P REQNL +WARP L +PRKL RI+DPRLEG +SE GA+KAA LA++CLSHR K RP +S
Sbjct  292   PQREQNLVEWARPMLNEPRKLSRIMDPRLEGQYSELGARKAAALAFQCLSHRPKQRPKIS  351

Query  538   TVVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
              VVKTLEPLKD+ D+    FVYT P+E D 
Sbjct  352   EVVKTLEPLKDFDDI-PFAFVYTVPSESDN  380



>ref|XP_009359732.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=479

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/390 (75%), Positives = 324/390 (83%), Gaps = 12/390 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssals  1433
             + +K   T  SI   C+++            PKK  ++   KQ SF R+  T+LS+ + +
Sbjct  1     MAVKKVFTWRSILPDCYKSG---------VPPKKSSKKVAAKQTSFQRLSLTDLSNPSTT  51

Query  1432  edl--sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQP  1259
                  SISLAGSN+H FTL ELK+ITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL AQP
Sbjct  52    FSEDLSISLAGSNLHIFTLGELKMITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLAAQP  111

Query  1258  VAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQ  1079
             VAVKLLDLDG+QGHREWLTEV+FLGQLRHPHLVKLIGYCCE+EHRLLVYEYMPRGSLENQ
Sbjct  112   VAVKLLDLDGTQGHREWLTEVVFLGQLRHPHLVKLIGYCCEDEHRLLVYEYMPRGSLENQ  171

Query  1078  LFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGL  899
             LFRRYS SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGL
Sbjct  172   LFRRYSVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTPKLSDFGL  231

Query  898   AKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTK  719
             AKDGPEGD+THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +
Sbjct  232   AKDGPEGDETHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNR  291

Query  718   PNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMS  539
             P REQNL +WARP L +PRKL RI+DPRLEG +SE GA+KAA LA++CLSHR K RP +S
Sbjct  292   PQREQNLVEWARPMLNEPRKLSRIMDPRLEGQYSELGARKAAALAFQCLSHRPKQRPKIS  351

Query  538   TVVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
              VVKTLEPLKD+ D+    FVYT P+E D 
Sbjct  352   EVVKTLEPLKDFDDI-PFAFVYTVPSESDN  380



>gb|KDP33918.1| hypothetical protein JCGZ_07489 [Jatropha curcas]
Length=471

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/386 (78%), Positives = 331/386 (86%), Gaps = 9/386 (2%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelss-salsedls  1421
             K T  S+F  CF+        D      KP++E +TKQ SF R+  ++LS+ S LSEDLS
Sbjct  5     KFTWTSMFASCFKL-------DAEKPSSKPKKE-VTKQTSFHRVSVSDLSNPSLLSEDLS  56

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
             +SLAGSN+H FTL ELKVITQ+FSSSNF+GEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL
Sbjct  57    VSLAGSNLHVFTLAELKVITQNFSSSNFIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  116

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DLDG QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS
Sbjct  117   DLDGLQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  176

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              SLPWSTR+KIALGAAKGLAFLHE+EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPE
Sbjct  177   VSLPWSTRIKIALGAAKGLAFLHESEKPVIYRDFKASNILLDSDYTPKLSDFGLAKDGPE  236

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             G DTHVSTRVMGT GYAAPEYIMTGHLT+ SDVYSFG+VL+ELLTGRR++DK++P REQ 
Sbjct  237   GSDTHVSTRVMGTQGYAAPEYIMTGHLTSMSDVYSFGVVLVELLTGRRSVDKSRPQREQK  296

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             L +WARP L D RKL RI+DPRLEGM+SEAGAQ+AA LAY+CLSHR K RPTMSTV+K L
Sbjct  297   LIEWARPMLNDSRKLGRIMDPRLEGMYSEAGAQQAAALAYQCLSHRPKHRPTMSTVIKIL  356

Query  520   EPLKDYKDVSSVTFVYTAPTEKDTKT  443
             EPL + KD+   TFVYT PTE D  T
Sbjct  357   EPLMESKDIPVGTFVYTVPTESDNST  382



>ref|NP_001238581.1| kinase-like protein [Glycine max]
 gb|ACM89494.1| kinase-like protein [Glycine max]
 gb|KHN17726.1| Putative receptor-like protein kinase [Glycine soja]
Length=456

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/318 (84%), Positives = 289/318 (91%), Gaps = 0/318 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F+L ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDKLRPGL+AQPVAVKLLDLDG
Sbjct  57    GSNLHVFSLAELKIITQGFSSSNFLGEGGFGPVHKGFIDDKLRPGLEAQPVAVKLLDLDG  116

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGH+EWLTEV+FLGQLRHPHLVKLIGYCCEEEHRLLVYEY+PRGSLENQLFRRY+ASLP
Sbjct  117   SQGHKEWLTEVVFLGQLRHPHLVKLIGYCCEEEHRLLVYEYLPRGSLENQLFRRYTASLP  176

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIA GAAKGLAFLHEA+KPVIYRDFKASNILLDSDY+ KLSDFGLAKDGPEGDDT
Sbjct  177   WSTRMKIAAGAAKGLAFLHEAKKPVIYRDFKASNILLDSDYNAKLSDFGLAKDGPEGDDT  236

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +P REQNL +W
Sbjct  237   HVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKGRPQREQNLVEW  296

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             AR  L D RKL RI+DPRLEG +SE GA+KAA LAY+CLSHR +SRP MSTVV  LEPL+
Sbjct  297   ARSALNDSRKLSRIMDPRLEGQYSEVGARKAAALAYQCLSHRPRSRPLMSTVVNVLEPLQ  356

Query  508   DYKDVSSVTFVYTAPTEK  455
             D+ DV    FVYT P E+
Sbjct  357   DFDDVPIGPFVYTVPAEQ  374



>gb|KHG00343.1| hypothetical protein F383_18271 [Gossypium arboreum]
Length=451

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/385 (78%), Positives = 328/385 (85%), Gaps = 11/385 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MKIT  SIF  C +          P T  KP++E +TKQ+SF R+   ELS  S+ L+ED
Sbjct  4     MKITWRSIFPSCSKGVVK------PET--KPKKE-VTKQSSFNRLAMLELSYPSTMLTED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS SLAGSN+H FTL ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK
Sbjct  55    LSTSLAGSNLHVFTLGELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDL+G QGHREWLTEVIFL +LRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR
Sbjct  115   LLDLEGLQGHREWLTEVIFLAELRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YS SLPW+TRMKIALGAAKGLA+LHEAEKPVIYRDFKASNILLDSDY+GKLSDFGLAKDG
Sbjct  175   YSVSLPWATRMKIALGAAKGLAYLHEAEKPVIYRDFKASNILLDSDYNGKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +  RE
Sbjct  235   PEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVDKNRCPRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L D RKL RI+DPRLEG +SE  A+KAA LAY+CLSHR K RP MS VVK
Sbjct  295   QNLVEWARPMLNDARKLGRIMDPRLEGQYSETAARKAAALAYQCLSHRPKQRPKMSDVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKD  452
             TLEPL+D +DV    FVYT PT+ D
Sbjct  355   TLEPLQDDEDVLVGPFVYTVPTQSD  379



>ref|XP_007012630.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY30249.1| Kinase superfamily protein [Theobroma cacao]
Length=448

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/394 (75%), Positives = 327/394 (83%), Gaps = 18/394 (5%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MKIT  SI   C +             P+   ++ + KQ+SF R+   +LS  SS LSED
Sbjct  4     MKITWRSIIPSCSKGV---------EKPEPKPKKEVAKQSSFARLAMLDLSYPSSMLSED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS SLAGSN+H FTL ELKVITQSFSS+NFLGEGGFGPVHKGFIDDK+RPGLKAQPVAVK
Sbjct  55    LSTSLAGSNLHIFTLGELKVITQSFSSANFLGEGGFGPVHKGFIDDKVRPGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDL+G QGHREWLTEVIFL QLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR
Sbjct  115   LLDLEGLQGHREWLTEVIFLAQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YS SLPW+TRMKIALGAAKGLA+LH+A+KPVIYRDFKASNILLDSDY  KLSDFGLAKDG
Sbjct  175   YSVSLPWATRMKIALGAAKGLAYLHQADKPVIYRDFKASNILLDSDYTAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGT GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DK++  RE
Sbjct  235   PEGDDTHVSTRVMGTQGYAAPEYVMTGHLTAMSDVYSFGVVLLELLTGRRSLDKSRSQRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNLA+WARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RP MS VV 
Sbjct  295   QNLAEWARPMLNDPRKLGRIMDPRLEGQYSEMGARKAAALAYQCLSHRPKQRPKMSDVVS  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTE-------KDTK  446
             TLEPL+D +D+    FVYT PTE       KDTK
Sbjct  355   TLEPLQDSEDIPIGPFVYTVPTESGSPKEDKDTK  388



>ref|NP_178651.1| RPM1-induced protein kinase [Arabidopsis thaliana]
 gb|AAC95171.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL07094.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM45011.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC05986.1| RPM1-induced protein kinase [Arabidopsis thaliana]
Length=462

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/394 (74%), Positives = 324/394 (82%), Gaps = 10/394 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIP---ATels  1448
             + +K K++  S+  GC         + + A+ KKP+R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKVSWRSLIVGCL-----GDPETLMASSKKPKRKNDVIKKQSSFQRLSILDMSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGFIDDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHVFTLAELKVITQSFSSTNFLGEGGFGPVHKGFIDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEAE PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAENPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEGQYSETGARKAATLAYQCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
              MS VV  L  LKDY D+   TF YT P   D K
Sbjct  356   CMSAVVSILNDLKDYNDIPMGTFTYTVPNTPDNK  389



>ref|XP_002885808.1| hypothetical protein ARALYDRAFT_899389 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62067.1| hypothetical protein ARALYDRAFT_899389 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/397 (74%), Positives = 327/397 (82%), Gaps = 11/397 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIP---ATels  1448
             + +K K++  S+  GC         + + A+ KKP+R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKVSWRSLIVGCL-----GDPETLMASSKKPKRKDDVIKKQSSFQRLSILDMSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGFIDDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHVFTLAELKVITQSFSSTNFLGEGGFGPVHKGFIDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEAE PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAENPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLNDPRKLCRIMDPRLEGQYSETGARKAATLAYQCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
              MS VV  L  LKDY D+   TF YT P   D K+VS
Sbjct  356   CMSAVVSILNDLKDYNDIPMGTFTYTVPNTPD-KSVS  391



>ref|XP_006297624.1| hypothetical protein CARUB_v10013644mg [Capsella rubella]
 gb|EOA30522.1| hypothetical protein CARUB_v10013644mg [Capsella rubella]
Length=464

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/395 (73%), Positives = 324/395 (82%), Gaps = 11/395 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR---EAITKQASFTRIPA---Tel  1451
             + +K K++  S+  GC         + + A+ KKP+R   + I KQ+SF R+     +  
Sbjct  1     MAVKKKVSWRSLIVGCL-----GDPETLMASSKKPKRKGDDVIKKQSSFQRLAILDLSNP  55

Query  1450  sssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL  1271
             SS+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGFIDDKLRPGL
Sbjct  56    SSNTLSEDLSISLAGSDLHVFTLAELKVITQSFSSTNFLGEGGFGPVHKGFIDDKLRPGL  115

Query  1270  KAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGS  1091
             KAQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGS
Sbjct  116   KAQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGS  175

Query  1090  LENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLS  911
             LENQLFRRYSASLPWSTRMKIA GAA GL FLHEA+ PVIYRDFKASNILLDSDY  KLS
Sbjct  176   LENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAKNPVIYRDFKASNILLDSDYTAKLS  235

Query  910   DFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAI  731
             DFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SD+YSFG+VLLELLTGRR++
Sbjct  236   DFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDIYSFGVVLLELLTGRRSV  295

Query  730   DKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSR  551
             DK + +REQNL DWARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K+R
Sbjct  296   DKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEGQYSETGARKAATLAYQCLSHRPKNR  355

Query  550   PTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
             P MS VV  L  LK+Y D+   TF YT P   D K
Sbjct  356   PCMSAVVSILNDLKEYNDIPMGTFTYTVPNTPDNK  390



>ref|XP_010467109.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=465

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/397 (73%), Positives = 326/397 (82%), Gaps = 11/397 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIPA---Tels  1448
             + +K K++  S+  GC         + + A+ KK +R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKVSWRSLIVGCL-----GDPETLMASSKKNKRKDDVIKKQSSFQRLSILDLSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGFIDDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHVFTLAELKVITQSFSSTNFLGEGGFGPVHKGFIDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEA+ PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAKNPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SD+YSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDIYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEGQYSETGARKAATLAYQCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
              MS VV  L  LKDY D+   TF YT P   D K+VS
Sbjct  356   CMSAVVSILNDLKDYNDIPMGTFTYTVPNTPD-KSVS  391



>ref|XP_010488784.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Camelina sativa]
Length=472

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/397 (73%), Positives = 326/397 (82%), Gaps = 11/397 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIPA---Tels  1448
             + +K K++  S+  GC         + + A+ KK +R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKVSWRSLIVGCL-----GDPETLMASSKKTKRKDDVIKKQSSFQRLSILDLSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGFIDDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHVFTLAELKVITQSFSSTNFLGEGGFGPVHKGFIDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEA+ PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAKNPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SD+YSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDIYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEGQYSETGARKAATLAYQCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
              MS VV  L  LKDY D+   TF YT P   D K+VS
Sbjct  356   CMSAVVSILNDLKDYNDIPMGTFTYTVPNTPD-KSVS  391



>ref|XP_010412805.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Camelina sativa]
 ref|XP_010412812.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Camelina sativa]
Length=472

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/397 (73%), Positives = 326/397 (82%), Gaps = 11/397 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIPA---Tels  1448
             + +K K++  S+  GC         + + A+ KK +R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKVSWRSLIVGCL-----GDPETLMASSKKNKRKDDVIKKQSSFQRLSILDLSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGFIDDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHVFTLAELKVITQSFSSTNFLGEGGFGPVHKGFIDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVTFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEA+ PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAKNPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SD+YSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDIYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEGQYSETGARKAATLAYQCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
              MS VV  L  LKDY D++  TF YT P   D K+VS
Sbjct  356   CMSAVVSILNDLKDYNDIAMGTFTYTVPNTPD-KSVS  391



>ref|XP_008459841.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
melo]
Length=385

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/314 (82%), Positives = 287/314 (91%), Gaps = 0/314 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS+IH FTL ELK+I+Q+FSSSNFLGEGGFGPV+KGF+DD LRPGL  QPVA+KLLDLDG
Sbjct  63    GSDIHVFTLAELKLISQAFSSSNFLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWLTEVIFLGQL+H HLVKLIGYCCE+EHR+LVYEYMPRGSLENQLF++YS  LP
Sbjct  123   TQGHREWLTEVIFLGQLKHAHLVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAAKGLAFLHEA+KPVIYRDFKASN+LLDSDY  KLSDFGLAKDGPEGD+T
Sbjct  183   WSTRMKIALGAAKGLAFLHEADKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNT  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+++K+   R+QNLA+W
Sbjct  243   HVSTRVMGTHGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L DPRKL RI+DPRLEG +SE GAQKAA LAY+CLSHR K RPTMS VVK LEPLK
Sbjct  303   ARPMLNDPRKLSRIIDPRLEGQYSEMGAQKAASLAYQCLSHRPKQRPTMSAVVKVLEPLK  362

Query  508   DYKDVSSVTFVYTA  467
             D+ D+SS TFVYT 
Sbjct  363   DFDDISSGTFVYTV  376



>gb|KGN60504.1| hypothetical protein Csa_2G000130 [Cucumis sativus]
Length=385

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/314 (82%), Positives = 288/314 (92%), Gaps = 0/314 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS+IH FTL ELK+I+Q+FSSSNFLGEGGFGPV+KGF+DD LRPGL  QPVA+KLLDLDG
Sbjct  63    GSDIHVFTLAELKLISQAFSSSNFLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWLTEVIFLGQL+H HLVKLIGYCCE+EHR+LVYEYMPRGSLENQLF++YS  LP
Sbjct  123   TQGHREWLTEVIFLGQLKHAHLVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAAKGLAFLHEA+KPVIYRDFKASN+LLDSDY  KLSDFGLAKDGPEGD+T
Sbjct  183   WSTRMKIALGAAKGLAFLHEADKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNT  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+++K+   R+QNLA+W
Sbjct  243   HVSTRVMGTHGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L DPRKL RI+DPRLEG +SE GAQKAA LAY+CLSHR K RP+MS+VVK LEPLK
Sbjct  303   ARPMLNDPRKLSRIIDPRLEGQYSEMGAQKAASLAYQCLSHRPKQRPSMSSVVKVLEPLK  362

Query  508   DYKDVSSVTFVYTA  467
             D+ D+SS TFVYT 
Sbjct  363   DFDDISSGTFVYTV  376



>ref|XP_004141072.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cucumis sativus]
Length=360

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/314 (82%), Positives = 288/314 (92%), Gaps = 0/314 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS+IH FTL ELK+I+Q+FSSSNFLGEGGFGPV+KGF+DD LRPGL  QPVA+KLLDLDG
Sbjct  38    GSDIHVFTLAELKLISQAFSSSNFLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDG  97

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWLTEVIFLGQL+H HLVKLIGYCCE+EHR+LVYEYMPRGSLENQLF++YS  LP
Sbjct  98    TQGHREWLTEVIFLGQLKHAHLVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLP  157

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAAKGLAFLHEA+KPVIYRDFKASN+LLDSDY  KLSDFGLAKDGPEGD+T
Sbjct  158   WSTRMKIALGAAKGLAFLHEADKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNT  217

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+++K+   R+QNLA+W
Sbjct  218   HVSTRVMGTHGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEW  277

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L DPRKL RI+DPRLEG +SE GAQKAA LAY+CLSHR K RP+MS+VVK LEPLK
Sbjct  278   ARPMLNDPRKLSRIIDPRLEGQYSEMGAQKAASLAYQCLSHRPKQRPSMSSVVKVLEPLK  337

Query  508   DYKDVSSVTFVYTA  467
             D+ D+SS TFVYT 
Sbjct  338   DFDDISSGTFVYTV  351



>ref|XP_004157966.1| PREDICTED: putative receptor-like protein kinase At1g72540-like, 
partial [Cucumis sativus]
Length=338

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/314 (82%), Positives = 288/314 (92%), Gaps = 0/314 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS+IH FTL ELK+I+Q+FSSSNFLGEGGFGPV+KGF+DD LRPGL  QPVA+KLLDLDG
Sbjct  16    GSDIHVFTLAELKLISQAFSSSNFLGEGGFGPVYKGFLDDNLRPGLLPQPVAIKLLDLDG  75

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWLTEVIFLGQL+H HLVKLIGYCCE+EHR+LVYEYMPRGSLENQLF++YS  LP
Sbjct  76    TQGHREWLTEVIFLGQLKHAHLVKLIGYCCEDEHRMLVYEYMPRGSLENQLFKKYSIPLP  135

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAAKGLAFLHEA+KPVIYRDFKASN+LLDSDY  KLSDFGLAKDGPEGD+T
Sbjct  136   WSTRMKIALGAAKGLAFLHEADKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGDNT  195

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+++K+   R+QNLA+W
Sbjct  196   HVSTRVMGTHGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSVEKSSRKRQQNLAEW  255

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L DPRKL RI+DPRLEG +SE GAQKAA LAY+CLSHR K RP+MS+VVK LEPLK
Sbjct  256   ARPMLNDPRKLSRIIDPRLEGQYSEMGAQKAASLAYQCLSHRPKQRPSMSSVVKVLEPLK  315

Query  508   DYKDVSSVTFVYTA  467
             D+ D+SS TFVYT 
Sbjct  316   DFDDISSGTFVYTV  329



>ref|XP_010666301.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/319 (83%), Positives = 293/319 (92%), Gaps = 1/319 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSNIH F L EL++ITQ+FSSSNFLGEGGFGPVHKGFIDDK+RPGLKAQPVAVK+LDLDG
Sbjct  72    GSNIHVFNLNELRLITQNFSSSNFLGEGGFGPVHKGFIDDKIRPGLKAQPVAVKILDLDG  131

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWL EVI LGQLRHPHLVKLIGYCCE+EHR+LVYEYMPRGSLENQLFRR+SASLP
Sbjct  132   TQGHREWLAEVIVLGQLRHPHLVKLIGYCCEDEHRVLVYEYMPRGSLENQLFRRFSASLP  191

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIALGAAKGLAFLHEAEKP+IYRDFKASNILLDSD+  KLSDFGLAKDGPEGDDT
Sbjct  192   WLTRLKIALGAAKGLAFLHEAEKPIIYRDFKASNILLDSDFTPKLSDFGLAKDGPEGDDT  251

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTAASDVYSFG+VLLELLTGRR++DK +P REQNLA+W
Sbjct  252   HVSTRVMGTQGYAAPEYIMTGHLTAASDVYSFGVVLLELLTGRRSMDKNRPPREQNLAEW  311

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARPQL+  R+L R++DPRLE  +SE GAQKAALLAY+CLSHR KSRPTMS VVKTLEPL 
Sbjct  312   ARPQLQSQRRLTRLMDPRLESQYSEDGAQKAALLAYQCLSHRPKSRPTMSVVVKTLEPLL  371

Query  508   D-YKDVSSVTFVYTAPTEK  455
             +   D+ S  FVYTAP+++
Sbjct  372   NLVHDIPSGPFVYTAPSDQ  390



>ref|XP_010488785.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Camelina sativa]
Length=449

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/368 (77%), Positives = 314/368 (85%), Gaps = 6/368 (2%)
 Frame = -3

Query  1525  ATPKKPRR--EAITKQASFTRIPA---TelsssalsedlsislAGSNIHAFTLQELKVIT  1361
             A+ KK +R  + I KQ+SF R+     +  SS+ LSEDLSISLAGS++H FTL ELKVIT
Sbjct  2     ASSKKTKRKDDVIKKQSSFQRLSILDLSNPSSNTLSEDLSISLAGSDLHVFTLAELKVIT  61

Query  1360  QSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQ  1181
             QSFSS+NFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDL+G QGHREWLTEV+FLGQ
Sbjct  62    QSFSSTNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGLQGHREWLTEVMFLGQ  121

Query  1180  LRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLA  1001
             L+H +LVKLIGYCCEEEHR LVYE+MPRGSLENQLFRRYSASLPWSTRMKIA GAA GL 
Sbjct  122   LKHKNLVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQ  181

Query  1000  FLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPE  821
             FLHEA+ PVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPE
Sbjct  182   FLHEAKNPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPE  241

Query  820   YIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILD  641
             YIMTGHLTA SD+YSFG+VLLELLTGRR++DK + +REQNL DWARP L DPRKL RI+D
Sbjct  242   YIMTGHLTARSDIYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMD  301

Query  640   PRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPT  461
             PRLEG +SE GA+KAA LAY+CLSHR K+RP MS VV  L  LKDY D+   TF YT P 
Sbjct  302   PRLEGQYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPN  361

Query  460   EKDTKTVS  437
               D K+VS
Sbjct  362   TPD-KSVS  368



>gb|EPS67912.1| hypothetical protein M569_06861, partial [Genlisea aurea]
Length=391

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/372 (76%), Positives = 323/372 (87%), Gaps = 12/372 (3%)
 Frame = -3

Query  1579  IFTGCFRA-APAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedlsislAGS  1403
             +  GCF+A AP          PK  ++ A   Q SF RIP T+LSSS LSE+LSISLAGS
Sbjct  7     LLAGCFKAEAP---------DPKAHKKTA--SQISFHRIPLTDLSSSTLSEELSISLAGS  55

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+HAFTLQELK+ITQ+FSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG Q
Sbjct  56    NLHAFTLQELKIITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGGQ  115

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWLTEV+FLGQLRH +LVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR+S SLPWS
Sbjct  116   GHREWLTEVVFLGQLRHRNLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRFSVSLPWS  175

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TRMKIA+GAAKGL FLHEAE PVI+RDFKASNILLDSD+  KLSDFGLAKDGP+GDDTHV
Sbjct  176   TRMKIAIGAAKGLGFLHEAENPVIFRDFKASNILLDSDFTAKLSDFGLAKDGPDGDDTHV  235

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             STR++GTHGYAAPEYI+TGHLTAASDVYSFG+VLLEL+TGR+++DK++P+REQNL +WA+
Sbjct  236   STRILGTHGYAAPEYILTGHLTAASDVYSFGVVLLELITGRKSVDKSRPSREQNLVEWAK  295

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             P LK+PR+L R++DPRLEG + EAGAQKAA LAY+CLS R K RPT+  V++ LE LKD 
Sbjct  296   PMLKNPRRLPRVIDPRLEGQYPEAGAQKAAELAYQCLSQRPKLRPTIRQVIQILETLKDL  355

Query  502   KDVSSVTFVYTA  467
              D+   T+V++ 
Sbjct  356   DDMQIGTYVFSV  367



>gb|KFK39885.1| hypothetical protein AALP_AA3G301300 [Arabis alpina]
Length=460

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/398 (73%), Positives = 327/398 (82%), Gaps = 10/398 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITK--QASFTRIPA---Tels  1448
             + +K KI+  S+ +GC         + + A+PKK +++      Q+SF R+     +  S
Sbjct  1     MAVKKKISWRSLVSGCL-----GDPETVLASPKKIKKKDDVIKKQSSFQRLSNLDLSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGF+DDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHKFTLAELKVITQSFSSTNFLGEGGFGPVHKGFVDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA G+ FLHEAEKPVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGVQFLHEAEKPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP L D RKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K+RP
Sbjct  296   KKRTSREQNLVDWARPMLNDARKLARIMDPRLEGQYSENGARKAAALAYQCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVST  434
             +MSTVV  L  LKDY D+   TFVYT P   DT    T
Sbjct  356   SMSTVVSILNDLKDYNDIPMGTFVYTVPNTPDTSVSDT  393



>gb|KHG27920.1| hypothetical protein F383_06954 [Gossypium arboreum]
Length=443

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/383 (75%), Positives = 315/383 (82%), Gaps = 11/383 (3%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MKIT  SI   C +             P+   ++ ++KQ SFTR    +LS  SS LSED
Sbjct  4     MKITWRSIIPSCSKGV---------VKPEGKPKKDVSKQGSFTRFAMLDLSYPSSMLSED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS SLAGSN+H FTL EL++ITQSFSS NFLGEGGFGPVHKGFIDDKLRPGLKAQ VAVK
Sbjct  55    LSTSLAGSNLHVFTLAELRLITQSFSSVNFLGEGGFGPVHKGFIDDKLRPGLKAQSVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDL+G QGHREWLTEVIFL QLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR
Sbjct  115   LLDLEGLQGHREWLTEVIFLAQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YS SLPW+TRMKIALGAAKGLA+LHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAK G
Sbjct  175   YSVSLPWATRMKIALGAAKGLAYLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKGG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGT GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DK +  RE
Sbjct  235   PEGDDTHVSTRVMGTEGYAAPEYVMTGHLTAMSDVYSFGVVLLELLTGRRSLDKKRSPRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L D RKL RI+DPRLEG +SE GA+KAA LAY+CLS R K RP M  VV 
Sbjct  295   QNLVEWARPILNDARKLGRIMDPRLEGQYSEMGARKAAALAYQCLSQRPKQRPKMCDVVG  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTE  458
              LEPL+DY+D+   +FVYT P +
Sbjct  355   ILEPLQDYEDIPIGSFVYTVPNQ  377



>ref|XP_010533019.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=451

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/387 (73%), Positives = 319/387 (82%), Gaps = 9/387 (2%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIP---ATelsss  1442
             + +K K +  S   GCF+      + +   +  KP+   + KQ SF R+     +  SS+
Sbjct  1     MAVKKKSSWRSFVAGCFQ------DQNFEKSSDKPKNSEVKKQKSFQRLSILDMSNPSST  54

Query  1441  alsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQ  1262
              LSEDLSISLAGS++H FTL ELKVITQSFSS++FLGEGGFG VHKGFIDDKLRPGLKAQ
Sbjct  55    TLSEDLSISLAGSDLHIFTLAELKVITQSFSSNSFLGEGGFGQVHKGFIDDKLRPGLKAQ  114

Query  1261  PVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLEN  1082
             PVAVK LD DG QGHREWLTEVIFLGQL+HP+LVKLIGYCCE+EHRLLVYE+MPRGSLEN
Sbjct  115   PVAVKNLDPDGLQGHREWLTEVIFLGQLKHPNLVKLIGYCCEDEHRLLVYEFMPRGSLEN  174

Query  1081  QLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFG  902
             QLFRRYSASLPW+TRMKIA GAAKGL FLHEAEKPVIYRDFKASNILLDSDY  KLSDFG
Sbjct  175   QLFRRYSASLPWATRMKIAHGAAKGLQFLHEAEKPVIYRDFKASNILLDSDYMAKLSDFG  234

Query  901   LAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKT  722
             LAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK 
Sbjct  235   LAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVDKK  294

Query  721   KPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTM  542
             +  R+QNL DWARP L DPRKL RI+DPRLEG +SE GA+KAA LAY+CLSHR K RP M
Sbjct  295   RSPRQQNLVDWARPMLNDPRKLSRIMDPRLEGQYSETGARKAAALAYQCLSHRPKHRPNM  354

Query  541   STVVKTLEPLKDYKDVSSVTFVYTAPT  461
             S VV  L+ LK+YKD+    FV+T P+
Sbjct  355   SAVVAVLDDLKNYKDIPMGPFVFTVPS  381



>ref|XP_010273843.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nelumbo 
nucifera]
Length=481

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/383 (73%), Positives = 320/383 (84%), Gaps = 12/383 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsss---alsed  1427
             K T  S+   CF+A       ++P   ++P ++ + KQ+SF RI  +++S S     ++D
Sbjct  4     KFTWKSLVPCCFQA-------EIPL--EEPTKKIVKKQSSFQRISVSDISLSGPSLSADD  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             +S SL GSN+H FTL ELKVITQSFS+SNFLGEGGFGPVHKGFIDDKL+PGLKAQPVAVK
Sbjct  55    ISSSLIGSNLHVFTLAELKVITQSFSTSNFLGEGGFGPVHKGFIDDKLKPGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             L++L+G+QGHREWLTEVIFLGQLRHPHLVKLIGYCCE+EHRLLVYEYM RGSLENQLFRR
Sbjct  115   LMNLEGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEDEHRLLVYEYMVRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YSASLPW TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDG
Sbjct  175   YSASLPWLTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGD+THVSTRVMGTHGYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DK +  RE
Sbjct  235   PEGDETHVSTRVMGTHGYAAPEYVMTGHLTAKSDVYSFGVVLLELLTGRRSVDKNRGPRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             Q+L DW RP L D RKL RI+DPRLEG +S  GA KA  LA++CLS   KSRPTMS+VV+
Sbjct  295   QSLVDWGRPLLNDVRKLDRIMDPRLEGQYSVKGAMKAGALAFKCLSRNPKSRPTMSSVVE  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTE  458
             TLE ++   D+   TFVY APTE
Sbjct  355   TLELIQKLDDIPVGTFVYIAPTE  377



>ref|XP_006396126.1| hypothetical protein EUTSA_v10002520mg [Eutrema salsugineum]
 gb|ESQ36905.1| hypothetical protein EUTSA_v10002520mg [Eutrema salsugineum]
Length=462

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/389 (73%), Positives = 318/389 (82%), Gaps = 10/389 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIPA---Tels  1448
             + +K K++  S+  GC         + + A  +KP+R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKLSWRSLVAGCL-----GDPETIMAPSEKPKRKDDVIKKQSSFQRLSILDLSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGEGGFGPVHKGF+DDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHKFTLAELKVITQSFSSTNFLGEGGFGPVHKGFVDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEAE PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAENPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP L D RKL RI+DPRLEG +SE  A+KAA LAY CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLNDARKLCRIMDPRLEGQYSEIAAKKAASLAYLCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPT  461
              MS VV  L  LKDY D+   TF YT P 
Sbjct  356   CMSAVVSILNDLKDYNDIPMGTFTYTVPN  384



>gb|KHG16004.1| hypothetical protein F383_02714 [Gossypium arboreum]
Length=462

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/388 (72%), Positives = 319/388 (82%), Gaps = 5/388 (1%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels--ssalsed  1427
             MK T  SI   C +    A  +       K +    +KQ SF+R+   +LS  SS  +ED
Sbjct  4     MKFTWRSIIPRCSKGIEEAEAEAEAEPETKKQD---SKQGSFSRLAMIDLSYPSSRFTED  60

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS SLAGSN++ FTL+ELKVITQ FSS+NFLGEGGFGPVHKGFIDD LRPGL+AQPVAVK
Sbjct  61    LSTSLAGSNLYVFTLEELKVITQCFSSANFLGEGGFGPVHKGFIDDNLRPGLEAQPVAVK  120

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDL+G QGHREWLTEV+FL QL HPHLVKLIGYCCE+EHRLLVYEYMPRGSLENQLF +
Sbjct  121   LLDLEGLQGHREWLTEVVFLAQLSHPHLVKLIGYCCEDEHRLLVYEYMPRGSLENQLFAK  180

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YS  LPWSTRMKIALGAAKGLA+LHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDG
Sbjct  181   YSVPLPWSTRMKIALGAAKGLAYLHEAEKPVIYRDFKASNILLDSDYSAKLSDFGLAKDG  240

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGD THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK++  RE
Sbjct  241   PEGDKTHVSTRVMGTRGYAAPEYIMTGHLTAMSDVYSFGVVLLELLTGRRSLDKSRSPRE  300

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNLA+WARP L + R+L RI+DP+LEG +SE GA+KAA LAY+CLSHR+K RP MS VV 
Sbjct  301   QNLAEWARPMLNESRRLARIMDPKLEGQYSETGARKAAALAYQCLSHRAKQRPKMSDVVN  360

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKDTKT  443
              LEPL DY++ S  TFVYT PT ++ ++
Sbjct  361   ILEPLLDYEETSVGTFVYTVPTHQNGRS  388



>ref|XP_004488084.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=460

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/317 (80%), Positives = 286/317 (90%), Gaps = 0/317 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G+NIHAFT+ ELK+ITQ FSSSNFLGEGGFGPVHKGFIDDKLR GLKAQPVAVKLLDL+ 
Sbjct  66    GTNIHAFTVAELKIITQQFSSSNFLGEGGFGPVHKGFIDDKLRYGLKAQPVAVKLLDLES  125

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EWLTEV+ LGQL HPHLVKLIGYCCE+EHRLLVYEY+PRGSLENQLFRR+SASLP
Sbjct  126   KQGHKEWLTEVVVLGQLTHPHLVKLIGYCCEDEHRLLVYEYLPRGSLENQLFRRFSASLP  185

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIA+GAAKGLAFLHEAEKPVI+RDFKASNILLDSDY+ KLSDFGLAKDGPEGDDT
Sbjct  186   WSTRMKIAVGAAKGLAFLHEAEKPVIFRDFKASNILLDSDYNPKLSDFGLAKDGPEGDDT  245

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DK +P REQNL DW
Sbjct  246   HVSTRVMGTQGYAAPEYVMTGHLTAKSDVYSFGVVLLELLTGRKSVDKNRPPREQNLVDW  305

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D RK+ +++DP+LEG +SE G +KAA LA++CLSHR KSRPTMS VVK LEPL+
Sbjct  306   ARPMLNDSRKISKLMDPKLEGQYSEMGTKKAASLAFQCLSHRPKSRPTMSNVVKILEPLQ  365

Query  508   DYKDVSSVTFVYTAPTE  458
             D+ D+    FVY AP +
Sbjct  366   DFDDIPMGPFVYHAPID  382



>ref|XP_004144034.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
sativus]
 ref|XP_004161115.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
sativus]
 gb|KGN66304.1| hypothetical protein Csa_1G597020 [Cucumis sativus]
Length=421

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/353 (77%), Positives = 308/353 (87%), Gaps = 5/353 (1%)
 Frame = -3

Query  1486  QASFTRIPATelsssalsedl--sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGP  1313
             Q+SFTRI   +LS+         SISLAGSNIH FTL E+KV+TQ+FS+ +F+GEGGFGP
Sbjct  33    QSSFTRISQLDLSNPNSLLSEDLSISLAGSNIHMFTLGEIKVMTQTFSTGSFIGEGGFGP  92

Query  1312  VHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEE  1133
             V+KGFIDDKLRPGLKAQPVAVKLLDLDG+QGHREWLTEVIFLGQLR PHLVKLIGYCCE+
Sbjct  93    VYKGFIDDKLRPGLKAQPVAVKLLDLDGTQGHREWLTEVIFLGQLRDPHLVKLIGYCCED  152

Query  1132  EHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKA  953
             EHR+LVYEYMPRGSLENQLFRR+S SL WSTRMKIALGAAKGLAFLH AEKPVIYRDFKA
Sbjct  153   EHRVLVYEYMPRGSLENQLFRRFSVSLSWSTRMKIALGAAKGLAFLHGAEKPVIYRDFKA  212

Query  952   SNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSF  773
             SNILLDSDY+ KLSDFGLAKDGP+GDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSF
Sbjct  213   SNILLDSDYNAKLSDFGLAKDGPDGDDTHVSTRVMGTEGYAAPEYIMTGHLTAMSDVYSF  272

Query  772   GIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAA  593
             G+VLLELLTGRR+++K++P+REQNL ++ARP L D RKL RI+D RLEG +SE GA+KAA
Sbjct  273   GVVLLELLTGRRSLEKSRPHREQNLVEYARPMLMDNRKLSRIMDTRLEGQYSETGARKAA  332

Query  592   LLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVST  434
              LAY+CLSHR K RPTM+ VVK LEPLKDY+D+   TFV+  P   D+  VS+
Sbjct  333   TLAYQCLSHRPKQRPTMNEVVKILEPLKDYQDMPIGTFVFEMP---DSSPVSS  382



>ref|XP_009102353.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
Length=457

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/397 (74%), Positives = 325/397 (82%), Gaps = 11/397 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIPA---Tels  1448
             + +K KI+  S+   C         D + A P+KP+R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKISWRSLVASCL-----GDPDIIMAPPQKPKRKDDVIKKQSSFQRLSVLDLSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQ FSS+NFLGEGGFGPVHKGF+DDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHKFTLGELKVITQCFSSTNFLGEGGFGPVHKGFVDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEAE PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAENPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP LKD RKL RI+DPRLEG +SE GA+KAA LAY CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLKDARKLDRIMDPRLEGQYSETGAKKAAALAYLCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
              MSTVV  L  LKDY D+   TF YT P   + K+VS
Sbjct  356   CMSTVVSILNDLKDYNDIPMGTFTYTVPNTPE-KSVS  391



>emb|CDY33401.1| BnaA07g04380D [Brassica napus]
Length=457

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/397 (74%), Positives = 325/397 (82%), Gaps = 11/397 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIPA---Tels  1448
             + +K KI+  S+   C         D + A P+KP+R  + I KQ+SF R+     +  S
Sbjct  1     MAVKKKISWRSLVASCL-----GDPDIIMAPPQKPKRKDDVIKKQSSFQRLSVLDLSNPS  55

Query  1447  ssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLK  1268
             S+ LSEDLSISLAGS++H FTL ELKVITQ FSS+NFLGEGGFGPVHKGF+DDKLRPGLK
Sbjct  56    SNTLSEDLSISLAGSDLHKFTLGELKVITQCFSSTNFLGEGGFGPVHKGFVDDKLRPGLK  115

Query  1267  AQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSL  1088
             AQPVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSL
Sbjct  116   AQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSL  175

Query  1087  ENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSD  908
             ENQLFRRYSASLPWSTRMKIA GAA GL FLHEAE PVIYRDFKASNILLDSDY  KLSD
Sbjct  176   ENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAENPVIYRDFKASNILLDSDYTAKLSD  235

Query  907   FGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAID  728
             FGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++D
Sbjct  236   FGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVD  295

Query  727   KTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRP  548
             K + +REQNL DWARP LKD RKL RI+DPRLEG +SE GA+KAA LAY CLSHR K+RP
Sbjct  296   KKRSSREQNLVDWARPMLKDARKLDRIMDPRLEGQYSETGAKKAAALAYLCLSHRPKNRP  355

Query  547   TMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
              MSTVV  L  LKDY D+   TF YT P   + K+VS
Sbjct  356   CMSTVVSILNDLKDYNDIPMGTFTYTVPNTPE-KSVS  391



>emb|CDY65349.1| BnaCnng46760D [Brassica napus]
Length=457

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/395 (74%), Positives = 325/395 (82%), Gaps = 11/395 (3%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRR--EAITKQASFTRIPA---Telsss  1442
             +K KI+  S+   C         D + A P+KP+R  + I KQ+SF R+     +  SS+
Sbjct  3     VKKKISWRSLVASCL-----GDPDIIMAPPQKPKRKDDVIKKQSSFQRLSVLDLSNPSSN  57

Query  1441  alsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQ  1262
              LSEDLSISLAGS++H FTL ELK+ITQ FSS+NFLGEGGFGPVHKGF+DDKLRPGLKAQ
Sbjct  58    TLSEDLSISLAGSDLHKFTLGELKIITQCFSSTNFLGEGGFGPVHKGFVDDKLRPGLKAQ  117

Query  1261  PVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLEN  1082
             PVAVKLLDL+G QGHREWLTEV+FLGQL+H +LVKLIGYCCEEEHR LVYE+MPRGSLEN
Sbjct  118   PVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSLEN  177

Query  1081  QLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFG  902
             QLFRRYSASLPWSTRMKIA GAA GL FLHEAE PVIYRDFKASNILLDSDY  KLSDFG
Sbjct  178   QLFRRYSASLPWSTRMKIAHGAATGLQFLHEAENPVIYRDFKASNILLDSDYTAKLSDFG  237

Query  901   LAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKT  722
             LAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK 
Sbjct  238   LAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVDKK  297

Query  721   KPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTM  542
             + +REQNL DWARP LKD RKL RI+DPRLEG +SE GA+KAA LAY CLSHR K+RP M
Sbjct  298   RSSREQNLVDWARPMLKDARKLDRIMDPRLEGQYSETGAKKAAALAYLCLSHRPKNRPCM  357

Query  541   STVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
             STVV  L+ LKDY D+   TF YT P   + K+VS
Sbjct  358   STVVSILDDLKDYNDIPMGTFTYTVPNTPE-KSVS  391



>gb|KFK22322.1| hypothetical protein AALP_AAs55656U000100 [Arabis alpina]
Length=428

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/354 (78%), Positives = 307/354 (87%), Gaps = 4/354 (1%)
 Frame = -3

Query  1498  AITKQASFTRIPA---TelsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGE  1328
              ITKQ SF R+     +  SS+ LSEDLSISLAGS++H FTL ELKVITQSFSS+NFLGE
Sbjct  25    VITKQKSFLRLSILDISNPSSTTLSEDLSISLAGSDLHEFTLAELKVITQSFSSNNFLGE  84

Query  1327  GGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIG  1148
             GGFGPVHKGFIDD+LRPGLKAQPVAVKLLDLDG QGHREWLTEV+FLGQL+HP+LVKLIG
Sbjct  85    GGFGPVHKGFIDDRLRPGLKAQPVAVKLLDLDGLQGHREWLTEVVFLGQLKHPNLVKLIG  144

Query  1147  YCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIY  968
             YCCE+EHRLLVYE+MPRGSLE+QLFRRYS SLPWSTRMKIA GAAKGL FLHEAEKPVIY
Sbjct  145   YCCEDEHRLLVYEFMPRGSLESQLFRRYSVSLPWSTRMKIAHGAAKGLQFLHEAEKPVIY  204

Query  967   RDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAAS  788
             RDFKASNILLDSDY  KLSDFGLAKDGPEGD+THVSTRVMGT GYAAPEYIMTGHLTA S
Sbjct  205   RDFKASNILLDSDYTAKLSDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTGHLTAKS  264

Query  787   DVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAG  608
             DVYSFG+VLLELLTGRR+++K +  REQNL DWARP L +PRKL RI+DPRLEG FSE+G
Sbjct  265   DVYSFGVVLLELLTGRRSVNKKRATREQNLVDWARPMLNEPRKLGRIMDPRLEGQFSESG  324

Query  607   AQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYK-DVSSVTFVYTAPTEKDT  449
             A+KAA LAY+CLS+R K+RP +STVV  L+ +K Y  D+   TF YT  +   T
Sbjct  325   ARKAAALAYQCLSYRPKNRPCISTVVSILQDIKAYNDDIPIGTFTYTVSSSPAT  378



>ref|XP_010261848.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=478

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/384 (72%), Positives = 315/384 (82%), Gaps = 14/384 (4%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels---ssalsed  1427
             KIT  S   GC+RA       ++P  P++P++  I KQ S + I  T+++   S   ++D
Sbjct  4     KITWKSFVPGCYRA-------EIP--PEEPKKR-IKKQTSSSWISLTDINNPGSPLSADD  53

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             +S S+ GSN+HAF L EL+VITQSFSSSN LGEGGFGPVHKGFIDDKLRPGLKAQ VAVK
Sbjct  54    ISNSVIGSNLHAFMLAELRVITQSFSSSNILGEGGFGPVHKGFIDDKLRPGLKAQAVAVK  113

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDL+G QGHREWL EVIFLGQLRHP+LVKLIGYCCE+EHRLLVYEYM RGSLENQLFRR
Sbjct  114   LLDLEGLQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEHRLLVYEYMVRGSLENQLFRR  173

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YSASLPWSTR+KIALGAAKGL FLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDG
Sbjct  174   YSASLPWSTRIKIALGAAKGLQFLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKDG  233

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGD+THVSTRVMGT GYAAPEY+MTGHLT  SDVYSFG+V LE+LTGRR++DK +  RE
Sbjct  234   PEGDETHVSTRVMGTQGYAAPEYVMTGHLTKMSDVYSFGVVFLEMLTGRRSMDKNRGPRE  293

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WARP L D RKL RI+DP+LEG +S  GAQKAA LAY+CLSH  KSRPTM  VVK
Sbjct  294   QNLVEWARPLLNDSRKLERIMDPKLEGQYSNKGAQKAAALAYQCLSHNPKSRPTMGIVVK  353

Query  526   TLEPLKDY-KDVSSVTFVYTAPTE  458
             TLE ++ Y  D+    FVY AP+E
Sbjct  354   TLELIQTYNNDIPIGPFVYIAPSE  377



>ref|XP_003595279.1| Kinase-like protein [Medicago truncatula]
 gb|AES65530.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=543

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/385 (73%), Positives = 319/385 (83%), Gaps = 8/385 (2%)
 Frame = -3

Query  1600  MKITLDSIF-TGCFRAA-PAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsed  1427
             MK+   SIF   CF+   P+     + AT  KPR    +   S  RI   ELS+   +ED
Sbjct  1     MKLKWKSIFPASCFKGEYPSPKPKKVVAT--KPR----SASTSTHRISIEELSNPNATED  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LSISLAGSN++AFT+ ELKVITQ FSSSN LG GGFGPVHKGFIDDK+RPGLKAQ VAVK
Sbjct  55    LSISLAGSNLYAFTVAELKVITQQFSSSNHLGAGGFGPVHKGFIDDKVRPGLKAQSVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDL+  QGH+EWLTEV+ LGQLR PHLVKLIGYC E+EHRLLVYEY+PRGSLENQLFRR
Sbjct  115   LLDLESKQGHKEWLTEVVVLGQLRDPHLVKLIGYCIEDEHRLLVYEYLPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             +SASLPWSTRMKIA+GAAKGLAFLHEAE+PVI+RDFKASNILLDSDY+ KLSDFGLAKDG
Sbjct  175   FSASLPWSTRMKIAVGAAKGLAFLHEAEQPVIFRDFKASNILLDSDYNAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGT GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DK +P RE
Sbjct  235   PEGDDTHVSTRVMGTQGYAAPEYVMTGHLTAKSDVYSFGVVLLELLTGRKSVDKNRPQRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL DWARP L D RK+ +I+DP+LEG +SE GA+KAA LAY+CLSHR KSRPTMS VVK
Sbjct  295   QNLVDWARPMLIDSRKISKIMDPKLEGQYSEMGAKKAASLAYQCLSHRPKSRPTMSNVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKD  452
              LEPL+D+ D+    FVYT P + +
Sbjct  355   ILEPLQDFDDIPIGPFVYTVPIDNN  379



>ref|XP_002280196.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 ref|XP_010648396.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 ref|XP_010648397.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
Length=440

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/390 (69%), Positives = 315/390 (81%), Gaps = 14/390 (4%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRA-APAAGNDDMPATPKKPRREAITKQASFTRIPATels---ssa  1439
             + +KIT  +I  GC++   P A          + R++ + KQ SF R+  ++LS   S  
Sbjct  1     MTLKITWKTIMPGCYKTETPIA----------ESRKKPVLKQGSFQRLSLSDLSNPGSPL  50

Query  1438  lsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQP  1259
               +D+S SL GSN++ FTL EL+ IT +FS SN LGEGGFGPV+KGFID+KLRP LKAQP
Sbjct  51    SVDDISNSLIGSNLYTFTLAELREITHNFSPSNLLGEGGFGPVYKGFIDEKLRPKLKAQP  110

Query  1258  VAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQ  1079
             VAVKLLDLDG QGHREWL E+IFLGQLRHPHLVKLIGYCCE+EHRLL+YEYM RGSLENQ
Sbjct  111   VAVKLLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGYCCEDEHRLLIYEYMARGSLENQ  170

Query  1078  LFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGL  899
             LFRRYSA+LPWS RMKI  GAAKGLAFLHE +KPVIYRDFKASNILLD DY  KLSDFGL
Sbjct  171   LFRRYSAALPWSARMKILFGAAKGLAFLHEGDKPVIYRDFKASNILLDPDYTAKLSDFGL  230

Query  898   AKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTK  719
             AKDGPEGD+THVSTR+MGTHGYAAPEYIMTGHLT  SDVYSFG+VLLE+++G+R++DKT+
Sbjct  231   AKDGPEGDETHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLEVISGKRSMDKTR  290

Query  718   PNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMS  539
             P+REQNL +WARP LKDPRKL R++D RLEG+FS  GAQKAA LAY+CLSH++K+RP MS
Sbjct  291   PSREQNLVEWARPMLKDPRKLDRVIDSRLEGLFSTKGAQKAAELAYKCLSHQAKARPAMS  350

Query  538   TVVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
              VVK LEPL+D+ D     FVY  P E + 
Sbjct  351   DVVKILEPLQDFDDTVISPFVYVVPAEGEV  380



>ref|XP_010541992.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=442

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/382 (76%), Positives = 316/382 (83%), Gaps = 9/382 (2%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPA---Telsssalsed  1427
             KI+  S   GCF+  P+          KKPR E + KQ SF R+     +  SS+ LSED
Sbjct  5     KISWRSFVAGCFQD-PSFERKSF----KKPRNE-VKKQRSFQRLSILDISNPSSTTLSED  58

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LSISLAGS++H FTL ELK+ITQSFSSSNFLGEGGFG VHKGFIDDKLRPGLKAQPVAVK
Sbjct  59    LSISLAGSDLHIFTLSELKIITQSFSSSNFLGEGGFGQVHKGFIDDKLRPGLKAQPVAVK  118

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
              LD DG QGHREWLTEVI LGQL+HP+LVKLIGYCCEEEHRLLVYE+MPRGSLENQLFRR
Sbjct  119   NLDPDGLQGHREWLTEVICLGQLKHPNLVKLIGYCCEEEHRLLVYEFMPRGSLENQLFRR  178

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YS SLPW+TRMKIA GAAKGL FLHEAEKP+IYRDFKASNILLDSDY  KLSDFGLAKDG
Sbjct  179   YSVSLPWTTRMKIAHGAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDG  238

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK +  RE
Sbjct  239   PEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVDKKRSQRE  298

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL DWARP L DPRKL RI DPRLEG FS AGA+KAA LAY CLSHR K+RPTMS+VV 
Sbjct  299   QNLVDWARPMLNDPRKLSRITDPRLEGQFSVAGARKAAALAYNCLSHRPKNRPTMSSVVA  358

Query  526   TLEPLKDYKDVSSVTFVYTAPT  461
              L+ +KDYKD+    FVYT  +
Sbjct  359   VLDDVKDYKDIPMGPFVYTVSS  380



>ref|XP_006395963.1| hypothetical protein EUTSA_v10004211mg [Eutrema salsugineum]
 gb|ESQ33249.1| hypothetical protein EUTSA_v10004211mg [Eutrema salsugineum]
Length=448

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/392 (72%), Positives = 322/392 (82%), Gaps = 14/392 (4%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRRE---AITKQASF---TRIPATel  1451
             + +K K++  SI   CF+      + D   + KK ++     ITKQ SF   + +  ++ 
Sbjct  1     MAVKKKLSWKSIMVACFQ------DPDNICSSKKAKKNDGGVITKQKSFLGLSVLDISDP  54

Query  1450  sssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL  1271
             SS+ LSEDLSISLAGS++H FT  ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLR GL
Sbjct  55    SSTTLSEDLSISLAGSDLHVFTQGELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRLGL  114

Query  1270  KAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGS  1091
             KAQPVAVKLLDLDG QGHREWLTEVIFLG+L+HP+LVKLIGYCCEEEHRLLVYE+MPRGS
Sbjct  115   KAQPVAVKLLDLDGFQGHREWLTEVIFLGKLKHPNLVKLIGYCCEEEHRLLVYEFMPRGS  174

Query  1090  LENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLS  911
             LE+QLFRR S SLPW TRMKIA GAAKGL FLHEAEKPVIYRDFKASNILLDS+Y  KLS
Sbjct  175   LESQLFRRCSISLPWLTRMKIAHGAAKGLQFLHEAEKPVIYRDFKASNILLDSNYTAKLS  234

Query  910   DFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAI  731
             DFGLAKDGPEGD+THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++
Sbjct  235   DFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRSV  294

Query  730   DKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSR  551
             DK + +REQNL DWARP L DPRKL RI+DPRLE  +SE GA+KAA LAY+CLS+R K+R
Sbjct  295   DKKRSSREQNLVDWARPMLNDPRKLGRIMDPRLEDQYSETGARKAAALAYQCLSYRPKNR  354

Query  550   PTMSTVVKTLEPLKDYK-DVSSVTFVYT-APT  461
             P +S VV  L+ +KDY  D+   TF YT AP+
Sbjct  355   PCISNVVSVLQEIKDYSDDIPIGTFTYTVAPS  386



>ref|XP_009124269.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
 emb|CDX74646.1| BnaA04g07430D [Brassica napus]
Length=450

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/392 (72%), Positives = 319/392 (81%), Gaps = 14/392 (4%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRRE----AITKQASF---TRIPATe  1454
             + +K K++  S+   CF       + D   + KK ++      ITKQ SF   + +  ++
Sbjct  1     MAVKKKLSWRSLMVLCFL------DPDNICSSKKVKKNDGDGVITKQKSFLGLSILDISD  54

Query  1453  lsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  1274
              SSS LSEDLSISLAGS++H FT  ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG
Sbjct  55    PSSSTLSEDLSISLAGSDLHVFTQAELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  114

Query  1273  LKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRG  1094
             LKAQPVAVKLLDLDG QGHREWLTEVIFLG+L+HP+LVKLIGYCCEEEHRLLVYE+MPRG
Sbjct  115   LKAQPVAVKLLDLDGLQGHREWLTEVIFLGKLKHPNLVKLIGYCCEEEHRLLVYEFMPRG  174

Query  1093  SLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKL  914
             SLE+QLFRR S SLPW TRMKIA GAAKGL FLHEAEKPVIYRDFKASNILLDSDY  KL
Sbjct  175   SLESQLFRRCSISLPWLTRMKIAHGAAKGLQFLHEAEKPVIYRDFKASNILLDSDYTAKL  234

Query  913   SDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRA  734
             SDFGLAKDGPEGD+THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+
Sbjct  235   SDFGLAKDGPEGDETHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRS  294

Query  733   IDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKS  554
             +DK + +REQNL DWARP L DPRKL RI+DPRLE  +SE GA+KAA LAY+CLS+R   
Sbjct  295   VDKKRSSREQNLVDWARPMLNDPRKLGRIMDPRLEDQYSETGARKAAALAYQCLSYRPNR  354

Query  553   RPTMSTVVKTLEPLKDY-KDVSSVTFVYTAPT  461
             RP +STVV  L+ +KDY  D+   TF YT  +
Sbjct  355   RPCISTVVSALQDIKDYGDDIPIGTFTYTVSS  386



>ref|XP_009409118.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=431

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/325 (77%), Positives = 282/325 (87%), Gaps = 0/325 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FTL ELK  TQSFSSSNFLGEGGFGPV+KGF+DDK++PGLKAQ VAVK+LDL+G
Sbjct  60    GSNLHVFTLAELKAATQSFSSSNFLGEGGFGPVYKGFVDDKVKPGLKAQAVAVKVLDLEG  119

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGH+EWLTEV+FLGQLRH HLVKLIGYCCE+EHRLLVYE+M RGSLEN LF+RY ASLP
Sbjct  120   SQGHKEWLTEVVFLGQLRHSHLVKLIGYCCEDEHRLLVYEFMTRGSLENHLFKRYFASLP  179

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLH+ EKPVIYRDFKASNILLDSDY+ KLSDFGLAKDGPEGD+T
Sbjct  180   WSTRLKIAIGAAKGLAFLHDIEKPVIYRDFKASNILLDSDYEVKLSDFGLAKDGPEGDET  239

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTR+MGT GYAAPEYI+TGHLT  SDVY FG+VLLELLTGRR++DK +P+REQNL +W
Sbjct  240   HVSTRIMGTQGYAAPEYILTGHLTVKSDVYGFGVVLLELLTGRRSVDKKRPSREQNLVEW  299

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L DPRKL RI+DP L G +SE GAQKAA +AY+CLSH  KSRP MS +V+TLEPL 
Sbjct  300   ARPCLNDPRKLNRIMDPGLCGQYSEQGAQKAAAVAYKCLSHHPKSRPQMSAIVETLEPLL  359

Query  508   DYKDVSSVTFVYTAPTEKDTKTVST  434
             D KD+    FVY  P E   K  ST
Sbjct  360   DVKDMPIAPFVYVVPAEDGCKEEST  384



>ref|XP_009762767.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
sylvestris]
Length=461

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/395 (67%), Positives = 311/395 (79%), Gaps = 13/395 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQAS---FTRIPATelsssalse-  1430
             KI    I   CF+A     ND     P + +   I KQ +    +R+  +++S+ + S  
Sbjct  5     KIAWKFILPNCFKAK----NDTTHILPSETKIIQICKQINSDHHSRLAISDISTDSRSVF  60

Query  1429  -----dlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKA  1265
                    S ++ GSN+H FT  ELK+IT +FSS+NFLG+GGFGPVHKGFIDDK++PGLKA
Sbjct  61    ISLDDLSSNAIIGSNLHIFTYAELKIITSNFSSANFLGKGGFGPVHKGFIDDKIKPGLKA  120

Query  1264  QPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLE  1085
             QPVAVKLLDLDG+QGH+EWLTEV+FLGQLRHPHLVKLIGYC EEE RLLVYEYM RG+LE
Sbjct  121   QPVAVKLLDLDGNQGHQEWLTEVVFLGQLRHPHLVKLIGYCWEEEQRLLVYEYMARGNLE  180

Query  1084  NQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDF  905
             N LF RYS+ LPWSTR+KIA+GAAKGLAFLH  EKPVIYRDFKASNILLDSDY  KLSDF
Sbjct  181   NHLFSRYSSCLPWSTRIKIAVGAAKGLAFLHGEEKPVIYRDFKASNILLDSDYKAKLSDF  240

Query  904   GLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDK  725
             GLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLT+ SDVYSFG+VLLEL+TGR A+DK
Sbjct  241   GLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTSKSDVYSFGVVLLELITGRPAMDK  300

Query  724   TKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPT  545
              +P RE+NL DWARP L+D  KL RI+DPRLEG++S  GA+K A LAY+CLSH+ +SRPT
Sbjct  301   NRPIRERNLVDWARPMLRDSHKLDRIMDPRLEGLYSTEGAKKVAALAYQCLSHQPRSRPT  360

Query  544   MSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTV  440
             MS VVK+LEP+ + KD+    FVY  P+ +  K +
Sbjct  361   MSNVVKSLEPVSELKDIPIGPFVYVVPSSECDKEL  395



>ref|XP_006282611.1| hypothetical protein CARUB_v10004829mg [Capsella rubella]
 gb|EOA15509.1| hypothetical protein CARUB_v10004829mg [Capsella rubella]
Length=440

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/324 (78%), Positives = 283/324 (87%), Gaps = 1/324 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++H FT  EL+VITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG
Sbjct  59    GSDLHVFTQAELRVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  118

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREW+TEV+ LG+L+HP+LVKLIGYCCEEEHRLLVYE+MPRGSLE+QLFRR S  LP
Sbjct  119   LQGHREWMTEVMCLGKLKHPNLVKLIGYCCEEEHRLLVYEFMPRGSLESQLFRRCSLPLP  178

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA  AAKGL FLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGP+GD T
Sbjct  179   WSTRLKIAYEAAKGLQFLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDAT  238

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK + +REQ+L DW
Sbjct  239   HVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQSLVDW  298

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D RKLRRI+DPRLE  +SEAGA+KAA LAY+CL +R K+RP +S VV  L+ +K
Sbjct  299   ARPMLNDARKLRRIMDPRLEDQYSEAGARKAATLAYQCLRYRPKTRPDISMVVSVLQDIK  358

Query  508   DYK-DVSSVTFVYTAPTEKDTKTV  440
             DYK D+   TF YT PT K ++ V
Sbjct  359   DYKEDIPIGTFTYTVPTTKPSREV  382



>ref|XP_010450389.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=447

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/393 (70%), Positives = 319/393 (81%), Gaps = 14/393 (4%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRRE----AITKQASF---TRIPATe  1454
             + +K K +   +   CF+      + D+  +PKK ++      ITKQ SF   + +  ++
Sbjct  1     MAVKKKSSWRCLMVSCFQ------DQDIINSPKKAKKNDGEGVITKQKSFLGLSILDISD  54

Query  1453  lsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  1274
              SS+ LSEDLSISLAGS++H FT  ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG
Sbjct  55    PSSTTLSEDLSISLAGSDLHVFTQAELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  114

Query  1273  LKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRG  1094
             LKAQPVAVKLLDLDG QGHREW+TEV+ LG+L+HP+LVKLIGYCCEEEHRLLVYE+MPRG
Sbjct  115   LKAQPVAVKLLDLDGLQGHREWMTEVMCLGKLKHPNLVKLIGYCCEEEHRLLVYEFMPRG  174

Query  1093  SLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKL  914
             SLE+QLFRR S  LPWSTR+KIA  AAKGL FLHEAEKPVIYRDFKASNILLDSDY  KL
Sbjct  175   SLESQLFRRCSLPLPWSTRLKIAYEAAKGLQFLHEAEKPVIYRDFKASNILLDSDYTAKL  234

Query  913   SDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRA  734
             SDFGLAKDGP+GD THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+
Sbjct  235   SDFGLAKDGPQGDATHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRS  294

Query  733   IDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKS  554
             +DK + +REQ+L DWARP L D RKL RI+DPRLE  +SE GA+KAA LAY+CL +R K+
Sbjct  295   VDKKRSSREQSLVDWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKT  354

Query  553   RPTMSTVVKTLEPLKDYK-DVSSVTFVYTAPTE  458
             RP +STVV  L+ +KDY  D+   TF YT PT+
Sbjct  355   RPDISTVVSVLQDIKDYNDDIPIGTFTYTVPTK  387



>ref|XP_010440738.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=447

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/393 (70%), Positives = 319/393 (81%), Gaps = 14/393 (4%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRRE----AITKQASF---TRIPATe  1454
             + +K K +   +   CF+      + D+  +PKK ++      ITKQ SF   + +  ++
Sbjct  1     MAVKKKSSWRCLMVSCFQ------DQDIINSPKKAKKNDGEGVITKQKSFLGLSILDISD  54

Query  1453  lsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  1274
              SS+ LSEDLSISLAGS++H FT  ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG
Sbjct  55    PSSTTLSEDLSISLAGSDLHVFTQAELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  114

Query  1273  LKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRG  1094
             L+AQPVAVKLLDLDG QGHREW+TEV+ LG+L+HP+LVKLIGYCCEEEHRLLVYE+MPRG
Sbjct  115   LQAQPVAVKLLDLDGLQGHREWMTEVMCLGKLKHPNLVKLIGYCCEEEHRLLVYEFMPRG  174

Query  1093  SLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKL  914
             SLE+QLFRR S  LPWSTR+KIA  AAKGL FLHEAEKPVIYRDFKASNILLDSDY  KL
Sbjct  175   SLESQLFRRCSLPLPWSTRLKIAYEAAKGLQFLHEAEKPVIYRDFKASNILLDSDYTAKL  234

Query  913   SDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRA  734
             SDFGLAKDGP+GD THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+
Sbjct  235   SDFGLAKDGPQGDATHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRS  294

Query  733   IDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKS  554
             +DK + +REQ+L DWARP L D RKL RI+DPRLE  +SE GA+KAA LAY+CL +R K+
Sbjct  295   VDKKRSSREQSLVDWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKT  354

Query  553   RPTMSTVVKTLEPLKDYK-DVSSVTFVYTAPTE  458
             RP +STVV  L+ +KDY  D+   TF YT PT+
Sbjct  355   RPDISTVVSVLQDIKDYNDDIPIGTFTYTVPTK  387



>ref|XP_010435442.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=447

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/393 (70%), Positives = 318/393 (81%), Gaps = 14/393 (4%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRRE----AITKQASF---TRIPATe  1454
             + +K K +   +   CF+      + D+   PKK ++      ITKQ SF   + +  ++
Sbjct  1     MAVKKKSSWRCLMVSCFQ------DQDIINYPKKAKKNDGEGVITKQKSFLGLSILDISD  54

Query  1453  lsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  1274
              SS+ LSEDLSISLAGS++H FT  ELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG
Sbjct  55    PSSTTLSEDLSISLAGSDLHVFTQAELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  114

Query  1273  LKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRG  1094
             LKAQPVAVKLLDLDG QGHREW+TEV+ LG+L+HP+LVKLIGYCCEEEHRLLVYE+MPRG
Sbjct  115   LKAQPVAVKLLDLDGLQGHREWMTEVMCLGKLKHPNLVKLIGYCCEEEHRLLVYEFMPRG  174

Query  1093  SLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKL  914
             SLE+QLFRR S  LPWSTR+KIA  AAKGL FLHEAEKPVIYRDFKASNILLDSDY  KL
Sbjct  175   SLESQLFRRCSLPLPWSTRLKIAYEAAKGLQFLHEAEKPVIYRDFKASNILLDSDYTAKL  234

Query  913   SDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRA  734
             SDFGLAKDGP+GD THVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+
Sbjct  235   SDFGLAKDGPQGDATHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRS  294

Query  733   IDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKS  554
             +DK + +REQ+L DWARP L D RKL RI+DPRLE  +SE GA+KAA LAY+CL +R K+
Sbjct  295   VDKKRSSREQSLVDWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKT  354

Query  553   RPTMSTVVKTLEPLKDYK-DVSSVTFVYTAPTE  458
             RP +STVV  L+ +KDY  D+   TF YT PT+
Sbjct  355   RPDISTVVSVLQDIKDYNDDIPIGTFTYTVPTK  387



>ref|XP_008802464.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=419

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/373 (70%), Positives = 306/373 (82%), Gaps = 6/373 (2%)
 Frame = -3

Query  1567  CFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsed---lsislAGSNI  1397
             C       G+D+ P+   +P++ A  KQ S  R+  ++LS+S        LSISL GSN+
Sbjct  12    CLLTMCCGGDDEGPSV--RPKKLA-AKQKSLQRLSYSDLSNSTGMLSPEDLSISLVGSNL  68

Query  1396  HAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGH  1217
             + FTL ELKV TQSFS+SNFLGEGGFGPV+KGF+D+K++PGLKAQ VAVKLLDL+G QGH
Sbjct  69    YVFTLAELKVATQSFSTSNFLGEGGFGPVYKGFVDEKVKPGLKAQSVAVKLLDLEGVQGH  128

Query  1216  REWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTR  1037
             +EWL EVIFLGQLRHPHLVKLIGYCCE++HRLLVYE+M RGSLEN LF++Y ASLPW TR
Sbjct  129   KEWLAEVIFLGQLRHPHLVKLIGYCCEDKHRLLVYEFMARGSLENHLFKKYFASLPWLTR  188

Query  1036  MKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVST  857
             +KIA+GAA+GLAFLHE EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDTHVST
Sbjct  189   LKIAVGAARGLAFLHEMEKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDTHVST  248

Query  856   RVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQ  677
             RVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DKT+P+REQNL +WARP 
Sbjct  249   RVMGTEGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVEWARPC  308

Query  676   LKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKD  497
             L D RKL RI+DP LEG +S   AQKAA +AY+CLSH  KSRP MST+V+ LEPL + +D
Sbjct  309   LNDARKLNRIMDPSLEGQYSTKCAQKAAAVAYQCLSHTPKSRPQMSTIVENLEPLLEMED  368

Query  496   VSSVTFVYTAPTE  458
             +    F+YT   E
Sbjct  369   MPIGPFIYTVSAE  381



>ref|XP_006452974.1| hypothetical protein CICLE_v10010608mg [Citrus clementina]
 gb|ESR66214.1| hypothetical protein CICLE_v10010608mg [Citrus clementina]
Length=418

 Score =   527 bits (1357),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 256/389 (66%), Positives = 309/389 (79%), Gaps = 12/389 (3%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRI---PATelsssal  1436
             +K K+T  SI   C++++    N +          E + KQ SF R+     +  SS   
Sbjct  1     MKKKLTWKSITLSCYKSSMPESNTN---------NEQVDKQTSFQRLCLSDVSNPSSPLS  51

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             ++DLS S+ GS +H FTL EL++IT +FS SN LGEGGFGPV+KGF+D+KL+PGL+AQPV
Sbjct  52    ADDLSNSVIGSKLHVFTLAELRLITSNFSRSNLLGEGGFGPVYKGFVDEKLKPGLEAQPV  111

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVK LDLDG+QGH+EW+ E+IFLGQLRHPHLVKLIGYC EEE+RLLVYEYMPRGSL NQL
Sbjct  112   AVKALDLDGTQGHKEWMAEIIFLGQLRHPHLVKLIGYCWEEEYRLLVYEYMPRGSLHNQL  171

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FR YSA+LPWSTRMKIALGAAKGLAFLH  +KPVIYRDFKASNILLDSDY  KLSDFGLA
Sbjct  172   FRSYSAALPWSTRMKIALGAAKGLAFLHGEDKPVIYRDFKASNILLDSDYTAKLSDFGLA  231

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEG++THV TRVMGT GYAAPEY+MTGHLT  SDVYSFG+VLLELLTG+RA+D T+P
Sbjct  232   KDGPEGEETHVITRVMGTQGYAAPEYVMTGHLTTMSDVYSFGVVLLELLTGKRAVDNTRP  291

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQ+LA+WARP LK+PRKL R++DPR+EG F   GAQKAA +A++CLSH  + RPTMS 
Sbjct  292   GREQSLAEWARPLLKEPRKLERLIDPRIEGQFPIKGAQKAAAMAFKCLSHHPRHRPTMSY  351

Query  535   VVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
             VV+ L+ L+D++D     FVY  P E ++
Sbjct  352   VVRVLDSLQDFQDSFVGPFVYVVPNETES  380



>ref|XP_011072653.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Sesamum 
indicum]
Length=450

 Score =   528 bits (1359),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 261/384 (68%), Positives = 306/384 (80%), Gaps = 13/384 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels---ssalsed  1427
             K+T  S+F  CF   P + N D  +         ++KQ S +RI  +++S   SS  + D
Sbjct  5     KMTWRSLFPSCFN--PKSHNLDSTSQ--------VSKQNSASRISLSDISDTGSSFCASD  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS S   SN+H FTL ELKVIT +FSSSNFLGEGGFGPVHKGF+DDK RPGL+AQPVAVK
Sbjct  55    LSNSKFASNLHIFTLAELKVITSNFSSSNFLGEGGFGPVHKGFVDDKCRPGLEAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLD DG QGHREWLTEV+ LGQLRHP+LVKLIGYCCE+EHRLLVYEYM RG+LEN LFRR
Sbjct  115   LLDHDGDQGHREWLTEVVLLGQLRHPNLVKLIGYCCEDEHRLLVYEYMARGNLENHLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YS+ LPW TRMKIA+GAAKGLAFLH  EKPVIYRDFK SNILLDSD + KLSDFGLAKDG
Sbjct  175   YSSPLPWLTRMKIAIGAAKGLAFLHGEEKPVIYRDFKTSNILLDSDCNAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTR+MGTHGYAAPEY+MTGHLT  +DVYSFG+VLLELLTG+RA+DK +P RE
Sbjct  235   PEGDDTHVSTRIMGTHGYAAPEYVMTGHLTTMNDVYSFGVVLLELLTGKRAMDKKRPARE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             QNL +WA+P LKD  KL R++DPRLEG +S  G +K A LA++CL+H  KSRP+M  V+K
Sbjct  295   QNLVEWAKPYLKDHHKLDRLMDPRLEGQYSSEGTKKVAALAHQCLNHYPKSRPSMKHVIK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEK  455
              LEP+  Y D+ +  F+Y APTE+
Sbjct  355   ILEPILKYTDIPAGPFIYIAPTEE  378



>ref|XP_011019325.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Populus 
euphratica]
 ref|XP_011019326.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Populus 
euphratica]
Length=449

 Score =   525 bits (1353),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 260/384 (68%), Positives = 301/384 (78%), Gaps = 15/384 (4%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssa---lsed  1427
             K+TL SI   C             ++P       I+KQ SF R+  +++S  +     ED
Sbjct  5     KVTLKSIILSCC------------SSPLPESTNRISKQGSFQRLSLSDVSDPSLPFCIED  52

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             +S S  GS +H FT  EL+VIT +FS SN LGEGGFGPV+KGF+DDK+RPGL AQPVAVK
Sbjct  53    ISNSFTGSKLHIFTFSELRVITHNFSRSNLLGEGGFGPVYKGFVDDKVRPGLDAQPVAVK  112

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
              LDLDG QGH+EW+ E+IFLGQLRH HLVKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR
Sbjct  113   SLDLDGLQGHKEWMAEIIFLGQLRHSHLVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRR  172

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YSA+LPWSTRMKIALGAAKGLAFLHE++KPVIYRDFK+SNILLDSDY  KLSDFGLAKDG
Sbjct  173   YSAALPWSTRMKIALGAAKGLAFLHESDKPVIYRDFKSSNILLDSDYTAKLSDFGLAKDG  232

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEG++THV+TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+R++D T+P RE
Sbjct  233   PEGEETHVTTRVMGTQGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSMDNTRPGRE  292

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             Q+L +WARP LKD  KL RI+DPRLEG +S  GAQKAA LAY+CLSH  K RP MS VV+
Sbjct  293   QSLVEWARPLLKDASKLDRIMDPRLEGQYSTKGAQKAAALAYKCLSHHPKPRPMMSYVVE  352

Query  526   TLEPLKDYKDVSSVTFVYTAPTEK  455
              LE L+D+ +     FVY  PTE 
Sbjct  353   VLESLQDFDETFIQPFVYIVPTEN  376



>ref|XP_011036441.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Populus 
euphratica]
Length=449

 Score =   525 bits (1352),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 273/315 (87%), Gaps = 0/315 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H FTL+EL+ +T  FS SN+LGEGGFG V+KGFIDDKLRPGLKAQPVAVK+LDLDGSQ
Sbjct  56    NLHVFTLKELQTVTNEFSKSNYLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKVLDLDGSQ  115

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL E+IFLGQL+H HLV LIGYCCEEEHRLLVYEY+ RG+LE++LF RYSA+LPW 
Sbjct  116   GHREWLAEIIFLGQLKHRHLVNLIGYCCEEEHRLLVYEYIERGNLEDKLFNRYSAALPWL  175

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIA+G AKGLAFLHE EKPVIYRDFKASN+LLDSDY+ KLSDFGLA DGPEGDDTHV
Sbjct  176   TRLKIAVGTAKGLAFLHEEEKPVIYRDFKASNVLLDSDYNAKLSDFGLAMDGPEGDDTHV  235

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             +T VMGT GYAAPEYIMTGHLT  SDV+SFG+VLLELLTGRR++DK +PNREQNL  WAR
Sbjct  236   TTPVMGTEGYAAPEYIMTGHLTTMSDVFSFGVVLLELLTGRRSVDKNRPNREQNLVKWAR  295

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             PQLKDPRKL +I+DPRLEG +S  GA+KAA LAY+CLSH  KSRPTM TVVKTLEPL   
Sbjct  296   PQLKDPRKLCQIMDPRLEGQYSTEGARKAAALAYQCLSHHPKSRPTMRTVVKTLEPLLAL  355

Query  502   KDVSSVTFVYTAPTE  458
              D+    FVY  P E
Sbjct  356   TDIPIGPFVYIVPNE  370



>ref|XP_002309457.2| hypothetical protein POPTR_0006s23590g [Populus trichocarpa]
 gb|EEE92980.2| hypothetical protein POPTR_0006s23590g [Populus trichocarpa]
Length=444

 Score =   525 bits (1351),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 260/386 (67%), Positives = 303/386 (78%), Gaps = 16/386 (4%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssa---lsed  1427
             K+TL SI + C    P + N              I+KQ SF R+  +++S  +     ED
Sbjct  3     KVTLKSILSCCSSPLPESTN-------------RISKQGSFQRLSLSDVSDPSLPFCIED  49

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             +S S +GS +H FT  EL+VIT +FS SN LGEGGFGPV+KGF+DDKLRPGL AQPVAVK
Sbjct  50    ISNSFSGSKLHIFTFSELRVITHNFSRSNLLGEGGFGPVYKGFVDDKLRPGLDAQPVAVK  109

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
              LDLDG QGH+EW+ E+IFLGQLRH HLV+LIGYCCEE+ RLLVYEYMPRGSLENQLFRR
Sbjct  110   SLDLDGLQGHKEWMAEIIFLGQLRHSHLVRLIGYCCEEDQRLLVYEYMPRGSLENQLFRR  169

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YSA+LPWSTRMKIALGAAKGLAFLHE++KPVIYRDFK+SNILLDSDY  KLSDFGLAKDG
Sbjct  170   YSAALPWSTRMKIALGAAKGLAFLHESDKPVIYRDFKSSNILLDSDYTAKLSDFGLAKDG  229

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEG++THV+TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+R++D T+P RE
Sbjct  230   PEGEETHVTTRVMGTQGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSMDNTRPGRE  289

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             Q+L +WARP LKD  KL RI+DPRLEG +S  GAQKAA LAY+CLSH  K RP MS VV+
Sbjct  290   QSLVEWARPLLKDASKLDRIMDPRLEGQYSTKGAQKAAALAYKCLSHHPKPRPMMSHVVE  349

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKDT  449
              LE L+ + +     FVY  PTE  +
Sbjct  350   VLESLQGFDETFIQPFVYIVPTENGS  375



>ref|XP_007012454.1| Root-specific kinase 1 [Theobroma cacao]
 gb|EOY30073.1| Root-specific kinase 1 [Theobroma cacao]
Length=434

 Score =   524 bits (1349),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 260/385 (68%), Positives = 304/385 (79%), Gaps = 13/385 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATels---ssalsed  1427
             K+T  S+   C++    + +            E I K   F R+  T++S   S    +D
Sbjct  5     KVTWKSLMLSCYKNNNNSSDSG----------EKILKPCQFQRLSLTDVSDPNSQLSVDD  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS SL GSN+H FT  EL+VIT +F+  N LGEGGFGPV+KGFIDDKLRPGLKAQPVAVK
Sbjct  55    LSTSLLGSNLHVFTFSELRVITHNFARCNLLGEGGFGPVYKGFIDDKLRPGLKAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
              LDLDG QGHREWL E+IFLGQLRHPHLVKL+GYC EEE+RLLVYEYMPRGSLENQLFRR
Sbjct  115   ALDLDGFQGHREWLAEIIFLGQLRHPHLVKLVGYCYEEENRLLVYEYMPRGSLENQLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YSA+LPWSTRMKIALGAAKGLAFLHEA+KPVIYRDFK SNILLDSDY+ KLSDFGLAKDG
Sbjct  175   YSAALPWSTRMKIALGAAKGLAFLHEADKPVIYRDFKTSNILLDSDYNCKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEG++THV+TRV+GT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+R++D T+P+RE
Sbjct  235   PEGEETHVTTRVIGTQGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSMDNTRPSRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             Q+L +WARP L+D ++L R++DPRLEG FS  GAQ+ A LAY+ LSHR K RPTM  VVK
Sbjct  295   QSLVEWARPLLRDLKRLDRLIDPRLEGQFSSKGAQRVAALAYKSLSHRPKPRPTMGDVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKD  452
              LE L+ ++D     FVY  P+E D
Sbjct  355   ILECLQGFEDEFVGPFVYVVPSETD  379



>ref|XP_009612481.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
tomentosiformis]
Length=460

 Score =   525 bits (1351),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 243/323 (75%), Positives = 280/323 (87%), Gaps = 0/323 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT  ELK+IT +FSS+NFLG+GGFGPVHKGFIDDK++PGLKAQPVAVKLLDLDG
Sbjct  72    GSNLHTFTYAELKIITSNFSSANFLGKGGFGPVHKGFIDDKIKPGLKAQPVAVKLLDLDG  131

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWLTEV+FLGQLRHPHLVKL+GYC E+E R+LVYEYM RG+LENQLF RYS+ LP
Sbjct  132   NQGHQEWLTEVVFLGQLRHPHLVKLMGYCWEDEQRILVYEYMARGNLENQLFSRYSSCLP  191

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLH  EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  192   WSTRIKIAVGAAKGLAFLHGEEKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDT  251

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLT+ SDVYSFG+VLLEL+TGR A+DK++  RE+NL DW
Sbjct  252   HVSTRVMGTHGYAAPEYIMTGHLTSKSDVYSFGVVLLELITGRPAMDKSRHIRERNLVDW  311

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L+D  KL RI+D RLEG +S  GA+K A LAY+CLSH+ +SRPTMS VVK LEP+ 
Sbjct  312   ARPMLRDSHKLDRIMDSRLEGQYSTEGAKKVAALAYQCLSHQPRSRPTMSNVVKALEPVL  371

Query  508   DYKDVSSVTFVYTAPTEKDTKTV  440
             + KD+    FVY  P+ +  K +
Sbjct  372   ELKDIPIGPFVYVVPSSECDKEL  394



>gb|EYU28327.1| hypothetical protein MIMGU_mgv1a006430mg [Erythranthe guttata]
Length=444

 Score =   524 bits (1349),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 254/321 (79%), Positives = 281/321 (88%), Gaps = 1/321 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSNIH FTL EL+VIT +FSSSNFLGEGGFG VHKGF+DDK+RPGLKAQPVAVK +D DG
Sbjct  63    GSNIHVFTLNELRVITHNFSSSNFLGEGGFGKVHKGFVDDKIRPGLKAQPVAVKAMDPDG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWLTEVIFLGQLRH HLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR+S SLP
Sbjct  123   KQGHREWLTEVIFLGQLRHAHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRFSVSLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHE+ KPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGD+T
Sbjct  183   WSTRIKIAIGAAKGLAFLHESAKPVIYRDFKASNILLDSDYTSKLSDFGLAKDGPEGDET  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLT+ASDVYSFG++LLELLTGR+++DK +  REQ LA+W
Sbjct  243   HVSTRVMGTEGYAAPEYIMTGHLTSASDVYSFGVLLLELLTGRKSVDKNRSYREQILAEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LK+PRKL R +DPRLEG + E  AQ+AA LAY CLSHR K RPTMS VVK LE LK
Sbjct  303   ARPMLKNPRKLIRAMDPRLEGQYPERAAQEAAALAYRCLSHRPKLRPTMSEVVKVLESLK  362

Query  508   DY-KDVSSVTFVYTAPTEKDT  449
             D+  +VS  TFV+ +    D+
Sbjct  363   DFDNEVSMGTFVFVSTDSTDS  383



>ref|XP_002868426.1| hypothetical protein ARALYDRAFT_355547 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44685.1| hypothetical protein ARALYDRAFT_355547 [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 271/393 (69%), Positives = 318/393 (81%), Gaps = 14/393 (4%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRRE----AITKQASF---TRIPATe  1454
             + +K K +  S+   CF+      + D   +PKK +++     ITKQ SF   + +  + 
Sbjct  1     MAVKKKSSWRSLMVLCFQ------DPDNIYSPKKTKKDDGQGVITKQKSFLGLSILDISN  54

Query  1453  lsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  1274
              SS+ LSEDLSISLAGS++H FT  ELKVITQSFSSSNFLGEGGFGPVHKGFIDD+LRPG
Sbjct  55    PSSTTLSEDLSISLAGSDLHVFTQAELKVITQSFSSSNFLGEGGFGPVHKGFIDDRLRPG  114

Query  1273  LKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRG  1094
             LKAQPVAVKLLDLDG QGHREW+TEV+ LG+L+HP+LVKLIGYCCEEEHRLLVYE+MPRG
Sbjct  115   LKAQPVAVKLLDLDGLQGHREWMTEVMCLGKLKHPNLVKLIGYCCEEEHRLLVYEFMPRG  174

Query  1093  SLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKL  914
             SLE+QLFRR S  LPW+TR+KIA  AAKGL FLHEAEKPVIYRDFKASNILLDSDY  KL
Sbjct  175   SLESQLFRRCSLPLPWTTRLKIAYEAAKGLQFLHEAEKPVIYRDFKASNILLDSDYTAKL  234

Query  913   SDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRA  734
             SDFGLAKDGP+GDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGR++
Sbjct  235   SDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKS  294

Query  733   IDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKS  554
             +D  + +R++ L +WARP L D RKL RI+DPRLE  +SE GA+KAA LAY+CL +R K+
Sbjct  295   VDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKT  354

Query  553   RPTMSTVVKTLEPLKDYK-DVSSVTFVYTAPTE  458
             RP +STVV  L+ +KDYK D+    F YT PT+
Sbjct  355   RPDISTVVSVLQDIKDYKDDIPIGVFTYTVPTK  387



>ref|XP_011035727.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Populus 
euphratica]
Length=450

 Score =   524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 245/315 (78%), Positives = 274/315 (87%), Gaps = 0/315 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H F L+EL+ IT  FS SN+LGEGGFG V+KGFIDDKLRPGLKAQPVAVK LD DGSQ
Sbjct  57    NLHVFALKELRTITHEFSKSNYLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKALDPDGSQ  116

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL EVIFLGQL+H HLV LIGYCCE+EHRLLVYEY+ RG+LE++LF RYSA+LPW 
Sbjct  117   GHREWLAEVIFLGQLKHRHLVNLIGYCCEDEHRLLVYEYVERGNLEDKLFCRYSAALPWL  176

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIA+GAAKGLAFLHE EKPVIYRDFKASN+LLDSDY+ KLSDFGLA DGPEGDDTH+
Sbjct  177   TRLKIAVGAAKGLAFLHEEEKPVIYRDFKASNVLLDSDYNAKLSDFGLATDGPEGDDTHI  236

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             +T VMGT GYAAPEYIMTGHLT  SDV+SFG+VLLELLTGRR++DK  PNREQNL  WAR
Sbjct  237   TTCVMGTEGYAAPEYIMTGHLTTMSDVFSFGVVLLELLTGRRSLDKNLPNREQNLVKWAR  296

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             PQLKDPRKL +I+DPRLEG +S  GA+KAA LAY+CLSH SKSRPTMSTVV+TLE L D 
Sbjct  297   PQLKDPRKLEQIMDPRLEGQYSTEGARKAAGLAYQCLSHHSKSRPTMSTVVRTLEQLLDL  356

Query  502   KDVSSVTFVYTAPTE  458
              D  + TFVY  PTE
Sbjct  357   TDTPTGTFVYIVPTE  371



>gb|KDO73664.1| hypothetical protein CISIN_1g040050mg, partial [Citrus sinensis]
Length=401

 Score =   521 bits (1343),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 256/389 (66%), Positives = 307/389 (79%), Gaps = 12/389 (3%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRI---PATelsssal  1436
             +K K+T  SI   C++++    N +          E + KQ SF R+     +  SS   
Sbjct  1     MKKKLTWKSITLSCYKSSMPESNTN---------NEQVDKQTSFQRLCLSDVSNPSSPLS  51

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             ++DLS S+ GS +H FTL EL++IT +FS SN LGEGGFGPV+KGF+D+KL+PGL+AQPV
Sbjct  52    ADDLSNSVIGSKLHVFTLAELRLITSNFSRSNLLGEGGFGPVYKGFVDEKLKPGLEAQPV  111

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVK LDLDG+QGH+EW+ E+IFLGQLRHPHLVKLIGYC EEE+RLLVYEYMPRGSL NQL
Sbjct  112   AVKALDLDGTQGHKEWMAEIIFLGQLRHPHLVKLIGYCWEEEYRLLVYEYMPRGSLHNQL  171

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FR YSA+LPWSTRMKIALGAAKGLAFLH  +KPVIYRDFKASNILLDSDY  KLSDFGLA
Sbjct  172   FRSYSAALPWSTRMKIALGAAKGLAFLHGEDKPVIYRDFKASNILLDSDYTAKLSDFGLA  231

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEG++THV TRVMGT GYAAPEY+MTGHLT  SDVYSFG+VLLELLTG+RA+D T+ 
Sbjct  232   KDGPEGEETHVITRVMGTQGYAAPEYVMTGHLTTMSDVYSFGVVLLELLTGKRAMDNTRL  291

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQ+LA+WARP LK+PRKL R++DPRLEG F   GAQKAA  A++CLSH  + RPTMS 
Sbjct  292   GREQSLAEWARPLLKEPRKLERLIDPRLEGQFPIKGAQKAAATAFKCLSHHPRHRPTMSY  351

Query  535   VVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
             VV+ L+ L+D++D     FVY  P E ++
Sbjct  352   VVRVLDSLQDFQDSFVGPFVYVVPNETES  380



>ref|XP_009419910.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=439

 Score =   523 bits (1347),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 243/324 (75%), Positives = 280/324 (86%), Gaps = 3/324 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ ELK +T++FS +NF+G GGFGPV+KG+IDDKLRPGLK   VAVK LDLDG
Sbjct  54    GSNLHVFTIGELKAVTRNFSMTNFIGSGGFGPVYKGYIDDKLRPGLKEPHVAVKSLDLDG  113

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHLVKLIGYCCE+EHR+LVYEYMPRGSLEN LF+R  ASLP
Sbjct  114   LQGHREWLAEVIFLGQLRHPHLVKLIGYCCEDEHRMLVYEYMPRGSLENHLFKRLLASLP  173

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGP+GD+T
Sbjct  174   WSTRLKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTVKLSDFGLAKDGPQGDNT  233

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEY++TGHLTA SDVYSFG+VLLELL GRR +DKT+PNR++NL DW
Sbjct  234   HVTTRVMGTRGYAAPEYVLTGHLTAKSDVYSFGVVLLELLAGRRCVDKTRPNRQKNLVDW  293

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L +  K+ R++DP L+G +S  GAQKAA +AY+CLSH  KSRP M+TVV+TLEPL 
Sbjct  294   ARPYLNNSDKISRVMDPNLDGQYSSKGAQKAAAIAYKCLSHNPKSRPNMTTVVETLEPLL  353

Query  508   DYKDVSSVTFVYTAPTEK---DTK  446
             +  DV   +FVY APTE+   DTK
Sbjct  354   NLSDVPVGSFVYVAPTERVAEDTK  377



>ref|NP_001234561.1| auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum]
 gb|AAK62821.1|AF332960_1 auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum]
 gb|ACZ71039.1| auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum]
Length=464

 Score =   523 bits (1348),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 244/321 (76%), Positives = 276/321 (86%), Gaps = 0/321 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT +ELK+IT  FSS+NFLG+GGFGPVHKGFIDDK++PGL AQPVAVKLLDLDG
Sbjct  67    GSNLHVFTYEELKLITSDFSSANFLGKGGFGPVHKGFIDDKIKPGLDAQPVAVKLLDLDG  126

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWLTEV+FLGQLRH HLVKLIGYC EEE RLLVYEYM RG+LE+QLF RYS+ LP
Sbjct  127   NQGHQEWLTEVVFLGQLRHHHLVKLIGYCWEEEQRLLVYEYMARGNLEDQLFSRYSSCLP  186

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KI +GAAKGLAFLH  EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  187   WLTRIKIMVGAAKGLAFLHGEEKPVIYRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDT  246

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLT+ SDVYSFG+VLLEL+TGRRA+DK +P +E+ L DW
Sbjct  247   HVSTRVMGTHGYAAPEYIMTGHLTSKSDVYSFGVVLLELITGRRAMDKKRPLKERILVDW  306

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L+DP KL RI+DPRLEG +S  GA+K A LAY+CLSH  +SRPTMS +VK LEP+ 
Sbjct  307   ARPMLRDPHKLDRIMDPRLEGQYSTQGAKKVAALAYQCLSHHPRSRPTMSNIVKILEPVL  366

Query  508   DYKDVSSVTFVYTAPTEKDTK  446
             D KD+    FVY  P+ K  K
Sbjct  367   DMKDIPMGPFVYVVPSSKPDK  387



>ref|XP_002304131.1| hypothetical protein POPTR_0003s06450g [Populus trichocarpa]
 gb|EEE79110.1| hypothetical protein POPTR_0003s06450g [Populus trichocarpa]
Length=434

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 242/315 (77%), Positives = 272/315 (86%), Gaps = 0/315 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H FTL+EL+ +T  FS SN+LGEGGFG V+KGFIDDKLRPGLKAQPVAVK+LDLDGSQ
Sbjct  56    NLHVFTLKELQTVTNEFSKSNYLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKVLDLDGSQ  115

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL E+IFLGQL+H HLV LIGYC EEEHRLLVYEY+ RGSLEN+LF RYSA+LPW 
Sbjct  116   GHREWLAEIIFLGQLKHRHLVNLIGYCGEEEHRLLVYEYIERGSLENKLFNRYSAALPWL  175

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIA+G AKGLAFLHE EKPVIYRDFKASN+LL+SDY+ KLSDFGLA DGPEGDDTHV
Sbjct  176   TRLKIAVGTAKGLAFLHEEEKPVIYRDFKASNVLLESDYNAKLSDFGLAMDGPEGDDTHV  235

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             +T VMGT GYAAPEYIMTGHLT  SDV+SFG+VLLEL+TGRR++DK +PNREQNL  WAR
Sbjct  236   TTPVMGTEGYAAPEYIMTGHLTTMSDVFSFGVVLLELITGRRSVDKNRPNREQNLVKWAR  295

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             PQLKDPRKL +I+DPRLEG +S  GA+KAA LAY+CLSH  KSRPTM TVVKTLEPL   
Sbjct  296   PQLKDPRKLDQIMDPRLEGQYSSEGARKAAALAYQCLSHHPKSRPTMRTVVKTLEPLLAL  355

Query  502   KDVSSVTFVYTAPTE  458
              D+    FVY  P E
Sbjct  356   TDIPIGPFVYIVPNE  370



>ref|XP_008778596.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=439

 Score =   521 bits (1342),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 239/319 (75%), Positives = 277/319 (87%), Gaps = 0/319 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT  ELKV+T++FS+SNF+G GGFGPV KGFIDDKLRPGLKAQ VAVK LDL+G
Sbjct  62    GSNLHVFTFAELKVVTRNFSTSNFIGSGGFGPVFKGFIDDKLRPGLKAQTVAVKSLDLEG  121

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWL EV+FLGQL HPHLVKLIGYCCE+E RLLVYEYM RGSLEN LF++  ASLP
Sbjct  122   TQGHREWLAEVVFLGQLEHPHLVKLIGYCCEDERRLLVYEYMARGSLENHLFKKILASLP  181

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGL FLHEA+KPVIYRDFKASNILL+SDY  KLSDFGLAKDGPEG+DT
Sbjct  182   WSTRIKIAVGAAKGLTFLHEAQKPVIYRDFKASNILLNSDYTAKLSDFGLAKDGPEGEDT  241

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P+REQNL +W
Sbjct  242   HVTTRVMGTQGYAAPEYVMTGHLTAKSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVEW  301

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LK+  KL R++DP LEG++S  GAQKAA +AY+CLSH  KSRP M  +V+ LEPL 
Sbjct  302   ARPFLKNANKLGRVMDPHLEGLYSTKGAQKAAAVAYQCLSHSPKSRPQMRDIVEELEPLL  361

Query  508   DYKDVSSVTFVYTAPTEKD  452
             ++ D+   TFVYT   EK+
Sbjct  362   NFNDIPLGTFVYTVTLEKN  380



>ref|XP_006369136.1| hypothetical protein POPTR_0001s16810g [Populus trichocarpa]
 gb|ERP65705.1| hypothetical protein POPTR_0001s16810g [Populus trichocarpa]
Length=450

 Score =   521 bits (1343),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 244/315 (77%), Positives = 273/315 (87%), Gaps = 0/315 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H F L+EL+ IT  FS SN+LGEGGFG V+KGFIDDKLRPGLKAQPVAVK LD DGSQ
Sbjct  57    NLHVFALKELRTITHEFSKSNYLGEGGFGAVYKGFIDDKLRPGLKAQPVAVKALDPDGSQ  116

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL EVIFLGQL+H HLV LIGYCCE+EHRLLVYEY+ RG+LE++LF RYSA+LPW 
Sbjct  117   GHREWLAEVIFLGQLKHRHLVNLIGYCCEDEHRLLVYEYVERGNLEDKLFYRYSAALPWL  176

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIA+GAAKGLAFLHE EKPVIYRDFKASN+LLDSDY+ KLSDFGLA DGPEGD TH+
Sbjct  177   TRLKIAVGAAKGLAFLHEEEKPVIYRDFKASNVLLDSDYNAKLSDFGLATDGPEGDRTHI  236

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             +T VMGT GYAAPEYIMTGHLT  SDV+SFG+VLLELLTGRR++DK  PNREQNL  WAR
Sbjct  237   TTPVMGTEGYAAPEYIMTGHLTTMSDVFSFGVVLLELLTGRRSVDKNLPNREQNLVKWAR  296

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             PQLKDPRKL +I+DPRLEG +S  GA+KAA LAY+CLSH SKSRPTMSTVV+TLE L D 
Sbjct  297   PQLKDPRKLEQIMDPRLEGQYSTEGARKAAGLAYQCLSHHSKSRPTMSTVVRTLEQLLDL  356

Query  502   KDVSSVTFVYTAPTE  458
              D  + TFVY  PTE
Sbjct  357   TDTPTGTFVYIVPTE  371



>emb|CDO97843.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   523 bits (1346),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 243/318 (76%), Positives = 280/318 (88%), Gaps = 1/318 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FTL EL+V+T  FSSSNFLGEGGFGPV+KGF+DD+ RPGLKAQPVAVKLLDL+G
Sbjct  61    GSNLHIFTLAELRVLTHDFSSSNFLGEGGFGPVYKGFVDDRTRPGLKAQPVAVKLLDLEG  120

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QG+REWLTEVIFLGQLRHPHLVKLIGYCCE++HRLLVYEYM RG+LENQLFRR+S SLP
Sbjct  121   TQGYREWLTEVIFLGQLRHPHLVKLIGYCCEDQHRLLVYEYMARGNLENQLFRRFSISLP  180

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR++IA GAA+GLAFLH  EKPVIYRDFK+SNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  181   WLTRIEIAAGAARGLAFLHGEEKPVIYRDFKSSNILLDSDYTAKLSDFGLAKDGPEGDDT  240

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+RA+DK++P+REQNL +W
Sbjct  241   HVTTRVMGTHGYAAPEYIMTGHLTTRSDVYSFGVVLLELLTGKRAVDKSRPSREQNLVEW  300

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKD  K+ +I+DP+L+G +S  GA+KAA LAY+CLSHR++SRPTM  VVK L+ + 
Sbjct  301   ARPLLKDLHKIDKIMDPKLDGQYSSEGAKKAATLAYQCLSHRARSRPTMDGVVKMLDNIL  360

Query  508   DYKDVSSVT-FVYTAPTE  458
             D KD   V  FVY  P E
Sbjct  361   DLKDDIPVGPFVYIVPKE  378



>ref|XP_008782588.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=450

 Score =   521 bits (1341),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 262/385 (68%), Positives = 302/385 (78%), Gaps = 11/385 (3%)
 Frame = -3

Query  1603  KMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIP---ATelsssals  1433
             K K +  S+   CF      G  D  +  +  R   +TKQ S  R+     +  +     
Sbjct  5     KSKASWWSLLASCF------GRGDELSQIRAKR--LVTKQKSLQRLSFSDVSHSTGMLSP  56

Query  1432  edlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVA  1253
             EDLSISL GSN++ FTL ELK+ TQ FS SNFLGEGGFGPV+KGF+DDK++PGLKAQ VA
Sbjct  57    EDLSISLVGSNLYVFTLAELKMATQGFSMSNFLGEGGFGPVYKGFVDDKVKPGLKAQSVA  116

Query  1252  VKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLF  1073
             VKLLDL+G QGH+EWL EVIFLGQLRHPHLVKLIGYC EEEHRLLVYE+M RGSLEN LF
Sbjct  117   VKLLDLEGGQGHKEWLAEVIFLGQLRHPHLVKLIGYCYEEEHRLLVYEFMARGSLENHLF  176

Query  1072  RRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAK  893
             +R+ A LPW TR++IA+GAAKGLAFLHE EKPVIYRDFKASNILLDSDY  KLSDFGLAK
Sbjct  177   KRFFAPLPWLTRLRIAVGAAKGLAFLHETEKPVIYRDFKASNILLDSDYKAKLSDFGLAK  236

Query  892   DGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPN  713
             DGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK++P+
Sbjct  237   DGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRSVDKSRPS  296

Query  712   REQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTV  533
             REQNL +WARP L D RKL RI++P LEG +S  GAQKAA +AY+CLS   KSRP MST+
Sbjct  297   REQNLVEWARPCLNDARKLNRIMEPSLEGQYSTKGAQKAAAVAYQCLSQNPKSRPQMSTI  356

Query  532   VKTLEPLKDYKDVSSVTFVYTAPTE  458
             V+ LEPL +  D++   FVYT   E
Sbjct  357   VEILEPLLEMDDITIGPFVYTVSAE  381



>ref|XP_006357404.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=464

 Score =   520 bits (1340),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 242/321 (75%), Positives = 276/321 (86%), Gaps = 0/321 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT +ELK+IT  FS +NFLG+GGFGPVHKGFIDDK++PGL AQPVAVKLLDLDG
Sbjct  67    GSNLHVFTYEELKLITSDFSPANFLGKGGFGPVHKGFIDDKIKPGLDAQPVAVKLLDLDG  126

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWLTEV+FLGQLRH HLVKLIGYC EEE RLLVYEYM RG+LE+QLF RYS+ LP
Sbjct  127   NQGHQEWLTEVVFLGQLRHHHLVKLIGYCWEEEQRLLVYEYMARGNLEDQLFSRYSSCLP  186

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KI +GAAKGLAFLH  EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  187   WLTRIKIMVGAAKGLAFLHGEEKPVIYRDFKASNILLDSDYRAKLSDFGLAKDGPEGDDT  246

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLT+ SDVYSFG+VLLEL+TGR+A+DK +P +E+ L DW
Sbjct  247   HVSTRVMGTHGYAAPEYIMTGHLTSKSDVYSFGVVLLELITGRQAMDKKRPLKERILVDW  306

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L+DP KL RI+DPRLEG +S  GA+K A LAY+CLSH+ +SRPTMS +VK LEP+ 
Sbjct  307   ARPMLRDPHKLDRIMDPRLEGQYSTQGAKKVAALAYQCLSHQPRSRPTMSNIVKILEPVL  366

Query  508   DYKDVSSVTFVYTAPTEKDTK  446
             D KD+    FVY  P+ K  K
Sbjct  367   DMKDIPMGPFVYVVPSSKPDK  387



>ref|XP_006474675.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Citrus sinensis]
Length=418

 Score =   518 bits (1334),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 256/389 (66%), Positives = 307/389 (79%), Gaps = 12/389 (3%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRI---PATelsssal  1436
             +K K+T  SI   C++++       MP +      E + KQ SF R+     +  SS   
Sbjct  1     MKKKLTWKSITLSCYKSS-------MPES--NANNEQVDKQTSFQRLCLSDVSNPSSPLS  51

Query  1435  sedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
             ++DLS S+ GS +H FTL EL++IT +FS SN LGEGGFGPV+KGF+D+KL+PGL+AQPV
Sbjct  52    ADDLSNSVIGSKLHVFTLAELRLITSNFSRSNLLGEGGFGPVYKGFVDEKLKPGLEAQPV  111

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVK LDLDG+QGH+EW+ E+IFLGQLRHPHLVKLIGYC EEE+RLLVY YMPRGSL NQL
Sbjct  112   AVKALDLDGTQGHKEWMAEIIFLGQLRHPHLVKLIGYCWEEEYRLLVYAYMPRGSLHNQL  171

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FR YSA+LPWSTRMKIALGAAKGLAFLH  +KPVIYRDFKASNILLDSDY  KLSDFGLA
Sbjct  172   FRSYSAALPWSTRMKIALGAAKGLAFLHGEDKPVIYRDFKASNILLDSDYTAKLSDFGLA  231

Query  895   KDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKP  716
             KDGPEG++THV TRVMGT GYAAPEY+MTGHLT  SDVYSFG+VLLELLTG+RA+D T+ 
Sbjct  232   KDGPEGEETHVITRVMGTQGYAAPEYVMTGHLTTMSDVYSFGVVLLELLTGKRAMDNTRL  291

Query  715   NREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMST  536
              REQ+LA+WARP LK+PRKL R++DPRLEG F   GAQKAA  A++CLSH  + RPTMS 
Sbjct  292   GREQSLAEWARPLLKEPRKLERLIDPRLEGQFPIKGAQKAAATAFKCLSHHPRHRPTMSY  351

Query  535   VVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
             VV+ L+ L+D++D     FVY  P E ++
Sbjct  352   VVRVLDSLQDFQDSFVGPFVYVVPNETES  380



>ref|XP_009390860.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   519 bits (1336),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 242/328 (74%), Positives = 278/328 (85%), Gaps = 5/328 (2%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN++ FTL ELK  TQSFS  NFLGEGGFGPV++GF+D+K++PGLK+QPVAVKLLDLDG
Sbjct  55    GSNLYVFTLAELKEATQSFSVGNFLGEGGFGPVYRGFVDEKVKPGLKSQPVAVKLLDLDG  114

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EWL EV+ LG+LRHPHLVKLIGYCCEEEHRLLVYE+MPRGSLEN LF+RY   LP
Sbjct  115   GQGHKEWLAEVLVLGRLRHPHLVKLIGYCCEEEHRLLVYEFMPRGSLENHLFKRYYTPLP  174

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W  R++IA+GAAKGL FLH+++KPVIYRDFKASNILLDSDY  +LSDFGLAKDGPEGDDT
Sbjct  175   WLARLRIAVGAAKGLGFLHDSDKPVIYRDFKASNILLDSDYKARLSDFGLAKDGPEGDDT  234

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR +DK +P+REQNL +W
Sbjct  235   HVSTRVMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRCVDKARPSREQNLVEW  294

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L DPRKL RI+DP LEG +S  GAQ+AA + Y+CLS   KSRP MS +V+ LEPL 
Sbjct  295   ARPCLSDPRKLYRIMDPGLEGQYSTQGAQRAAAVVYQCLSQSPKSRPHMSAIVEALEPLL  354

Query  508   DYKDVSSVTFVYTAP-----TEKDTKTV  440
             D  DV   TFVY AP     +E+ T+TV
Sbjct  355   DMNDVLLGTFVYVAPVAENGSEEGTETV  382



>ref|XP_010937336.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=450

 Score =   518 bits (1335),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 242/317 (76%), Positives = 273/317 (86%), Gaps = 0/317 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN++ FTL ELKV TQSFS+SNF+GEGGFGPV+KGF+DDK++PGLKAQ VAVKLLDL+G
Sbjct  65    GSNLYVFTLAELKVATQSFSTSNFIGEGGFGPVYKGFVDDKVKPGLKAQSVAVKLLDLEG  124

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH EW  EVIFLGQLRHPHLVKLIGYC EEEHRLLVYE+M RGSLEN LF+R+ A LP
Sbjct  125   VQGHMEWQAEVIFLGQLRHPHLVKLIGYCYEEEHRLLVYEFMARGSLENHLFKRFFAPLP  184

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGL FLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  185   WLTRLKIAVGAAKGLVFLHEAEKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDT  244

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR++DK++P+REQNL +W
Sbjct  245   HVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRSVDKSRPSREQNLVEW  304

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D RKL RI+DP LEG +S  GA KAA +AY+CLS   KSRP MST+V+ LEP+ 
Sbjct  305   ARPCLNDARKLNRIMDPSLEGQYSTKGALKAAAVAYQCLSQNPKSRPHMSTIVEILEPIL  364

Query  508   DYKDVSSVTFVYTAPTE  458
             +  D+ +  FVYT   E
Sbjct  365   EMDDIPTGPFVYTVSAE  381



>gb|KHG06741.1| hypothetical protein F383_33276 [Gossypium arboreum]
Length=422

 Score =   517 bits (1332),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 255/390 (65%), Positives = 308/390 (79%), Gaps = 10/390 (3%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAA--GNDDMPATPKKPRREAITKQASFTRIPATelsssa  1439
             + +K KIT  S+   C+++  ++  G + +   P + +R +++          ++ SS  
Sbjct  1     MTVKKKITWKSLMPSCYKSKDSSDSGENRLKLKPCQFQRLSLSD--------VSDPSSPI  52

Query  1438  lsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQP  1259
                 LS SL GSN++ FTL EL++IT +F+  N LGEGGFGPV+KGF+DDKLRPGLKAQP
Sbjct  53    CVNGLSTSLFGSNLYVFTLAELRLITHNFARCNLLGEGGFGPVYKGFVDDKLRPGLKAQP  112

Query  1258  VAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQ  1079
             VAVK LDLDG QGHREWL E+IFLGQLRHPHLVKLIGYC E+E+RLLVYEYMPRGSLENQ
Sbjct  113   VAVKTLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGYCYEDENRLLVYEYMPRGSLENQ  172

Query  1078  LFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGL  899
             LFRRYSA+LPWSTRMKIAL AAKGLAFLHEA+KPVIYRDFK+SNILLDSDY+ KLSDFGL
Sbjct  173   LFRRYSATLPWSTRMKIALEAAKGLAFLHEADKPVIYRDFKSSNILLDSDYNCKLSDFGL  232

Query  898   AKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTK  719
             AKDGPEG +THV+TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+R++D T+
Sbjct  233   AKDGPEGGETHVTTRVMGTQGYAAPEYIMTGHLTTRSDVYSFGVVLLELLTGKRSMDNTR  292

Query  718   PNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMS  539
             P+REQ+L +WARP L+DP++L R++DPRLEG +S  GAQK A LAY+CLSH  K RPTM 
Sbjct  293   PSREQSLVEWARPLLRDPKRLDRVIDPRLEGQYSNKGAQKVAALAYKCLSHYPKPRPTMG  352

Query  538   TVVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
              VV  LE L+ ++D     FVY  P E + 
Sbjct  353   DVVIVLESLQGFEDEFVGPFVYVVPNETEN  382



>gb|KDP34015.1| hypothetical protein JCGZ_07586 [Jatropha curcas]
Length=441

 Score =   516 bits (1330),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 258/387 (67%), Positives = 300/387 (78%), Gaps = 14/387 (4%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssal---sed  1427
             K T + +   C+++ P   +++            + K  SF R+  T++S+ +     ED
Sbjct  5     KGTWNCMILSCYKSEPLEESENQ-----------VFKHNSFRRLSLTDVSNPSSPLCVED  53

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS S AG  +H FT  EL++ITQSF+  N LGEGGFGPV+KGFIDDKLRPGLKAQPVAVK
Sbjct  54    LSNSFAGPKLHIFTFAELRIITQSFARINLLGEGGFGPVYKGFIDDKLRPGLKAQPVAVK  113

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
              LDLDG QGH+EW+ E+IFLGQLRHPHLVKLIGYCCEE+ RLLVYEYMPRGSLENQLFRR
Sbjct  114   SLDLDGMQGHKEWMAEIIFLGQLRHPHLVKLIGYCCEEDQRLLVYEYMPRGSLENQLFRR  173

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YSA+LPWSTRMKIAL AAKGLAFLHE++KPVI+RDFK SNILLDSDY  KLSDFGLAKDG
Sbjct  174   YSAALPWSTRMKIALEAAKGLAFLHESDKPVIFRDFKTSNILLDSDYTAKLSDFGLAKDG  233

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEG++THV+TRVMGT GYAAPEY+MTGHLT  SDVYSFG+VLLELLTG+R++D T+  RE
Sbjct  234   PEGEETHVTTRVMGTQGYAAPEYVMTGHLTTMSDVYSFGVVLLELLTGKRSMDDTRLGRE  293

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             Q+L +  RP LKD  KL RI+DPRLEG F   GAQKAA LAY+CLSH  K RPTMS VVK
Sbjct  294   QSLVECTRPLLKDQHKLDRIIDPRLEGQFPYNGAQKAAALAYKCLSHNPKGRPTMSCVVK  353

Query  526   TLEPLKDYKDVSSVTFVYTAPTEKDTK  446
              LE L+D+ D  S  FVY  P E   K
Sbjct  354   VLESLQDFDDTFSAPFVYIVPDETSAK  380



>ref|XP_010939901.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=442

 Score =   516 bits (1329),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 240/317 (76%), Positives = 272/317 (86%), Gaps = 0/317 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN++ FTL ELKV TQ FS SNFLGEGGFGPV+KGF+D+K++PGLKAQ VAVKLLDL+G
Sbjct  67    GSNLYVFTLSELKVATQGFSMSNFLGEGGFGPVYKGFVDEKVKPGLKAQSVAVKLLDLEG  126

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EWL EVIFLGQLRHPHLVKLIGYCCE++HRLLVYE+M RGSLEN LF+++ ASLP
Sbjct  127   VQGHKEWLAEVIFLGQLRHPHLVKLIGYCCEDKHRLLVYEFMARGSLENHLFKKFLASLP  186

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA GAA+GL FLHE EKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  187   WLTRLKIAAGAARGLTFLHETEKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDT  246

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYI+TGHLTA SDVYSFG+VLLELLTGRR++DKT+P+REQNL +W
Sbjct  247   HVSTRVMGTEGYAAPEYILTGHLTAKSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVEW  306

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D RKL RI+DP L G +S   AQKAA +AY+CLS   KSRP MST+VKTLEPL 
Sbjct  307   ARPCLNDARKLNRIMDPCLVGQYSTKCAQKAAAVAYQCLSQNPKSRPQMSTIVKTLEPLL  366

Query  508   DYKDVSSVTFVYTAPTE  458
             +  D+    F+YT   E
Sbjct  367   EMDDMPIGPFIYTVSVE  383



>ref|XP_004498840.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=387

 Score =   513 bits (1322),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 295/362 (81%), Gaps = 4/362 (1%)
 Frame = -3

Query  1519  PKKPRREAITKQASFTRI---PATelsssalsedlsislAGSNIHAFTLQELKVITQSFS  1349
             P +  +E + KQ SF R+     +  SS+   EDLSIS AGS ++AFTL+ELK  T SFS
Sbjct  23    PLEESKEQVLKQGSFQRLCLSDISNSSSTQAIEDLSISFAGSKLYAFTLEELKEATHSFS  82

Query  1348  SSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHP  1169
              SN LGEGGFGPV+KGF+DDKLR GLKAQ VAVK LDLDG QGHREWL E+IFLGQLRHP
Sbjct  83    WSNMLGEGGFGPVYKGFVDDKLRQGLKAQTVAVKCLDLDGLQGHREWLAEIIFLGQLRHP  142

Query  1168  HLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHE  989
             HLVKLIGYC E+EHRLLVYEYMPRGSLENQLFRRYSA++PWSTRMKIALGAAKGLAFLHE
Sbjct  143   HLVKLIGYCYEDEHRLLVYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHE  202

Query  988   AEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMT  809
             A+KPVIYRDFKASN+LLDSDY  KLSDFGLAKDGPEG++THV+TR+MGTHGYAAPEYIMT
Sbjct  203   ADKPVIYRDFKASNVLLDSDYTAKLSDFGLAKDGPEGEETHVTTRIMGTHGYAAPEYIMT  262

Query  808   GHLTAASDVYSFGIVLLELLTGRRAIDKT-KPNREQNLADWARPQLKDPRKLRRILDPRL  632
             GHLT  SDVYS+G+VLLELLTG+R +DK+ +  R ++L +WARP L+DP+KL RI+D RL
Sbjct  263   GHLTTKSDVYSYGVVLLELLTGKRVVDKSLQSKRGKSLVEWARPMLRDPKKLHRIIDRRL  322

Query  631   EGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKD  452
             EG F   GA K A+LA++CL H    RP+MS VVK LEPL+D+ DV    FVY A  E  
Sbjct  323   EGQFPMKGAIKVAMLAFKCLCHHPNPRPSMSNVVKILEPLQDFDDVFIGPFVYVAVNENG  382

Query  451   TK  446
              K
Sbjct  383   DK  384



>ref|XP_006849707.1| hypothetical protein AMTR_s00024p00242070 [Amborella trichopoda]
 gb|ERN11288.1| hypothetical protein AMTR_s00024p00242070 [Amborella trichopoda]
Length=419

 Score =   514 bits (1323),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 254/375 (68%), Positives = 297/375 (79%), Gaps = 12/375 (3%)
 Frame = -3

Query  1570  GCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedlsislAGSNIHA  1391
             GC R +          +PK  +R  + KQ SF R+ +    S     +      GS++H 
Sbjct  13    GCLRES----------SPKTNKR-VVAKQTSFQRL-SFSDLSDPFLVEDLSLSLGSSLHN  60

Query  1390  FTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHRE  1211
             FTL ELK ITQ+FS+S  LGEGGFGPVHKG+IDDKLRPGLKAQ VAVKLLDL+G QGHRE
Sbjct  61    FTLSELKAITQNFSASFLLGEGGFGPVHKGYIDDKLRPGLKAQAVAVKLLDLEGLQGHRE  120

Query  1210  WLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMK  1031
             WL EVIFLGQLRHPHLVKL+GYC E+EHRLLVYE+MP+GSLEN LF+R+S SLPW+ R+K
Sbjct  121   WLAEVIFLGQLRHPHLVKLVGYCYEDEHRLLVYEFMPKGSLENHLFKRFSISLPWAIRLK  180

Query  1030  IALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRV  851
             I +GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGD+THVSTRV
Sbjct  181   ITIGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDETHVSTRV  240

Query  850   MGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLK  671
             MGTHGYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P+REQ+L +WARP L 
Sbjct  241   MGTHGYAAPEYVMTGHLTAKSDVYSFGVVLLELLTGRRSMDKTRPSREQSLVEWARPYLN  300

Query  670   DPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVS  491
             + +KL R++DP L+G +S  GAQKAA LAY+CLSH  K+RP M  VV+ LEP++D K+  
Sbjct  301   NSKKLNRVMDPNLDGQYSIKGAQKAAALAYQCLSHNPKNRPLMRQVVEILEPVQDLKEDI  360

Query  490   SVTFVYTAPTEKDTK  446
                FVYTA  E   K
Sbjct  361   VGPFVYTAAMENARK  375



>ref|XP_009408404.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   514 bits (1325),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 276/316 (87%), Gaps = 1/316 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+HAFT+ EL+ +T++FS +NF+G GGFGPV+KGFIDDKLRPGLKAQ VAVK LDLDG
Sbjct  58    GSNLHAFTIAELRAVTRNFSVTNFIGSGGFGPVYKGFIDDKLRPGLKAQQVAVKSLDLDG  117

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHLVKLIGYCCE+EHR+LVYE++PRGSLEN LF+R  +SLP
Sbjct  118   QQGHREWLAEVIFLGQLRHPHLVKLIGYCCEDEHRMLVYEFVPRGSLENHLFKRLVSSLP  177

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFKASNIL+D+D+  KL+DFGLAKDGP+GD+T
Sbjct  178   WSTRLKIAVGAAKGLAFLHEAEKPVIYRDFKASNILIDTDHTAKLADFGLAKDGPQGDNT  237

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEY++TGHLTA SDVYSFG+VLLELL GRR +DK +PNR++NL DW
Sbjct  238   HVTTRVMGTHGYAAPEYVLTGHLTAKSDVYSFGVVLLELLAGRRCVDKNRPNRQKNLVDW  297

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L +  KLRR++DP L+G++S  GAQKAA +AY+CLSH  KSRP M TVV+ LEPL 
Sbjct  298   ARPYLTNADKLRRVMDPGLDGLYSTKGAQKAAAIAYKCLSHNPKSRPEMRTVVEMLEPLL  357

Query  508   DYKDVS-SVTFVYTAP  464
             +  DV     FVY AP
Sbjct  358   NLNDVPFGGAFVYVAP  373



>ref|XP_009390859.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   514 bits (1323),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 278/330 (84%), Gaps = 7/330 (2%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN++ FTL ELK  TQSFS  NFLGEGGFGPV++GF+D+K++PGLK+QPVAVKLLDLDG
Sbjct  55    GSNLYVFTLAELKEATQSFSVGNFLGEGGFGPVYRGFVDEKVKPGLKSQPVAVKLLDLDG  114

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EWL EV+ LG+LRHPHLVKLIGYCCEEEHRLLVYE+MPRGSLEN LF+RY   LP
Sbjct  115   GQGHKEWLAEVLVLGRLRHPHLVKLIGYCCEEEHRLLVYEFMPRGSLENHLFKRYYTPLP  174

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDS--DYDGKLSDFGLAKDGPEGD  875
             W  R++IA+GAAKGL FLH+++KPVIYRDFKASNILLDS  DY  +LSDFGLAKDGPEGD
Sbjct  175   WLARLRIAVGAAKGLGFLHDSDKPVIYRDFKASNILLDSFQDYKARLSDFGLAKDGPEGD  234

Query  874   DTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLA  695
             DTHVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR +DK +P+REQNL 
Sbjct  235   DTHVSTRVMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRCVDKARPSREQNLV  294

Query  694   DWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEP  515
             +WARP L DPRKL RI+DP LEG +S  GAQ+AA + Y+CLS   KSRP MS +V+ LEP
Sbjct  295   EWARPCLSDPRKLYRIMDPGLEGQYSTQGAQRAAAVVYQCLSQSPKSRPHMSAIVEALEP  354

Query  514   LKDYKDVSSVTFVYTAP-----TEKDTKTV  440
             L D  DV   TFVY AP     +E+ T+TV
Sbjct  355   LLDMNDVLLGTFVYVAPVAENGSEEGTETV  384



>dbj|BAB09992.1| serine/threonine protein kinase-like [Arabidopsis thaliana]
Length=464

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 267/393 (68%), Positives = 316/393 (80%), Gaps = 14/393 (4%)
 Frame = -3

Query  1612  IELKMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRRE----AITKQASF---TRIPATe  1454
             + +K K +  S+   CF+      + D   +PKK +++     ITKQ SF   + +  + 
Sbjct  1     MAVKKKSSWRSLMVLCFQ------DPDNIYSPKKTKKDDGERVITKQKSFLGLSILDISN  54

Query  1453  lsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  1274
              SS+ LSEDLSISLAGS++H FT  EL+VITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG
Sbjct  55    PSSTTLSEDLSISLAGSDLHVFTQAELRVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG  114

Query  1273  LKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRG  1094
             LKAQPVAVKLLDLDG QGHRE++TEV+ LG+L+HP+LVKLIGYCCEE HRLLVYE+MPRG
Sbjct  115   LKAQPVAVKLLDLDGLQGHREFMTEVMCLGKLKHPNLVKLIGYCCEEAHRLLVYEFMPRG  174

Query  1093  SLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKL  914
             SLE+QLFRR S  LPW+TR+ IA  AAKGL FLHEAEKP+IYRDFKASNILLDSDY  KL
Sbjct  175   SLESQLFRRCSLPLPWTTRLNIAYEAAKGLQFLHEAEKPIIYRDFKASNILLDSDYTAKL  234

Query  913   SDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRA  734
             SDFGLAKDGP+GDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGR++
Sbjct  235   SDFGLAKDGPQGDDTHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRKS  294

Query  733   IDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKS  554
             +D  + +R++ L +WARP L D RKL RI+DPRLE  +SE GA+KAA LAY+CL +R K+
Sbjct  295   VDIARSSRKETLVEWARPMLNDARKLGRIMDPRLEDQYSETGARKAATLAYQCLRYRPKT  354

Query  553   RPTMSTVVKTLEPLKDYKDVSSV-TFVYTAPTE  458
             RP +STVV  L+ +KDYKD   +  F YT PT+
Sbjct  355   RPDISTVVSVLQDIKDYKDDIPIGIFTYTVPTK  387



>ref|XP_002521318.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF40986.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=455

 Score =   514 bits (1324),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 238/315 (76%), Positives = 273/315 (87%), Gaps = 0/315 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H FTL+ELK  TQ+ S SN+LGEGGFG V+KGFI DKLRPGLKAQ VAVK LDLDGSQ
Sbjct  61    NLHVFTLKELKTATQNLSKSNYLGEGGFGAVYKGFITDKLRPGLKAQSVAVKALDLDGSQ  120

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL EVIFLGQL+HPHLV LIGYCCE+EHRLLVYEYM RG+LEN LF+RYSA+LPW 
Sbjct  121   GHREWLAEVIFLGQLKHPHLVNLIGYCCEDEHRLLVYEYMERGNLENLLFKRYSAALPWL  180

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIALGAAKGLAFLHE EKPVIYRDFKASN+LLD+D++ KLSDFGLA DGP+GD++H+
Sbjct  181   TRLKIALGAAKGLAFLHEEEKPVIYRDFKASNVLLDADFNAKLSDFGLATDGPQGDESHI  240

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             STRVMGT GYAAPEYIMTGHLTA SDV+SFG+VLLELLTGRR++DK +P+REQNL  WAR
Sbjct  241   STRVMGTEGYAAPEYIMTGHLTAMSDVFSFGVVLLELLTGRRSVDKNRPSREQNLVKWAR  300

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             P LKD  KL  I+DPRLEG +S  GA+KAA LAY+CLSH  KSRP+M++VVKTLE L + 
Sbjct  301   PLLKDHHKLDLIMDPRLEGQYSTEGARKAAALAYQCLSHHCKSRPSMTSVVKTLESLLEL  360

Query  502   KDVSSVTFVYTAPTE  458
              D+   TFVY  P+E
Sbjct  361   NDIPMGTFVYIVPSE  375



>gb|KHN20154.1| Putative receptor-like protein kinase [Glycine soja]
Length=386

 Score =   511 bits (1317),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 251/353 (71%), Positives = 291/353 (82%), Gaps = 3/353 (1%)
 Frame = -3

Query  1495  ITKQASFTRI---PATelsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEG  1325
             + KQ SF R+     +  SS+   ED+SIS AGS ++AFTL+EL+  T SFS SN LGEG
Sbjct  31    VLKQGSFQRLCLSDVSNSSSTQAIEDISISFAGSKLYAFTLEELREATNSFSWSNMLGEG  90

Query  1324  GFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGY  1145
             GFGPV+KGF+DDKLR GLKAQ VAVK LDLDG QGHREWL E+IFLGQLRHPHLVKLIGY
Sbjct  91    GFGPVYKGFVDDKLRSGLKAQTVAVKRLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGY  150

Query  1144  CCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYR  965
             C E+EHRLL+YEYMPRGSLENQLFRRYSA++PWSTRMKIALGAAKGLAFLHEA+KPVIYR
Sbjct  151   CYEDEHRLLMYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEADKPVIYR  210

Query  964   DFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASD  785
             DFKASNILLDSD+  KLSDFGLAKDGPEG+DTHV+TR+MGT GYAAPEYIMTGHLT  SD
Sbjct  211   DFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTGHLTTKSD  270

Query  784   VYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGA  605
             VYS+G+VLLELLTGRR +DK++ N  ++L +WARP L+D +K+  I+D RLEG F   GA
Sbjct  271   VYSYGVVLLELLTGRRVVDKSRSNEGKSLVEWARPLLRDQKKVYNIIDRRLEGQFPMKGA  330

Query  604   QKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
              K A+LA++CLSH   +RPTMS V+K LEPL+DY DV    FVY A +E   K
Sbjct  331   MKVAMLAFKCLSHHPNARPTMSDVIKVLEPLQDYDDVFIGPFVYVAVSETGDK  383



>ref|XP_010917227.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=437

 Score =   513 bits (1321),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 240/314 (76%), Positives = 271/314 (86%), Gaps = 0/314 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT  ELK +T++FS SNF+G GGFGPV KGFIDDKLRPGLKAQ VAVK LDL+G
Sbjct  62    GSNLHVFTFAELKDVTKNFSMSNFIGSGGFGPVFKGFIDDKLRPGLKAQTVAVKSLDLEG  121

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWL EV+FLGQL HPHLVKLIGYCCEEEHRLLVYEYM RGSLEN LF+R  ASLP
Sbjct  122   TQGHREWLAEVVFLGQLEHPHLVKLIGYCCEEEHRLLVYEYMARGSLENHLFKRILASLP  181

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEA+KPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEG+DT
Sbjct  182   WSTRIKIAVGAAKGLAFLHEAQKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEDT  241

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DK +P+REQNL +W
Sbjct  242   HVTTRVMGTQGYAAPEYVMTGHLTAKSDVYSFGVVLLELLTGRRSVDKNRPSREQNLVEW  301

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LK+  KL R +DP LEG++S  GAQKAA +AY+CLSH  KSRP M  +V  LEPL 
Sbjct  302   ARPLLKNSNKLCRFMDPNLEGLYSTKGAQKAAAVAYQCLSHSPKSRPHMRDIVGDLEPLL  361

Query  508   DYKDVSSVTFVYTA  467
             ++ D+    FVYTA
Sbjct  362   NWVDIPIGPFVYTA  375



>ref|NP_198408.2| Ser/Thr protein kinase ACIK1b [Arabidopsis thaliana]
 gb|AED93983.1| Ser/Thr protein kinase ACIK1b [Arabidopsis thaliana]
Length=494

 Score =   515 bits (1326),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 261/363 (72%), Positives = 304/363 (84%), Gaps = 8/363 (2%)
 Frame = -3

Query  1522  TPKKPRRE----AITKQASF---TRIPATelsssalsedlsislAGSNIHAFTLQELKVI  1364
             +PKK +++     ITKQ SF   + +  +  SS+ LSEDLSISLAGS++H FT  EL+VI
Sbjct  13    SPKKTKKDDGERVITKQKSFLGLSILDISNPSSTTLSEDLSISLAGSDLHVFTQAELRVI  72

Query  1363  TQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLG  1184
             TQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG QGHRE++TEV+ LG
Sbjct  73    TQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLG  132

Query  1183  QLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGL  1004
             +L+HP+LVKLIGYCCEE HRLLVYE+MPRGSLE+QLFRR S  LPW+TR+ IA  AAKGL
Sbjct  133   KLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGL  192

Query  1003  AFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAP  824
              FLHEAEKP+IYRDFKASNILLDSDY  KLSDFGLAKDGP+GDDTHVSTRVMGT GYAAP
Sbjct  193   QFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAP  252

Query  823   EYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRIL  644
             EYIMTGHLTA SDVYSFG+VLLELLTGR+++D  + +R++ L +WARP L D RKL RI+
Sbjct  253   EYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIM  312

Query  643   DPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSV-TFVYTA  467
             DPRLE  +SE GA+KAA LAY+CL +R K+RP +STVV  L+ +KDYKD   +  F YT 
Sbjct  313   DPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTV  372

Query  466   PTE  458
             PT+
Sbjct  373   PTK  375



>ref|XP_009599916.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Nicotiana 
tomentosiformis]
Length=465

 Score =   514 bits (1323),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 254/386 (66%), Positives = 300/386 (78%), Gaps = 5/386 (1%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRAA----PAAGNDDMPATPKKPRREAITKQASFTRIPATelsssa  1439
             +  KITL +I   CF+      P    +++    K         + + + I +   SS +
Sbjct  1     MAFKITLKTIIPSCFKVKIDVLPLEDKNNIVQVSKNSNTNCGNSRLALSDI-SDPESSLS  59

Query  1438  lsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQP  1259
             +S+  S ++ GSN+H FT  ELKV+T +FSSSNFLGEGGFGPVHKGFIDDK++PGLKAQP
Sbjct  60    ISDLSSNAVIGSNLHIFTHSELKVMTSNFSSSNFLGEGGFGPVHKGFIDDKIKPGLKAQP  119

Query  1258  VAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQ  1079
             VAVKLLDL+GSQGH EWLTEV+ LGQLRHP+LVKLIGYC E+E RLLVYEYM RG+LENQ
Sbjct  120   VAVKLLDLEGSQGHLEWLTEVVLLGQLRHPNLVKLIGYCWEDEQRLLVYEYMARGNLENQ  179

Query  1078  LFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGL  899
             LFRR S+SLPW TRM IA+ AAKGLAFLH  EKPVIYRDFKASNILLDSDY  KLSDFGL
Sbjct  180   LFRRCSSSLPWLTRMNIAVDAAKGLAFLHGEEKPVIYRDFKASNILLDSDYTAKLSDFGL  239

Query  898   AKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTK  719
             AKDGPEG DTHV+TRVMGT+GYAAPEY+MTG+LT+ SDVYSFG+VLLELLTGR+ IDK +
Sbjct  240   AKDGPEGSDTHVTTRVMGTYGYAAPEYMMTGYLTSKSDVYSFGVVLLELLTGRQVIDKKR  299

Query  718   PNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMS  539
             P+REQNL +WARP LKD  KL RI+DPRLEG +S  GA+K   L Y+CLS + KSRPTM+
Sbjct  300   PSREQNLVEWARPFLKDSHKLDRIMDPRLEGQYSTQGAKKVVALTYQCLSQQPKSRPTMT  359

Query  538   TVVKTLEPLKDYKDVSSVTFVYTAPT  461
              VVK LEP+ D KD+    FVY  P+
Sbjct  360   NVVKILEPILDLKDIPIGPFVYVVPS  385



>ref|XP_002516154.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF46156.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=448

 Score =   513 bits (1320),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 239/321 (74%), Positives = 270/321 (84%), Gaps = 0/321 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G  +H F   EL+ ITQSFS SN LGEGGFGPV+KGF+DDKLRPGL AQPVAVK LDLDG
Sbjct  60    GPKLHIFAFAELRTITQSFSRSNLLGEGGFGPVYKGFVDDKLRPGLAAQPVAVKSLDLDG  119

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EW+ E+IFLGQLRH HLVKLIGYC EE+ RLLVYEYMPRGSLENQLFRRYSA+LP
Sbjct  120   LQGHKEWMAEIIFLGQLRHQHLVKLIGYCSEEDQRLLVYEYMPRGSLENQLFRRYSAALP  179

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WS RMKIALGAAKGLAFLHE + PVIYRDFK+SNILLDSDY  KLSDFGLAKDGP+G++T
Sbjct  180   WSARMKIALGAAKGLAFLHETDPPVIYRDFKSSNILLDSDYIAKLSDFGLAKDGPDGEET  239

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEY+MTGHLT  SDVYSFG+VL+ELLTGRR++D T+P R+QN+ +W
Sbjct  240   HVTTRVMGTQGYAAPEYVMTGHLTTMSDVYSFGVVLIELLTGRRSMDDTRPGRDQNIVEW  299

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKD  KL RI+DPRLEG +S +GAQKAA LAY+CLSH  K RPTMS VVK LE L+
Sbjct  300   ARPLLKDLNKLDRIIDPRLEGQYSSSGAQKAAALAYKCLSHHPKPRPTMSYVVKVLESLQ  359

Query  508   DYKDVSSVTFVYTAPTEKDTK  446
             D+ D     FVY  P E  +K
Sbjct  360   DFDDTFLAPFVYIVPNENGSK  380



>ref|XP_009403379.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=439

 Score =   510 bits (1313),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 274/320 (86%), Gaps = 0/320 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FTL ELK +T++FS++NF+G GGFGPV KG++DDKLRPGLKAQ VAVK LDL+G
Sbjct  61    GSNLHVFTLAELKAVTRNFSTTNFIGSGGFGPVFKGYVDDKLRPGLKAQHVAVKSLDLEG  120

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHL KLIGYCCE+EHR+LVYEYM RGSLEN LF+R  ASLP
Sbjct  121   LQGHREWLAEVIFLGQLRHPHLAKLIGYCCEDEHRMLVYEYMARGSLENHLFKRLLASLP  180

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGP+G++T
Sbjct  181   WSTRIKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGEET  240

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEY++TGHLTA SDVYSFG+VLLELL+GRR++DK + NRE+NL +W
Sbjct  241   HVTTRVMGTRGYAAPEYLLTGHLTAKSDVYSFGVVLLELLSGRRSVDKNRSNREKNLVEW  300

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARPQL +P+KL R++D  LEG +S  GAQKAA +AY+CL+   K RP M  VV+TLEPL 
Sbjct  301   ARPQLNNPQKLSRVMDRNLEGQYSTKGAQKAAAVAYKCLNLNPKKRPDMRAVVETLEPLL  360

Query  508   DYKDVSSVTFVYTAPTEKDT  449
             +  DV    FVYTAP E + 
Sbjct  361   EMNDVPIGPFVYTAPAETEN  380



>ref|XP_003588903.1| Protein kinase 2B [Medicago truncatula]
 gb|AES59154.1| kinase 1B [Medicago truncatula]
Length=388

 Score =   508 bits (1307),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 242/322 (75%), Positives = 272/322 (84%), Gaps = 1/322 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS +HAFTL+ELK  T +FS SN LGEGGFGPV+KGF+DDKLR GLKAQ VAVK LDLDG
Sbjct  64    GSKLHAFTLEELKEATHNFSWSNMLGEGGFGPVYKGFVDDKLRQGLKAQTVAVKCLDLDG  123

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL E+IFLGQL HPHLVKLIGYC E+EHRLLVYEYMPRGSLENQLFRRYSA++P
Sbjct  124   LQGHREWLAEIIFLGQLSHPHLVKLIGYCFEDEHRLLVYEYMPRGSLENQLFRRYSATMP  183

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAAKGLAFLHEA+KPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEG++T
Sbjct  184   WSTRMKIALGAAKGLAFLHEADKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGEET  243

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDK-TKPNREQNLAD  692
             HV+TRVMGTHGYAAPEYIMTGHLT  SDVYS+G+VLLELLTGRR +DK ++ +R +NL +
Sbjct  244   HVTTRVMGTHGYAAPEYIMTGHLTTKSDVYSYGVVLLELLTGRRVVDKSSESSRGKNLVE  303

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             WARP L+D +KL RI+D RLEG +   GA K A+LA++CLSH    RP MS VVK LEPL
Sbjct  304   WARPMLRDQKKLHRIIDRRLEGQYPTKGALKVAMLAFKCLSHHPNPRPFMSDVVKVLEPL  363

Query  511   KDYKDVSSVTFVYTAPTEKDTK  446
             +D+ DV    FVY A  E   K
Sbjct  364   QDFDDVFIGPFVYVAVNENGDK  385



>ref|XP_010086797.1| Putative receptor-like protein kinase [Morus notabilis]
 gb|EXB23807.1| Putative receptor-like protein kinase [Morus notabilis]
Length=456

 Score =   510 bits (1314),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 236/318 (74%), Positives = 271/318 (85%), Gaps = 0/318 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FTL+ELK ITQ FS SNFLGEGGFG V+KGFIDDKLRPGL+AQ VAVK+LDLDG
Sbjct  61    GSNLHIFTLKELKNITQDFSKSNFLGEGGFGQVYKGFIDDKLRPGLEAQSVAVKVLDLDG  120

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQL+HPHLV LIGYCCE+EHRLLVYE+MPRG+L+N+LF  YSA+LP
Sbjct  121   KQGHREWLAEVIFLGQLKHPHLVNLIGYCCEDEHRLLVYEFMPRGNLDNRLFESYSATLP  180

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W  R++IA+GAAKGL FLHE +KPVIYRDFKASNILL+SD+  KLSDFGLA DGPEGD++
Sbjct  181   WLRRLQIAVGAAKGLTFLHEEDKPVIYRDFKASNILLNSDFTSKLSDFGLAIDGPEGDES  240

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEYIMTGH+T  SDV+SFG+VLLELLTGRR +DKT+PNREQNL DW
Sbjct  241   HVTTRVMGTQGYAAPEYIMTGHVTTMSDVFSFGVVLLELLTGRRCLDKTRPNREQNLVDW  300

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P LKD  K+ RI+DPRLEG +S  GA+KAA LAY CLS   K RPTMS V+KTLEPL 
Sbjct  301   AKPFLKDAHKVDRIMDPRLEGQYSSEGARKAATLAYHCLSQHPKCRPTMSFVIKTLEPLL  360

Query  508   DYKDVSSVTFVYTAPTEK  455
             D     S+ FVY  P ++
Sbjct  361   DVTHDISIPFVYVVPHDE  378



>gb|KHN05281.1| Serine/threonine-protein kinase [Glycine soja]
Length=389

 Score =   507 bits (1306),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 248/353 (70%), Positives = 290/353 (82%), Gaps = 3/353 (1%)
 Frame = -3

Query  1495  ITKQASFTRI---PATelsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEG  1325
             + KQ SF R+     +  SS+   ED+SIS AGS ++AFTL+EL+  T SFS SN LGEG
Sbjct  34    VLKQGSFQRLCLSDVSNSSSTQAIEDISISFAGSKLYAFTLEELREATNSFSWSNMLGEG  93

Query  1324  GFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGY  1145
             GFGPV+KGF+DDKLR GLKAQ +AVK LDLDG QGHREWL E+IFLGQLRHPHLVKLIGY
Sbjct  94    GFGPVYKGFLDDKLRSGLKAQTIAVKRLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGY  153

Query  1144  CCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYR  965
             C E+EHRLL+YEYMPRGSLENQLFR+YSA++PWSTRMKIALGAAKGL FLHEA+KPVIYR
Sbjct  154   CYEDEHRLLMYEYMPRGSLENQLFRKYSAAMPWSTRMKIALGAAKGLTFLHEADKPVIYR  213

Query  964   DFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASD  785
             DFKASNILLDSD+  KLSDFGLAKDGPEG+DTHV+TR+MGT GYAAPEYIMTGHLT  SD
Sbjct  214   DFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTGHLTTKSD  273

Query  784   VYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGA  605
             VYS+G+VLLELLTGRR +DK++ N  ++L +WARP L+D +K+  I+D RLEG F   GA
Sbjct  274   VYSYGVVLLELLTGRRVVDKSQSNGRKSLVEWARPLLRDQKKVYSIIDRRLEGQFPMKGA  333

Query  604   QKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
              K A+LA++CLSH   +RP+MS VVK LEPL+DY DV    FVY A +E   K
Sbjct  334   MKVAMLAFKCLSHHPNARPSMSDVVKVLEPLQDYDDVFIGPFVYVAVSENGDK  386



>dbj|BAD94092.1| serine/threonine protein kinase-like [Arabidopsis thaliana]
Length=494

 Score =   511 bits (1315),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 260/363 (72%), Positives = 303/363 (83%), Gaps = 8/363 (2%)
 Frame = -3

Query  1522  TPKKPRRE----AITKQASF---TRIPATelsssalsedlsislAGSNIHAFTLQELKVI  1364
             +PKK +++     ITKQ SF   + +  +  SS+ LSEDLSISLAGS++H FT  EL+VI
Sbjct  13    SPKKTKKDDGERVITKQKSFLGLSILDISNPSSTTLSEDLSISLAGSDLHVFTQAELRVI  72

Query  1363  TQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLG  1184
             TQSFSSSNFLGEGGFG VHKGFIDDKLRPGLKAQPVAVKLLDLDG QGHRE++TEV+ LG
Sbjct  73    TQSFSSSNFLGEGGFGLVHKGFIDDKLRPGLKAQPVAVKLLDLDGLQGHREFMTEVMCLG  132

Query  1183  QLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGL  1004
             +L+HP+LVKLIGYCCEE HRLLVYE+MPRGSLE+QLFRR S  LPW+TR+ IA  AAKGL
Sbjct  133   KLKHPNLVKLIGYCCEEAHRLLVYEFMPRGSLESQLFRRCSLPLPWTTRLNIAYEAAKGL  192

Query  1003  AFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAP  824
              FLHEAEKP+IYRDFKASNILLDSDY  KLSDFGLAKDGP+GDDTHVSTRVMGT GYAAP
Sbjct  193   QFLHEAEKPIIYRDFKASNILLDSDYTAKLSDFGLAKDGPQGDDTHVSTRVMGTQGYAAP  252

Query  823   EYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRIL  644
             EYIMTGHLTA SDVYSFG+VLLELLTGR+++D  + +R++ L +WARP L D RKL RI+
Sbjct  253   EYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRIM  312

Query  643   DPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSV-TFVYTA  467
             DPRLE  +SE GA+KAA LAY+CL +R K+RP +STVV  L+ +KDYKD   +  F YT 
Sbjct  313   DPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKDDIPIGIFTYTV  372

Query  466   PTE  458
             PT+
Sbjct  373   PTK  375



>ref|XP_003544585.2| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Glycine max]
Length=386

 Score =   506 bits (1304),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 248/353 (70%), Positives = 290/353 (82%), Gaps = 3/353 (1%)
 Frame = -3

Query  1495  ITKQASFTRI---PATelsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEG  1325
             + KQ SF R+     +  SS+   ED+SIS AGS ++AFTL+EL+  T SFS SN LGEG
Sbjct  31    VLKQGSFQRLCLSDVSNSSSTQAIEDISISFAGSKLYAFTLEELREATNSFSWSNMLGEG  90

Query  1324  GFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGY  1145
             GFGPV+KGF+DDKLR GLKAQ +AVK LDLDG QGHREWL E+IFLGQLRHPHLVKLIGY
Sbjct  91    GFGPVYKGFLDDKLRSGLKAQTIAVKRLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGY  150

Query  1144  CCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYR  965
             C E+EHRLL+YEYMPRGSLENQLFR+YSA++PWSTRMKIALGAAKGL FLHEA+KPVIYR
Sbjct  151   CYEDEHRLLMYEYMPRGSLENQLFRKYSAAMPWSTRMKIALGAAKGLTFLHEADKPVIYR  210

Query  964   DFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASD  785
             DFKASNILLDSD+  KLSDFGLAKDGPEG+DTHV+TR+MGT GYAAPEYIMTGHLT  SD
Sbjct  211   DFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTGHLTTKSD  270

Query  784   VYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGA  605
             VYS+G+VLLELLTGRR +DK++ N  ++L +WARP L+D +K+  I+D RLEG F   GA
Sbjct  271   VYSYGVVLLELLTGRRVVDKSQSNGRKSLVEWARPLLRDQKKVYSIIDRRLEGQFPMKGA  330

Query  604   QKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
              K A+LA++CLSH   +RP+MS VVK LEPL+DY DV    FVY A +E   K
Sbjct  331   MKVAMLAFKCLSHHPNARPSMSDVVKVLEPLQDYDDVFIGPFVYVAVSENGDK  383



>gb|EYU21319.1| hypothetical protein MIMGU_mgv1a006343mg [Erythranthe guttata]
Length=447

 Score =   508 bits (1309),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 240/319 (75%), Positives = 271/319 (85%), Gaps = 2/319 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKL-RPGLKAQPVAVKLLDLD  1232
              SN+H FTL ELK+IT  FSSSNFLGEGGFGPVHKGF+ +   RPGL+AQPVAVKLLDLD
Sbjct  62    ASNLHIFTLPELKLITNGFSSSNFLGEGGFGPVHKGFVSETAGRPGLEAQPVAVKLLDLD  121

Query  1231  GSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASL  1052
             G QGHREWLTEV+ LGQLRHPHLVKLIGYCCE+E RLLVYEYM RG+LEN LFRRY++SL
Sbjct  122   GDQGHREWLTEVVLLGQLRHPHLVKLIGYCCEDEQRLLVYEYMTRGNLENHLFRRYTSSL  181

Query  1051  PWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             PW TRMKIA+GAAKGLAFLH  EKPVIYRDFK SNILLDSDY+ KLSDFGLAKDGPEGDD
Sbjct  182   PWLTRMKIAVGAAKGLAFLHGEEKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPEGDD  241

Query  871   THVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             THVSTR+MGTHGYAAPEYIMTGHLTA +DVYSFG+VLLELLTG+RA+DK +P REQNL +
Sbjct  242   THVSTRIMGTHGYAAPEYIMTGHLTAMNDVYSFGVVLLELLTGKRAMDKARPAREQNLVE  301

Query  691   WARPQLKD-PRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEP  515
             WA+P LKD   K+ R++DP LE  +S  GA+K A LA +CLSH  K RPTMS VV+ LE 
Sbjct  302   WAKPYLKDHHHKIERLIDPTLEDQYSSQGAKKVASLANQCLSHNPKYRPTMSHVVRILES  361

Query  514   LKDYKDVSSVTFVYTAPTE  458
             + +Y D+ +  FVY APTE
Sbjct  362   ILEYSDIPAGPFVYVAPTE  380



>dbj|BAO45889.1| receptor-like protein kinase [Acacia mangium]
Length=382

 Score =   506 bits (1303),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 260/385 (68%), Positives = 299/385 (78%), Gaps = 16/385 (4%)
 Frame = -3

Query  1597  KITLDSI-FT-GCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             KIT  SI FT  C+R       ++ P            KQ SF R+  +++S+S+  + +
Sbjct  4     KITWKSIIFTLNCYRTDYPTLQENQP-----------LKQGSFQRLCLSDISNSSSPQAI  52

Query  1423  ---sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVA  1253
                SISLAGS +H F+L+ELK  T +FS SN LGEGGFGPVHKGF DDKLR GLKAQPVA
Sbjct  53    DDLSISLAGSKLHIFSLEELKEATHNFSWSNLLGEGGFGPVHKGFFDDKLRRGLKAQPVA  112

Query  1252  VKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLF  1073
             VK LDL G QGHREWL E+IFLGQL+HPHLVKLIGYC EEEHRLLVYEYMPRGSLENQLF
Sbjct  113   VKRLDLSGLQGHREWLAEIIFLGQLQHPHLVKLIGYCYEEEHRLLVYEYMPRGSLENQLF  172

Query  1072  RRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAK  893
             RRYSA LPWSTRMKIALGAAKGLAFLHE +KPVIYRDFKASNILLDSDY  KLSDFGLAK
Sbjct  173   RRYSAVLPWSTRMKIALGAAKGLAFLHEVDKPVIYRDFKASNILLDSDYTAKLSDFGLAK  232

Query  892   DGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPN  713
             DGPEG++THV+TRVMGT GYAAPEY+MTGHLT  SDVYS+G+VLLELLTG+R +DK +P+
Sbjct  233   DGPEGEETHVTTRVMGTQGYAAPEYVMTGHLTTKSDVYSYGVVLLELLTGKRVVDKNRPS  292

Query  712   REQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTV  533
             +E +L +WARP L+DP+KL R++DPRLEG F   GA+K A LAY+CLSH    RP MS V
Sbjct  293   KEHSLVEWARPMLRDPKKLYRVIDPRLEGQFPARGARKVAALAYKCLSHHPNPRPAMSDV  352

Query  532   VKTLEPLKDYKDVSSVTFVYTAPTE  458
             V  LE L+ + DV    FVY A  E
Sbjct  353   VAILETLQGFDDVFIGPFVYVAIGE  377



>gb|KDP40693.1| hypothetical protein JCGZ_24692 [Jatropha curcas]
Length=461

 Score =   507 bits (1306),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 235/319 (74%), Positives = 268/319 (84%), Gaps = 0/319 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H FTL+EL+ IT  FS S  LGEGGFG V+KGFI DKLRPGLKAQ VAVK+LDLDGSQ
Sbjct  63    NLHVFTLKELEKITHQFSKSYVLGEGGFGTVYKGFITDKLRPGLKAQSVAVKVLDLDGSQ  122

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL EVIFLGQL+HPH+V LIGYCCE+EHRLLVYEYM RG+LE QLF+RYSA+LPW 
Sbjct  123   GHREWLAEVIFLGQLKHPHVVNLIGYCCEDEHRLLVYEYMERGNLETQLFKRYSAALPWL  182

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIA+ AAKGLAFLHE EK VIYRDFKASN+LLDSDY+ KLSDFGLA DGP+GDDTH+
Sbjct  183   TRLKIAIEAAKGLAFLHEEEKTVIYRDFKASNVLLDSDYNAKLSDFGLATDGPQGDDTHI  242

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             +TRVMGT GYAAPEYIMTGHLT  SDV+SFG+VLLELLTGRR++DK +P REQNL  WAR
Sbjct  243   TTRVMGTEGYAAPEYIMTGHLTTMSDVFSFGVVLLELLTGRRSLDKNRPTREQNLVKWAR  302

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             P L+D  KL +I+DPRLEG +S  GA+KAA LAY+CLSH  KSRPTMS VVK LEPL + 
Sbjct  303   PFLRDHHKLDQIMDPRLEGQYSTEGARKAAALAYQCLSHHCKSRPTMSAVVKILEPLLEL  362

Query  502   KDVSSVTFVYTAPTEKDTK  446
              D+    FVY   +E + K
Sbjct  363   NDIPVGPFVYVVSSESEKK  381



>ref|XP_009402133.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=427

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/319 (74%), Positives = 272/319 (85%), Gaps = 1/319 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++H FTL+ELK  T++FS +N +G GGFGPV+KGFIDD LRPGL AQ VAVK LDL+G
Sbjct  54    GSDLHVFTLEELKAATRNFSMTNVIGSGGFGPVYKGFIDDNLRPGLLAQHVAVKSLDLEG  113

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHLV+LIGYCCE+E R+LVYEYM RGSLEN LF+R  ASLP
Sbjct  114   LQGHREWLAEVIFLGQLRHPHLVRLIGYCCEDEQRMLVYEYMARGSLENHLFKRLLASLP  173

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  KLSDFGLAK+GP+GDDT
Sbjct  174   WSTRIKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYTAKLSDFGLAKNGPQGDDT  233

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEY+MTGHLTA SDVYSFG+VLLELL+GRR++DK +PNRE+NL +W
Sbjct  234   HVTTRVMGTHGYAAPEYVMTGHLTAKSDVYSFGVVLLELLSGRRSVDKNRPNREKNLVEW  293

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L +P +L R++DP LEG +S  GA+KAA +AY CLS   K+RP M  VV+ LEP+ 
Sbjct  294   ARPYLNNPNRLSRVMDPNLEGQYSTDGARKAAAVAYRCLSLSLKTRPNMRAVVEALEPVM  353

Query  508   DYKDVSSVT-FVYTAPTEK  455
             +  DV  V  FVYTAP EK
Sbjct  354   ELNDVPIVGPFVYTAPEEK  372



>ref|XP_010098385.1| Serine/threonine-protein kinase [Morus notabilis]
 gb|EXB74909.1| Serine/threonine-protein kinase [Morus notabilis]
Length=430

 Score =   504 bits (1298),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 252/385 (65%), Positives = 305/385 (79%), Gaps = 14/385 (4%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssal---sed  1427
             KIT   I  GC +               +P++E ++KQ SF R+  +++S  +    ++D
Sbjct  5     KITWKWIIPGCCKTRNQV---------LEPKKE-VSKQISFQRLSISDVSDPSSPLFADD  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS SL GS +H F+L ELK IT +FS SN LGEGGFGPV+KGF+D+KLRPGL AQPVAVK
Sbjct  55    LSNSLIGSKLHVFSLAELKDITNNFSWSNLLGEGGFGPVYKGFVDEKLRPGLVAQPVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDLDG QGHREWL E+IFLGQLRHP+LVKLIGYCCE+EHRLLVY+YM RGSLEN LFRR
Sbjct  115   LLDLDGLQGHREWLAEIIFLGQLRHPNLVKLIGYCCEDEHRLLVYDYMARGSLENHLFRR  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             ++A++PWSTRMKIA GAAKGLAFLHEA+KPVI+RDFK+SNILLD+DY  KLSDFGLAKDG
Sbjct  175   FTAAMPWSTRMKIAFGAAKGLAFLHEADKPVIFRDFKSSNILLDTDYTPKLSDFGLAKDG  234

Query  886   PEGDDTHV-STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNR  710
             PEG++TH+ +T + GT GYAAPEYIMTGHLT  SDVY +G+VLLELLTG+R+ID+ +P+R
Sbjct  235   PEGEETHITTTHIFGTQGYAAPEYIMTGHLTTKSDVYGYGVVLLELLTGKRSIDRNRPSR  294

Query  709   EQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVV  530
             +Q+L +WARP LKDP+KL R +DPRLEG FS  GAQ+AALLAY+CLS+  K RPTM  VV
Sbjct  295   KQSLVEWARPLLKDPKKLDRFMDPRLEGQFSTKGAQRAALLAYKCLSNHPKCRPTMGDVV  354

Query  529   KTLEPLKDYKDVSSVTFVYTAPTEK  455
               LEPL D  D     FVY APT++
Sbjct  355   TILEPLLDLNDWFFEPFVYVAPTDE  379



>ref|XP_002272911.2| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 emb|CBI35860.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   504 bits (1299),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 273/320 (85%), Gaps = 0/320 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++  FTL E++ IT +FSSS+FLGEGGFGPV+KG ID+K+RPG KAQ VAVK+LDLDG 
Sbjct  41    TDLDVFTLAEVRAITHNFSSSSFLGEGGFGPVYKGVIDEKVRPGFKAQQVAVKVLDLDGQ  100

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWL EVIFLGQLRHPHLVKLIGYC E+E R+L+YEYM +G+LENQLFRRYSASLPW
Sbjct  101   QGHREWLAEVIFLGQLRHPHLVKLIGYCSEKEQRVLIYEYMAKGNLENQLFRRYSASLPW  160

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TR+KIAL AAKGLAFLHE E PVI+RDFKASNILLDSDY  KLSDFGLAKDGPEGD+TH
Sbjct  161   TTRVKIALEAAKGLAFLHEEENPVIFRDFKASNILLDSDYTVKLSDFGLAKDGPEGDETH  220

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             V+TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTGRR+ DK++P+REQNL  WA
Sbjct  221   VTTRVMGTEGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGRRSTDKSRPSREQNLVGWA  280

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
              P LKDP+KL+RI+DP+LEGM+S  GA++ A+LA +CLS ++K RP MS+VVKTLE L D
Sbjct  281   LPFLKDPQKLKRIIDPKLEGMYSTEGAKRVAMLANQCLSQKAKCRPRMSSVVKTLESLMD  340

Query  505   YKDVSSVTFVYTAPTEKDTK  446
               D   + FVY  P E   K
Sbjct  341   LADTGFMPFVYIVPAEGQKK  360



>ref|XP_009414115.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   504 bits (1299),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 231/318 (73%), Positives = 276/318 (87%), Gaps = 0/318 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+ AFT+ ELK +T++FS +NF+G GGFGPV+KG+ID+KLRPGLKAQ VAVK LDLDG
Sbjct  55    GSNLFAFTIAELKAVTRNFSMTNFVGSGGFGPVYKGYIDEKLRPGLKAQYVAVKSLDLDG  114

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGHREWL EVIFLGQLRHP+LVKL+GYCCE+EHR+LVYE+MP GSLE+ +F+   ASLP
Sbjct  115   SQGHREWLAEVIFLGQLRHPNLVKLVGYCCEDEHRMLVYEFMPGGSLESHIFKSLLASLP  174

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFKASNILL+SDY  KLSDFGLAKDGP+GD+T
Sbjct  175   WSTRLKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLESDYTAKLSDFGLAKDGPQGDNT  234

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEY++TGHLTA SDVYSFG+VLLELLTGRR +DK +PNR++NL DW
Sbjct  235   HVTTRVMGTHGYAAPEYVLTGHLTAKSDVYSFGVVLLELLTGRRCVDKNRPNRQKNLVDW  294

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L +  KL R++DP L+G++S  GAQ+AA +A++CLS   KSRP M +VV++LEPL 
Sbjct  295   ARPYLNNADKLSRVMDPSLDGLYSTKGAQRAAAIAHKCLSQAPKSRPDMRSVVESLEPLL  354

Query  508   DYKDVSSVTFVYTAPTEK  455
                DV    FVY APTE+
Sbjct  355   SLNDVPVGPFVYVAPTER  372



>ref|XP_007216399.1| hypothetical protein PRUPE_ppa022600mg [Prunus persica]
 gb|EMJ17598.1| hypothetical protein PRUPE_ppa022600mg [Prunus persica]
Length=455

 Score =   505 bits (1300),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 248/387 (64%), Positives = 300/387 (78%), Gaps = 7/387 (2%)
 Frame = -3

Query  1603  KMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             K K+ L+ +  GCF+      N  +     +  +E  +++ S + +  +  S   +  DL
Sbjct  3     KKKLALNLLTPGCFKT-----NKPISDQKSQTSKEISSRRLSLSDV--SNSSICTVLSDL  55

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S SL GSN+H FT +ELK ITQSFS SN+LGEGGFG V+KGFIDDKLRPGL+AQPVAVK+
Sbjct  56    SNSLIGSNLHIFTQKELKKITQSFSKSNYLGEGGFGKVYKGFIDDKLRPGLEAQPVAVKV  115

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDLDG QGHREWL EVIFLGQL+HP+LV LIGYCCE+EHRLLVYEYM RG+LEN+LF+ Y
Sbjct  116   LDLDGKQGHREWLAEVIFLGQLKHPNLVNLIGYCCEDEHRLLVYEYMERGNLENRLFKCY  175

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
               +LPW TR+KIA+GAAKGL+ LHE EK VIYRDFKASNILLDSDY  KLSDFGLA DGP
Sbjct  176   GGTLPWLTRIKIAIGAAKGLSSLHEEEKQVIYRDFKASNILLDSDYTAKLSDFGLAIDGP  235

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EGD+TH++T VMGTHGYAAPEY+ TGHLT  SDVYSFG+VLLELLTGRR++D+++  REQ
Sbjct  236   EGDETHITTCVMGTHGYAAPEYVKTGHLTTMSDVYSFGVVLLELLTGRRSVDESRHGREQ  295

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             NL +W++P LKD  KL R++DP LEG +S  GA+KAA L ++CL+H  K RPTMSTVVKT
Sbjct  296   NLVEWSKPFLKDAHKLDRVMDPGLEGQYSTEGARKAAALTHQCLNHNPKCRPTMSTVVKT  355

Query  523   LEPLKDYKDVSSVTFVYTAPTEKDTKT  443
             LEPL D  D+    FVY  PTE+  K 
Sbjct  356   LEPLMDLNDIPIGPFVYVVPTEEKKKV  382



>ref|XP_004305755.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Fragaria vesca subsp. vesca]
Length=450

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 232/317 (73%), Positives = 273/317 (86%), Gaps = 0/317 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F   ELK IT+SFS SN+LGEGGFG V+KGF+DDKLRPGL+AQPVAVK+LDLDG
Sbjct  63    GSNLHIFAHNELKKITKSFSKSNYLGEGGFGKVYKGFVDDKLRPGLEAQPVAVKVLDLDG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGHREWL EVIFLGQL+HP+LV LIGYCCE+EHRLLVYEY+ RG+L+++LF+ YS +LP
Sbjct  123   TQGHREWLAEVIFLGQLKHPNLVNLIGYCCEDEHRLLVYEYLERGNLDHKLFKCYSGTLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGL+ LHE EKP+IYRDFKASNILLD DY  KLSD GLA DGPEGD+T
Sbjct  183   WLTRIKIAIGAAKGLSCLHEEEKPIIYRDFKASNILLDCDYTAKLSDLGLAIDGPEGDET  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEYIMTGHLT  SDVYSFG+VLLELLTGRR++D+++  REQNL +W
Sbjct  243   HVTTRVMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGRRSMDESRTFREQNLVEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P LKD  KL R++D RLEG +S  GA+KAA LA++CLSH  KSRPTMSTV+KTLEPL 
Sbjct  303   AKPFLKDSHKLDRVMDQRLEGQYSTEGARKAAALAHQCLSHNPKSRPTMSTVIKTLEPLM  362

Query  508   DYKDVSSVTFVYTAPTE  458
             + KD+    FVY  PTE
Sbjct  363   NLKDIPIGPFVYVVPTE  379



>ref|XP_007161127.1| hypothetical protein PHAVU_001G044900g [Phaseolus vulgaris]
 gb|ESW33121.1| hypothetical protein PHAVU_001G044900g [Phaseolus vulgaris]
Length=386

 Score =   501 bits (1289),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 248/353 (70%), Positives = 289/353 (82%), Gaps = 3/353 (1%)
 Frame = -3

Query  1495  ITKQASFTRI---PATelsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEG  1325
             + KQ SF R+     +  SS+   EDLSIS  GS ++AFTL+EL+  T SFS SN LGEG
Sbjct  31    VLKQGSFQRLCLSDVSNSSSTQAIEDLSISFGGSKLYAFTLEELREATSSFSWSNMLGEG  90

Query  1324  GFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGY  1145
             GFGPV+KGF+DDKLRPGLKAQ VAVK LDLDG QGHREWL E+IFLGQLRHPHLVKLIGY
Sbjct  91    GFGPVYKGFVDDKLRPGLKAQTVAVKRLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGY  150

Query  1144  CCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYR  965
             C E+E+RLL+YEYMPRGSLENQLFRRYSA++PWSTRMKIALGAAKGLAFLHEA+KPVIYR
Sbjct  151   CYEDENRLLMYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEADKPVIYR  210

Query  964   DFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASD  785
             D KASNILLDSD+  KLSDFGLAKDGPEG+DT+V+TR+MGT GYAAPEYIMTGHLT  SD
Sbjct  211   DLKASNILLDSDFTAKLSDFGLAKDGPEGEDTYVTTRIMGTQGYAAPEYIMTGHLTTKSD  270

Query  784   VYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGA  605
             VYS+G+VLLELLTGRR +DK++ N  ++L +WARP L+DP+ +  I+D RLEG F   GA
Sbjct  271   VYSYGVVLLELLTGRRVVDKSRSNGGKSLVEWARPLLRDPKIVYSIIDCRLEGQFPMKGA  330

Query  604   QKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
              K A+LA++CLS    +RPTMS VVK LEPL+D+ DV    FVY A +E   K
Sbjct  331   MKVAMLAFKCLSPHPNARPTMSDVVKVLEPLQDFDDVFIGPFVYVAVSENGNK  383



>ref|XP_008228357.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Prunus 
mume]
Length=455

 Score =   503 bits (1295),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 247/384 (64%), Positives = 299/384 (78%), Gaps = 7/384 (2%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedlsi  1418
             K+ L+ +  GCF+      N  +     +  +E  +++ S + +  +  S   +  DLS 
Sbjct  5     KLALNLLTPGCFKT-----NKPISDQKSQTSKEIYSRRLSLSDV--SNSSICTVLSDLSN  57

Query  1417  slAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLD  1238
             SL GSN+H FT +ELK ITQ+FS SN+L EGGFG V+KGFIDDKLRPGL+AQPVAVK+LD
Sbjct  58    SLIGSNLHIFTQKELKKITQNFSKSNYLDEGGFGKVYKGFIDDKLRPGLEAQPVAVKVLD  117

Query  1237  LDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSA  1058
             LDG QGHREWL EVIFLGQL+HP+LV LIGYCCE+EHRLLVYEYM RG+LEN+LF+ Y  
Sbjct  118   LDGKQGHREWLAEVIFLGQLKHPNLVNLIGYCCEDEHRLLVYEYMERGNLENRLFKCYGG  177

Query  1057  SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEG  878
             +LPW TR+KIA+GAAKGL+ LHE EK VIYRDFKASNILLDSDY  KLSDFGLA DGPEG
Sbjct  178   TLPWLTRIKIAIGAAKGLSSLHEEEKQVIYRDFKASNILLDSDYTAKLSDFGLAIDGPEG  237

Query  877   DDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNL  698
             D+TH++T VMGTHGYAAPEY+ TGHLT  SDVYSFG+VLLELLTGRR++D+++  REQNL
Sbjct  238   DETHITTCVMGTHGYAAPEYVRTGHLTTMSDVYSFGVVLLELLTGRRSVDESRHGREQNL  297

Query  697   ADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLE  518
              +W++P LKD  KL R++DP LEG +S  GA+KAA LA++CLSH  K RPTMSTVVKTLE
Sbjct  298   VEWSKPFLKDSHKLDRVMDPGLEGQYSTEGARKAAALAHQCLSHNPKCRPTMSTVVKTLE  357

Query  517   PLKDYKDVSSVTFVYTAPTEKDTK  446
             PL D  D+    FVY  PTE+  K
Sbjct  358   PLMDLNDIPIGPFVYVVPTEEKNK  381



>gb|KHG16114.1| hypothetical protein F383_07817 [Gossypium arboreum]
Length=415

 Score =   501 bits (1291),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 233/319 (73%), Positives = 270/319 (85%), Gaps = 0/319 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT  EL++IT  F+  N LGEGGFGPV+KGFIDDKLRPGLKAQPVAVK LDL G
Sbjct  63    GSNLHVFTFAELRLITHYFARCNLLGEGGFGPVYKGFIDDKLRPGLKAQPVAVKALDLYG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL E+IFLGQLRHPHLVKLIGYC EE++R+LVYEYMPRGSLENQLFRRYSA LP
Sbjct  123   LQGHREWLAEIIFLGQLRHPHLVKLIGYCYEEDNRVLVYEYMPRGSLENQLFRRYSAPLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WS RMKIAL AAKGLAFLHEA+KPVI+RDFK+SNILLDSDY+ KLSDFGLAKDGPEG+ T
Sbjct  183   WSARMKIALAAAKGLAFLHEADKPVIFRDFKSSNILLDSDYNCKLSDFGLAKDGPEGEQT  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+R++D ++P +EQ+L +W
Sbjct  243   HVTTRVMGTQGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSVDNSRPGQEQSLVEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L+DP+KL +++D RLE  FS  GAQK A LAY+CLSH+ K RP+M  VVK L+ ++
Sbjct  303   ARPLLRDPKKLDKLIDARLERQFSNKGAQKVAALAYKCLSHQPKPRPSMGDVVKILDSVQ  362

Query  508   DYKDVSSVTFVYTAPTEKD  452
              ++D     FVY  P E D
Sbjct  363   GFEDEFVGPFVYVVPNETD  381



>ref|XP_004252518.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Solanum 
lycopersicum]
Length=419

 Score =   501 bits (1291),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 236/316 (75%), Positives = 271/316 (86%), Gaps = 0/316 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G+N+H FT  +LKVIT +FSS NFLGEGGFGPV KGFIDDK++ GL AQPVAVKLLDL+G
Sbjct  62    GTNLHVFTYAQLKVITSNFSSHNFLGEGGFGPVFKGFIDDKIKYGLDAQPVAVKLLDLEG  121

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH EWLTEV+ LGQLRHP+LVKLIGYC E++ RLLVYEYM RG+LENQLFRR S+SLP
Sbjct  122   DQGHIEWLTEVVLLGQLRHPNLVKLIGYCWEDKQRLLVYEYMARGNLENQLFRRCSSSLP  181

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TRMKIAL AAKGLAFLH  +KPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEG DT
Sbjct  182   WLTRMKIALDAAKGLAFLHGEKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGSDT  241

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+MTG+LT  SDVYS+G+VLLELLTGR+AIDK + +REQNL +W
Sbjct  242   HVTTRVMGTYGYAAPEYMMTGYLTTRSDVYSYGVVLLELLTGRQAIDKKRGSREQNLVEW  301

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L+D  KL RI+DPRLEG +S  GA+K A LAY+CLSH+ KSRPTMS VVKTLEP+ 
Sbjct  302   AKPFLRDSHKLERIIDPRLEGEYSTQGAKKVATLAYQCLSHQPKSRPTMSNVVKTLEPIL  361

Query  508   DYKDVSSVTFVYTAPT  461
             D KD+   +FVY  P+
Sbjct  362   DLKDIPIGSFVYVVPS  377



>ref|XP_006361336.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Solanum tuberosum]
Length=424

 Score =   501 bits (1290),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 236/316 (75%), Positives = 270/316 (85%), Gaps = 0/316 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT  +LKVIT +FSS NFLGEGGFGPVHKGFIDDK++ GL AQPVAVKLLDL+G
Sbjct  62    GSNLHVFTYAQLKVITSNFSSYNFLGEGGFGPVHKGFIDDKIKYGLDAQPVAVKLLDLEG  121

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH EWLTEV+ LGQLRHP+LVKLIGYC E++ RLLVYEYM RG+LENQLFRR S+SLP
Sbjct  122   DQGHIEWLTEVVLLGQLRHPNLVKLIGYCWEDKQRLLVYEYMARGNLENQLFRRCSSSLP  181

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TRMKIA  AAKGLAFLH  +KPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEG DT
Sbjct  182   WLTRMKIARDAAKGLAFLHGEKKPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGSDT  241

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+MTG+LT  SDVYS+G+VLLELLTGR+AIDK + +REQNL +W
Sbjct  242   HVTTRVMGTYGYAAPEYMMTGYLTTRSDVYSYGVVLLELLTGRQAIDKKRASREQNLVEW  301

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L+D  KL RI+DPRLEG +S  GA+K A LAY+CLSH+ KSRPTMS VVK LEP+ 
Sbjct  302   AKPFLRDSHKLERIMDPRLEGEYSSQGAKKVATLAYQCLSHQPKSRPTMSNVVKILEPIL  361

Query  508   DYKDVSSVTFVYTAPT  461
             D KD+   +FVY  P+
Sbjct  362   DLKDIPIGSFVYVVPS  377



>ref|XP_008220586.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
 ref|XP_008220587.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
Length=394

 Score =   499 bits (1286),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 257/390 (66%), Positives = 311/390 (80%), Gaps = 6/390 (2%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKK---PRREAITKQASFTRIPATelsssalsed  1427
             KIT   I  GC+++A    N       +K    ++  + K+ S + I   + SS+  ++D
Sbjct  5     KITWKCIIPGCYKSAARLENRLQTDCKRKQILKQKPLLQKRLSLSDI-NDDPSSTLFADD  63

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS S+ G N+H F+L EL+V+T +FS SN LGEGGFGPV KGF+DDKLRPGLK QPVAVK
Sbjct  64    LSNSVIGLNLHVFSLAELRVVTSNFSWSNLLGEGGFGPVFKGFVDDKLRPGLKPQPVAVK  123

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDLDG QGHREWL E+IFLGQLRHP+LVKLIGYCCE+EHRLLVYE+M RGSLENQLFR 
Sbjct  124   LLDLDGLQGHREWLAELIFLGQLRHPNLVKLIGYCCEDEHRLLVYEFMARGSLENQLFRS  183

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAE-KPVIYRDFKASNILLDSDYDGKLSDFGLAKD  890
             YS++LPWS RMKIA+GAAKGLAFLHEA+ KPVI+RDFK SNILLDSDY  KLSDFGLAKD
Sbjct  184   YSSALPWSKRMKIAVGAAKGLAFLHEADHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKD  243

Query  889   GPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNR  710
             GPEG+DTH++TR++GT GYAAPEYIMTG LT  SDVYSFG+VLLELLTG++ ID T+PNR
Sbjct  244   GPEGEDTHITTRIIGTQGYAAPEYIMTGRLTTKSDVYSFGVVLLELLTGKQCIDNTRPNR  303

Query  709   EQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVV  530
             EQNL +WA+P+LKDPRKL RI+DP +EG +S  GA+KAA LAY CLSH+ K+RP MS VV
Sbjct  304   EQNLVEWAKPRLKDPRKLDRIIDPTMEGQYSTRGARKAAALAYACLSHQPKNRPMMSDVV  363

Query  529   KTLEPLKDYKDVSSVT-FVYTAPTEKDTKT  443
               LEPL+++ +   V  FVY AP E+D+ +
Sbjct  364   MILEPLQNFNEGLIVRPFVYVAPNEEDSNS  393



>ref|XP_003603231.1| Kinase-like protein [Medicago truncatula]
 gb|AES73482.1| kinase 1B [Medicago truncatula]
Length=384

 Score =   498 bits (1282),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 254/387 (66%), Positives = 302/387 (78%), Gaps = 17/387 (4%)
 Frame = -3

Query  1597  KITLDSI--FTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             KIT  SI    GC++   +          ++P ++ + KQ SF R+  +++S S+ +   
Sbjct  5     KITWKSIVLILGCYKTKYSL---------EEPEKKVL-KQGSFQRVSLSDISISSSTTQA  54

Query  1423  ----sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPV  1256
                 SISLAGS ++ FTL+EL+  T +FS SN LGEGGFGPV+KGF+DDKLR GLKAQP+
Sbjct  55    IEDLSISLAGSKLYTFTLEELREATHNFSRSNLLGEGGFGPVYKGFVDDKLRHGLKAQPI  114

Query  1255  AVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQL  1076
             AVK L+LDGSQGHREWL E+IFLGQLRHPHLVKLIGYCCEEE RLLVYEYM RGSLENQL
Sbjct  115   AVKRLNLDGSQGHREWLAEIIFLGQLRHPHLVKLIGYCCEEEQRLLVYEYMTRGSLENQL  174

Query  1075  FRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLA  896
             FRRYSA+LPWSTRMKIALGAAKGLAFLHEA+KPVIYRDFK SNILLDSDY  KLSD GLA
Sbjct  175   FRRYSATLPWSTRMKIALGAAKGLAFLHEADKPVIYRDFKTSNILLDSDYTAKLSDLGLA  234

Query  895   KDGPEGDDTHVSTR-VMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTK  719
             KDGPEG++THV+T  +MGT GYAAPEYIM+GHL+  SDVYS+G+VLLELLTG+R +DK++
Sbjct  235   KDGPEGEETHVTTTCIMGTKGYAAPEYIMSGHLSTKSDVYSYGVVLLELLTGKRVVDKSR  294

Query  718   PNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMS  539
              NRE+NL +WARP L+D RKL  I+DPRLEG F   GA K A L Y+CLSH    RP MS
Sbjct  295   SNRERNLVEWARPILRDQRKLPHIIDPRLEGQFPIKGALKVAALTYKCLSHHPNPRPNMS  354

Query  538   TVVKTLEPLKDYKDVSSVTFVYTAPTE  458
              VVK+LE L+D+ D+    FVY A +E
Sbjct  355   DVVKSLELLQDFDDMFIGPFVYVAVSE  381



>emb|CAN77773.1| hypothetical protein VITISV_021885 [Vitis vinifera]
Length=438

 Score =   499 bits (1284),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 232/319 (73%), Positives = 270/319 (85%), Gaps = 0/319 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             ++  FTL E++ IT +FS S+FLGEGGFGPV+KG ID+K+RPG K Q VAVK+LDLDG Q
Sbjct  42    DLDVFTLAEVRAITHNFSLSSFLGEGGFGPVYKGVIDEKVRPGFKDQQVAVKVLDLDGQQ  101

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL EVIFLGQLRHPHLVKLIGYC E+E R+L+YEYM +G+LENQLFRRYSASLPW+
Sbjct  102   GHREWLAEVIFLGQLRHPHLVKLIGYCSEKEQRVLIYEYMAKGNLENQLFRRYSASLPWT  161

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIAL AAKGLAFLHE E PVI+RDFKASNILLDSDY  KLSDFGLAKDGPEGD+THV
Sbjct  162   TRVKIALEAAKGLAFLHEEENPVIFRDFKASNILLDSDYTVKLSDFGLAKDGPEGDETHV  221

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             +TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTGRR+ DK++P+REQNL  WA 
Sbjct  222   TTRVMGTEGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGRRSTDKSRPSREQNLVGWAL  281

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             P LKDP+KL+RI+DP+LEGM+S  GA++ A+LA +CLS ++K RP MS+VVKTLE L D 
Sbjct  282   PFLKDPQKLKRIIDPKLEGMYSTEGAKRVAMLANQCLSQKAKCRPRMSSVVKTLESLMDL  341

Query  502   KDVSSVTFVYTAPTEKDTK  446
              D   + FVY  P E   K
Sbjct  342   ADTGFMPFVYIVPAESQKK  360



>ref|XP_004501421.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=385

 Score =   496 bits (1277),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 254/383 (66%), Positives = 295/383 (77%), Gaps = 8/383 (2%)
 Frame = -3

Query  1597  KITLDSI--FTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             KIT  S+    GC++       + +  T K+  +    K+   + I     SSS   EDL
Sbjct  5     KITWKSLVLILGCYKT-----KNTLDETEKRGLKHGSFKRLCLSDISINSTSSSQAIEDL  59

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S+SLAGS ++ FTL+EL+  T  FS SN LGEGGFGPV+KGF+DDKLR GL+AQPVAVK 
Sbjct  60    SVSLAGSKLYTFTLEELREATHDFSWSNLLGEGGFGPVYKGFVDDKLRHGLRAQPVAVKR  119

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             L+LDGSQGHREWL E+IFLGQLRHPHLVKLIGYCCEEE RLLVYEYM RGSLENQLFRRY
Sbjct  120   LNLDGSQGHREWLAEIIFLGQLRHPHLVKLIGYCCEEEQRLLVYEYMARGSLENQLFRRY  179

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             SA+LPWSTRMKIALGAAKGLAFLHE +KPVIYRDFKASNILLDSDY  KLSD GLAKDGP
Sbjct  180   SATLPWSTRMKIALGAAKGLAFLHETDKPVIYRDFKASNILLDSDYTAKLSDLGLAKDGP  239

Query  883   EGDDTHVSTR-VMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             +G++THV+T  +MGT GYAAPEYIM+GHL+  SDVYS+G+VLLELLTG+R +DK++ NRE
Sbjct  240   DGEETHVTTTCIMGTKGYAAPEYIMSGHLSTKSDVYSYGVVLLELLTGKRVLDKSRSNRE  299

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             +NL +WARP L+D RKL  I D RLEG F   GA K A L Y+CLSH    RPTMS VVK
Sbjct  300   RNLVEWARPILRDQRKLLHITDSRLEGQFPIKGALKVAALTYKCLSHHPNPRPTMSDVVK  359

Query  526   TLEPLKDYKDVSSVTFVYTAPTE  458
              LE L+D+ DV    FVY A +E
Sbjct  360   ILESLQDFDDVIIGPFVYVAVSE  382



>ref|XP_010932408.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=426

 Score =   497 bits (1280),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 236/318 (74%), Positives = 267/318 (84%), Gaps = 0/318 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++H FT  ELK +T +FS SNF+G GGFGPV+KGFI D LRPGLKAQ VAVK LDL+G
Sbjct  45    GSDLHVFTFLELKAVTSNFSMSNFIGSGGFGPVYKGFIGDNLRPGLKAQTVAVKSLDLEG  104

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWLTEVIFLGQLRHPHLV+LIGYCCE+E RLLVYEYM  GSLEN LF+R   SLP
Sbjct  105   LQGHREWLTEVIFLGQLRHPHLVRLIGYCCEDERRLLVYEYMEGGSLENHLFKRLLTSLP  164

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLH AEKPVIYRDFKASNILLD DY  KLSDFGLAKDGPEG++T
Sbjct  165   WSTRLKIAVGAAKGLAFLHGAEKPVIYRDFKASNILLDLDYTAKLSDFGLAKDGPEGENT  224

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT GYAAPEYIMTGHLTA SDVYSFG+VLLELLTGRR+IDK++P REQNL +W
Sbjct  225   HVTTRVMGTLGYAAPEYIMTGHLTAKSDVYSFGVVLLELLTGRRSIDKSRPTREQNLVEW  284

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             +RP LK+  KL RI+DP+LEG +S  GAQ+AA +AY+CLS   KSRP M  +V+TLEPL 
Sbjct  285   SRPYLKNADKLGRIMDPKLEGQYSTKGAQRAAAVAYQCLSQSPKSRPHMRDIVETLEPLL  344

Query  508   DYKDVSSVTFVYTAPTEK  455
             +  DV    FVYT   EK
Sbjct  345   NLNDVPIGLFVYTVTVEK  362



>ref|XP_010064028.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Eucalyptus 
grandis]
 gb|KCW71325.1| hypothetical protein EUGRSUZ_F04407 [Eucalyptus grandis]
Length=466

 Score =   498 bits (1281),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 243/381 (64%), Positives = 292/381 (77%), Gaps = 13/381 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIP---ATelsssalsed  1427
             +++ D +  GC +A           T     +  I+KQ SF R+     +   SS    D
Sbjct  5     RLSWDCVVPGCLKAQ----------TTSTQHKSHISKQTSFRRLSLSDVSNHGSSISLND  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS SL GSN+H FTL ELK +T +FS SN+LGEGGFG V+KG ID+ LRP +KAQ VAVK
Sbjct  55    LSSSLVGSNLHIFTLAELKTVTHNFSRSNYLGEGGFGIVYKGMIDEGLRPEMKAQVVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
              LDLDG+QGHREWL EVIFLGQLRHPHLV LIGYCCE+EHRLLVY+YM RG+LE+QLF++
Sbjct  115   TLDLDGTQGHREWLAEVIFLGQLRHPHLVNLIGYCCEDEHRLLVYQYMERGNLEDQLFKK  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             YS  LPW TR+KIA+GAAKGLA LHE EKPVIYRDFKASN+LLDSDY+ KLSDFGLA DG
Sbjct  175   YSLPLPWLTRIKIAIGAAKGLACLHEEEKPVIYRDFKASNVLLDSDYNAKLSDFGLAVDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             P GD+THV+ RVMGT GYAAPEYI TGHLT  SDVYSFG+VLLEL+TGRR++D ++P RE
Sbjct  235   PLGDNTHVTARVMGTRGYAAPEYISTGHLTTISDVYSFGVVLLELITGRRSVDMSRPTRE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
             ++L +WARP LKD  KL +I+DPRLEG++S  GA+KA LLA++CLS   K RPTM TVVK
Sbjct  295   KDLVNWARPMLKDTHKLDKIVDPRLEGLYSTEGAKKAVLLAHQCLSQNPKCRPTMQTVVK  354

Query  526   TLEPLKDYKDVSSVTFVYTAP  464
             TLE + D  D+   +F+YT P
Sbjct  355   TLETIMDLDDIPVRSFLYTDP  375



>ref|XP_007223042.1| hypothetical protein PRUPE_ppa006919mg [Prunus persica]
 gb|EMJ24241.1| hypothetical protein PRUPE_ppa006919mg [Prunus persica]
Length=390

 Score =   493 bits (1269),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 256/387 (66%), Positives = 308/387 (80%), Gaps = 6/387 (2%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAG---NDDMPATPKKPRREAITKQASFTRIPATelsssalsed  1427
             KIT   I  GC+++A       + D   T    ++  + K+ S + I   + SS+  ++D
Sbjct  5     KITWKCIIPGCYKSAARLEKRLHTDCKRTEILKQKPLLQKRLSLSDI-NDDPSSTLFADD  63

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS S+ G N+H F+L EL+V+T +FS SN LGEGGFGPV KGF+DDKLRPGLK QPVAVK
Sbjct  64    LSNSVIGLNLHVFSLAELRVVTSNFSWSNLLGEGGFGPVFKGFVDDKLRPGLKPQPVAVK  123

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             LLDLDG QGHREWL E+IFLGQLRHP+LVKLIGYCCE+EHRLLVYE+M RGSLENQLFR 
Sbjct  124   LLDLDGLQGHREWLAELIFLGQLRHPNLVKLIGYCCEDEHRLLVYEFMARGSLENQLFRS  183

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAE-KPVIYRDFKASNILLDSDYDGKLSDFGLAKD  890
             YS++LPWS RMKIA+GAAKGLAFLHEA+ KPVI+RDFK SNILLDSDY  KLSDFGLAKD
Sbjct  184   YSSALPWSKRMKIAVGAAKGLAFLHEADHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKD  243

Query  889   GPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNR  710
             GPEG+DTH++TR++GT GYAAPEYIMTG LT  SDVYSFG+VLLELLTG+  IDKT+PNR
Sbjct  244   GPEGEDTHITTRIIGTQGYAAPEYIMTGRLTTKSDVYSFGVVLLELLTGKWCIDKTRPNR  303

Query  709   EQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVV  530
             EQNL +WA+P+LKDPRKL RI+DP +EG +S  GA+KAA LAY CLSH+ K+RP M  VV
Sbjct  304   EQNLVEWAKPRLKDPRKLDRIIDPTMEGQYSTRGARKAAALAYACLSHQPKNRPMMRDVV  363

Query  529   KTLEPLKDYKDVSSVT-FVYTAPTEKD  452
               LEPL+++ +   V  FVY AP E++
Sbjct  364   MILEPLQNFNEGLIVRPFVYVAPNEEE  390



>ref|XP_003527759.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=374

 Score =   493 bits (1268),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 246/356 (69%), Positives = 276/356 (78%), Gaps = 6/356 (2%)
 Frame = -3

Query  1516  KKPRREAITKQASFTR-----IPATelsssalsedlsislAGSNIHAFTLQELKVITQSF  1352
              K   + + KQ SF R     I       +     +SISL G  +H FTL EL+  T +F
Sbjct  18    NKTSEKQVLKQGSFQRLCLSDISIPSSPQAIEDLSISISLVGPKLHTFTLDELREATHNF  77

Query  1351  SSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRH  1172
             S SNFLGEGGFGPV+KGF+DDKLRPGLKAQP+AVK LDLDG QGHREWL E+IFLGQLRH
Sbjct  78    SWSNFLGEGGFGPVYKGFVDDKLRPGLKAQPLAVKQLDLDGLQGHREWLAEIIFLGQLRH  137

Query  1171  PHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLH  992
             PHLVKLIGYCCE+EHRLLVYEYM RGSLENQL RRYSA+LPWSTRMKIALGAAKGLAFLH
Sbjct  138   PHLVKLIGYCCEDEHRLLVYEYMARGSLENQLHRRYSAALPWSTRMKIALGAAKGLAFLH  197

Query  991   EAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTR-VMGTHGYAAPEYI  815
             EA+KPVIYRDFK SNILLDSDY  KLSD GLAKDGPEG+ THV+T  +MGT GYAAPEYI
Sbjct  198   EADKPVIYRDFKTSNILLDSDYTAKLSDLGLAKDGPEGEATHVTTTCIMGTRGYAAPEYI  257

Query  814   MTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPR  635
             M+GHL+  SDVYS+G+VLLELLTGRR +DK   NREQ+L +WARP L+D RKL  I+DPR
Sbjct  258   MSGHLSTKSDVYSYGVVLLELLTGRRVVDKCGSNREQSLVEWARPLLRDQRKLHHIIDPR  317

Query  634   LEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTA  467
             LEG F   GA K A L Y+CLS     RP+MS VVK LE L+D+ DV    FVY A
Sbjct  318   LEGQFPMKGALKVAALTYKCLSRHPNPRPSMSDVVKILESLQDFDDVIIGPFVYVA  373



>gb|KHN32159.1| Serine/threonine-protein kinase [Glycine soja]
Length=374

 Score =   491 bits (1264),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 245/356 (69%), Positives = 276/356 (78%), Gaps = 6/356 (2%)
 Frame = -3

Query  1516  KKPRREAITKQASFTR-----IPATelsssalsedlsislAGSNIHAFTLQELKVITQSF  1352
              K   + + KQ SF R     I       +     +SISL G  +H FTL EL+  T +F
Sbjct  18    NKTSEKQVLKQGSFQRLCLSDISIPSSPQAIEDLSISISLVGPKLHTFTLDELREATHNF  77

Query  1351  SSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRH  1172
             S SNFLGEGGFGPV+KGF+DDKLRPGLKAQP+AVK LDLDG QGHREWL ++IFLGQLRH
Sbjct  78    SWSNFLGEGGFGPVYKGFVDDKLRPGLKAQPLAVKQLDLDGLQGHREWLVKIIFLGQLRH  137

Query  1171  PHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLH  992
             PHLVKLIGYCCE+EHRLLVYEYM RGSLENQL RRYSA+LPWSTRMKIALGAAKGLAFLH
Sbjct  138   PHLVKLIGYCCEDEHRLLVYEYMARGSLENQLHRRYSAALPWSTRMKIALGAAKGLAFLH  197

Query  991   EAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTR-VMGTHGYAAPEYI  815
             EA+KPVIYRDFK SNILLDSDY  KLSD GLAKDGPEG+ THV+T  +MGT GYAAPEYI
Sbjct  198   EADKPVIYRDFKTSNILLDSDYTAKLSDLGLAKDGPEGEATHVTTTCIMGTRGYAAPEYI  257

Query  814   MTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPR  635
             M+GHL+  SDVYS+G+VLLELLTGRR +DK   NREQ+L +WARP L+D RKL  I+DPR
Sbjct  258   MSGHLSTKSDVYSYGVVLLELLTGRRVVDKCGSNREQSLVEWARPLLRDQRKLHHIIDPR  317

Query  634   LEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTA  467
             LEG F   GA K A L Y+CLS     RP+MS VVK LE L+D+ DV    FVY A
Sbjct  318   LEGQFPMKGALKVAALTYKCLSRHPNPRPSMSDVVKILESLQDFDDVIIGPFVYVA  373



>ref|XP_004303452.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Fragaria 
vesca subsp. vesca]
Length=408

 Score =   492 bits (1266),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 272/320 (85%), Gaps = 2/320 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG-LKAQPVAVKLLDLD  1232
             G N+H F+L ELKV T SFS SN LGEGGFGPV+KGF+DD LRPG LKAQPVAVKLL+LD
Sbjct  64    GLNLHVFSLSELKVATNSFSWSNLLGEGGFGPVYKGFVDDNLRPGTLKAQPVAVKLLNLD  123

Query  1231  GSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASL  1052
             G QGHREWL E++FLGQLRHP++VKLIGYCCEEEHRLLVYE++ RGSLE+QLFRRYSA+L
Sbjct  124   GFQGHREWLAELVFLGQLRHPNIVKLIGYCCEEEHRLLVYEHIARGSLEDQLFRRYSAAL  183

Query  1051  PWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             PWSTRMKIA+GA+KGLAFLHE  +PVI+RDFK SN+L+DSDY  KLSDFGLAKDGPEG++
Sbjct  184   PWSTRMKIAVGASKGLAFLHEDHRPVIFRDFKTSNVLVDSDYTAKLSDFGLAKDGPEGEE  243

Query  871   THVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             THV TR++GT GYAAPEY+ TGHLT  SDVYSFG+VLLELLTG+R++D+T+ +REQ L +
Sbjct  244   THVVTRILGTQGYAAPEYLRTGHLTTKSDVYSFGVVLLELLTGKRSLDRTRRSREQCLVE  303

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             WARP LKDPRKL RI+DPRLEG +S  GA+KAA LAY CLS+  KSRP M+ VV  LE L
Sbjct  304   WARPLLKDPRKLNRIIDPRLEGQYSTKGARKAATLAYACLSNNPKSRPMMTDVVMILESL  363

Query  511   KDYKDVSSVT-FVYTAPTEK  455
             + + +      FVY AP+E+
Sbjct  364   QGFNEALIYQPFVYVAPSEE  383



>ref|XP_007136897.1| hypothetical protein PHAVU_009G083300g [Phaseolus vulgaris]
 gb|ESW08891.1| hypothetical protein PHAVU_009G083300g [Phaseolus vulgaris]
Length=388

 Score =   491 bits (1263),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 232/318 (73%), Positives = 264/318 (83%), Gaps = 1/318 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G  ++ FTL+EL+  T +FS SN LGEGGFGPV+KGF+D+KLRP LKAQ VAVK L+LDG
Sbjct  68    GPKLYTFTLEELREATHNFSWSNLLGEGGFGPVYKGFVDNKLRPDLKAQSVAVKQLNLDG  127

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL E+IFLGQLRHPHLVKLIGYCCEEEHRLLVYEYM RGSLENQLFRRYSA+LP
Sbjct  128   FQGHREWLAEIIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMARGSLENQLFRRYSAALP  187

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAAKGLAFLHEA+KPVIYRDFK SNILLDSDY  KLSD GLAKDGPEG+DT
Sbjct  188   WSTRMKIALGAAKGLAFLHEADKPVIYRDFKTSNILLDSDYTAKLSDLGLAKDGPEGEDT  247

Query  868   HVSTR-VMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             H++T  +MGT GYAAPEYIM+GHL+  SDVYS+G+VLLELLTGRR +DK +PNRE++L +
Sbjct  248   HLTTTCIMGTRGYAAPEYIMSGHLSTKSDVYSYGVVLLELLTGRRVVDKCRPNRERSLVE  307

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             WARP L+D RKL  I+D RLEG F   GA K A L Y+CLSH    RPTM  VVK LE +
Sbjct  308   WARPLLRDQRKLHHIIDSRLEGQFPTKGALKVAALTYKCLSHHPYPRPTMGDVVKILESV  367

Query  511   KDYKDVSSVTFVYTAPTE  458
             +D+ DV    FVY A +E
Sbjct  368   QDFDDVIRGPFVYVAVSE  385



>ref|XP_003528552.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Glycine max]
 gb|KHN01418.1| Putative receptor-like protein kinase [Glycine soja]
Length=463

 Score =   493 bits (1269),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 268/324 (83%), Gaps = 0/324 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+  FT QEL  +T +FS SN+LGEGGFG V KGFIDD L+PGLKAQ VAVK L+LDG
Sbjct  64    GSNLRIFTYQELSEVTHNFSKSNYLGEGGFGKVFKGFIDDNLKPGLKAQTVAVKALNLDG  123

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EV+FLGQL+H HLV LIGYCCE+EHRLLVYEYM RG+LE +LF+ Y A+LP
Sbjct  124   KQGHREWLAEVVFLGQLKHRHLVNLIGYCCEDEHRLLVYEYMERGNLEEKLFKGYLAALP  183

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGL FLHE EKPVIYRD KASNILLD+DY+ KLSDFGLA DGPE D T
Sbjct  184   WLTRIKIAIGAAKGLMFLHEEEKPVIYRDIKASNILLDADYNAKLSDFGLAIDGPEKDQT  243

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             H++TRVMGTHGYAAPEYIMTGHLT  SDVYSFG+VLLELLTG++++DK +P REQ+L +W
Sbjct  244   HITTRVMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKKSVDKKRPTREQDLVEW  303

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKD  KL RI+D RLE  +S  GA+K A LAY+CLSH +K+RPTM TVV+TLEPL 
Sbjct  304   ARPLLKDSHKLERIMDTRLEDQYSTEGARKFAALAYQCLSHHAKARPTMRTVVRTLEPLL  363

Query  508   DYKDVSSVTFVYTAPTEKDTKTVS  437
             + KD+    FVY  P+E+++  V+
Sbjct  364   ELKDIPVGPFVYVVPSEEESTKVN  387



>ref|XP_003547753.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Glycine max]
 gb|KHN39624.1| Putative receptor-like protein kinase [Glycine soja]
Length=451

 Score =   489 bits (1259),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/324 (70%), Positives = 266/324 (82%), Gaps = 0/324 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+  FT QEL  +T +FS SN+LGEGGFG V+KGFIDD L+ GLKAQ VAVK L+LDG
Sbjct  64    GSNLRIFTYQELSEVTHNFSKSNYLGEGGFGKVYKGFIDDNLKRGLKAQTVAVKALNLDG  123

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQL+H HLV LIGYCCE+EHRLLVYEYM RG+LE +LF+ Y A+LP
Sbjct  124   KQGHREWLAEVIFLGQLKHRHLVNLIGYCCEDEHRLLVYEYMERGNLEEKLFKGYLAALP  183

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGL FLHE EKPVIYRD KASNILLDSDY+ KLSDFGLA DGPE D T
Sbjct  184   WLTRIKIAIGAAKGLMFLHEEEKPVIYRDIKASNILLDSDYNPKLSDFGLAIDGPEKDQT  243

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             H++T VMGTHGYAAPEYIMTGHLT  SDVYSFG+VLLELLTG++++DK +P REQ+L +W
Sbjct  244   HITTHVMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKKSVDKKRPTREQDLVEW  303

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKD  KL RI+D RLE  +S  GA+K A LAY+CLSH +K+RPTM TVV+TLEPL 
Sbjct  304   ARPLLKDSHKLERIMDTRLEDQYSTEGARKFAALAYQCLSHHAKARPTMRTVVRTLEPLL  363

Query  508   DYKDVSSVTFVYTAPTEKDTKTVS  437
             + KD+    FVY  P+E+D   V+
Sbjct  364   ELKDIPVGPFVYVVPSEEDKTKVN  387



>ref|XP_009375471.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Pyrus 
x bretschneideri]
Length=456

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 227/323 (70%), Positives = 269/323 (83%), Gaps = 1/323 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F  +EL  ITQSFS SN+LGEGGFG V+KGFIDDKLRPGL+AQPVAVK+LDLDG
Sbjct  61    GSNLHIFAHKELTKITQSFSKSNYLGEGGFGQVYKGFIDDKLRPGLEAQPVAVKVLDLDG  120

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVI LGQL+HP+LV LIGYCCE++HRLLVYEYM RG+L++ LF+RY  +LP
Sbjct  121   KQGHREWLAEVIVLGQLKHPNLVNLIGYCCEDDHRLLVYEYMERGNLDHHLFKRYGGTLP  180

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGL+ LHE EKPVIYRDFK SNILLD DY  KLSDFGLA DGPEGD+T
Sbjct  181   WLTRIKIAIGAAKGLSCLHEEEKPVIYRDFKTSNILLDLDYTAKLSDFGLAIDGPEGDET  240

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             H+ST VMGTHGYAAPEY+ TGHLTA SDVY FG+VLLELLTGRR++D+++  REQNL +W
Sbjct  241   HISTHVMGTHGYAAPEYVKTGHLTAMSDVYGFGVVLLELLTGRRSVDESRHGREQNLVEW  300

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ++P LKD  KL  ++DPRLEG +S  GA+KAA LA++CL++  K RPTMS+VVKTLEPL 
Sbjct  301   SKPFLKDTHKLDSVMDPRLEGQYSTEGARKAAALAHQCLNYNPKCRPTMSSVVKTLEPLM  360

Query  508   DY-KDVSSVTFVYTAPTEKDTKT  443
             D   D+    FVY  PTE++ K 
Sbjct  361   DLTNDIPIGPFVYVVPTEEEKKV  383



>ref|XP_009362909.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=401

 Score =   486 bits (1252),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 268/322 (83%), Gaps = 2/322 (1%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H F+L EL V+T++FS S+ +GEGGFGPV KGF+ DK+RPGLKAQPVAVKLLDLDG Q
Sbjct  68    NLHVFSLAELGVVTRNFSWSSLIGEGGFGPVFKGFVGDKVRPGLKAQPVAVKLLDLDGLQ  127

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GH+EWL E++FLGQLRHP+LVKLIGYCCE+EHRLLVYEYM  GSLENQLFR YS  LPWS
Sbjct  128   GHKEWLAEIVFLGQLRHPNLVKLIGYCCEDEHRLLVYEYMAGGSLENQLFRSYSTPLPWS  187

Query  1042  TRMKIALGAAKGLAFLHEAE-KPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              RMKIA+GAAKGLAFLHEA+ KPVI+RDFK SNILLDSDY  KLSDFGLAK+GPEG DTH
Sbjct  188   KRMKIAVGAAKGLAFLHEADHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKNGPEGKDTH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             ++TR++GT GYAAPEYIMTG LT  SDVYSFG+VLLELLTG+R ID T P+REQ L +WA
Sbjct  248   ITTRIIGTQGYAAPEYIMTGCLTTKSDVYSFGVVLLELLTGKRCIDNTCPSREQKLVEWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             +P+LKDPRKL  I+DP +EG +S  GA+KAA LAY CLSH  K RP MS VV  LE L+D
Sbjct  308   KPRLKDPRKLDGIIDPMMEGQYSIRGARKAAALAYSCLSHNPKRRPRMSDVVVILEGLQD  367

Query  505   YKDVSSVT-FVYTAPTEKDTKT  443
             + +   V  FVY AP E+D+ +
Sbjct  368   FDEGLVVRPFVYVAPNEEDSNS  389



>gb|ABR16273.1| unknown [Picea sitchensis]
Length=440

 Score =   488 bits (1255),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/313 (73%), Positives = 265/313 (85%), Gaps = 0/313 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+  FTL EL++IT+SF S   LGEGGFG V+KG+ID+ +R GLK  PVAVK+L+ +G
Sbjct  84    GSNVLVFTLFELEIITKSFRSDYILGEGGFGTVYKGYIDENVRAGLKPLPVAVKVLNKNG  143

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWLTEVIFLGQL HPHLVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  LP
Sbjct  144   FQGHREWLTEVIFLGQLSHPHLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAAVPLP  203

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRM IALGAAKGLAFLH AEKPVIYRDFK SNILLDSDY  KLSDFGLAKDGP+GD+T
Sbjct  204   WSTRMMIALGAAKGLAFLHGAEKPVIYRDFKTSNILLDSDYAAKLSDFGLAKDGPQGDET  263

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+PNRE NL DW
Sbjct  264   HVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPNREHNLVDW  323

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D R+L +I+DPRLEG +S  GAQKA  LAY CL+   K+RP M  VV+TLEPL+
Sbjct  324   ARPLLNDKRRLLQIIDPRLEGQYSMKGAQKACSLAYHCLNQNPKARPLMGDVVETLEPLQ  383

Query  508   DYKDVSSVTFVYT  470
             + KD+ + + +YT
Sbjct  384   NRKDMVNASLMYT  396



>ref|XP_007024642.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY27264.1| Kinase superfamily protein [Theobroma cacao]
Length=456

 Score =   488 bits (1256),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 231/313 (74%), Positives = 261/313 (83%), Gaps = 0/313 (0%)
 Frame = -3

Query  1396  HAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGH  1217
             H FTL+EL++IT  FS SN+LGEGGFGPV+KGFIDD LRPGLKAQ VAVK+LDLDGSQGH
Sbjct  64    HIFTLKELELITHKFSKSNYLGEGGFGPVYKGFIDDNLRPGLKAQSVAVKVLDLDGSQGH  123

Query  1216  REWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTR  1037
             REWL EVIFLGQL+HPHLV LIGYC E+EHRLLVYEYM RGSLE+QLF+RY   LPW TR
Sbjct  124   REWLAEVIFLGQLKHPHLVNLIGYCYEQEHRLLVYEYMARGSLEDQLFKRYGPPLPWLTR  183

Query  1036  MKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVST  857
             +KIA+G AKGLAFLHE EKPVIYRDFK SNILLD  Y+ K+SDFGLA DGPEG+ THV+T
Sbjct  184   LKIAVGTAKGLAFLHEEEKPVIYRDFKTSNILLDLAYNAKVSDFGLATDGPEGEATHVTT  243

Query  856   RVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQ  677
              VMGT GYAAPEYI TGHLT  SDV+SFG+VLLELLTGRR++DK +P RE+NL +WARP 
Sbjct  244   CVMGTEGYAAPEYITTGHLTTMSDVFSFGVVLLELLTGRRSVDKARPGREKNLVEWARPL  303

Query  676   LKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKD  497
             LKDP KL  I+D RLEG +S  GA+KAA LAY+CLS+  KSRPTMS VVK LEPL D  D
Sbjct  304   LKDPYKLDGIMDTRLEGQYSTEGARKAAALAYQCLSNHPKSRPTMSNVVKALEPLLDLTD  363

Query  496   VSSVTFVYTAPTE  458
             +    FVY  PT+
Sbjct  364   IPIGPFVYIVPTQ  376



>ref|XP_008342636.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Malus 
domestica]
Length=456

 Score =   488 bits (1255),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 267/323 (83%), Gaps = 1/323 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F+  ELK ITQSFS SN+LGEGGFG V+KGFIDDKLRPGL+AQPVAVK+LDLDG
Sbjct  61    GSNLHIFSHNELKKITQSFSKSNYLGEGGFGQVYKGFIDDKLRPGLEAQPVAVKVLDLDG  120

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EV+FLGQL+HP+LV LIGYCCE+E+RLLVYEYM RG+L++QLF+RY  +LP
Sbjct  121   KQGHREWLAEVVFLGQLKHPNLVNLIGYCCEDEYRLLVYEYMERGNLDHQLFKRYGGTLP  180

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGL+ LHE EKPVIYRDFK SNILLD DY  KLSDFGLA DGPEGD+T
Sbjct  181   WLTRIKIAIGAAKGLSCLHEEEKPVIYRDFKTSNILLDLDYTAKLSDFGLAIDGPEGDET  240

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             H++TRVMGTHGY APEY+ TGHLT  SDVYSFG+VLLELLTGR+++D ++  REQNL   
Sbjct  241   HITTRVMGTHGYTAPEYVKTGHLTTMSDVYSFGVVLLELLTGRKSVDDSRHGREQNLVKR  300

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
              +P LKD  KL R++DPRLEG +S  GA+KAA LA++CLSH  K RPTMS+VVKTLEPL 
Sbjct  301   FKPFLKDSHKLDRMMDPRLEGQYSTVGARKAAALAHQCLSHNPKCRPTMSSVVKTLEPLM  360

Query  508   DYK-DVSSVTFVYTAPTEKDTKT  443
             D   D+    FVY  PTE   K 
Sbjct  361   DLTIDIPIGPFVYIVPTEGKDKV  383



>ref|XP_010548490.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=429

 Score =   486 bits (1252),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 222/298 (74%), Positives = 253/298 (85%), Gaps = 0/298 (0%)
 Frame = -3

Query  1399  IHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQG  1220
             +H FTL EL+VIT  FS SN LGEGGFGPV+KGF+DDKL+PGL AQPVAVK LDL G QG
Sbjct  78    LHVFTLSELRVITHGFSRSNMLGEGGFGPVYKGFVDDKLKPGLDAQPVAVKALDLHGHQG  137

Query  1219  HREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWST  1040
             HREWL E+IFLGQLRH HLVKLIG+CCEE+ RLLVYEYMPRGSLENQLFRRYS +LPW T
Sbjct  138   HREWLAEIIFLGQLRHEHLVKLIGFCCEEDQRLLVYEYMPRGSLENQLFRRYSVTLPWPT  197

Query  1039  RMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVS  860
             RMKIALGAAKGLAFLHEAEKPVIYRDFK SN+LLDS Y+ KLSDFGLAKDGPEG+DTHV+
Sbjct  198   RMKIALGAAKGLAFLHEAEKPVIYRDFKTSNVLLDSSYNAKLSDFGLAKDGPEGEDTHVT  257

Query  859   TRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARP  680
             TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLEL+TG+R++D  +  REQ+L +WARP
Sbjct  258   TRVMGTQGYAAPEYIMTGHLTTMSDVYSFGVVLLELITGKRSMDNNRALREQSLVEWARP  317

Query  679   QLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
              L+DPRKL RI+DPRLEG +     Q  A LA++CL H+ K RP M  VV+ L+ +K+
Sbjct  318   MLRDPRKLERIIDPRLEGQYQAKPVQVVAALAHKCLGHQPKFRPHMGEVVRILQSMKE  375



>ref|XP_009414114.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=477

 Score =   488 bits (1256),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 231/351 (66%), Positives = 276/351 (79%), Gaps = 33/351 (9%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+ AFT+ ELK +T++FS +NF+G GGFGPV+KG+ID+KLRPGLKAQ VAVK LDLDG
Sbjct  55    GSNLFAFTIAELKAVTRNFSMTNFVGSGGFGPVYKGYIDEKLRPGLKAQYVAVKSLDLDG  114

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGHREWL EVIFLGQLRHP+LVKL+GYCCE+EHR+LVYE+MP GSLE+ +F+   ASLP
Sbjct  115   SQGHREWLAEVIFLGQLRHPNLVKLVGYCCEDEHRMLVYEFMPGGSLESHIFKSLLASLP  174

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDS---------------------  932
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFKASNILL+S                     
Sbjct  175   WSTRLKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLESVNFFDFERVKTKKSFCPHQCK  234

Query  931   ------------DYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAAS  788
                         DY  KLSDFGLAKDGP+GD+THV+TRVMGTHGYAAPEY++TGHLTA S
Sbjct  235   LTSSHDDDLVSQDYTAKLSDFGLAKDGPQGDNTHVTTRVMGTHGYAAPEYVLTGHLTAKS  294

Query  787   DVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAG  608
             DVYSFG+VLLELLTGRR +DK +PNR++NL DWARP L +  KL R++DP L+G++S  G
Sbjct  295   DVYSFGVVLLELLTGRRCVDKNRPNRQKNLVDWARPYLNNADKLSRVMDPSLDGLYSTKG  354

Query  607   AQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEK  455
             AQ+AA +A++CLS   KSRP M +VV++LEPL    DV    FVY APTE+
Sbjct  355   AQRAAAIAHKCLSQAPKSRPDMRSVVESLEPLLSLNDVPVGPFVYVAPTER  405



>ref|XP_003523655.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
 gb|KHN29669.1| Serine/threonine-protein kinase [Glycine soja]
Length=380

 Score =   483 bits (1243),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 260/315 (83%), Gaps = 1/315 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G  ++ F L EL+  T +FS +NFLGEGGFGPV+KGF+DDKLR GLKAQPVAVK LDLDG
Sbjct  65    GPKLYTFPLDELREATHNFSWNNFLGEGGFGPVYKGFVDDKLRLGLKAQPVAVKQLDLDG  124

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL E+IFLGQLRHPHLVKLIGYCCE+E RLLVYEYM RGSLENQL RRYSA+LP
Sbjct  125   LQGHREWLAEIIFLGQLRHPHLVKLIGYCCEDEDRLLVYEYMARGSLENQLHRRYSAALP  184

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTRMKIALGAA+GLAFLHEA+KPVIYRDFK SNILLDSDY  KLSD GLAKDGPEG+DT
Sbjct  185   WSTRMKIALGAARGLAFLHEADKPVIYRDFKTSNILLDSDYIAKLSDLGLAKDGPEGEDT  244

Query  868   HVSTR-VMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             HV+T  +MGT GYAAPEYIM+GHL+  SDVYS+G+VLLELLTGRR +D  +PNRE++L +
Sbjct  245   HVTTTCIMGTRGYAAPEYIMSGHLSTKSDVYSYGVVLLELLTGRRVVDMCRPNRERSLVE  304

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             WARP L+D RKL  I+DPRLEG F   GA K A L Y+CLSH    RP+MS VVK LE L
Sbjct  305   WARPLLRDQRKLYHIIDPRLEGQFPMKGALKVAALTYKCLSHHPNPRPSMSDVVKILESL  364

Query  511   KDYKDVSSVTFVYTA  467
             +D  DV    FVY A
Sbjct  365   QDLDDVIIGPFVYVA  379



>emb|CAN82003.1| hypothetical protein VITISV_023198 [Vitis vinifera]
Length=455

 Score =   485 bits (1249),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 287/487 (59%), Positives = 329/487 (68%), Gaps = 69/487 (14%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelss--salsedl  1424
             KIT  S+F  C+      G++ M +  K+ +   + KQ SF RI  ++LS+  S LSEDL
Sbjct  5     KITWRSVFPACY------GSEKMAS--KRRKAAVVAKQTSFQRISISDLSNPGSTLSEDL  56

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S SL GSN+H FTL ELKVI Q+FSS+NF+GEGGFGPVHKGFIDDKLRPGLKAQPVAVKL
Sbjct  57    STSLMGSNLHVFTLTELKVICQNFSSNNFIGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  116

Query  1243  LDLDGSQGHREWLT--------------------EVIFLGQLRHP----HLVKLIGYCCE  1136
             LDL+G QGHREWL                      V+  G+ + P    H  + +G    
Sbjct  117   LDLEGLQGHREWLVSSNRSDFSRATEAPASCQADRVLLRGRAQAPGIRIHAARKLGESAL  176

Query  1135  EEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFK  956
             ++++            E      YS SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFK
Sbjct  177   QKNK-----------CERSSAAGYSVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFK  225

Query  955   ASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYS  776
             ASNILLDSD+  KLSDFGLAKDGPEGDDTHVSTRVMGT GYAAPEYIMTGHLTA SDVYS
Sbjct  226   ASNILLDSDHTPKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTAMSDVYS  285

Query  775   FGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKA  596
             FG+VLLELLTGRR++DKT+PNREQNLA+WARPQL D RKL RI+DPRLEG +SEAGAQ A
Sbjct  286   FGVVLLELLTGRRSVDKTRPNREQNLAEWARPQLNDSRKLARIMDPRLEGQYSEAGAQSA  345

Query  595   ALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVSTekdnkg  416
             A LAY+CLSHR K RPTMSTVVKTLEPL+DY ++   TFVYT P+E D     T      
Sbjct  346   AALAYQCLSHRPKHRPTMSTVVKTLEPLQDYNEIPVGTFVYTVPSENDLPKEET------  399

Query  415   eeekkelkkeneehrhkhhhqhhhhhhqnrhhqhdqkhRTRSPNSTTVYSETALQQKLR-  239
                                        +        +HR RSP S T+YSETAL+Q LR 
Sbjct  400   -----------------KEGGEAQKEPKKESSHQGHRHRMRSPKSPTIYSETALRQNLRN  442

Query  238   SNNSPLH  218
             S NSPLH
Sbjct  443   SPNSPLH  449



>ref|NP_001235224.1| Avr9/Cf-9 induced kinase [Glycine max]
 gb|ACM89553.1| Avr9/Cf-9 induced kinase [Glycine max]
Length=301

 Score =   479 bits (1232),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 224/298 (75%), Positives = 255/298 (86%), Gaps = 0/298 (0%)
 Frame = -3

Query  1339  FLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLV  1160
              LGEGGFGPV+KGF+DDKLR GLKAQ VAVK LDLDG QGHREWL E+IFLGQLRHPHLV
Sbjct  1     MLGEGGFGPVYKGFVDDKLRSGLKAQTVAVKRLDLDGLQGHREWLAEIIFLGQLRHPHLV  60

Query  1159  KLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEK  980
             KLIGYC E+EHRLL+YEYMPRGSLENQLFRRYSA++PWSTRMKIALGAAKGLAFLHEA+K
Sbjct  61    KLIGYCYEDEHRLLMYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEADK  120

Query  979   PVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHL  800
             PVIYRDFKASNILLDSD+  KLSDFGLAKDGPEG+DTHV+TR+MGT GYAAPEYIMTGHL
Sbjct  121   PVIYRDFKASNILLDSDFTAKLSDFGLAKDGPEGEDTHVTTRIMGTQGYAAPEYIMTGHL  180

Query  799   TAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMF  620
             T  SDVYS+G+VLLELLTGRR +DK++ N  ++L +WARP L+D +K+  I+D RLEG F
Sbjct  181   TTKSDVYSYGVVLLELLTGRRVVDKSRSNEGKSLVEWARPLLRDQKKVYNIIDRRLEGQF  240

Query  619   SEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
                GA K A+LA++CLSH   +RPTMS V+K LEPL+DY DV    FVY A +E   K
Sbjct  241   PMKGAMKVAMLAFKCLSHHPNARPTMSDVIKVLEPLQDYDDVFIGPFVYVAVSETGDK  298



>gb|KDP40692.1| hypothetical protein JCGZ_24691 [Jatropha curcas]
Length=401

 Score =   482 bits (1240),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 260/319 (82%), Gaps = 0/319 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H F L+EL+ IT  FS    LGEGGFG V+KGFI DKLRPGLKAQ VA K+LDLDGSQ
Sbjct  63    NLHVFALKELETITHQFSKRYVLGEGGFGTVYKGFITDKLRPGLKAQSVAGKVLDLDGSQ  122

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL EVIFLG+L+HPHLV LIGYCCE+EHRLLVYEYM RG+LE QLF +YSA+LPW 
Sbjct  123   GHREWLAEVIFLGRLKHPHLVNLIGYCCEDEHRLLVYEYMERGNLETQLFEKYSAALPWL  182

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TR+KIA+GAAKGLAFLHE E+ V YRDFKASN+LLDSDY+ KLSDFGLA DGP+GDDT +
Sbjct  183   TRLKIAIGAAKGLAFLHEEERTVTYRDFKASNVLLDSDYNAKLSDFGLATDGPQGDDTRI  242

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
             +TRVMGT GYA  EYIMTGHLT  SD++SFG+VLLELLTGRR++DK + +REQNL  WAR
Sbjct  243   TTRVMGTEGYAVSEYIMTGHLTTTSDLFSFGVVLLELLTGRRSLDKNRTSREQNLVKWAR  302

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             P L D  KL +I+DPRLEG +S  GA+KAA LAY CLSH  KSRPTMS+VVK LEPL + 
Sbjct  303   PFLMDHHKLDQIMDPRLEGQYSTEGARKAAALAYHCLSHLFKSRPTMSSVVKILEPLLEL  362

Query  502   KDVSSVTFVYTAPTEKDTK  446
              D+ +   VY   +E + K
Sbjct  363   NDIPAGPLVYVVSSESEKK  381



>ref|XP_007135433.1| hypothetical protein PHAVU_010G129000g [Phaseolus vulgaris]
 gb|ESW07427.1| hypothetical protein PHAVU_010G129000g [Phaseolus vulgaris]
Length=464

 Score =   484 bits (1246),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 292/382 (76%), Gaps = 14/382 (4%)
 Frame = -3

Query  1582  SIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRI-----PATelsssalsedlsi  1418
             S+  GCF+A     N      P       ++K++S +RI       ++ SS ++  DLS 
Sbjct  10    SLVLGCFKAK----NQQTLEAP-----NIVSKKSSSSRIFLSDLSLSDYSSLSIMSDLSN  60

Query  1417  slAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLD  1238
             SL GSN+  FT QELK IT SFS SN LGEGGFG V+KGFIDD  + GLKAQ VAVK L+
Sbjct  61    SLVGSNLRIFTYQELKEITHSFSKSNILGEGGFGKVYKGFIDDSFKRGLKAQVVAVKALN  120

Query  1237  LDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSA  1058
             LDG QGHREWL EVIFLGQL+H HLV LIGYCCE+E+RLLVYEYM RG+LE +LF+ Y A
Sbjct  121   LDGKQGHREWLAEVIFLGQLKHRHLVNLIGYCCEDEYRLLVYEYMERGNLEEKLFKGYVA  180

Query  1057  SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEG  878
             +LPW TR+KIA+GAAKGL FLHE EKPVIYRDFKASNILLD+DY+ KLSDFGLA DGPE 
Sbjct  181   ALPWLTRIKIAIGAAKGLMFLHEEEKPVIYRDFKASNILLDADYNAKLSDFGLAIDGPEK  240

Query  877   DDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNL  698
             D TH++TRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTG++++DK +P+REQ+L
Sbjct  241   DQTHITTRVMGTKGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKKSVDKKRPSREQDL  300

Query  697   ADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLE  518
              +WARP L+D  KL RI+DPRLE  +S  GA++ A LAY+CLSH +K RPTM TVV+TLE
Sbjct  301   VEWARPLLRDSYKLERIMDPRLEDQYSPEGAKRFAALAYQCLSHHAKGRPTMRTVVRTLE  360

Query  517   PLKDYKDVSSVTFVYTAPTEKD  452
              L   KD+    FVY  P+E+D
Sbjct  361   SLLKLKDIPVGPFVYVVPSEED  382



>ref|XP_004510479.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cicer arietinum]
Length=457

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 262/324 (81%), Gaps = 0/324 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN++ FT +ELK IT +F+ SNFLGEGGFG V+KGFIDDK RP L  Q VAVK L+LDG
Sbjct  63    GSNLYIFTCKELKEITNNFNKSNFLGEGGFGKVYKGFIDDKFRPALLPQVVAVKALNLDG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQL+H +LV LIGYCCE+EHRLLVYEYM RG+LE +LF+ Y A+LP
Sbjct  123   KQGHREWLAEVIFLGQLKHRNLVNLIGYCCEDEHRLLVYEYMERGNLEEKLFKAYLATLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGLAFLHE EKPVIYRD KASNILLD+DY+ KLSDFGLA DGPE D T
Sbjct  183   WLTRIKIAIGAAKGLAFLHEEEKPVIYRDIKASNILLDADYNAKLSDFGLAIDGPEKDQT  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             H++TRVMGTHGYAAPEYIMTG LT  SDVYSFG+VLLEL+TG++++DK +P REQ+L +W
Sbjct  243   HITTRVMGTHGYAAPEYIMTGRLTTMSDVYSFGVVLLELITGKKSVDKKRPTREQDLVEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKD  KL RI+D RLE  +S  GA+K A LAY+CLS   KSRPTM TVVKTLEPL 
Sbjct  303   ARPLLKDSHKLERIIDSRLEDQYSIEGARKLATLAYQCLSQHDKSRPTMRTVVKTLEPLM  362

Query  508   DYKDVSSVTFVYTAPTEKDTKTVS  437
                D+    FVY AP+E     VS
Sbjct  363   KLNDIPIGHFVYVAPSEVTNVEVS  386



>ref|XP_002461008.1| hypothetical protein SORBIDRAFT_02g039110 [Sorghum bicolor]
 gb|EER97529.1| hypothetical protein SORBIDRAFT_02g039110 [Sorghum bicolor]
Length=439

 Score =   483 bits (1242),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 224/304 (74%), Positives = 259/304 (85%), Gaps = 0/304 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F++ EL+  T+ F S NFLGEGGFGPV+KGF+DD ++ GLK Q +AVKL D +G
Sbjct  67    GSNLHVFSVAELREATRGFVSGNFLGEGGFGPVYKGFVDDGVKKGLKPQAIAVKLWDPEG  126

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWL EVIFLGQLRHP+LVKL+GYCCE+E+RLLVYEYM  GSLEN LF++  A LP
Sbjct  127   AQGHKEWLAEVIFLGQLRHPNLVKLVGYCCEDENRLLVYEYMEHGSLENHLFKQIPAVLP  186

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+ IA+GAAKGLAFLH AEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  187   WSTRLNIAVGAAKGLAFLHNAEKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDT  246

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLE+LTGRR++DKT+P+REQNL D+
Sbjct  247   HVSTRVMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLEILTGRRSVDKTRPSREQNLVDY  306

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKDP +L RI+DP +EG +S   AQ AAL+AY CLS   K+RP MS VV+ LEPL 
Sbjct  307   ARPCLKDPLRLARIMDPAMEGQYSARAAQSAALVAYRCLSSSPKNRPDMSAVVQALEPLL  366

Query  508   DYKD  497
             D  D
Sbjct  367   DLND  370



>ref|XP_004985497.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Setaria 
italica]
Length=425

 Score =   482 bits (1240),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 268/322 (83%), Gaps = 0/322 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F++ EL+ +T+ FS +NF+GEGGFGPV+KG++DDK +PGL+AQPVAVKLLDL+G
Sbjct  79    GSNLHVFSIAELRAVTRDFSMTNFIGEGGFGPVYKGYVDDKTKPGLRAQPVAVKLLDLEG  138

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH EWLTEVIFLGQLRHPHL KLIGYC EEEHRLLVYE+M RGSLE  LF++Y+ASLP
Sbjct  139   GQGHTEWLTEVIFLGQLRHPHLAKLIGYCYEEEHRLLVYEFMTRGSLEKHLFKKYAASLP  198

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFK SNILLDSDY  KLSDFGLAKDGPE D+T
Sbjct  199   WSTRLKIAIGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDYKAKLSDFGLAKDGPEDDET  258

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVY FG+VLLELLTGRR++DK++P REQ+L +W
Sbjct  259   HVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGFGVVLLELLTGRRSVDKSRPPREQSLVEW  318

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D R+L R++DP L G +S   AQKAA +A++C+S   KSRP MS VV  LEPL 
Sbjct  319   ARPYLTDARRLDRVMDPNLAGQYSARAAQKAAAVAHQCVSLNPKSRPHMSAVVDALEPLL  378

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
                D     FVY AP E ++  
Sbjct  379   ALDDCPVGPFVYVAPPEDNSNN  400



>ref|XP_008393577.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=401

 Score =   481 bits (1238),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 228/322 (71%), Positives = 266/322 (83%), Gaps = 2/322 (1%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             N+H F+L EL V+T++FS S+ +GEGGFGPV KGF+ DK+RPGLKAQPVAVKLLDLDG Q
Sbjct  68    NLHVFSLAELGVVTRNFSWSSLIGEGGFGPVFKGFVGDKVRPGLKAQPVAVKLLDLDGLQ  127

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GH+EWL E++FLGQLRH +LVKLIGYCCE+EHRLLVYEYM  GSLENQLFR YS  L WS
Sbjct  128   GHKEWLAEIVFLGQLRHQNLVKLIGYCCEDEHRLLVYEYMAGGSLENQLFRSYSTPLSWS  187

Query  1042  TRMKIALGAAKGLAFLHEAE-KPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              RMKIA+GAAKGLAFLHEA+ KPVI+RDFK SNILLDSDY  KLSDFGLAKDGPEG+DTH
Sbjct  188   KRMKIAVGAAKGLAFLHEADHKPVIFRDFKTSNILLDSDYTAKLSDFGLAKDGPEGEDTH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             ++TR++GT GYAAPEYIMTG LT  SDVYSFG+VLLELLTG+R ID T P+REQ L +WA
Sbjct  248   ITTRIIGTQGYAAPEYIMTGCLTTKSDVYSFGVVLLELLTGKRCIDNTCPSREQKLVEWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             +P+LKD RKL  I+DP +EG +S  GA+KAA LAY CLSH  K RP MS VV  LE L+D
Sbjct  308   KPRLKDTRKLDGIIDPMMEGQYSIRGARKAAALAYSCLSHNPKQRPRMSDVVVILEGLQD  367

Query  505   YKDVSSVT-FVYTAPTEKDTKT  443
             + +   V  FVY AP E+D+ +
Sbjct  368   FDEGLVVRPFVYVAPNEEDSNS  389



>ref|XP_009337171.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=411

 Score =   480 bits (1236),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 269/321 (84%), Gaps = 2/321 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G N+H F+L EL ++T++FS S+ LGEGGFGPV KGF+ DKLRPGLKAQPVAVKLLDLDG
Sbjct  66    GLNLHVFSLVELGIVTRNFSRSSLLGEGGFGPVFKGFVGDKLRPGLKAQPVAVKLLDLDG  125

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EWLTE+IFLGQLRHP+LVKLIGYCCE+EHRLLVYEY+  GSLENQLFR YS  L 
Sbjct  126   LQGHKEWLTEIIFLGQLRHPNLVKLIGYCCEDEHRLLVYEYIAGGSLENQLFRSYSTPLS  185

Query  1048  WSTRMKIALGAAKGLAFLHEAE-KPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             WS RMKIA+GAAKGLAFLHEA+ KPVI+RDFK SNILL+SD+  KLSDFGLA+DGPEG+D
Sbjct  186   WSKRMKIAVGAAKGLAFLHEADHKPVIFRDFKTSNILLESDHTAKLSDFGLARDGPEGED  245

Query  871   THVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             TH++TR +GT GYA PEYIMTG LT  SDVYSFG+VLLELLTG+R ID ++P RE+NL +
Sbjct  246   THITTRRIGTRGYADPEYIMTGCLTTKSDVYSFGVVLLELLTGKRCIDNSRPKRERNLVE  305

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             WA+P+LKDPRKL RI+DP +EG +S  GA+KAA LA++CLSH  K RP MS VV  LE L
Sbjct  306   WAKPRLKDPRKLDRIIDPMMEGQYSTRGARKAAALAFKCLSHNPKQRPRMSDVVVILEGL  365

Query  511   KDYKDVSSVT-FVYTAPTEKD  452
             +D+ +   V  FVY AP ++D
Sbjct  366   QDFNEELVVRPFVYVAPNDED  386



>ref|XP_010685306.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Beta 
vulgaris subsp. vulgaris]
Length=427

 Score =   481 bits (1237),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 264/323 (82%), Gaps = 3/323 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFS-SSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLD  1232
             GSN+  FTL EL++I+ +FS + NF+GEGGFG V+KGFIDDKLRPGLKAQ VA+K+LDL+
Sbjct  69    GSNLQVFTLDELRIISNNFSYTGNFIGEGGFGAVYKGFIDDKLRPGLKAQAVAIKVLDLE  128

Query  1231  GSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASL  1052
             GSQGH EWL EVI+LGQLRHPHLVKLIGYCCE E R+LVYEYM RG+L+NQLFRR S +L
Sbjct  129   GSQGHNEWLAEVIYLGQLRHPHLVKLIGYCCENEQRVLVYEYMSRGNLDNQLFRRVSVAL  188

Query  1051  PWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             PW TRMKIALGAAKGLAFLHEA KPVI RDFKA+NILLDS++  KLSDFG A+DGPEGD 
Sbjct  189   PWLTRMKIALGAAKGLAFLHEANKPVILRDFKAANILLDSNFKAKLSDFGYARDGPEGDK  248

Query  871   THVST-RVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLA  695
             +HV+T  ++GT GY APEY+MTGHLT  SDVYSFG+VLLE+LTG+R +DKT+P RE  L 
Sbjct  249   SHVTTEHILGTKGYVAPEYVMTGHLTTMSDVYSFGVVLLEILTGKRCMDKTRPRREHCLV  308

Query  694   DWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEP  515
             +WARP LKD RK+  I+DPRL+G +S  G +   +LAY+CLSH  KSRPTMSTVVKTLEP
Sbjct  309   EWARPFLKDSRKIAMIMDPRLDGQYSVQGVKVTTMLAYQCLSHNPKSRPTMSTVVKTLEP  368

Query  514   LKDYKDVSSVTFVYTAPTEKDTK  446
             L    D+    FVY  P + D K
Sbjct  369   LMVLNDIPG-HFVYVVPKQGDKK  390



>ref|XP_003558674.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brachypodium 
distachyon]
Length=439

 Score =   481 bits (1237),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 271/319 (85%), Gaps = 1/319 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ EL+ +T+ FS +NF+GEGGFGPV+KG++D+K++PGL+AQPVAVKLLDL+G
Sbjct  87    GSNLHVFTIAELRAVTRDFSMTNFIGEGGFGPVYKGYVDEKVKPGLRAQPVAVKLLDLEG  146

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH EWLTEVIFLGQLR+PHLVKLIGYC E+EHRLLVYE+M RGSLE  LF++Y+ASLP
Sbjct  147   NQGHNEWLTEVIFLGQLRNPHLVKLIGYCYEDEHRLLVYEFMTRGSLEKHLFKKYAASLP  206

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAE PVIYRDFK SNILLDSDY  KLSDFGLAKDGPE D+T
Sbjct  207   WSTRLKIAIGAAKGLAFLHEAENPVIYRDFKTSNILLDSDYKAKLSDFGLAKDGPEEDET  266

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVY FG+VLLELLTGR+++DK++P REQNL DW
Sbjct  267   HVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGFGVVLLELLTGRKSVDKSRPPREQNLVDW  326

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L DPR+L R++DP L G ++   AQKAA +AY C+S   KSRP MS VV+ LEPL 
Sbjct  327   ARPYLNDPRRLDRVMDPNLAGQYAGRAAQKAAAVAYRCVSLNPKSRPHMSAVVEALEPLL  386

Query  508   DYKDVSSVT-FVYTAPTEK  455
               +D   V  FVY AP + 
Sbjct  387   ALEDDGLVGPFVYVAPPDN  405



>ref|NP_001064525.1| Os10g0395000 [Oryza sativa Japonica Group]
 gb|AAM22740.1|AC092388_24 putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|AAM44878.1|AC122144_1 Putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|AAP53593.1| serine/threonine-protein kinase NAK, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26439.1| Os10g0395000 [Oryza sativa Japonica Group]
 gb|EAZ15967.1| hypothetical protein OsJ_31410 [Oryza sativa Japonica Group]
Length=389

 Score =   479 bits (1232),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 224/317 (71%), Positives = 264/317 (83%), Gaps = 0/317 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS + AFT++EL+  T+ FS SNF+GEGGFGPV+KG++D++L+PG++AQ VAVKLLDL+G
Sbjct  71    GSGVEAFTVEELRRATRDFSVSNFVGEGGFGPVYKGYVDERLKPGVRAQAVAVKLLDLEG  130

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGH+EWL EVIFLGQLRH HLVKLIGYC E+EHRLLVYE+M RGSLE  LF++YSASLP
Sbjct  131   SQGHKEWLAEVIFLGQLRHHHLVKLIGYCYEDEHRLLVYEFMARGSLEKHLFKKYSASLP  190

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAA+GLAFLHEA KPVIYRDFK SNILL+SDY+ KLSDFGLAKDGP+ D+T
Sbjct  191   WSTRLKIAIGAARGLAFLHEAAKPVIYRDFKTSNILLNSDYEAKLSDFGLAKDGPQEDET  250

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLT  SDVYS+G+VLLELLTGR+A+DK +P REQNL +W
Sbjct  251   HVSTRVMGTQGYAAPEYIMTGHLTTKSDVYSYGVVLLELLTGRKAVDKKRPPREQNLVEW  310

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D R+L R++D  L G +S    QKAA +AY+CLS   KSRP MS VV+ LEPL 
Sbjct  311   ARPCLHDSRRLNRVIDKSLNGQYSTRAVQKAAAIAYQCLSVSPKSRPRMSAVVEALEPLL  370

Query  508   DYKDVSSVTFVYTAPTE  458
                D     FVY AP E
Sbjct  371   AMDDGIVEPFVYMAPPE  387



>ref|XP_008653340.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Zea 
mays]
 tpg|DAA63581.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=459

 Score =   480 bits (1235),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 224/304 (74%), Positives = 259/304 (85%), Gaps = 0/304 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F++ EL+  T+ F S NFLGEGGFGPV++GF+ D  + GLKAQ +AVKL D +G
Sbjct  68    GSNLHVFSVAELREATRGFVSGNFLGEGGFGPVYRGFVADGAKKGLKAQAIAVKLWDPEG  127

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWL EVIFLGQLRHP+LVKL+GYCCE+EHRLLVYEYM  GSLEN LF++  A LP
Sbjct  128   AQGHKEWLAEVIFLGQLRHPNLVKLVGYCCEDEHRLLVYEYMEHGSLENHLFKQIPAVLP  187

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+ IA+GAAKGLAFLH+AEKPVIYRDFKASNILLDSDY  KLSDFGLAKDGPEGDDT
Sbjct  188   WSTRLNIAVGAAKGLAFLHDAEKPVIYRDFKASNILLDSDYKAKLSDFGLAKDGPEGDDT  247

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLE+LTGRR++DKT+P+REQNL D+
Sbjct  248   HVSTRVMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLEILTGRRSVDKTRPSREQNLVDY  307

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKDP +L RI+DP +EG +S   AQ AAL+AY CLS   K+RP MS VV+ LEPL 
Sbjct  308   ARPCLKDPLRLGRIMDPAMEGQYSPRAAQSAALVAYRCLSASPKNRPDMSAVVRALEPLL  367

Query  508   DYKD  497
             D  D
Sbjct  368   DLHD  371



>gb|AAP12978.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|AAU89229.1| serine/threonine protein kinase, putative [Oryza sativa Japonica 
Group]
Length=448

 Score =   479 bits (1233),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 240/384 (63%), Positives = 293/384 (76%), Gaps = 6/384 (2%)
 Frame = -3

Query  1582  SIFTGCFRAAPAAGNDDMPATPK-----KPRREAITKQASFTRIPATelsssalsedlsi  1418
             S+F GC     AAG+  +   P+       +       A+  R+  T++ S+A  ++LS+
Sbjct  12    SLFRGCLSGGGAAGSRKVRPGPRTAAAAAAKHGGGASSAAAQRLSFTDVMSTASEQELSV  71

Query  1417  slAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLD  1238
             SL GSN+H FT+ ELK  TQ F   NFLGEGGFGPV+KG + DK +PGLKAQP+AVKL D
Sbjct  72    SLVGSNLHVFTVGELKAATQGFLDGNFLGEGGFGPVYKGNVADKAKPGLKAQPIAVKLWD  131

Query  1237  LDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSA  1058
              +G+QGH+EWL+EVIFLGQLRHP+LVKLIGYCCE+EHRLLVYEYM +GSLEN LF+++ +
Sbjct  132   PEGAQGHKEWLSEVIFLGQLRHPNLVKLIGYCCEDEHRLLVYEYMAKGSLENHLFKKFPS  191

Query  1057  SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEG  878
              L WSTR+ IA+GAAKGL FLH+AEKPVIYRDFK SNILLD +Y  KLSDFGLAKDGPEG
Sbjct  192   MLSWSTRLNIAVGAAKGLVFLHDAEKPVIYRDFKTSNILLDPEYKAKLSDFGLAKDGPEG  251

Query  877   DDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNL  698
             DDTHVSTRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLE+L+GRRA+DKT+P+REQ+L
Sbjct  252   DDTHVSTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLEILSGRRAVDKTRPSREQHL  311

Query  697   ADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLE  518
              +  R  LKDP+KL R++DP LEG +    A KAAL+AY+CLS   K+RP M  VVK LE
Sbjct  312   VEHMRSWLKDPQKLSRVMDPALEGQYFATAAHKAALVAYKCLSGNPKNRPDMCQVVKDLE  371

Query  517   PLKDY-KDVSSVTFVYTAPTEKDT  449
             PL +   DVS  +    AP  +D 
Sbjct  372   PLLNVTDDVSDESVAPIAPVREDN  395



>ref|XP_009800306.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
sylvestris]
Length=439

 Score =   479 bits (1232),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 239/368 (65%), Positives = 285/368 (77%), Gaps = 13/368 (4%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATel---sssalse  1430
             M +T  S+   C++       DD     KK     + KQ+SF R+   +    SS   ++
Sbjct  1     MVLTWKSMIPCCYKV------DDELVRSKK----NVKKQSSFQRLTLLDFDDPSSPLSAD  50

Query  1429  dlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAV  1250
              LS S  GSN+  FT  EL+ +T  FSS+NFLGEGGFGPV+KGF+DDKLRPGLK Q VAV
Sbjct  51    GLSNSFIGSNLINFTFTELREVTHHFSSANFLGEGGFGPVYKGFVDDKLRPGLKPQVVAV  110

Query  1249  KLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFR  1070
             K+LD DG QGH+EWLTE+IFLGQLRHPHLVKLIGYC E+ +RLLVYE++PRGSLENQLF 
Sbjct  111   KVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDNNRLLVYEFLPRGSLENQLFG  170

Query  1069  RYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKD  890
             ++S +L WSTRMKIALGAAKGLAFLHE EKPVIYRDFKASNIL++SDY  KLSDFGLAKD
Sbjct  171   KFSITLSWSTRMKIALGAAKGLAFLHEGEKPVIYRDFKASNILINSDYTAKLSDFGLAKD  230

Query  889   GPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNR  710
             GP GDDTHVSTR+MGTHGYAAPEYIMTGHLT  SDVYSFG+VLLE+LTG+R++DK +   
Sbjct  231   GPAGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLEMLTGKRSLDKKRREG  290

Query  709   EQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVV  530
             E NL +W RP L+DP+K+ R++D RLEG +   GAQ AAL+AY+CLSH  K RPTM  VV
Sbjct  291   ETNLVEWLRPYLRDPKKIARVMDRRLEGEYPIKGAQTAALVAYKCLSHYPKPRPTMDDVV  350

Query  529   KTLEPLKD  506
             K LE L++
Sbjct  351   KILETLQE  358



>gb|EEC75449.1| hypothetical protein OsI_11987 [Oryza sativa Indica Group]
Length=454

 Score =   479 bits (1234),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 240/384 (63%), Positives = 293/384 (76%), Gaps = 6/384 (2%)
 Frame = -3

Query  1582  SIFTGCFRAAPAAGNDDMPATPK-----KPRREAITKQASFTRIPATelsssalsedlsi  1418
             S+F GC     AAG+  +   P+       +       A+  R+  T++ S+A  ++LS+
Sbjct  12    SLFRGCLSGGGAAGSRKVRPGPRTAAAAAAKHGGGASSAAAQRLSFTDVMSTASEQELSV  71

Query  1417  slAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLD  1238
             SL GSN+H FT+ ELK  TQ F   NFLGEGGFGPV+KG + DK +PGLKAQP+AVKL D
Sbjct  72    SLVGSNLHVFTVGELKAATQGFLDGNFLGEGGFGPVYKGNVADKAKPGLKAQPIAVKLWD  131

Query  1237  LDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSA  1058
              +G+QGH+EWL+EVIFLGQLRHP+LVKLIGYCCE+EHRLLVYEYM +GSLEN LF+++ +
Sbjct  132   PEGAQGHKEWLSEVIFLGQLRHPNLVKLIGYCCEDEHRLLVYEYMAKGSLENHLFKKFPS  191

Query  1057  SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEG  878
              L WSTR+ IA+GAAKGL FLH+AEKPVIYRDFK SNILLD +Y  KLSDFGLAKDGPEG
Sbjct  192   MLSWSTRLNIAVGAAKGLVFLHDAEKPVIYRDFKTSNILLDPEYKAKLSDFGLAKDGPEG  251

Query  877   DDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNL  698
             DDTHVSTRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLE+L+GRRA+DKT+P+REQ+L
Sbjct  252   DDTHVSTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLEILSGRRAVDKTRPSREQHL  311

Query  697   ADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLE  518
              +  R  LKDP+KL R++DP LEG +    A KAAL+AY+CLS   K+RP M  VVK LE
Sbjct  312   VEHMRSWLKDPQKLSRVMDPALEGQYFATAAHKAALVAYKCLSGNPKNRPDMCQVVKDLE  371

Query  517   PLKDY-KDVSSVTFVYTAPTEKDT  449
             PL +   DVS  +    AP  +D 
Sbjct  372   PLLNVTDDVSDESVAPIAPVREDN  395



>ref|NP_001049156.1| Os03g0179400 [Oryza sativa Japonica Group]
 gb|ABF94292.1| serine/threonine-protein kinase NAK, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11070.1| Os03g0179400 [Oryza sativa Japonica Group]
 dbj|BAG97926.1| unnamed protein product [Oryza sativa Japonica Group]
Length=425

 Score =   477 bits (1227),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 230/316 (73%), Positives = 268/316 (85%), Gaps = 1/316 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ EL+ +T+ FS +NF+GEGGFGPV+KG++DDKL+PGL+AQPVAVKLLDL+G
Sbjct  74    GSNLHVFTIAELRAVTRDFSMTNFIGEGGFGPVYKGYVDDKLKPGLRAQPVAVKLLDLEG  133

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH EWLTEVIFLGQLRHPHLVKLIGYC E+EHRLLVYE+M RGSLE  LF++Y+ASLP
Sbjct  134   TQGHNEWLTEVIFLGQLRHPHLVKLIGYCYEDEHRLLVYEFMTRGSLEKHLFKKYAASLP  193

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFK SNILLDSD+  KLSDFGLAKDGPE D+T
Sbjct  194   WSTRLKIAIGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDFKAKLSDFGLAKDGPEDDET  253

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVY FG+VLLELL+GR+++DK++P REQNL +W
Sbjct  254   HVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGFGVVLLELLSGRKSVDKSRPAREQNLVEW  313

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D R+L R++D  L G +    AQKAA LA+ C+S   KSRP MS VV+ LEPL 
Sbjct  314   ARPYLTDARRLGRVMDRNLAGQYPAKAAQKAAALAHRCVSLNPKSRPHMSAVVEALEPLL  373

Query  508   DYKDVSSV-TFVYTAP  464
                D   V TFVY AP
Sbjct  374   ALDDDCLVGTFVYVAP  389



>ref|NP_180197.1| root-specific kinase 1 [Arabidopsis thaliana]
 gb|AAC14522.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC07819.1| root-specific kinase 1 [Arabidopsis thaliana]
Length=424

 Score =   476 bits (1226),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 235/366 (64%), Positives = 280/366 (77%), Gaps = 1/366 (0%)
 Frame = -3

Query  1603  KMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             K K +L S+F GC++A  A+  +       K R     K+ S + I +   S  ++ +DL
Sbjct  6     KKKTSLTSLFLGCYKAKNASKYEGGEKAVMKIRTCPAFKRLSLSDI-SDPSSPMSVMDDL  64

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S S     +  FTL EL+VIT +FS SN LGEGGFGPV+KGFIDDK++PG++AQPVAVK 
Sbjct  65    SHSFTSQKLRLFTLSELRVITHNFSRSNMLGEGGFGPVYKGFIDDKVKPGIEAQPVAVKA  124

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDL G QGHREWL E++FLGQL + HLVKLIG+CCEEE R+LVYEYMPRGSLENQLFRR 
Sbjct  125   LDLHGHQGHREWLAEILFLGQLSNKHLVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRN  184

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S ++ W  RMKIALGAAKGLAFLHEAEKPVIYRDFK SNILLDSDY+ KLSDFGLAKDGP
Sbjct  185   SLAMAWGIRMKIALGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGP  244

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EG+ THV+TRVMGT GYAAPEYIMTGHLT  +DVYSFG+VLLEL+TG+R++D T+  REQ
Sbjct  245   EGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQ  304

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             +L +WARP L+D RKL RI+DPRL        AQ AA LAY+CLS   K RPTM  VVK 
Sbjct  305   SLVEWARPMLRDQRKLERIIDPRLANQHKTEAAQVAASLAYKCLSQHPKYRPTMCEVVKV  364

Query  523   LEPLKD  506
             LE +++
Sbjct  365   LESIQE  370



>ref|NP_001050336.1| Os03g0407900 [Oryza sativa Japonica Group]
 gb|ABF96536.1| serine/threonine-protein kinase NAK, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12250.1| Os03g0407900 [Oryza sativa Japonica Group]
 dbj|BAG90865.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   479 bits (1233),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 240/384 (63%), Positives = 293/384 (76%), Gaps = 6/384 (2%)
 Frame = -3

Query  1582  SIFTGCFRAAPAAGNDDMPATPK-----KPRREAITKQASFTRIPATelsssalsedlsi  1418
             S+F GC     AAG+  +   P+       +       A+  R+  T++ S+A  ++LS+
Sbjct  64    SLFRGCLSGGGAAGSRKVRPGPRTAAAAAAKHGGGASSAAAQRLSFTDVMSTASEQELSV  123

Query  1417  slAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLD  1238
             SL GSN+H FT+ ELK  TQ F   NFLGEGGFGPV+KG + DK +PGLKAQP+AVKL D
Sbjct  124   SLVGSNLHVFTVGELKAATQGFLDGNFLGEGGFGPVYKGNVADKAKPGLKAQPIAVKLWD  183

Query  1237  LDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSA  1058
              +G+QGH+EWL+EVIFLGQLRHP+LVKLIGYCCE+EHRLLVYEYM +GSLEN LF+++ +
Sbjct  184   PEGAQGHKEWLSEVIFLGQLRHPNLVKLIGYCCEDEHRLLVYEYMAKGSLENHLFKKFPS  243

Query  1057  SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEG  878
              L WSTR+ IA+GAAKGL FLH+AEKPVIYRDFK SNILLD +Y  KLSDFGLAKDGPEG
Sbjct  244   MLSWSTRLNIAVGAAKGLVFLHDAEKPVIYRDFKTSNILLDPEYKAKLSDFGLAKDGPEG  303

Query  877   DDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNL  698
             DDTHVSTRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLE+L+GRRA+DKT+P+REQ+L
Sbjct  304   DDTHVSTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLEILSGRRAVDKTRPSREQHL  363

Query  697   ADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLE  518
              +  R  LKDP+KL R++DP LEG +    A KAAL+AY+CLS   K+RP M  VVK LE
Sbjct  364   VEHMRSWLKDPQKLSRVMDPALEGQYFATAAHKAALVAYKCLSGNPKNRPDMCQVVKDLE  423

Query  517   PLKDY-KDVSSVTFVYTAPTEKDT  449
             PL +   DVS  +    AP  +D 
Sbjct  424   PLLNVTDDVSDESVAPIAPVREDN  447



>ref|XP_003561556.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brachypodium 
distachyon]
Length=456

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 234/350 (67%), Positives = 282/350 (81%), Gaps = 7/350 (2%)
 Frame = -3

Query  1561  RAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedlsislAGSNIHAFTL  1382
             R+    G DD+        R ++    +  R+  T++ S+A  ++LS+SL GSN+H FT+
Sbjct  42    RSTNKHGEDDL-------ERGSVASAVAGQRMSFTDVMSAASDQELSVSLVGSNLHVFTV  94

Query  1381  QELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLT  1202
              ELK  TQ F  SNFLGEGGFGPV+KG +DDK +PGLKAQ +AVKL D +G+QGH+EWL+
Sbjct  95    GELKAATQGFLDSNFLGEGGFGPVYKGSVDDKAKPGLKAQSIAVKLWDPEGTQGHKEWLS  154

Query  1201  EVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIAL  1022
             EVIFLGQ RH +LVKL+GYCCEE+HRLLVYEYM +GSLEN LF+++   L WSTR+ IA+
Sbjct  155   EVIFLGQFRHTNLVKLVGYCCEEDHRLLVYEYMAKGSLENHLFKKFPPVLSWSTRLNIAV  214

Query  1021  GAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGT  842
             GAAKGLAFLH+AEKPVIYRDFK SNILLD DY  KLSDFGLAKDGPEGDDTHVSTRVMGT
Sbjct  215   GAAKGLAFLHDAEKPVIYRDFKTSNILLDPDYKAKLSDFGLAKDGPEGDDTHVSTRVMGT  274

Query  841   HGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPR  662
             HGYAAPEYI+TGHLTA SDVYSFG+VLLE+L+GRRA+DKT+PNRE++L +  R  LKDP+
Sbjct  275   HGYAAPEYILTGHLTAKSDVYSFGVVLLEILSGRRAVDKTRPNRERHLVEHMRSWLKDPQ  334

Query  661   KLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             KL RI+DP LEG +S +GA KAAL+AY+CLS   KSRP MS VV+ LEPL
Sbjct  335   KLGRIMDPALEGKYSTSGAHKAALVAYQCLSGSPKSRPDMSKVVEDLEPL  384



>ref|XP_009600575.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Nicotiana 
tomentosiformis]
Length=439

 Score =   476 bits (1224),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 237/368 (64%), Positives = 286/368 (78%), Gaps = 13/368 (4%)
 Frame = -3

Query  1600  MKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATel---sssalse  1430
             M +T  S+   C++       DD     KK     + KQ+SF R+   +    SS   ++
Sbjct  1     MVLTWKSMIPCCYKV------DDEFVRSKK----QVKKQSSFQRLSLLDFDDPSSPLSAD  50

Query  1429  dlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAV  1250
              LS S  GS++  FT  +L+ +T  FSS+NFLGEGGFGPV+KGF+DDKLRPGLK Q VAV
Sbjct  51    GLSNSFIGSSLINFTFTQLREVTHHFSSANFLGEGGFGPVYKGFVDDKLRPGLKPQVVAV  110

Query  1249  KLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFR  1070
             K+LD DG QGH+EWLTE+IFLGQLRHPHLVKLIGYC E+++RLLVYE++PRGSLENQLF 
Sbjct  111   KVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFG  170

Query  1069  RYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKD  890
             ++S +L WSTRMKIALGAAKGLAFLHE EKPVIYRDFKASNIL++SDY  KLSDFGLAKD
Sbjct  171   KFSITLSWSTRMKIALGAAKGLAFLHEGEKPVIYRDFKASNILINSDYTAKLSDFGLAKD  230

Query  889   GPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNR  710
             GP GDDTHVSTR+MGTHGYAAPEYIMTGHLT  SDVYSFG+VLLE+LTG+R++DK +   
Sbjct  231   GPAGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLEMLTGKRSLDKKRREG  290

Query  709   EQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVV  530
             E NL +W RP L+DP+K+ R++D RLEG +   GAQ AAL+AY+CLSH  K RPTM  VV
Sbjct  291   ETNLVEWLRPYLRDPKKIARVMDRRLEGEYPIKGAQTAALVAYKCLSHYPKPRPTMDDVV  350

Query  529   KTLEPLKD  506
             K LE L++
Sbjct  351   KILETLQE  358



>ref|XP_004245036.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Solanum 
lycopersicum]
Length=437

 Score =   475 bits (1223),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/301 (72%), Positives = 260/301 (86%), Gaps = 0/301 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++  FT  +L+ +T +FSS+NFLGEGGFGPV+KGF+DDK+RPGLKAQ VAVK+LD DG
Sbjct  61    GSSLINFTFTDLREVTHNFSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDG  120

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EWLTE+IFLGQLRHPHLVKLIGYC E+++RLLVYE++PRGSLENQLF ++S +L 
Sbjct  121   LQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLS  180

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WS RMKIALGAAKGLAFLHE +KPVIYRDFKASNIL+DSDY  KLSDFGLAKDGPEGDDT
Sbjct  181   WSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDT  240

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTR+MGTHGYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+R++DK++   E NL +W
Sbjct  241   HVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEW  300

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
              RP L+DP+++ R++D RLE  +   GAQ AAL+AY+CL+H  K RPTM  VVK LE L+
Sbjct  301   LRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQ  360

Query  508   D  506
             D
Sbjct  361   D  361



>ref|XP_008377919.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=411

 Score =   474 bits (1220),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 226/324 (70%), Positives = 263/324 (81%), Gaps = 2/324 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G N+H F+L EL ++T++FS S  LGEGGFGPV KGF+ DKLRPGLKAQPVAVKLLDLDG
Sbjct  66    GLNLHVFSLVELGIVTRNFSRSRLLGEGGFGPVFKGFVGDKLRPGLKAQPVAVKLLDLDG  125

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH+EWL E+IFLGQLRHP+LVKLIGYCCE+E RLLVYEYM  GSLENQLFR YS  L 
Sbjct  126   LQGHKEWLAEIIFLGQLRHPNLVKLIGYCCEDEQRLLVYEYMAGGSLENQLFRSYSTPLS  185

Query  1048  WSTRMKIALGAAKGLAFLHEAE-KPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             WS RMKIA+GAAKGLAFLHEA+ KPVI RDFK SNILL+SD+  KLSDFGLAKDGPEG+D
Sbjct  186   WSKRMKIAIGAAKGLAFLHEADHKPVIIRDFKTSNILLESDHTAKLSDFGLAKDGPEGED  245

Query  871   THVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             THV+TR +GT GYA PEYIMTG LT  SDVYSFG+VLLELLTG+R ID ++P REQNL +
Sbjct  246   THVTTRRIGTQGYADPEYIMTGCLTTKSDVYSFGVVLLELLTGKRCIDNSRPKREQNLVE  305

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             WA+P+LKDPRKL +I+D  +EG +S  GA+KAA LAY CLSH  K RP MS  V  LE L
Sbjct  306   WAKPRLKDPRKLDQIIDQMMEGQYSTRGARKAAALAYSCLSHNPKQRPRMSDAVVILEGL  365

Query  511   KDYKD-VSSVTFVYTAPTEKDTKT  443
              D+ + +    FVY AP ++D+ +
Sbjct  366   XDFNEGLVXRPFVYVAPNDEDSNS  389



>ref|XP_006426670.1| hypothetical protein CICLE_v10025595mg [Citrus clementina]
 gb|ESR39910.1| hypothetical protein CICLE_v10025595mg [Citrus clementina]
Length=449

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 264/314 (84%), Gaps = 0/314 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FTL+EL++IT +FS S++LGEGGFG V+KG +DD LRPGLKAQPVAVK+LD++G
Sbjct  63    GSNLHVFTLKELQMITHNFSRSDYLGEGGFGKVYKGCVDDNLRPGLKAQPVAVKVLDVNG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGHREWL EVIFLGQL+HPHLV LIGYCCE+EHRLLVYEYM  G+L +QLF+ YS++LP
Sbjct  123   SQGHREWLAEVIFLGQLKHPHLVNLIGYCCEDEHRLLVYEYMALGNLHDQLFKNYSSTLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAA+ LAFLH  EKPVIYRDFKASNILLDSDY+ KLSDFGLA DGP+G+D+
Sbjct  183   WLTRIKIAIGAARCLAFLHGEEKPVIYRDFKASNILLDSDYNAKLSDFGLATDGPQGEDS  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             H++T VMGT GYAAPEYI TGHLT   DV+SFG+VLLELLTGRR+++K +  RE++L +W
Sbjct  243   HITTCVMGTEGYAAPEYINTGHLTTMCDVFSFGVVLLELLTGRRSVEKNRCKREKDLVEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKD  KL +I+D RLEG +S  GA++ A  A++CLSH  KSRPTM+TVVK LEPL 
Sbjct  303   ARPMLKDFTKLDQIIDSRLEGRYSTEGAKRLAAAAHQCLSHNPKSRPTMTTVVKALEPLL  362

Query  508   DYKDVSSVTFVYTA  467
             D  D+    FVYT 
Sbjct  363   DLNDIPIGPFVYTV  376



>ref|XP_006353843.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Solanum tuberosum]
Length=433

 Score =   474 bits (1221),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 234/367 (64%), Positives = 288/367 (78%), Gaps = 13/367 (4%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATel---sssalsed  1427
             K++  S+   C++       DD     KK     + KQ SF R+   +    SS   +++
Sbjct  5     KLSWKSMIPCCYKV------DDEFVRSKK----QVKKQTSFQRLTLLDFDDPSSPLSADE  54

Query  1426  lsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVK  1247
             LS S  GS++  FT  +L+ +T  FSS+NFLGEGGFGPV+KGF+DDK+RPGLKAQ VAVK
Sbjct  55    LSNSFIGSSLINFTFTDLREVTHHFSSANFLGEGGFGPVYKGFVDDKVRPGLKAQIVAVK  114

Query  1246  LLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRR  1067
             +LD +G QGH+EWLTE+IFLGQLRHPHLVKLIGYC E+++RLLVYE++PRGSLENQ+F +
Sbjct  115   VLDTEGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQIFGK  174

Query  1066  YSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDG  887
             +S +L WSTRMKIALGAAKGLAFLHE +KPVIYRDFKASNIL+DSDY  KLSDFGLAKDG
Sbjct  175   FSITLSWSTRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDG  234

Query  886   PEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNRE  707
             PEGDDTHVSTR+MGTHGYAAPEYIMTGHLT  SDVYSFG+VLLELLTG+R++DK++   E
Sbjct  235   PEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGE  294

Query  706   QNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVK  527
              NL +W RP L+DP+++ R++D RLE  +   GAQ AAL+AY+CL+H  K RPTM  VVK
Sbjct  295   HNLVEWLRPYLRDPKRVARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVK  354

Query  526   TLEPLKD  506
              LE L+D
Sbjct  355   ILETLQD  361



>ref|XP_006294280.1| hypothetical protein CARUB_v10023277mg [Capsella rubella]
 gb|EOA27178.1| hypothetical protein CARUB_v10023277mg [Capsella rubella]
Length=424

 Score =   474 bits (1219),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 234/366 (64%), Positives = 278/366 (76%), Gaps = 1/366 (0%)
 Frame = -3

Query  1603  KMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             K K +L S+F GC++A   +  +       K R     K+ S + I +   S  ++ +DL
Sbjct  6     KKKTSLTSMFLGCYKAKNTSKYEGEEKPVMKIRTCPAFKRLSLSDI-SDPSSPMSVMDDL  64

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S S     +  FTL EL+ IT  FS SN LGEGGFGPV+KGFIDDK++PGL+ QPVAVK 
Sbjct  65    SHSFTSQKLRLFTLAELRTITHHFSRSNMLGEGGFGPVYKGFIDDKIKPGLEPQPVAVKA  124

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDL G QGHREWL E+IFLGQL + HLVKLIG+CCEEE R+LVYEYMPRGSLENQLFRR 
Sbjct  125   LDLHGHQGHREWLAEIIFLGQLSNKHLVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRN  184

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S ++ W  RMKIALGAAKGLAFLHEAEKPVIYRDFK SNILLDS+Y+ KLSDFGLAKDGP
Sbjct  185   SVAMAWGIRMKIALGAAKGLAFLHEAEKPVIYRDFKTSNILLDSNYNAKLSDFGLAKDGP  244

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EG+ THV+TRVMGT GYAAPEYIMTGHLT  +DVYSFG+VLLEL+TGRR++D T+  REQ
Sbjct  245   EGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELITGRRSMDNTRARREQ  304

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             +L +WARP L+D RKL RI+DPRLE  + +  AQ  A LAY+CLS   K RPTM  VVK 
Sbjct  305   SLVEWARPILRDQRKLERIIDPRLESQYKKEAAQVTAGLAYKCLSQHPKYRPTMCEVVKV  364

Query  523   LEPLKD  506
             LE +++
Sbjct  365   LESIQE  370



>ref|XP_006368257.1| kinase family protein [Populus trichocarpa]
 gb|ERP64826.1| kinase family protein [Populus trichocarpa]
Length=422

 Score =   473 bits (1216),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 262/322 (81%), Gaps = 0/322 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G ++  F L EL+ ITQ+FSS+  LGEGGFG VHKG++DD LR GLKAQ VAVKLLD++G
Sbjct  74    GPDLFDFQLSELRAITQNFSSNFLLGEGGFGTVHKGYVDDNLRQGLKAQAVAVKLLDIEG  133

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCEEE RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  134   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEEEERLLVYEFMPRGSLENHLFKRISVSLP  193

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLH AEKPVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG DT
Sbjct  194   WSTRLKIAIGAAKGLAFLHGAEKPVIYRDFKTSNVLLDSDFTVKLSDFGLAKMGPEGSDT  253

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+ TGHLT  SDV+SFG+VLLELLTGRRA DK++P REQN+ DW
Sbjct  254   HVTTRVMGTYGYAAPEYVSTGHLTTKSDVFSFGVVLLELLTGRRATDKSRPKREQNIIDW  313

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L   R+LR I+DPRL G +S  GA++ ALLA +C+S   K RP M ++V+TLE L+
Sbjct  314   AKPYLTSSRRLRCIIDPRLAGQYSVKGAKQMALLARQCVSLNPKDRPKMPSIVETLEALQ  373

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
              YKD++       A T+  T+ 
Sbjct  374   HYKDMAVACGQSQASTKSATRN  395



>ref|XP_004958293.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Setaria 
italica]
Length=439

 Score =   473 bits (1216),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/304 (74%), Positives = 260/304 (86%), Gaps = 0/304 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H F++ ELK  T+ F S NFLGEGGFGPV+KGF+ D ++ GLKAQ +AVKL D +G
Sbjct  63    GSNLHVFSVAELKDATRGFVSGNFLGEGGFGPVYKGFVADGVKKGLKAQAIAVKLWDPEG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWL EVIFLGQLRHP+LVKL+GYCCE+EHRLLVYEYM  GSLEN LF++  A LP
Sbjct  123   AQGHKEWLAEVIFLGQLRHPNLVKLVGYCCEDEHRLLVYEYMEHGSLENHLFKQIPAVLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+ IA+GAAKGLAFLH+AEKPVIYRDFKASNILLDS+Y  KLSDFGLAKDGPEGDDT
Sbjct  183   WSTRLNIAVGAAKGLAFLHDAEKPVIYRDFKASNILLDSNYKAKLSDFGLAKDGPEGDDT  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLE+LTGRR++DKT+P+REQNL D+
Sbjct  243   HVSTRVMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLEILTGRRSVDKTRPSREQNLVDY  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKDP KL RI+DP +EG +S   AQ AAL+AY CLS   K+RP MS VV+ LEPL 
Sbjct  303   ARPCLKDPLKLARIMDPAMEGQYSAQAAQSAALVAYRCLSGSPKNRPDMSAVVEALEPLL  362

Query  508   DYKD  497
               KD
Sbjct  363   SLKD  366



>ref|XP_011018376.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
Length=422

 Score =   471 bits (1213),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 262/322 (81%), Gaps = 0/322 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G +++ F L EL+ ITQ+F S+  LGEGGFG VHKG++DD LR GLKAQ VAVKLLD++G
Sbjct  74    GPDLYDFQLSELRAITQNFCSNFLLGEGGFGTVHKGYVDDNLRQGLKAQAVAVKLLDIEG  133

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCEEE RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  134   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEEEERLLVYEFMPRGSLENHLFKRISVSLP  193

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLH AEKPVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG DT
Sbjct  194   WSTRLKIAIGAAKGLAFLHGAEKPVIYRDFKTSNVLLDSDFTVKLSDFGLAKMGPEGSDT  253

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+ TGHLT  SDV+SFG+VLLELLTGRRA DK++P REQN+ DW
Sbjct  254   HVTTRVMGTYGYAAPEYVSTGHLTTKSDVFSFGVVLLELLTGRRATDKSRPKREQNIIDW  313

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L   R+LR I+DPRL G +S  GA++ ALLA +C+S   K RP M ++V+TLE L+
Sbjct  314   AKPYLTSSRRLRCIIDPRLAGQYSVKGAKQMALLARQCVSLNPKDRPKMPSIVETLEALQ  373

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
              YKD++       A T+  T+ 
Sbjct  374   HYKDMAVACGQAQASTKSATRN  395



>ref|XP_008651532.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Zea mays]
 tpg|DAA43687.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=446

 Score =   472 bits (1214),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 226/320 (71%), Positives = 265/320 (83%), Gaps = 0/320 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ EL+ +T+ FS ++F+GEGGFGPV++G++DDK + GL AQPVAVKLLDL+G
Sbjct  90    GSNLHVFTIAELRAVTRDFSMTHFIGEGGFGPVYRGYVDDKTKRGLAAQPVAVKLLDLEG  149

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGH EWLTEV FLGQLRHPHLVKLIGYC E+EHRLLVYE+M RGSLE  LF++Y+ASLP
Sbjct  150   GQGHTEWLTEVFFLGQLRHPHLVKLIGYCYEDEHRLLVYEFMTRGSLEKHLFKKYAASLP  209

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAAKGLAFLHEAEKPVIYRDFK SNILLDSDY  KLSDFGLAKDGPE D+T
Sbjct  210   WSTRLKIAIGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDYKAKLSDFGLAKDGPEDDET  269

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVY FG+VLLELL+GR+A+DK++P REQNL +W
Sbjct  270   HVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGFGVVLLELLSGRKAVDKSRPPREQNLVEW  329

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D R+L R++DP L G +S   A KAA +A++C++   KSRP MS VV+ LEPL 
Sbjct  330   ARPYLTDARRLDRVMDPSLVGQYSSRAAHKAAAVAHQCVALNPKSRPHMSAVVEALEPLL  389

Query  508   DYKDVSSVTFVYTAPTEKDT  449
                D     FVY AP E  T
Sbjct  390   ALDDCLVGPFVYIAPPETTT  409



>ref|XP_006465910.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
isoform X1 [Citrus sinensis]
 gb|KDO65011.1| hypothetical protein CISIN_1g013105mg [Citrus sinensis]
Length=449

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 263/314 (84%), Gaps = 0/314 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FTL+EL++IT +FS S++LGEGGFG V+KG +DD LRPGLKAQ VAVK+LD++G
Sbjct  63    GSNLHVFTLKELQMITHNFSRSDYLGEGGFGKVYKGCVDDNLRPGLKAQTVAVKVLDVNG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGHREWL EVIFLGQL+HPHLV LIGYCCE+EHRLLVYEYM  G+L +QLF+ YS++LP
Sbjct  123   SQGHREWLAEVIFLGQLKHPHLVNLIGYCCEDEHRLLVYEYMALGNLHDQLFKNYSSTLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAA+ LAFLH  EKPVIYRDFKASNILLDSDY+ KLSDFGLA DGP+G+D+
Sbjct  183   WLTRIKIAIGAARCLAFLHGEEKPVIYRDFKASNILLDSDYNAKLSDFGLATDGPQGEDS  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             H++T VMGT GYAAPEYI TGHLT   DV+SFG+VLLELLTGRR+++K +  RE++L +W
Sbjct  243   HITTCVMGTEGYAAPEYINTGHLTTMCDVFSFGVVLLELLTGRRSVEKNRCKREKDLVEW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP LKD  KL +I+D RLE  +S  GA++ A +A++CLSH  KSRPTM+TVVK LEPL 
Sbjct  303   ARPMLKDFTKLDQIIDSRLEDRYSTEGAKRLAAVAHQCLSHNPKSRPTMTTVVKALEPLL  362

Query  508   DYKDVSSVTFVYTA  467
             D  D+    FVYT 
Sbjct  363   DLNDIPIGPFVYTV  376



>ref|XP_004954103.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Setaria 
italica]
Length=432

 Score =   470 bits (1209),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 241/379 (64%), Positives = 292/379 (77%), Gaps = 8/379 (2%)
 Frame = -3

Query  1591  TLDSIFTGCFRA-APAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedlsis  1415
             TL   F G   A +  +G++  PA  +  +++A+ + AS     AT    S   +DLS +
Sbjct  3     TLFRCFVGSEPAGSEMSGDERAPAAARTTKKKAVRRMAS-----ATARLRSLSLDDLSRT  57

Query  1414  lAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPG-LKAQPVAVKLLD  1238
             LA S +HAFTL ELK  T++FSSS+F+GEGGFGPV+KGF+D++LRPG L+ Q VAVK LD
Sbjct  58    LATSGLHAFTLAELKAATRNFSSSHFIGEGGFGPVYKGFLDERLRPGELQPQHVAVKYLD  117

Query  1237  LDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSA  1058
              DG QGHREWL EV++LG L HPHLVKLIGY C++E R+LVYEYM RGSLE+ LF+   +
Sbjct  118   ADGPQGHREWLAEVVYLGMLSHPHLVKLIGYGCQDEQRMLVYEYMARGSLEHHLFKNLLS  177

Query  1057  SLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEG  878
             SLPW TR+KIA+GAAKGLAFLHEAE PVIYRDFKASNILLDSDY  KLSDFGLAK+GP+G
Sbjct  178   SLPWCTRLKIAVGAAKGLAFLHEAETPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQG  237

Query  877   DDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNL  698
             DDTHV+TRVMGTHGYAAPEYI+TGHLT+ SDVYSFG+VLLELLTGRR++DK +  REQ+L
Sbjct  238   DDTHVTTRVMGTHGYAAPEYILTGHLTSKSDVYSFGVVLLELLTGRRSVDKRRRGREQHL  297

Query  697   ADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLE  518
              DWARP L+ P +L R++DP L+G +S   A KAA++AY CL    KSRPTM  VV TLE
Sbjct  298   VDWARPYLRRPERLHRVMDPSLDGQYSGKAAHKAAMVAYHCLHSVPKSRPTMRDVVDTLE  357

Query  517   PLKDY-KDVSSVTFVYTAP  464
             PL     DV +  FVYTAP
Sbjct  358   PLLAICGDVPAGPFVYTAP  376



>ref|XP_002880775.1| root-specific kinase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57034.1| root-specific kinase 1 [Arabidopsis lyrata subsp. lyrata]
Length=423

 Score =   469 bits (1206),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 236/366 (64%), Positives = 282/366 (77%), Gaps = 1/366 (0%)
 Frame = -3

Query  1603  KMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             K K +L S+F GC++A  A   +    +  K R     K+ S + I +   S  ++ +DL
Sbjct  6     KKKTSLTSLFLGCYKAKNARKYEGEENSVMKIRTCPAFKRLSLSDI-SDPSSPMSVMDDL  64

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S S     +  FTL EL+VIT +FS SN LGEGGFGPV+KGFIDDK++PG++AQPVAVK 
Sbjct  65    SHSFTSQKLRLFTLSELRVITHNFSRSNMLGEGGFGPVYKGFIDDKVKPGIEAQPVAVKA  124

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDL G QGHREWL E+IFLGQL + HLVKLIG+CCEEE R+LVYEYMPRGSLENQLFRR 
Sbjct  125   LDLHGHQGHREWLAEIIFLGQLSNKHLVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRN  184

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S ++ W  RMKIALGAAKGLAFLHEAEKPVIYRDFK SNILLDSDY+ KLSDFGLAKDGP
Sbjct  185   SLAMAWGIRMKIALGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGP  244

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EG+ THV+TRVMGT GYAAPEYIMTGHLT  +DVYSFG+VLLEL+TG+R++D T+  REQ
Sbjct  245   EGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQ  304

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             +L +WARP L+D RKL R++DPRLE  +    AQ AA LAY+CLS   K RPTM  VVK 
Sbjct  305   SLVEWARPMLRDQRKLERVIDPRLENQYKIEAAQVAAALAYKCLSQHPKYRPTMCEVVKV  364

Query  523   LEPLKD  506
             LE +++
Sbjct  365   LESIQE  370



>ref|XP_003627303.1| Kinase-like protein [Medicago truncatula]
 gb|AET01779.1| receptor-like kinase [Medicago truncatula]
Length=475

 Score =   471 bits (1211),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 245/392 (63%), Positives = 288/392 (73%), Gaps = 17/392 (4%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGNDDMPA--TPKKPRREAITKQASFTRIPATelsss---als  1433
             KI   S   GCF+       D  P+  TPK      ++K+    RI  ++LS     ++ 
Sbjct  5     KIQWKSFVLGCFK-------DKNPSLETPK-----FVSKKTGSCRISLSDLSDYSSPSVM  52

Query  1432  edlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVA  1253
              DLS SL GSN+H FT +ELK IT +F  SNFLGEGGFG V+KGFIDDKLRP L  Q VA
Sbjct  53    SDLSNSLVGSNLHIFTCKELKEITNNFDKSNFLGEGGFGKVYKGFIDDKLRPTLVPQAVA  112

Query  1252  VKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLF  1073
             VK L+LDG QGHREWL EVIFLGQL+H +LV LIGYC E+EHRLLVYEYM RGSLE +LF
Sbjct  113   VKALNLDGKQGHREWLAEVIFLGQLKHRNLVNLIGYCYEDEHRLLVYEYMERGSLEEKLF  172

Query  1072  RRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAK  893
             + Y A+LPW TR+KIA+GAAKGLAFLHE EKPVIYRD KASNILLD+DY+ KLSDFGLA 
Sbjct  173   KGYLATLPWLTRIKIAIGAAKGLAFLHEEEKPVIYRDVKASNILLDADYNAKLSDFGLAI  232

Query  892   DGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPN  713
             DGP+ D TH++TRVMGTHGYAAPEYI TG LT  SDVYSFG+VLLELLTG++++DK +  
Sbjct  233   DGPDKDQTHITTRVMGTHGYAAPEYINTGRLTTMSDVYSFGVVLLELLTGKKSVDKKRTP  292

Query  712   REQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTV  533
             REQ+L +WARP LKD  +L RI+D RLE  +S  GA+K A+L Y+CLSH  KSRPTM TV
Sbjct  293   REQDLVEWARPSLKDSHRLERIIDSRLEDQYSIEGARKLAMLTYQCLSHHDKSRPTMRTV  352

Query  532   VKTLEPLKDYKDVSSVTFVYTAPTEKDTKTVS  437
             VKTLE +    D+    FVY AP E     VS
Sbjct  353   VKTLEHVMKLNDIPIGHFVYVAPIEVTNIEVS  384



>ref|XP_006649093.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
Length=446

 Score =   469 bits (1207),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 221/313 (71%), Positives = 258/313 (82%), Gaps = 1/313 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             S +HAFTL ELK  T+SFS SNF+GEGGFGPV+KGF+D KLRPGL +Q VAVK LD DG 
Sbjct  59    SGLHAFTLAELKSATRSFSGSNFIGEGGFGPVYKGFVDAKLRPGLHSQHVAVKYLDTDGP  118

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWL EV++LG L HPHLVKLIGYCC+++HR+LVYEYM RGSLE+ LF+   +SLPW
Sbjct  119   QGHREWLAEVVYLGMLSHPHLVKLIGYCCQDDHRMLVYEYMARGSLEHHLFKNLLSSLPW  178

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TR+KIA+GAAKGLAFLH+A+ PVIYRDFKASNILLDSDY  KLSDFGLAK+GP+GD TH
Sbjct  179   ATRLKIAVGAAKGLAFLHDADTPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQGDATH  238

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             V+TRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLELLTGRR++DK +  REQNL DWA
Sbjct  239   VTTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLELLTGRRSVDKRRRGREQNLVDWA  298

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEP-LK  509
             RP L+ P +L R++DP LEG +S+  A KAA++AY CL    KSRP M  VV  LEP L 
Sbjct  299   RPYLRRPERLHRVMDPSLEGGYSDKVANKAAMVAYHCLHSVPKSRPHMRDVVDALEPLLH  358

Query  508   DYKDVSSVTFVYT  470
                DV +  FVYT
Sbjct  359   TCGDVPAGPFVYT  371



>ref|XP_010417417.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=424

 Score =   468 bits (1204),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 230/366 (63%), Positives = 279/366 (76%), Gaps = 1/366 (0%)
 Frame = -3

Query  1603  KMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             K K +L S+F GC++A   +  +       K R     K+ S + I +   S  ++ +DL
Sbjct  6     KKKTSLTSLFLGCYKAKNTSKYEGEEKPVMKIRTCPAFKRLSLSDI-SDPSSPMSVMDDL  64

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S S     +  FTL EL++IT +FS SN LGEGGFGPV+KGFIDDK++PGL+ QPVAVK 
Sbjct  65    SHSFTSQKLRLFTLSELRMITHNFSRSNMLGEGGFGPVYKGFIDDKVKPGLEPQPVAVKA  124

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDL G QGHREWL E++FLGQL + HLVKLIG+C EEE R+LVYEYMPRGSLENQLFRR 
Sbjct  125   LDLHGHQGHREWLAEILFLGQLSNKHLVKLIGFCYEEEQRVLVYEYMPRGSLENQLFRRN  184

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S ++ W  RMKIALGAAKGLAFLHEAEKPVIYRDFK SNILLDS+Y+ KLSDFGLAKDGP
Sbjct  185   SVAMAWGIRMKIALGAAKGLAFLHEAEKPVIYRDFKTSNILLDSNYNAKLSDFGLAKDGP  244

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EG+ THV+TRVMGT GYAAPEYIMTGHLT  +DVYSFG+VLLEL+TG+R++D T+  REQ
Sbjct  245   EGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRARREQ  304

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             +L +W RP L+D RKL +I+DPRLE  +    AQ AA LAY+CLS + K RPTM  VVK 
Sbjct  305   SLVEWMRPMLRDQRKLEQIIDPRLESQYKTEAAQVAASLAYKCLSQQPKYRPTMCEVVKV  364

Query  523   LEPLKD  506
             LE +++
Sbjct  365   LESIQE  370



>dbj|BAJ94670.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92007.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   469 bits (1206),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 269/316 (85%), Gaps = 1/316 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++H FT+ EL+ +T+ FS +NF+GEGGFGPV+KG++D+K++PGL+AQPVAVKLLDL+G
Sbjct  87    GSDLHVFTIAELRAVTRDFSMTNFIGEGGFGPVYKGYVDEKVKPGLRAQPVAVKLLDLEG  146

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH EWLTEVIFLGQLRHPHLVKLIGYC E+EHRLLVYE+M RGSLE  LF++Y+ASL 
Sbjct  147   NQGHNEWLTEVIFLGQLRHPHLVKLIGYCYEDEHRLLVYEFMTRGSLEKLLFKKYAASLQ  206

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIALGAAKGLAFLHEAE PVIYRDFK SNILLDSDY  KLSDFGLAKDGPE D+T
Sbjct  207   WSTRLKIALGAAKGLAFLHEAESPVIYRDFKTSNILLDSDYKAKLSDFGLAKDGPEEDET  266

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLTA SDVY FG+VLLELLTGR+++DK++P REQNL DW
Sbjct  267   HVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGFGVVLLELLTGRKSVDKSRPPREQNLVDW  326

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D R+L R++DP L G ++   AQKAA LAY+C+S   KSRP MS VV  LEPL 
Sbjct  327   ARPYLNDSRRLDRVMDPNLAGQYAGGAAQKAAALAYKCVSLNPKSRPHMSAVVSALEPLL  386

Query  508   DYKDVS-SVTFVYTAP  464
               ++ S +  FVY AP
Sbjct  387   ALEEDSLAGPFVYVAP  402



>ref|XP_009140739.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
Length=424

 Score =   468 bits (1203),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 235/365 (64%), Positives = 282/365 (77%), Gaps = 2/365 (1%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGND-DMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             K +L S+F GC+R   A+  + +      K R   + K+ S + I +   S  ++ +DLS
Sbjct  8     KTSLTSLFLGCYRTKNASRYEVEERGNAMKIRTCPVIKRLSLSDI-SDPSSPMSVMDDLS  66

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
              S     +  FTL EL+VIT +FS SN LGEGGFGPV+KGFIDDK++PGL+AQPVAVK L
Sbjct  67    NSFTSQKLRMFTLSELRVITHNFSRSNMLGEGGFGPVYKGFIDDKVKPGLEAQPVAVKAL  126

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DL G QGHREWL E+IFLGQL + HLVKLIG+CCEEE R+LVYEYMPRGSLENQLFRR S
Sbjct  127   DLHGHQGHREWLAEIIFLGQLSNKHLVKLIGFCCEEEQRVLVYEYMPRGSLENQLFRRNS  186

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPE  881
              ++ W  RMKIALGAAKGLAFLHEAEKPVIYRDFK SNILLD +Y+ KLSDFGLAKDGPE
Sbjct  187   VAMAWGIRMKIALGAAKGLAFLHEAEKPVIYRDFKTSNILLDCNYNAKLSDFGLAKDGPE  246

Query  880   GDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQN  701
             G+ THV+TRVMGT GYAAPEYIMTGHLT  +DVYSFG+VLLEL+TG+R++D T+  REQ+
Sbjct  247   GEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELITGKRSVDTTRARREQS  306

Query  700   LADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTL  521
             L +WARP L+D RKL RI+DPRLE  +    AQ AA LA++CLS   K RPTMS VVK L
Sbjct  307   LVEWARPMLRDQRKLDRIIDPRLECQYKTEAAQAAAALAFKCLSQNPKYRPTMSDVVKVL  366

Query  520   EPLKD  506
             E +++
Sbjct  367   ESIQE  371



>ref|XP_010244204.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=419

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 259/322 (80%), Gaps = 0/322 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++H F L EL+ ITQ+FSS+  LGEGGFG VHKG+ID+ LR GLKAQ VAVKLLD +G
Sbjct  71    GSDLHVFQLSELRAITQNFSSNFLLGEGGFGTVHKGYIDENLRQGLKAQAVAVKLLDSEG  130

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHLV+LIGYCCE+E RLLVYE+MPRGSLEN LFRR S SLP
Sbjct  131   LQGHREWLAEVIFLGQLRHPHLVRLIGYCCEDEERLLVYEFMPRGSLENHLFRRISVSLP  190

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGLAFLH AEKPVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG +T
Sbjct  191   WGTRLKIAIGAAKGLAFLHGAEKPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSNT  250

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+ TGHLT  SDVYSFG+VLLELLTGRR++DKT+P  EQNL DW
Sbjct  251   HVTTRVMGTYGYAAPEYVTTGHLTTKSDVYSFGVVLLELLTGRRSMDKTRPKSEQNLVDW  310

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L   RKLR I+D RL G +S  GA++ A LA +C+S   K RP M  +V+TLE L+
Sbjct  311   ARPYLTSSRKLRCIMDTRLAGQYSVKGAREIASLALQCVSPNPKDRPRMPAIVETLEKLQ  370

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
             + +D++     + A T K  + 
Sbjct  371   NLRDMAVTCGQWPAATPKSGRN  392



>dbj|BAK01570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 224/325 (69%), Positives = 261/325 (80%), Gaps = 0/325 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ ELK  TQ F   NFLGEGGFGPV+KG +DDK++PGLKAQP+AVKL D  G
Sbjct  93    GSNLHVFTVAELKAATQGFLDDNFLGEGGFGPVYKGAVDDKVKPGLKAQPIAVKLWDPQG  152

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWL+EVIFLGQLRH +LVKLIGYCCE E+RLLVYEYM +GSLEN LF+++   L 
Sbjct  153   AQGHKEWLSEVIFLGQLRHTNLVKLIGYCCEHENRLLVYEYMAKGSLENHLFKQFPPVLS  212

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+ IA+GAAKGLAFLH+AEKPVIYRDFKASNILLD DY  KLSDFGLAKDGPEGDDT
Sbjct  213   WSTRLNIAVGAAKGLAFLHDAEKPVIYRDFKASNILLDPDYKAKLSDFGLAKDGPEGDDT  272

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLE+LTGRRA+DKT+P+RE +L   
Sbjct  273   HVSTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLEILTGRRAVDKTRPSREHHLVQH  332

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
              R  LKDP KL +I+DP LEG ++   A KAAL+AY+CLS   KSRP MS VV+ LE L 
Sbjct  333   MRSWLKDPEKLGKIMDPALEGKYATTAAHKAALVAYQCLSGSPKSRPDMSKVVEDLELLL  392

Query  508   DYKDVSSVTFVYTAPTEKDTKTVST  434
             +  D      V    ++ DT+   T
Sbjct  393   NLVDDVPGESVMHVASQADTRKERT  417



>ref|XP_010429651.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=424

 Score =   467 bits (1201),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 228/366 (62%), Positives = 279/366 (76%), Gaps = 1/366 (0%)
 Frame = -3

Query  1603  KMKITLDSIFTGCFRAAPAAGNDDMPATPKKPRREAITKQASFTRIPATelsssalsedl  1424
             K K +L S+F GC++A   +  +       K R     K+ S + I +   S  ++ +DL
Sbjct  6     KKKTSLTSLFLGCYKAKNTSKYEGEEKPVMKIRTCPAFKRLSLSDI-SDPSSPMSVMDDL  64

Query  1423  sislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKL  1244
             S S     +  FTL EL++IT +FS SN LGEGGFGPV+KGFIDDK++PGL+AQPVAVK 
Sbjct  65    SHSFTSQKLRMFTLSELRMITHNFSRSNMLGEGGFGPVYKGFIDDKVKPGLEAQPVAVKA  124

Query  1243  LDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRY  1064
             LDL G QGHREWL E++FLGQL + HLVKLIG+C EEE R+LVYEYMPRGSLENQ+FRR 
Sbjct  125   LDLHGHQGHREWLAEILFLGQLSNKHLVKLIGFCYEEEQRVLVYEYMPRGSLENQIFRRN  184

Query  1063  SASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGP  884
             S ++ W  RMKIALGAAKGL FLHEAEKPVIYRDFK SNILLDS+Y+ KLSDFGLAKDGP
Sbjct  185   SVAMAWGIRMKIALGAAKGLVFLHEAEKPVIYRDFKTSNILLDSNYNAKLSDFGLAKDGP  244

Query  883   EGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQ  704
             EG+ THV+TRVMGT GYAAPEYIMTGHLT  +DVYSFG+VLLEL+TG++++D T+  REQ
Sbjct  245   EGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELITGKKSMDNTRARREQ  304

Query  703   NLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKT  524
             +L +W RP L+D RKL +I+DPRLE  +    AQ AA LAY+CLS + K RPTM  VVK 
Sbjct  305   SLVEWMRPMLRDQRKLGQIIDPRLESQYKTEAAQVAASLAYKCLSQQPKYRPTMCEVVKV  364

Query  523   LEPLKD  506
             LE +++
Sbjct  365   LESIQE  370



>ref|XP_008442306.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Cucumis 
melo]
Length=426

 Score =   467 bits (1201),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 260/314 (83%), Gaps = 0/314 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  70    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  129

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  LPW
Sbjct  130   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLPW  189

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             + RM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  190   ARRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  249

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKTKP++EQNL DWA
Sbjct  250   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTKPSKEQNLVDWA  309

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  310   RPKLNDKRKLLQIIDPRLESQYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  369

Query  505   YKDVSSVTFVYTAP  464
               D    + + T P
Sbjct  370   GNDAIEYSSMGTTP  383



>ref|XP_002519898.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
 gb|EEF42502.1| receptor serine-threonine protein kinase, putative [Ricinus communis]
Length=421

 Score =   466 bits (1200),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 220/323 (68%), Positives = 260/323 (80%), Gaps = 1/323 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G ++  F L ELK ITQ+FSS+  LGEGGFG VHKG+ID+ LR GLKAQ VAVKLLD++G
Sbjct  72    GPDLFDFQLSELKAITQNFSSNYLLGEGGFGTVHKGYIDENLRQGLKAQAVAVKLLDIEG  131

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  132   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFKRVSVSLP  191

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKG+AFLH AE PVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG DT
Sbjct  192   WGTRLKIAIGAAKGVAFLHGAENPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSDT  251

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+ TGHLT  SDVYSFG+VLLELLTGRRA+DK +P  EQNL DW
Sbjct  252   HVTTRVMGTYGYAAPEYVSTGHLTTKSDVYSFGVVLLELLTGRRAMDKCRPKSEQNLIDW  311

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L   R+LR I+DPRL G +S  GA++ ALLA +C+S   K RP M  +V+TLE L+
Sbjct  312   AKPYLTSSRRLRYIMDPRLAGQYSVKGAKQVALLALQCISMNPKDRPKMPAIVETLEALQ  371

Query  508   DYKDVSSVTFVYTAPTEKDTKTV  440
              YKD+ +V+     P+ K  + +
Sbjct  372   TYKDM-AVSCGQWPPSPKSKRNI  393



>ref|XP_010112273.1| Serine/threonine-protein kinase [Morus notabilis]
 gb|EXC33076.1| Serine/threonine-protein kinase [Morus notabilis]
Length=437

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 258/306 (84%), Gaps = 0/306 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G+ ++ F L EL+ ITQ+FSS+  LGEGGFG VHKG++D+ LR GLKAQ VAVKLLD++G
Sbjct  89    GAELYDFQLSELRAITQNFSSNFLLGEGGFGTVHKGYMDENLRQGLKAQAVAVKLLDIEG  148

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  149   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFKRLSVSLP  208

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR++IA+GAAKGLAFLH AE PVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG DT
Sbjct  209   WGTRLRIAIGAAKGLAFLHGAENPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSDT  268

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+ TGHLT  SDVYSFG+VLLELLTGRRA+DK++P  EQ L DW
Sbjct  269   HVTTRVMGTYGYAAPEYVSTGHLTTKSDVYSFGVVLLELLTGRRAMDKSRPKTEQYLVDW  328

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L   R+LR I+DPRL G +SE GA++ ALLA +C+S + K RP M T+++TLE L+
Sbjct  329   AKPYLTSSRRLRYIMDPRLAGQYSEKGAKQMALLALQCISLKPKDRPKMPTIIETLESLQ  388

Query  508   DYKDVS  491
             ++KD++
Sbjct  389   NFKDMA  394



>gb|KDP39727.1| hypothetical protein JCGZ_02747 [Jatropha curcas]
Length=415

 Score =   466 bits (1200),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 216/306 (71%), Positives = 254/306 (83%), Gaps = 0/306 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G ++  F L ELK IT +F S+  LGEGGFG VHKG++DD LR GLKAQPVAVKLLD++G
Sbjct  74    GPDLFDFQLSELKAITHNFCSNYLLGEGGFGTVHKGYVDDHLREGLKAQPVAVKLLDIEG  133

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EV+FLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  134   LQGHREWLAEVVFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFKRISVSLP  193

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGLAFLH+AEKPVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG DT
Sbjct  194   WGTRLKIAVGAAKGLAFLHDAEKPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSDT  253

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+ TGHLT  SDVYSFG+VLLELLTGRRA+DK++P  EQNL DW
Sbjct  254   HVTTRVMGTYGYAAPEYVSTGHLTTKSDVYSFGVVLLELLTGRRAMDKSRPKSEQNLIDW  313

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L   R+LR I+DPRL G +S  GA++ A LA +C+S   K RP M  +V+TLE L+
Sbjct  314   AKPYLTSSRRLRYIMDPRLAGQYSVKGAKQIAHLATQCISINPKDRPKMPAIVETLEALQ  373

Query  508   DYKDVS  491
              YKD++
Sbjct  374   QYKDMA  379



>ref|XP_006651489.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
Length=528

 Score =   470 bits (1210),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 214/299 (72%), Positives = 252/299 (84%), Gaps = 0/299 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ ELK  TQ F   NFLGEGGFGPV+KG + DK +PGLKAQP+AVKL D +G
Sbjct  149   GSNLHVFTVGELKAATQGFLDGNFLGEGGFGPVYKGTVADKAKPGLKAQPIAVKLWDPEG  208

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWL+EVIFLGQLRHP+LVKLIGYCCE+EHRLLVYEYMP+GSLEN LF+++   L 
Sbjct  209   AQGHKEWLSEVIFLGQLRHPNLVKLIGYCCEDEHRLLVYEYMPKGSLENHLFKKFPGMLS  268

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+ IA+GAAKGL FLH+AEKPVIYRDFK SNILLD +Y  KLSDFGLAKDGPEGD+T
Sbjct  269   WSTRLNIAVGAAKGLVFLHDAEKPVIYRDFKTSNILLDPEYKAKLSDFGLAKDGPEGDET  328

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLE+L+GRRA+DKT+P+REQNL + 
Sbjct  329   HVSTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLEILSGRRAVDKTRPSREQNLVEH  388

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
              R  LKDP+KL R++DP L+G +  A A + A++AY CLS   K+RP M  VV  LEPL
Sbjct  389   MRSWLKDPQKLTRVMDPALQGQYPAAAAHRVAMVAYRCLSGNPKNRPDMCQVVADLEPL  447



>gb|EAY88776.1| hypothetical protein OsI_10252 [Oryza sativa Indica Group]
Length=446

 Score =   467 bits (1201),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 231/335 (69%), Positives = 268/335 (80%), Gaps = 20/335 (6%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ EL+ +T+ FS +NF+GEGGFGPV+KG++DDKL+PGL+AQPVAVKLLDL+G
Sbjct  74    GSNLHVFTIAELRAVTRDFSMTNFIGEGGFGPVYKGYVDDKLKPGLRAQPVAVKLLDLEG  133

Query  1228  SQGHREWL-------------------TEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEY  1106
             +QGH EWL                   TEVIFLGQLRHPHLVKLIGYC E+EHRLLVYE+
Sbjct  134   TQGHNEWLLKFQNGNRAKGLEFKSCQLTEVIFLGQLRHPHLVKLIGYCYEDEHRLLVYEF  193

Query  1105  MPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  926
             M RGSLE  LF++Y+ASLPWSTR+KIA+GAAKGLAFLHEAEKPVIYRDFK SNILLDSD+
Sbjct  194   MTRGSLEKHLFKKYAASLPWSTRLKIAIGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDF  253

Query  925   DGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLT  746
               KLSDFGLAKDGPE D+THVSTRVMGT GYAAPEYIMTGHLTA SDVY FG+VLLELLT
Sbjct  254   KAKLSDFGLAKDGPEDDETHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGFGVVLLELLT  313

Query  745   GRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSH  566
             GR+++DK++P REQNL +WARP L D R+L R++D  L G +    AQKAA LA+ C+S 
Sbjct  314   GRKSVDKSRPAREQNLVEWARPYLTDARRLGRVMDRNLAGQYPAKAAQKAAALAHRCVSL  373

Query  565   RSKSRPTMSTVVKTLEPLKDYKDVSSV-TFVYTAP  464
               KSRP MS VV+ LEPL    D   V TFVY AP
Sbjct  374   NPKSRPHMSAVVEALEPLLALDDDCLVGTFVYVAP  408



>ref|XP_009410482.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009410483.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   465 bits (1197),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 218/299 (73%), Positives = 257/299 (86%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF +   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+LD DG 
Sbjct  64    TDVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLDKDGH  123

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +A L W
Sbjct  124   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSW  183

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GPEGD+TH
Sbjct  184   ATRMSIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETH  243

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQ+L DWA
Sbjct  244   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWA  303

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RKL ++LDPRL+  +S   AQKA  LAY CLSH  K+RP MS VV+TL+PL+
Sbjct  304   RPKLNDKRKLLQVLDPRLDDQYSVRAAQKACSLAYYCLSHNPKARPLMSDVVETLQPLQ  362



>gb|KDO46394.1| hypothetical protein CISIN_1g014736mg [Citrus sinensis]
Length=419

 Score =   465 bits (1197),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G +++ F L EL+ ITQ+FSS+  LGEGGFG VHKG+IDD LR GLKAQ VAVKLLD++G
Sbjct  75    GPDLYDFQLSELRAITQNFSSNYLLGEGGFGTVHKGYIDDDLRQGLKAQAVAVKLLDIEG  134

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHLV+LIGYCCE+E RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  135   LQGHREWLAEVIFLGQLRHPHLVRLIGYCCEDEERLLVYEFMPRGSLENHLFKRISVSLP  194

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGLAFLH AE PVIYRDFK SNILLDSD+  KLSDFGLAK GPEG +T
Sbjct  195   WGTRLKIAIGAAKGLAFLHGAENPVIYRDFKTSNILLDSDFTAKLSDFGLAKMGPEGSNT  254

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEYI TGHLT  SDVYSFG+VLLELLTGRR++DK +P  EQNL DW
Sbjct  255   HVTTRVMGTYGYAAPEYISTGHLTTKSDVYSFGVVLLELLTGRRSMDKLRPKSEQNLVDW  314

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L+  R+LR I+DPRL G +S  GA++ A+LA +C+S   K RP M+ VV TLE L 
Sbjct  315   AKPYLRSSRRLRYIVDPRLAGQYSVKGAKEMAVLALQCISVNPKDRPKMAAVVATLESLL  374

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
             + KD++     + A T+K T+ 
Sbjct  375   NLKDMAVSCGQWPA-TQKSTRN  395



>ref|XP_006661741.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
Length=399

 Score =   464 bits (1195),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 223/317 (70%), Positives = 266/317 (84%), Gaps = 0/317 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS + AFT++EL+  T+ FS SNF+GEGGFGPV+KG++D++L+PG++AQ VAVKLLDL+G
Sbjct  81    GSGVQAFTVEELRTATRDFSVSNFVGEGGFGPVYKGYVDERLKPGVRAQAVAVKLLDLEG  140

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             SQGH+EWL EVIFLGQLRH HLVKLIGYC E+EHRLLVYE+M RGSLE  LF++YS+SLP
Sbjct  141   SQGHKEWLAEVIFLGQLRHHHLVKLIGYCYEDEHRLLVYEFMARGSLEKHLFKKYSSSLP  200

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+KIA+GAA+GLAFLHEA KPVIYRDFK SNILLDSDY+ KLSDFGLAKDGP+ D+T
Sbjct  201   WSTRLKIAIGAARGLAFLHEAAKPVIYRDFKTSNILLDSDYEAKLSDFGLAKDGPQEDET  260

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT GYAAPEYIMTGHLT  SDVYS+G+VLLELLTGR+A+DK +P REQNL +W
Sbjct  261   HVSTRVMGTQGYAAPEYIMTGHLTTKSDVYSYGVVLLELLTGRKAVDKKRPLREQNLVEW  320

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ARP L D R+L R++D  L G +S   A++AA +A++CLS   KSRP MS VV+ LEPL 
Sbjct  321   ARPCLHDSRRLDRVIDKGLNGQYSGRAARRAAAVAHQCLSVSPKSRPRMSAVVEALEPLL  380

Query  508   DYKDVSSVTFVYTAPTE  458
                D     FVYTAP E
Sbjct  381   AMDDGIVEPFVYTAPPE  397



>ref|XP_009410484.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=391

 Score =   464 bits (1194),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 218/299 (73%), Positives = 257/299 (86%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF +   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+LD DG 
Sbjct  41    TDVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLDKDGH  100

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +A L W
Sbjct  101   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSW  160

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GPEGD+TH
Sbjct  161   ATRMSIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETH  220

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQ+L DWA
Sbjct  221   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWA  280

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RKL ++LDPRL+  +S   AQKA  LAY CLSH  K+RP MS VV+TL+PL+
Sbjct  281   RPKLNDKRKLLQVLDPRLDDQYSVRAAQKACSLAYYCLSHNPKARPLMSDVVETLQPLQ  339



>ref|XP_007161128.1| hypothetical protein PHAVU_001G044900g [Phaseolus vulgaris]
 gb|ESW33122.1| hypothetical protein PHAVU_001G044900g [Phaseolus vulgaris]
Length=371

 Score =   463 bits (1192),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/353 (66%), Positives = 275/353 (78%), Gaps = 18/353 (5%)
 Frame = -3

Query  1495  ITKQASFTRI---PATelsssalsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEG  1325
             + KQ SF R+     +  SS+   EDLSIS  GS ++AFTL+EL+  T SFS SN LGEG
Sbjct  31    VLKQGSFQRLCLSDVSNSSSTQAIEDLSISFGGSKLYAFTLEELREATSSFSWSNMLGEG  90

Query  1324  GFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGY  1145
             GFGPV+KGF+DDKLRPGLKAQ VAVK LDLDG QGHREWL E+IFLGQLRHPHLVKLIGY
Sbjct  91    GFGPVYKGFVDDKLRPGLKAQTVAVKRLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGY  150

Query  1144  CCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYR  965
             C E+E+RLL+YEYMPRGSLENQLFRRYSA++PWSTRMKIALGAAKGLAFLHEA+KP    
Sbjct  151   CYEDENRLLMYEYMPRGSLENQLFRRYSAAMPWSTRMKIALGAAKGLAFLHEADKP----  206

Query  964   DFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASD  785
                        D+  KLSDFGLAKDGPEG+DT+V+TR+MGT GYAAPEYIMTGHLT  SD
Sbjct  207   -----------DFTAKLSDFGLAKDGPEGEDTYVTTRIMGTQGYAAPEYIMTGHLTTKSD  255

Query  784   VYSFGIVLLELLTGRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGA  605
             VYS+G+VLLELLTGRR +DK++ N  ++L +WARP L+DP+ +  I+D RLEG F   GA
Sbjct  256   VYSYGVVLLELLTGRRVVDKSRSNGGKSLVEWARPLLRDPKIVYSIIDCRLEGQFPMKGA  315

Query  604   QKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDYKDVSSVTFVYTAPTEKDTK  446
              K A+LA++CLS    +RPTMS VVK LEPL+D+ DV    FVY A +E   K
Sbjct  316   MKVAMLAFKCLSPHPNARPTMSDVVKVLEPLQDFDDVFIGPFVYVAVSENGNK  368



>ref|XP_011018915.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
Length=427

 Score =   465 bits (1196),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 260/308 (84%), Gaps = 0/308 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  68    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  127

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHPHLVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  128   QGHREWLTEVNFLGQLRHPHLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  187

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  188   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P++EQ+L DWA
Sbjct  248   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  308   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQC  367

Query  505   YKDVSSVT  482
              +  SS+T
Sbjct  368   SEVSSSLT  375



>ref|XP_009388437.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/306 (71%), Positives = 253/306 (83%), Gaps = 0/306 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G+ ++AF L ELK IT  FSS+  LGEGGFG VHKG+ID+++RPGLKAQ VAVKLLD++G
Sbjct  73    GAGLYAFQLSELKAITHDFSSNFLLGEGGFGTVHKGYIDERMRPGLKAQAVAVKLLDVEG  132

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQ RHPHLVKLIGYCCE+E RLLVYE+MPRGSLEN LFRR S +L 
Sbjct  133   LQGHREWLAEVIFLGQFRHPHLVKLIGYCCEDEERLLVYEFMPRGSLENHLFRRISMALS  192

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGLAFLH AEKPVIYRDFK SNILLD D+  KLSDFGLAK GPEG+DT
Sbjct  193   WGTRLKIAIGAAKGLAFLHGAEKPVIYRDFKTSNILLDHDFTAKLSDFGLAKMGPEGEDT  252

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEY+MTGHLT  SDVYS+G+VLLELLTGRRA+DKTKP  E+ L DW
Sbjct  253   HVTTRVMGTHGYAAPEYVMTGHLTTKSDVYSYGVVLLELLTGRRAMDKTKPKNEEKLVDW  312

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L   R+LR I+D RL G +S  G+++ A LA  C+S   K RP MSTVV+TLE L+
Sbjct  313   AKPYLTSSRRLRCIMDHRLAGSYSTKGSREVASLALRCISPNPKDRPQMSTVVETLEGLQ  372

Query  508   DYKDVS  491
               KD++
Sbjct  373   HLKDMA  378



>ref|XP_004984060.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Setaria 
italica]
Length=456

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/317 (69%), Positives = 262/317 (83%), Gaps = 0/317 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ +LK  TQ F  SNFLGEGGFGPV+KG + +  +PGL+AQ +AVKL D +G
Sbjct  93    GSNLHVFTVGDLKAATQGFVDSNFLGEGGFGPVYKGAVAEGAKPGLRAQQIAVKLWDPEG  152

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWL+EVIFLGQLRHP+LVKL+GYC EEEHRLLVYEYMP+GSLEN LF+++   L 
Sbjct  153   TQGHKEWLSEVIFLGQLRHPNLVKLVGYCSEEEHRLLVYEYMPKGSLENHLFKKFPPVLS  212

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WSTR+ IA+GAAKGLAFLH+AEKPVIYRDFK SNILL+ DY+ KLSDFGLAKDGPEGDDT
Sbjct  213   WSTRLNIAVGAAKGLAFLHDAEKPVIYRDFKTSNILLNPDYEAKLSDFGLAKDGPEGDDT  272

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLE+L+GRRA+DKT+P+REQ+L ++
Sbjct  273   HVSTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLEILSGRRAVDKTRPSREQHLVEY  332

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
              R  LKDP+KL R++DP LEG +S   A KAAL+AY+CLS   K+RP MS VV+ LEPL 
Sbjct  333   MRSWLKDPQKLGRVMDPDLEGKYSTVAAHKAALVAYQCLSGSPKNRPDMSKVVEDLEPLL  392

Query  508   DYKDVSSVTFVYTAPTE  458
                D +       AP +
Sbjct  393   TVTDDAPGELPAAAPED  409



>ref|XP_009370852.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=419

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/308 (71%), Positives = 258/308 (84%), Gaps = 0/308 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  66    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGH  125

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  126   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  185

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  186   GTRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETH  245

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P+REQNL DWA
Sbjct  246   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVDWA  305

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  306   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  365

Query  505   YKDVSSVT  482
               + S+ T
Sbjct  366   CNEPSNST  373



>ref|XP_004137666.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
sativus]
Length=426

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 256/303 (84%), Gaps = 0/303 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  70    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  129

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  LPW
Sbjct  130   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLPW  189

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             + RM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  190   ARRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  249

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKTKP++EQNL DWA
Sbjct  250   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTKPSKEQNLVDWA  309

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  310   RPKLNDKRKLLQIIDPRLESQYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  369

Query  505   YKD  497
               D
Sbjct  370   GND  372



>gb|AAO13471.1| Putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
Length=444

 Score =   465 bits (1197),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 230/335 (69%), Positives = 268/335 (80%), Gaps = 20/335 (6%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ EL+ +T+ FS +NF+GEGGFGPV+KG++DDKL+PGL+AQPVAVKLLDL+G
Sbjct  74    GSNLHVFTIAELRAVTRDFSMTNFIGEGGFGPVYKGYVDDKLKPGLRAQPVAVKLLDLEG  133

Query  1228  SQGHREWL-------------------TEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEY  1106
             +QGH EWL                   TEVIFLGQLRHPHLVKLIGYC E+EHRLLVYE+
Sbjct  134   TQGHNEWLLKFQHGNRAKGLEFKSCQLTEVIFLGQLRHPHLVKLIGYCYEDEHRLLVYEF  193

Query  1105  MPRGSLENQLFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDY  926
             M RGSLE  LF++Y+ASLPWSTR+KIA+GAAKGLAFLHEAEKPVIYRDFK SNILLDSD+
Sbjct  194   MTRGSLEKHLFKKYAASLPWSTRLKIAIGAAKGLAFLHEAEKPVIYRDFKTSNILLDSDF  253

Query  925   DGKLSDFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLT  746
               KLSDFGLAKDGPE D+THVSTRVMGT GYAAPEYIMTGHLTA SDVY FG+VLLELL+
Sbjct  254   KAKLSDFGLAKDGPEDDETHVSTRVMGTQGYAAPEYIMTGHLTAKSDVYGFGVVLLELLS  313

Query  745   GRRAIDKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSH  566
             GR+++DK++P REQNL +WARP L D R+L R++D  L G +    AQKAA LA+ C+S 
Sbjct  314   GRKSVDKSRPAREQNLVEWARPYLTDARRLGRVMDRNLAGQYPAKAAQKAAALAHRCVSL  373

Query  565   RSKSRPTMSTVVKTLEPLKDYKDVSSV-TFVYTAP  464
               KSRP MS VV+ LEPL    D   V TFVY AP
Sbjct  374   NPKSRPHMSAVVEALEPLLALDDDCLVGTFVYVAP  408



>ref|XP_004160326.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
At5g01020-like [Cucumis sativus]
Length=426

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 256/303 (84%), Gaps = 0/303 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  70    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  129

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  LPW
Sbjct  130   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTTVPLPW  189

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             + RM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  190   ARRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  249

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKTKP++EQNL DWA
Sbjct  250   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTKPSKEQNLVDWA  309

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  310   RPKLNDKRKLLQIIDPRLESQYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  369

Query  505   YKD  497
               D
Sbjct  370   GND  372



>ref|XP_006432865.1| hypothetical protein CICLE_v10003320mg [Citrus clementina]
 ref|XP_006471639.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Citrus 
sinensis]
 gb|ESR46105.1| hypothetical protein CICLE_v10003320mg [Citrus clementina]
Length=419

 Score =   464 bits (1194),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G +++ F L EL+ ITQ+FSS+  LGEGGFG VHKG+IDD LR GLKAQ VAVKLLD++G
Sbjct  75    GPDLYDFQLSELRAITQNFSSNYLLGEGGFGTVHKGYIDDDLRQGLKAQAVAVKLLDIEG  134

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHLV+LIGYCCE+E RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  135   LQGHREWLAEVIFLGQLRHPHLVRLIGYCCEDEERLLVYEFMPRGSLENHLFKRISVSLP  194

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGLAFLH AE PVIYRDFK SNILLDSD+  KLSDFGLAK GPEG +T
Sbjct  195   WGTRLKIAIGAAKGLAFLHGAENPVIYRDFKTSNILLDSDFTAKLSDFGLAKMGPEGSNT  254

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEYI TGHLT  SDVYSFG+VLLELLTGRR++DK +P  EQNL DW
Sbjct  255   HVTTRVMGTYGYAAPEYISTGHLTTKSDVYSFGVVLLELLTGRRSMDKLRPKSEQNLVDW  314

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L+  R+LR I+DPRL G +S  GA++ A+LA +C+S   K RP M  VV TLE L 
Sbjct  315   AKPYLRSSRRLRYIVDPRLAGQYSVKGAKEMAVLALQCISVNPKDRPKMPAVVATLESLL  374

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
             + KD++     + A T+K T+ 
Sbjct  375   NLKDMAVSCGQWPA-TQKSTRN  395



>emb|CBI20734.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/390 (61%), Positives = 280/390 (72%), Gaps = 54/390 (14%)
 Frame = -3

Query  1606  LKMKITLDSIFTGCFRA-APAAGNDDMPATPKKPRREAITKQASFTRIPATels---ssa  1439
             + +KIT  +I  GC++   P A          + R++ + KQ SF R+  ++LS   S  
Sbjct  1     MTLKITWKTIMPGCYKTETPIA----------ESRKKPVLKQGSFQRLSLSDLSNPGSPL  50

Query  1438  lsedlsislAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQP  1259
               +D+S SL GSN++ FTL EL+ IT +FS SN LGEGGFGPV+KGFID+KLRP LKAQP
Sbjct  51    SVDDISNSLIGSNLYTFTLAELREITHNFSPSNLLGEGGFGPVYKGFIDEKLRPKLKAQP  110

Query  1258  VAVKLLDLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQ  1079
             VAVKLLDLDG QGHREWL E+IFLGQLRHPHLVKLIGYCCE+EHRLL+YEYM RGSLENQ
Sbjct  111   VAVKLLDLDGLQGHREWLAEIIFLGQLRHPHLVKLIGYCCEDEHRLLIYEYMARGSLENQ  170

Query  1078  LFRRYSASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGL  899
             LFRRYSA+LPWS RMKI  GAAKGLAFLHE +KPVIYRDFKASNILLD DY  KLSDFGL
Sbjct  171   LFRRYSAALPWSARMKILFGAAKGLAFLHEGDKPVIYRDFKASNILLDPDYTAKLSDFGL  230

Query  898   AKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTK  719
             AKDGPEGD+THVSTR+MGTHGYAAPEYIMTGHLT  SDVYSFG+VLLE+++G+R++DKT+
Sbjct  231   AKDGPEGDETHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLEVISGKRSMDKTR  290

Query  718   PNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMS  539
             P                                          LAY+CLSH++K+RP MS
Sbjct  291   PTE----------------------------------------LAYKCLSHQAKARPAMS  310

Query  538   TVVKTLEPLKDYKDVSSVTFVYTAPTEKDT  449
              VVK LEPL+D+ D     FVY  P E + 
Sbjct  311   DVVKILEPLQDFDDTVISPFVYVVPAEGEV  340



>ref|XP_003516498.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=420

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 262/322 (81%), Gaps = 2/322 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++  F L EL+ ITQ+FSS+  LGEGGFG VHKG+IDD LR GLKAQPVAVKLLD++G
Sbjct  72    GSDLFDFQLSELRAITQNFSSNFLLGEGGFGTVHKGYIDDNLRLGLKAQPVAVKLLDIEG  131

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LFRR + SLP
Sbjct  132   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFRRLT-SLP  190

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA GAAKGL+FLH AEKPVIYRDFK SN+LLDS++  KLSDFGLAK GPEG +T
Sbjct  191   WGTRLKIATGAAKGLSFLHGAEKPVIYRDFKTSNVLLDSEFTAKLSDFGLAKMGPEGSNT  250

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT+GYAAPEYI TGHLT  SDVYSFG+VLLELLTGRRA DKT+P  EQNL DW
Sbjct  251   HVSTRVMGTYGYAAPEYISTGHLTTKSDVYSFGVVLLELLTGRRATDKTRPKTEQNLVDW  310

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ++P L   R+LR I+DPRL G +S  GA++ A LA +C+S   K RP M T+V+TLE L+
Sbjct  311   SKPYLSSSRRLRYIMDPRLSGQYSVKGAKEMAHLALQCISLNPKDRPRMPTIVETLEGLQ  370

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
              YKD+ +VT  +   + K TK 
Sbjct  371   QYKDM-AVTSGHWPVSPKSTKN  391



>ref|XP_006586718.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Glycine max]
 gb|KHN11807.1| Serine/threonine-protein kinase [Glycine soja]
Length=423

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/321 (70%), Positives = 262/321 (82%), Gaps = 2/321 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++  F L EL+ ITQ+FSS+  LGEGGFG VHKG+IDD LR GLKAQPVAVKLLD++G
Sbjct  75    GSDLFDFQLIELRAITQNFSSNFLLGEGGFGTVHKGYIDDNLRLGLKAQPVAVKLLDIEG  134

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LFRR + SLP
Sbjct  135   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFRRLT-SLP  193

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA GAAKGL+FLH AEKPVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG +T
Sbjct  194   WGTRLKIATGAAKGLSFLHGAEKPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSNT  253

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT+GYAAPEYI TGHLT  SDVYSFG+VLLELLTGRRA DKT+P  EQNL DW
Sbjct  254   HVSTRVMGTYGYAAPEYISTGHLTTKSDVYSFGVVLLELLTGRRATDKTRPKTEQNLVDW  313

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ++P L   R+LR I+DPRL G +S  GA++ A LA +C+S   K RP M T+V+TLE L+
Sbjct  314   SKPYLSSSRRLRYIMDPRLAGQYSVKGAKEMAHLALQCISLNPKDRPRMPTIVETLEGLQ  373

Query  508   DYKDVSSVTFVYTAPTEKDTK  446
              YKD+ +VT  +   + K TK
Sbjct  374   QYKDM-AVTSGHWPVSSKSTK  393



>gb|EAZ24810.1| hypothetical protein OsJ_08589 [Oryza sativa Japonica Group]
Length=449

 Score =   465 bits (1196),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 259/318 (81%), Gaps = 3/318 (1%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL-KAQPVAVKLLDLDG  1229
             S + AFTL ELK  T+SFS SNF+GEGGFGPV+KGFID KLRPGL + Q VAVK LD +G
Sbjct  61    SGLQAFTLAELKAATRSFSGSNFIGEGGFGPVYKGFIDAKLRPGLLQPQHVAVKYLDGEG  120

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EV++LG L HPHLVKLIGYCC+++HR+LVYEYM RGSLE+ LF+   +SLP
Sbjct  121   DQGHREWLAEVVYLGMLSHPHLVKLIGYCCQDDHRMLVYEYMARGSLEHHLFKNLLSSLP  180

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W+TR+KIA+GAAKGLAFLH+A+ PVIYRDFKASNILLDSDY  KLSDFGLAK+GP+GD T
Sbjct  181   WATRLKIAVGAAKGLAFLHDADTPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQGDAT  240

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLELLTGRR++DK +  REQNL DW
Sbjct  241   HVTTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLELLTGRRSVDKRRRGREQNLVDW  300

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL-  512
             ARP L+ P +L R++DP LEG +S+  A KAA++AY CL    KSRP M  VV  LEPL 
Sbjct  301   ARPYLRRPERLHRVMDPSLEGGYSDKAAGKAAMVAYHCLHSVPKSRPHMRDVVAALEPLL  360

Query  511   -KDYKDVSSVTFVYTAPT  461
                  DV +  FVYT P+
Sbjct  361   QTSCGDVLAGPFVYTVPS  378



>ref|XP_010931422.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=414

 Score =   463 bits (1192),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 217/299 (73%), Positives = 256/299 (86%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +N+ +FTL EL+ IT+SF     LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ DG 
Sbjct  64    TNVISFTLFELETITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGH  123

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +A L W
Sbjct  124   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSW  183

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  184   ATRMSIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  243

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQ+L DWA
Sbjct  244   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWA  303

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RK+ +I+DPRLEG +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+
Sbjct  304   RPKLNDKRKMLQIIDPRLEGQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|NP_001240045.1| serine/threonine-protein kinase At5g01020-like [Glycine max]
 gb|ACM89551.1| protein kinase [Glycine max]
Length=420

 Score =   464 bits (1193),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 262/322 (81%), Gaps = 2/322 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++  F L EL+ ITQ+FSS+  LGEGGFG VHKG+IDD LR GLKAQPVAVKLLD++G
Sbjct  75    GSDLFDFQLIELRAITQNFSSNFLLGEGGFGTVHKGYIDDNLRLGLKAQPVAVKLLDIEG  134

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LFRR + SLP
Sbjct  135   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFRRLT-SLP  193

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA GAAKGL+FLH AEKPVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG +T
Sbjct  194   WGTRLKIATGAAKGLSFLHGAEKPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSNT  253

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT+GYAAPEYI TGHLT  SDVYSFG+VLLELLTGRRA DKT+P  EQNL DW
Sbjct  254   HVSTRVMGTYGYAAPEYISTGHLTTKSDVYSFGVVLLELLTGRRATDKTRPKTEQNLVDW  313

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ++P L   R+LR I+DPRL G +S  GA++ A LA +C+S   K RP M T+V+TLE L+
Sbjct  314   SKPYLSSSRRLRYIMDPRLAGQYSVKGAKEMAHLALQCISLNPKDRPRMPTIVETLEGLQ  373

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
              YKD+ +VT  +   + K TK 
Sbjct  374   QYKDM-AVTSGHWPVSSKSTKN  394



>ref|XP_010537625.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Tarenaya 
hassleriana]
Length=449

 Score =   464 bits (1195),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 222/316 (70%), Positives = 254/316 (80%), Gaps = 1/316 (0%)
 Frame = -3

Query  1402  NIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGSQ  1223
             ++H FT +EL+ ITQSFS SN+LGEGGFG V+KGF+DD LR GLKAQPVAVK L  DG Q
Sbjct  64    DLHIFTYKELETITQSFSKSNYLGEGGFGEVYKGFVDDSLRTGLKAQPVAVKALKPDGGQ  123

Query  1222  GHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPWS  1043
             GHREWL EVI LGQL+HPHLV LIGYCCE+EHRLLVYEYM RG+LE+ LF+RYS +LPW 
Sbjct  124   GHREWLAEVIILGQLKHPHLVNLIGYCCEDEHRLLVYEYMERGNLEDHLFQRYSGTLPWL  183

Query  1042  TRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTHV  863
             TRMKI LGAAKGLAFLHE + PVIYRDFK SNILL SD+  KLSDFGLA DG EG + +V
Sbjct  184   TRMKILLGAAKGLAFLHEEQSPVIYRDFKPSNILLTSDFRSKLSDFGLATDGSEGGEPNV  243

Query  862   STRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWAR  683
              TRVMGT GYAAPEYI TGHLT  SDV+SFG+VLLELLTGR A++K +  R +NL +WAR
Sbjct  244   -TRVMGTEGYAAPEYISTGHLTTMSDVFSFGVVLLELLTGRNAVEKYRSQRGRNLVEWAR  302

Query  682   PQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKDY  503
             P LKD  KL  I+DP LEG +S  G +KAA LAY+CL+H  KSRPTM TVVKTLEPL D 
Sbjct  303   PMLKDHTKLEGIIDPGLEGRYSVEGVRKAAALAYQCLNHNPKSRPTMKTVVKTLEPLLDL  362

Query  502   KDVSSVTFVYTAPTEK  455
             KD+ +  FVY  P E+
Sbjct  363   KDIQNGPFVYIVPVER  378



>gb|EAY87739.1| hypothetical protein OsI_09153 [Oryza sativa Indica Group]
Length=451

 Score =   464 bits (1195),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 259/318 (81%), Gaps = 3/318 (1%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGL-KAQPVAVKLLDLDG  1229
             S + AFTL ELK  T+SFS SNF+GEGGFGPV+KGFID KLRPGL + Q VAVK LD +G
Sbjct  63    SGLQAFTLAELKAATRSFSGSNFIGEGGFGPVYKGFIDAKLRPGLLQPQHVAVKYLDGEG  122

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EV++LG L HPHLVKLIGYCC+++HR+LVYEYM RGSLE+ LF+   +SLP
Sbjct  123   DQGHREWLAEVVYLGMLSHPHLVKLIGYCCQDDHRMLVYEYMARGSLEHHLFKNLLSSLP  182

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W+TR+KIA+GAAKGLAFLH+A+ PVIYRDFKASNILLDSDY  KLSDFGLAK+GP+GD T
Sbjct  183   WATRLKIAVGAAKGLAFLHDADTPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQGDAT  242

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGTHGYAAPEYI+TGHLTA SDVYSFG+VLLELLTGRR++DK +  REQNL DW
Sbjct  243   HVTTRVMGTHGYAAPEYILTGHLTAKSDVYSFGVVLLELLTGRRSVDKRRRGREQNLVDW  302

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL-  512
             ARP L+ P +L R++DP LEG +S+  A KAA++AY CL    KSRP M  VV  LEPL 
Sbjct  303   ARPYLRRPERLHRVMDPSLEGGYSDKAAGKAAMVAYHCLHSVPKSRPHMRDVVAALEPLL  362

Query  511   -KDYKDVSSVTFVYTAPT  461
                  DV +  FVYT P+
Sbjct  363   QTSCGDVLAGPFVYTVPS  380



>ref|XP_008388407.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
 ref|XP_008388408.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
 ref|XP_008388409.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=416

 Score =   463 bits (1191),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 257/308 (83%), Gaps = 0/308 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  63    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGY  122

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  123   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  182

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  183   GTRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYATKLSDFGLAKAGPQGDETH  242

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQNL DWA
Sbjct  243   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWA  302

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  303   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  362

Query  505   YKDVSSVT  482
               + S  T
Sbjct  363   CNEASDST  370



>ref|XP_009383280.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   462 bits (1190),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 218/299 (73%), Positives = 255/299 (85%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF     LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ DG 
Sbjct  64    NDVIAFTLFELETITKSFRPDYVLGEGGFGAVYKGYIDENVRVGLKSLPVAVKVLNKDGH  123

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +A L W
Sbjct  124   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAAAPLSW  183

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GPEGD+TH
Sbjct  184   ATRMSIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETH  243

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DK +P++EQ+L DWA
Sbjct  244   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKARPSKEQSLVDWA  303

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLSH  K+RP MS VV+TLEPL+
Sbjct  304   RPKLNDKRKLLQIIDPRLEDQYSVRAAQKACSLAYYCLSHNPKARPLMSDVVETLEPLQ  362



>ref|XP_003612555.1| Protein kinase 2B [Medicago truncatula]
 gb|AES95513.1| tyrosine kinase family protein [Medicago truncatula]
Length=420

 Score =   463 bits (1191),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 263/325 (81%), Gaps = 2/325 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++  F L EL+ ITQ+FSS+  LGEGGFG VHKG+ DD  R GLKAQPVAVKLLD++G
Sbjct  74    GSDLFDFQLSELRAITQNFSSNFLLGEGGFGTVHKGYFDDNFRQGLKAQPVAVKLLDIEG  133

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LFRR + SLP
Sbjct  134   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFRRLT-SLP  192

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W+TR+KIA+GAAKGL+FLH AEKPVIYRDFK SN+LLDSD+  KLSDFGLAK GPEG  +
Sbjct  193   WATRIKIAIGAAKGLSFLHGAEKPVIYRDFKTSNVLLDSDFTAKLSDFGLAKMGPEGSKS  252

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEYI TGHLT  SDVYSFG+VLLELLTGRRA DKT+P  EQN+ DW
Sbjct  253   HVTTRVMGTYGYAAPEYISTGHLTTKSDVYSFGVVLLELLTGRRATDKTRPKTEQNIVDW  312

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
              +P L   R+LR I+DPRL G +S  GA++ A LA +C+S   K RP M+ +V+TLE L+
Sbjct  313   TKPYLSSSRRLRYIMDPRLAGQYSVKGAKEIAHLALQCISLHPKDRPRMAMIVETLESLE  372

Query  508   DYKDVSSVTFVYTAPTEKDTKTVST  434
              +KD+ +VT  +   + K TK VS+
Sbjct  373   QFKDM-AVTSGHWPISSKSTKNVSS  396



>ref|XP_002519978.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF42302.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=534

 Score =   467 bits (1202),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 221/313 (71%), Positives = 262/313 (84%), Gaps = 1/313 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  68    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  127

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  LPW
Sbjct  128   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLPW  187

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  188   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P++EQ+L DWA
Sbjct  248   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  308   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQC  367

Query  505   YKD-VSSVTFVYT  470
               D  + VTF  T
Sbjct  368   SNDGATEVTFTPT  380



>ref|XP_003572269.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brachypodium 
distachyon]
Length=479

 Score =   465 bits (1197),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 222/324 (69%), Positives = 263/324 (81%), Gaps = 2/324 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+HAFT  EL+ +T  FS +N+LG GGFGPV+KG + D+LRPGL+AQPVAVK LDLD 
Sbjct  80    GSNLHAFTYAELRAVTGGFSRANYLGCGGFGPVYKGRVSDELRPGLQAQPVAVKYLDLDC  139

Query  1228  S-QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASL  1052
             S QGH+EWL EV FLGQLRH +LVKLIGYC E+EHR+LVYEYM  GSLE  LF+    S+
Sbjct  140   STQGHKEWLAEVFFLGQLRHKNLVKLIGYCYEDEHRMLVYEYMGNGSLEKHLFKSLDGSM  199

Query  1051  PWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             PW TRM+IA+GAAKGLAFLH+A+ PVI+RDFKASNILLD DY+ KLSDFGLAKDGP+GD 
Sbjct  200   PWITRMRIAVGAAKGLAFLHDADTPVIFRDFKASNILLDEDYNSKLSDFGLAKDGPQGDA  259

Query  871   THVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             THV+TR+MGTHGYAAPEYIMTGHLTA SDVYSFG+VLLELL+GRR+ID+ + +REQ+L D
Sbjct  260   THVTTRIMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLELLSGRRSIDRARRSREQSLVD  319

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             +ARP LK P KL RI+DP LEG +S  GA++AA +AY+CLS  SKSRPTM  VVK+LEP+
Sbjct  320   YARPYLKKPEKLYRIMDPALEGQYSCKGAEQAAQVAYKCLSQNSKSRPTMREVVKSLEPI  379

Query  511   KDYKDVSSVT-FVYTAPTEKDTKT  443
              D  D   V  FV+T   E   K 
Sbjct  380   LDMDDYLQVGPFVFTVVVEDVNKN  403



>ref|XP_008370313.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=419

 Score =   462 bits (1190),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/305 (72%), Positives = 256/305 (84%), Gaps = 0/305 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  66    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGH  125

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  126   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  185

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  186   GTRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETH  245

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P+REQNL DWA
Sbjct  246   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSREQNLVDWA  305

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  306   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  365

Query  505   YKDVS  491
               + S
Sbjct  366   CNEPS  370



>ref|XP_010693043.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/303 (72%), Positives = 255/303 (84%), Gaps = 0/303 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  84    TDVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  143

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+    L W
Sbjct  144   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAVVPLSW  203

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             STRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  204   STRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTTKLSDFGLAKAGPQGDETH  263

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQNL DWA
Sbjct  264   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWA  323

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  324   RPKLNDKRKLLQIIDPRLESQYSIRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  383

Query  505   YKD  497
               D
Sbjct  384   IGD  386



>ref|XP_006362327.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Solanum 
tuberosum]
Length=426

 Score =   462 bits (1190),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 217/299 (73%), Positives = 256/299 (86%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             ++I AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  68    THIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  127

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFRR + SL W
Sbjct  128   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRRATVSLSW  187

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  188   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P++EQNL DWA
Sbjct  248   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVDWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RK+ +I+DPRL+  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+
Sbjct  308   RPKLNDKRKMLQIIDPRLDNQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_003559971.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brachypodium 
distachyon]
Length=448

 Score =   463 bits (1192),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 216/300 (72%), Positives = 256/300 (85%), Gaps = 1/300 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GSN+H FT+ EL+  T+ F  +NFLGEGGFGPV+KGF+D  ++ GLK Q +AVKL D +G
Sbjct  72    GSNLHVFTVAELRAATRDFDDANFLGEGGFGPVYKGFVDGAVKHGLKPQHIAVKLWDPEG  131

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
             +QGH+EWL EVIFLGQLRHP+LVKL+GYCCE+EHRLLVYEYM  GSLEN LF+   A+LP
Sbjct  132   AQGHKEWLAEVIFLGQLRHPNLVKLVGYCCEDEHRLLVYEYMAHGSLENHLFQHVPATLP  191

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             WS R+ IA+GAAKGLAFLH+AEKPVIYRDFKASNILLDSD   KLSDFGLAKDGPEGDDT
Sbjct  192   WSIRLNIAVGAAKGLAFLHDAEKPVIYRDFKASNILLDSDDGAKLSDFGLAKDGPEGDDT  251

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGTHGYAAPEYIMTGHLTA SDVYSFG+VLLE+LTGRR++DK++P+REQNL ++
Sbjct  252   HVSTRVMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLEILTGRRSVDKSRPSREQNLVEY  311

Query  688   ARPQLKDPRKL-RRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPL  512
             ARP L+DP +L RRI+DP LE  +    AQ+AAL+A++CLS   K+RP MS VV+ LEPL
Sbjct  312   ARPGLRDPLRLARRIMDPALENRYPARAAQRAALVAHQCLSGSPKNRPDMSAVVEALEPL  371



>ref|XP_009381351.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/299 (73%), Positives = 255/299 (85%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF     LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ DG 
Sbjct  64    TDVIAFTLFELETITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNRDGH  123

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +A L W
Sbjct  124   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKTAAPLSW  183

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GPEGD+TH
Sbjct  184   ATRMSIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPEGDETH  243

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQ+L DWA
Sbjct  244   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWA  303

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RKL +I+D RLE  +S   AQKA  LAY CLSH  K+RP MS VV+TLEPL+
Sbjct  304   RPKLNDKRKLLQIIDSRLEDQYSARAAQKACSLAYYCLSHNPKARPLMSDVVETLEPLQ  362



>ref|XP_010553184.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=410

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/308 (71%), Positives = 256/308 (83%), Gaps = 0/308 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             + + AFTL EL+ IT+SF     LGEGGFG V+KG+IDD LR GLK+ PVAVK+L+ +G 
Sbjct  46    TQVIAFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGL  105

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +A L W
Sbjct  106   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMLRGSLENHLFRKTTAPLSW  165

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             S RM IALGAAKGLA LH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  166   SRRMMIALGAAKGLACLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  225

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLE+LTGR+++DKT+P+REQNL DWA
Sbjct  226   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLEMLTGRKSVDKTRPSREQNLVDWA  285

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  286   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQC  345

Query  505   YKDVSSVT  482
               DV  V+
Sbjct  346   TGDVGQVS  353



>ref|XP_010044463.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Eucalyptus 
grandis]
Length=425

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 255/303 (84%), Gaps = 0/303 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  66    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  125

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCEE+HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  126   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEEDHRLLVYEFMFRGSLENHLFRKATVPLSW  185

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  186   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  245

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR++ DKT+P++EQNL DWA
Sbjct  246   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSFDKTRPSKEQNLVDWA  305

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  306   RPKLNDKRKLLQIIDPRLENQYSARAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQG  365

Query  505   YKD  497
               D
Sbjct  366   SND  368



>ref|XP_007158107.1| hypothetical protein PHAVU_002G124700g [Phaseolus vulgaris]
 gb|ESW30101.1| hypothetical protein PHAVU_002G124700g [Phaseolus vulgaris]
Length=419

 Score =   461 bits (1187),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 264/322 (82%), Gaps = 2/322 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             GS++  F L EL+ ITQ+FSS+  LGEGGFG VHKG++DD LR GLKAQPVAVKLLD++G
Sbjct  72    GSDLFDFQLSELRAITQNFSSNFLLGEGGFGTVHKGYLDDHLRLGLKAQPVAVKLLDIEG  131

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHP+LVKLIGYCCE+E RLLVYE+MPRGSLEN LFRR + SLP
Sbjct  132   LQGHREWLAEVIFLGQLRHPNLVKLIGYCCEDEERLLVYEFMPRGSLENHLFRRLT-SLP  190

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGL+FLH AEKPVIYRDFK SN+LLDS++  KLSDFGLAK GPEG +T
Sbjct  191   WGTRLKIAIGAAKGLSFLHGAEKPVIYRDFKTSNVLLDSEFTAKLSDFGLAKMGPEGSNT  250

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HVSTRVMGT+GYAAPEYI TGHLT  SDVYSFG+VLLELLTGRRA DKT+P  EQNL DW
Sbjct  251   HVSTRVMGTYGYAAPEYISTGHLTTKSDVYSFGVVLLELLTGRRATDKTRPKTEQNLVDW  310

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             ++P L   R+LR I+DPRL G +S  GA++ + LA +C+S   K RP M  +V+TLE L+
Sbjct  311   SKPYLSSSRRLRYIMDPRLAGQYSVKGAKEISRLALQCISLNPKDRPRMPMIVETLEGLQ  370

Query  508   DYKDVSSVTFVYTAPTEKDTKT  443
              YKD+ +VT  +   ++K T++
Sbjct  371   QYKDM-AVTSGHWPVSQKSTRS  391



>ref|XP_006842637.1| hypothetical protein AMTR_s00077p00187600 [Amborella trichopoda]
 gb|ERN04312.1| hypothetical protein AMTR_s00077p00187600 [Amborella trichopoda]
Length=415

 Score =   461 bits (1186),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 219/299 (73%), Positives = 255/299 (85%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +N+ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ DG 
Sbjct  64    TNVIAFTLFELETITKSFRSDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGL  123

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWL EV FLGQLRH +LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ SA L W
Sbjct  124   QGHREWLAEVNFLGQLRHANLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKASAPLSW  183

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AEKPVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  184   ATRMTIALGAAKGLAFLHGAEKPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  243

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQ+L DWA
Sbjct  244   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWA  303

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RKL +++DPRLEG +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+
Sbjct  304   RPKLNDKRKLLQVIDPRLEGQYSTRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  362



>ref|XP_009337839.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
 ref|XP_009337840.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
 ref|XP_009337841.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=416

 Score =   461 bits (1186),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 257/308 (83%), Gaps = 0/308 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  63    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGF  122

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  123   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLLW  182

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  183   GTRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYATKLSDFGLAKAGPQGDETH  242

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQNL DWA
Sbjct  243   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWA  302

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  303   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  362

Query  505   YKDVSSVT  482
               + S  T
Sbjct  363   CNEASDST  370



>ref|XP_007205277.1| hypothetical protein PRUPE_ppa006509mg [Prunus persica]
 gb|EMJ06476.1| hypothetical protein PRUPE_ppa006509mg [Prunus persica]
Length=408

 Score =   461 bits (1185),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 218/305 (71%), Positives = 256/305 (84%), Gaps = 0/305 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  54    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  113

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  114   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  173

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  174   GTRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETH  233

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+PN+EQNL DWA
Sbjct  234   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPNKEQNLVDWA  293

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRL+  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  294   RPKLNDKRKLLQIIDPRLDNQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  353

Query  505   YKDVS  491
               + S
Sbjct  354   CNEPS  358



>ref|XP_010278903.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=410

 Score =   461 bits (1185),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 216/299 (72%), Positives = 254/299 (85%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ DG 
Sbjct  61    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKDGH  120

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  121   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKAAVPLSW  180

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IA GAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  181   ATRMMIAFGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  240

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQ+L DWA
Sbjct  241   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQSLVDWA  300

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+
Sbjct  301   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  359



>gb|AFW68830.1| putative protein kinase superfamily protein [Zea mays]
Length=382

 Score =   459 bits (1182),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 264/319 (83%), Gaps = 2/319 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKA-QPVAVKLLDLD  1232
             GS++ AFT++EL+V T+ FS SNF+GEGGFGPV+KG +D+++RPGL+  Q VAVKLLDL+
Sbjct  62    GSDVLAFTVEELRVATRDFSMSNFVGEGGFGPVYKGRVDERVRPGLRQPQAVAVKLLDLE  121

Query  1231  GSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASL  1052
             GSQGH+EWL EVIFLGQLRHPHLVKLIGYC ++EHRLLVYE+M RGSLE  LF+R+SASL
Sbjct  122   GSQGHKEWLAEVIFLGQLRHPHLVKLIGYCYQDEHRLLVYEFMARGSLEKHLFKRHSASL  181

Query  1051  PWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             PWSTRM+IA+GAAKGLAFLH+A KPVIYRDFK SNILLDSDY  KLSDFGLAK GP  D+
Sbjct  182   PWSTRMRIAIGAAKGLAFLHDAAKPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPGEDE  241

Query  871   THVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             THVSTRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTGR+A+DK +P REQ+L +
Sbjct  242   THVSTRVMGTQGYAAPEYIMTGHLTTKSDVYSFGVVLLELLTGRKALDKNRPPREQSLVE  301

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEA-GAQKAALLAYECLSHRSKSRPTMSTVVKTLEP  515
             WARP L+D R+L R++D RL    +    AQKAA +A++CLS   KSRP MS VV+ LE 
Sbjct  302   WARPCLRDARRLERVMDRRLPRPTTPTRAAQKAAGIAHQCLSVSPKSRPQMSHVVQALES  361

Query  514   LKDYKDVSSVTFVYTAPTE  458
             L    D +   FVYTAP E
Sbjct  362   LLALDDAAVEPFVYTAPPE  380



>ref|XP_006408732.1| hypothetical protein EUTSA_v10002290mg [Eutrema salsugineum]
 gb|ESQ50185.1| hypothetical protein EUTSA_v10002290mg [Eutrema salsugineum]
Length=429

 Score =   461 bits (1186),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 234/377 (62%), Positives = 281/377 (75%), Gaps = 12/377 (3%)
 Frame = -3

Query  1597  KITLDSIFTGCFRAAPAAGND-DMPATPKKPRREAITKQASFTRIPATelsssalsedls  1421
             K +L S+F GC+R   A   + +    P K R   + K+ S + I +   S  +  +DLS
Sbjct  3     KTSLTSLFLGCYRINNANRYEVEEKDHPMKIRTCPVFKRLSLSDI-SDPSSPMSFMDDLS  61

Query  1420  islAGSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLL  1241
              S     +  F++ EL+VIT +FS  + LGEGGFGPV+KGFIDDK++PGLKAQPVAVK L
Sbjct  62    NSFTSDKLRLFSMSELRVITHNFSRLSILGEGGFGPVYKGFIDDKVKPGLKAQPVAVKAL  121

Query  1240  DLDGSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYS  1061
             DL G QGHREWL+E+IFLGQL + HLVKLIG CCEEE R+LVYEYMPRGSLENQLFRR S
Sbjct  122   DLHGHQGHREWLSEIIFLGQLSNRHLVKLIGVCCEEEQRVLVYEYMPRGSLENQLFRRNS  181

Query  1060  ASLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDS----------DYDGKLS  911
               L W  RMKIALGAAKGLA LHEAEKPVIYRDFK SNILLDS          +Y+ KLS
Sbjct  182   VGLAWGLRMKIALGAAKGLASLHEAEKPVIYRDFKTSNILLDSESLFNPSYIFNYNAKLS  241

Query  910   DFGLAKDGPEGDDTHVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAI  731
             DFGLAKDGPEG+ THV+TRVMGT GYAAPEYIMTGHLT  +DVYSFG+VLLELLTG+R++
Sbjct  242   DFGLAKDGPEGEHTHVTTRVMGTQGYAAPEYIMTGHLTTMNDVYSFGVVLLELLTGKRSM  301

Query  730   DKTKPNREQNLADWARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSR  551
             D T+   EQ+L +W RP L+D RKL RI+DPRLE  ++   AQ AA+LA++CLS   K R
Sbjct  302   DNTRVRSEQSLVEWVRPMLRDQRKLERIIDPRLECQYNTEQAQTAAVLAFKCLSQNPKYR  361

Query  550   PTMSTVVKTLEPLKDYK  500
             PTMS VVK LEP+++ +
Sbjct  362   PTMSKVVKVLEPIQEVQ  378



>ref|XP_006381288.1| hypothetical protein POPTR_0006s11430g [Populus trichocarpa]
 gb|ERP59085.1| hypothetical protein POPTR_0006s11430g [Populus trichocarpa]
Length=414

 Score =   461 bits (1185),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 260/308 (84%), Gaps = 0/308 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  55    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  114

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  115   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  174

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  175   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  234

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P++EQ+L DWA
Sbjct  235   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWA  294

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  295   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQC  354

Query  505   YKDVSSVT  482
              +  SS+T
Sbjct  355   SEVSSSLT  362



>ref|XP_002265437.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
Length=432

 Score =   461 bits (1186),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 216/300 (72%), Positives = 256/300 (85%), Gaps = 0/300 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  68    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGF  127

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  128   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  187

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  188   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P++EQ+L DWA
Sbjct  248   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+D
Sbjct  308   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQD  367



>gb|KDP21817.1| hypothetical protein JCGZ_00604 [Jatropha curcas]
Length=433

 Score =   461 bits (1186),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 218/306 (71%), Positives = 257/306 (84%), Gaps = 0/306 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  70    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  129

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  130   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  189

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  190   GTRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  249

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P++EQ+L DWA
Sbjct  250   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQSLVDWA  309

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RK+ +ILDPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  310   RPKLNDKRKMLQILDPRLESQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQC  369

Query  505   YKDVSS  488
               D SS
Sbjct  370   SNDGSS  375



>ref|XP_004249015.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Solanum 
lycopersicum]
Length=426

 Score =   460 bits (1184),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 216/299 (72%), Positives = 255/299 (85%), Gaps = 0/299 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             ++I AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  68    THIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  127

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRH +LVKLIGYCCE++HRLLVYE+M RGSLEN LFRR + SL W
Sbjct  128   QGHREWLTEVNFLGQLRHSNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRRATVSLSW  187

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  188   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P++EQNL DWA
Sbjct  248   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPSKEQNLVDWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             RP+L D RK+ +I+DPRL+  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+
Sbjct  308   RPKLNDKRKMLQIIDPRLDNQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQ  366



>ref|XP_007040918.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY25419.1| Kinase superfamily protein [Theobroma cacao]
Length=418

 Score =   460 bits (1183),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 212/306 (69%), Positives = 252/306 (82%), Gaps = 0/306 (0%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDG  1229
             G +++ F L EL+ ITQ+FSS+  LGEGGFG VHKG++DD  R GLKAQ VAVKLLD++G
Sbjct  72    GPDLYDFQLSELRAITQNFSSNYLLGEGGFGTVHKGYVDDNFRQGLKAQAVAVKLLDIEG  131

Query  1228  SQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLP  1049
              QGHREWL EVIFLGQLRHPHLVKLIGYCCE+E RLLVYE+MPRGSLEN LF+R S SLP
Sbjct  132   LQGHREWLAEVIFLGQLRHPHLVKLIGYCCEDEQRLLVYEFMPRGSLENHLFKRISTSLP  191

Query  1048  WSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDT  869
             W TR+KIA+GAAKGLAFLH AE PVIYRDFK SNIL+DSD+  KLSDFGLAK GPEG +T
Sbjct  192   WGTRLKIAIGAAKGLAFLHGAENPVIYRDFKTSNILVDSDFTAKLSDFGLAKMGPEGSNT  251

Query  868   HVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADW  689
             HV+TRVMGT+GYAAPEY+ TGHLT  SDVYSFG+VLLELLTGRR+++K++   EQ L DW
Sbjct  252   HVTTRVMGTYGYAAPEYVSTGHLTTKSDVYSFGVVLLELLTGRRSVEKSRSKNEQILVDW  311

Query  688   ARPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLK  509
             A+P L   R+LR I+DPRL G +S  GA++ ALLA +C+S   K RP M  +V+TLE L+
Sbjct  312   AKPYLSSSRRLRYIMDPRLSGQYSVKGAKEMALLALQCISLNPKDRPRMPAIVQTLEALQ  371

Query  508   DYKDVS  491
              YKD++
Sbjct  372   QYKDMA  377



>ref|XP_011006228.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Populus 
euphratica]
Length=432

 Score =   461 bits (1185),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 216/303 (71%), Positives = 255/303 (84%), Gaps = 0/303 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  68    THVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSIPVAVKVLNREGL  127

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  128   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  187

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
             +TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  188   ATRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETH  247

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGR+++DKT+P +EQ+L DWA
Sbjct  248   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRKSVDKTRPGKEQSLVDWA  307

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRLE  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  308   RPKLNDKRKLLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQC  367

Query  505   YKD  497
               D
Sbjct  368   SND  370



>ref|XP_008244257.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
Length=418

 Score =   460 bits (1183),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 256/305 (84%), Gaps = 0/305 (0%)
 Frame = -3

Query  1405  SNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGS  1226
             +++ AFTL EL+ IT+SF S   LGEGGFG V+KG+ID+ +R GLK+ PVAVK+L+ +G 
Sbjct  64    THVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGL  123

Query  1225  QGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASLPW  1046
             QGHREWLTEV FLGQLRHP+LVKLIGYCCE++HRLLVYE+M RGSLEN LFR+ +  L W
Sbjct  124   QGHREWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSW  183

Query  1045  STRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDDTH  866
              TRM IALGAAKGLAFLH AE+PVIYRDFK SNILLDSDY  KLSDFGLAK GP+GD+TH
Sbjct  184   GTRMMIALGAAKGLAFLHNAERPVIYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETH  243

Query  865   VSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLADWA  686
             VSTRVMGT+GYAAPEY+MTGHLTA SDVYSFG+VLLELLTGRR++DKT+P++EQNL DWA
Sbjct  244   VSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLELLTGRRSVDKTRPSKEQNLVDWA  303

Query  685   RPQLKDPRKLRRILDPRLEGMFSEAGAQKAALLAYECLSHRSKSRPTMSTVVKTLEPLKD  506
             RP+L D RKL +I+DPRL+  +S   AQKA  LAY CLS   K+RP MS VV+TLEPL+ 
Sbjct  304   RPKLNDKRKLLQIIDPRLDNQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQS  363

Query  505   YKDVS  491
               + S
Sbjct  364   CNEPS  368



>ref|XP_008681384.1| PREDICTED: uncharacterized LOC100272518 isoform X2 [Zea mays]
Length=411

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 264/319 (83%), Gaps = 2/319 (1%)
 Frame = -3

Query  1408  GSNIHAFTLQELKVITQSFSSSNFLGEGGFGPVHKGFIDDKLRPGLKA-QPVAVKLLDLD  1232
             GS++ AFT++EL+V T+ FS SNF+GEGGFGPV+KG +D+++RPGL+  Q VAVKLLDL+
Sbjct  91    GSDVLAFTVEELRVATRDFSMSNFVGEGGFGPVYKGRVDERVRPGLRQPQAVAVKLLDLE  150

Query  1231  GSQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLVYEYMPRGSLENQLFRRYSASL  1052
             GSQGH+EWL EVIFLGQLRHPHLVKLIGYC ++EHRLLVYE+M RGSLE  LF+R+SASL
Sbjct  151   GSQGHKEWLAEVIFLGQLRHPHLVKLIGYCYQDEHRLLVYEFMARGSLEKHLFKRHSASL  210

Query  1051  PWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYDGKLSDFGLAKDGPEGDD  872
             PWSTRM+IA+GAAKGLAFLH+A KPVIYRDFK SNILLDSDY  KLSDFGLAK GP  D+
Sbjct  211   PWSTRMRIAIGAAKGLAFLHDAAKPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPGEDE  270

Query  871   THVSTRVMGTHGYAAPEYIMTGHLTAASDVYSFGIVLLELLTGRRAIDKTKPNREQNLAD  692
             THVSTRVMGT GYAAPEYIMTGHLT  SDVYSFG+VLLELLTGR+A+DK +P REQ+L +
Sbjct  271   THVSTRVMGTQGYAAPEYIMTGHLTTKSDVYSFGVVLLELLTGRKALDKNRPPREQSLVE  330

Query  691   WARPQLKDPRKLRRILDPRLEGMFSEA-GAQKAALLAYECLSHRSKSRPTMSTVVKTLEP  515
             WARP L+D R+L R++D RL    +    AQKAA +A++CLS   KSRP MS VV+ LE 
Sbjct  331   WARPCLRDARRLERVMDRRLPRPTTPTRAAQKAAGIAHQCLSVSPKSRPQMSHVVQALES  390

Query  514   LKDYKDVSSVTFVYTAPTE  458
             L    D +   FVYTAP E
Sbjct  391   LLALDDAAVEPFVYTAPPE  409



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5038884546152