BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c33066_g1_i1 len=684 path=[1:0-683]

Length=684
                                                                      Score     E

ref|XP_009616305.1|  PREDICTED: uncharacterized protein LOC104108870    118   5e-29   
ref|XP_006357447.1|  PREDICTED: uncharacterized protein LOC102581787    117   5e-29   
ref|XP_009781357.1|  PREDICTED: uncharacterized protein LOC104230292    117   8e-29   
ref|XP_004241927.1|  PREDICTED: uncharacterized protein LOC101255307    108   2e-25   
gb|EYU45936.1|  hypothetical protein MIMGU_mgv1a018168mg              79.3    5e-15   
ref|XP_006465189.1|  PREDICTED: uncharacterized protein LOC102622992  79.7    6e-15   
gb|KDO43975.1|  hypothetical protein CISIN_1g030839mg                 77.4    4e-14   
ref|XP_009346314.1|  PREDICTED: uncharacterized protein LOC103938041  73.9    4e-13   
ref|XP_009345350.1|  PREDICTED: uncharacterized protein LOC103937...  74.3    6e-13   
ref|XP_010098439.1|  hypothetical protein L484_012154                 73.6    7e-13   
ref|XP_004303818.1|  PREDICTED: uncharacterized protein LOC101314483  73.9    7e-13   
ref|XP_004507555.1|  PREDICTED: uncharacterized protein LOC101512441  67.8    5e-11   
ref|XP_009336363.1|  PREDICTED: uncharacterized protein LOC103928957  66.6    2e-10   
ref|XP_008342837.1|  PREDICTED: uncharacterized protein LOC103405...  66.2    2e-10   
ref|XP_008353762.1|  PREDICTED: uncharacterized protein LOC103417...  66.2    2e-10   
ref|XP_009345351.1|  PREDICTED: uncharacterized protein LOC103937...  66.6    2e-10   
ref|XP_003630113.1|  hypothetical protein MTR_8g091950                64.7    6e-10   
ref|XP_011046602.1|  PREDICTED: uncharacterized protein LOC105141166  64.3    8e-10   
ref|XP_009762998.1|  PREDICTED: uncharacterized protein LOC104214...  63.9    1e-09   
ref|XP_007215042.1|  hypothetical protein PRUPE_ppa012081mg           63.5    3e-09   
ref|XP_008227973.1|  PREDICTED: uncharacterized protein LOC103327...  62.8    5e-09   
ref|XP_002316437.2|  hypothetical protein POPTR_0010s25920g           60.8    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008342838.1|  PREDICTED: uncharacterized protein LOC103405...  60.5    3e-08   
ref|XP_008353763.1|  PREDICTED: uncharacterized protein LOC103417...  60.5    3e-08   
ref|XP_008356960.1|  PREDICTED: uncharacterized protein LOC103420...  60.1    4e-08   
ref|XP_009149120.1|  PREDICTED: uncharacterized protein LOC103872470  59.3    6e-08   
ref|XP_002533617.1|  conserved hypothetical protein                   59.3    6e-08   Ricinus communis
emb|CDX81787.1|  BnaC08g38140D                                        58.9    8e-08   
emb|CDY40029.1|  BnaC05g12860D                                        58.5    1e-07   
ref|XP_006580306.1|  PREDICTED: uncharacterized protein LOC102663813  58.5    1e-07   
ref|XP_002513325.1|  conserved hypothetical protein                   57.8    2e-07   Ricinus communis
emb|CDY54373.1|  BnaAnng13040D                                        57.8    2e-07   
ref|XP_008232474.1|  PREDICTED: uncharacterized protein LOC103331...  58.2    2e-07   
gb|KFK43886.1|  hypothetical protein AALP_AA1G186700                  57.8    2e-07   
ref|XP_002866636.1|  hypothetical protein ARALYDRAFT_332703           57.4    3e-07   
ref|XP_009762999.1|  PREDICTED: uncharacterized protein LOC104214...  57.4    3e-07   
gb|KDP25056.1|  hypothetical protein JCGZ_22591                       56.6    4e-07   
ref|XP_008227974.1|  PREDICTED: uncharacterized protein LOC103327...  57.0    5e-07   
ref|XP_007048138.1|  Uncharacterized protein TCM_001261               56.6    7e-07   
ref|XP_006427984.1|  hypothetical protein CICLE_v10026701mg           56.2    8e-07   
ref|XP_004504014.1|  PREDICTED: uncharacterized protein LOC101515131  55.8    9e-07   
ref|XP_006416770.1|  hypothetical protein EUTSA_v10008985mg           56.2    1e-06   
ref|XP_009626113.1|  PREDICTED: uncharacterized protein LOC104116868  56.2    1e-06   
ref|NP_201287.1|  uncharacterized protein                             55.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027342.1|  PREDICTED: uncharacterized protein LOC104417831  54.7    2e-06   
ref|XP_008356962.1|  PREDICTED: uncharacterized protein LOC103420...  55.5    2e-06   
ref|XP_010027337.1|  PREDICTED: uncharacterized protein LOC104417824  55.1    2e-06   
emb|CBI21520.3|  unnamed protein product                              53.5    4e-06   
ref|XP_006394106.1|  hypothetical protein EUTSA_v10005069mg           53.9    5e-06   
ref|XP_009598905.1|  PREDICTED: uncharacterized protein LOC104094647  53.9    5e-06   
ref|XP_010462684.1|  PREDICTED: uncharacterized protein LOC104743277  53.5    7e-06   
ref|XP_008440136.1|  PREDICTED: uncharacterized protein LOC103484692  52.8    1e-05   
ref|XP_002275864.2|  PREDICTED: uncharacterized protein LOC100261058  52.8    1e-05   Vitis vinifera
gb|KEH28532.1|  transmembrane protein, putative                       52.8    1e-05   
ref|XP_010444436.1|  PREDICTED: uncharacterized protein LOC104727119  52.8    1e-05   
gb|KGN48428.1|  hypothetical protein Csa_6G487000                     52.4    2e-05   
gb|KEH31328.1|  hypothetical protein MTR_4g094508                     52.0    2e-05   
ref|XP_009779351.1|  PREDICTED: uncharacterized protein LOC104228571  52.0    3e-05   
ref|XP_010027330.1|  PREDICTED: uncharacterized protein LOC104417818  52.0    3e-05   
ref|XP_010484277.1|  PREDICTED: uncharacterized protein LOC104762647  51.6    3e-05   
emb|CDY43565.1|  BnaC02g16620D                                        51.6    3e-05   
gb|KFK28171.1|  hypothetical protein AALP_AA8G481600                  51.6    4e-05   
ref|XP_009779353.1|  PREDICTED: uncharacterized protein LOC104228573  50.8    4e-05   
ref|XP_011021945.1|  PREDICTED: uncharacterized protein LOC105123878  51.6    4e-05   
ref|XP_008460283.1|  PREDICTED: uncharacterized protein LOC103499155  50.4    7e-05   
ref|XP_009130477.1|  PREDICTED: uncharacterized protein LOC103855261  51.2    7e-05   
ref|XP_008811575.1|  PREDICTED: uncharacterized protein LOC103722703  50.8    8e-05   
emb|CDY31300.1|  BnaA02g34410D                                        51.2    9e-05   
emb|CDY14515.1|  BnaC03g49440D                                        50.4    1e-04   
ref|XP_006282168.1|  hypothetical protein CARUB_v10028427mg           50.1    1e-04   
ref|XP_008232483.1|  PREDICTED: uncharacterized protein LOC103331...  50.4    1e-04   
ref|XP_009150561.1|  PREDICTED: uncharacterized protein LOC103873909  50.1    1e-04   
ref|XP_004144421.1|  PREDICTED: uncharacterized protein LOC101222094  49.7    1e-04   
ref|XP_009117739.1|  PREDICTED: uncharacterized protein LOC103842825  49.7    2e-04   
ref|XP_003531775.1|  PREDICTED: uncharacterized protein LOC100820...  49.3    2e-04   
ref|XP_002892924.1|  hypothetical protein ARALYDRAFT_334956           49.3    2e-04   
emb|CDY08846.1|  BnaA06g23780D                                        49.3    3e-04   
ref|XP_010498014.1|  PREDICTED: uncharacterized protein LOC104775787  48.9    3e-04   
ref|XP_007159763.1|  hypothetical protein PHAVU_002G265200g           48.5    5e-04   
emb|CDY46825.1|  BnaC02g43330D                                        48.1    6e-04   
ref|XP_010531935.1|  PREDICTED: uncharacterized protein LOC104808...  48.5    8e-04   
ref|NP_564008.1|  uncharacterized protein                             47.8    0.001   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009616305.1| PREDICTED: uncharacterized protein LOC104108870 [Nicotiana tomentosiformis]
Length=179

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = +2

Query  167  MEAVRKRRHPIVETAMALFSLPTTFPDTS-AYWTKLDSLIQQGRAFFSPPNLDFRQgeap  343
            MEA + ++ PI+ET   +FS PTT P TS +YW+K +SLI+Q +A+FSPP LDFR  +  
Sbjct  55   MEA-KAQKTPIIETVKRMFSFPTTLPQTSTSYWSKFNSLIKQCKAYFSPPTLDFRDSQEA  113

Query  344  eameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            +  EEG GEKVKEA++KS+DKSKE +EDSAKSAAKLAG+ V K   K+K T S
Sbjct  114  QGKEEGAGEKVKEAMIKSLDKSKEAMEDSAKSAAKLAGDAVQKTKNKVKRTFS  166



>ref|XP_006357447.1| PREDICTED: uncharacterized protein LOC102581787 [Solanum tuberosum]
Length=171

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 4/117 (3%)
 Frame = +2

Query  182  KRRHPIVETAMALFSLPTTFPDTSA-YWTKLDSLIQQGRAFFSPPNLDFR---Qgeapea  349
            K + PI+ET   +FS PT+FP TSA YW++ +SLI+QG+A+FSPP LDFR   + +A   
Sbjct  48   KSKTPIIETVKKMFSFPTSFPQTSANYWSRFESLIKQGKAYFSPPTLDFRDSQEAQARAE  107

Query  350  meegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDP  520
                PGEKVKEAV+KS+DKSK  +E+SAKSAAKLAGE V K  +K+K T S + +DP
Sbjct  108  GGAAPGEKVKEAVLKSLDKSKAALEESAKSAAKLAGEAVQKTAKKMKRTFSFEDRDP  164



>ref|XP_009781357.1| PREDICTED: uncharacterized protein LOC104230292 [Nicotiana sylvestris]
Length=182

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +2

Query  167  MEAVRKRRHPIVETAMALFSLPTTFPDTS-AYWTKLDSLIQQGRAFFSPPNLDFRQgeap  343
            MEA + ++ PI+ET   +FS PTT P TS +YW+K +SLI+QG+A+FSPP LDFR  +  
Sbjct  57   MEA-KSQKTPIIETVKRMFSFPTTLPQTSTSYWSKFNSLIKQGKAYFSPPTLDFRDSQEA  115

Query  344  eameegpg-eKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            +  EE    EKVKEAV+KS+DKSKE +EDSAKSAAKLAG+ V K   K+K T S
Sbjct  116  QGKEEEGAGEKVKEAVIKSLDKSKEAMEDSAKSAAKLAGDAVQKTKNKVKRTFS  169



>ref|XP_004241927.1| PREDICTED: uncharacterized protein LOC101255307 [Solanum lycopersicum]
Length=170

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 80/113 (71%), Gaps = 8/113 (7%)
 Frame = +2

Query  194  PIVETAMALFSLPTTFPDTSA-YWTKLDSLIQQGRAFFSPPNLDFR---Qgeapeameeg  361
            PI+ET   +FS    FP TSA YW++ +SLI+QG+A+FSPP LDFR   + +A       
Sbjct  55   PIIETVKKMFS----FPQTSANYWSRFESLIKQGKAYFSPPTLDFRDSQEAQARAEGGAA  110

Query  362  pgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDP  520
            PGEKVKEAV+KS+DKSK  +E+SAKSAAKLAGE V K T K+K T S   +DP
Sbjct  111  PGEKVKEAVLKSLDKSKAALEESAKSAAKLAGEAVSKTTNKMKRTFSFGDRDP  163



>gb|EYU45936.1| hypothetical protein MIMGU_mgv1a018168mg [Erythranthe guttata]
Length=146

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 69/118 (58%), Gaps = 16/118 (14%)
 Frame = +2

Query  188  RHPIVETAMALFSLPTTF-PDTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegp  364
            R  + + A  LFSLPTT  P T  ++ KL SL      F  PPNLDFR+G    A     
Sbjct  44   RMSVTDAAKTLFSLPTTISPFT--WFHKLKSL------FIHPPNLDFREGSEGAAE----  91

Query  365  geKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPAKPEL  538
              KVKEAVVKS+DKSK T+E+SAK+AA+LA E VGK   KL      ++     +PEL
Sbjct  92   --KVKEAVVKSLDKSKSTVEESAKTAAELAEEAVGKTVNKLSGK-GEQHHTADHEPEL  146



>ref|XP_006465189.1| PREDICTED: uncharacterized protein LOC102622992 [Citrus sinensis]
Length=170

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 69/104 (66%), Gaps = 2/104 (2%)
 Frame = +2

Query  197  IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeamee--gpge  370
            ++++  AL++  +    +S+YW KL + + Q +A+F PPNLDFR         +    GE
Sbjct  63   MLKSTFALYTSASPLSTSSSYWGKLKAFLNQAQAYFFPPNLDFRGSNNEAGAIKNPSGGE  122

Query  371  KVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            KVKEAV KS ++SKET+E SA++AA++AG+T+ K  +K+K T S
Sbjct  123  KVKEAVAKSTERSKETVEQSAQTAAEIAGKTMQKMKEKIKKTFS  166



>gb|KDO43975.1| hypothetical protein CISIN_1g030839mg [Citrus sinensis]
Length=170

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 68/104 (65%), Gaps = 2/104 (2%)
 Frame = +2

Query  197  IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeamee--gpge  370
            ++++  AL++  +    +S+YW KL + + Q +A+F PPNLDFR         +    GE
Sbjct  63   MLKSTFALYTSASPLSTSSSYWGKLKAFLNQAQAYFFPPNLDFRGSNNEAGAIKNPSGGE  122

Query  371  KVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            KVK AV KS ++SKET+E SA++AA++AG+T+ K  +K+K T S
Sbjct  123  KVKAAVAKSTERSKETVEQSAQTAAEIAGKTMQKVKEKIKKTFS  166



>ref|XP_009346314.1| PREDICTED: uncharacterized protein LOC103938041 [Pyrus x bretschneideri]
Length=138

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = +2

Query  221  FSLPTTFP-DTSAYWTKLDSLIQQGRAFFSPPNLDFR------QgeapeameegpgeKVK  379
            FSL T+ P   + Y  K  +L  Q RA+F PPNLDFR      + E   +  +G G KV 
Sbjct  23   FSLYTSSPLRVATYLDKSKTLFNQIRAYFFPPNLDFRGSMRNIEVEPGSSGGDGAGGKVT  82

Query  380  EAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            E V KS  KSKET+EDSAKSAAK+ GETV K  +K+K + S
Sbjct  83   EVVGKSFGKSKETVEDSAKSAAKIVGETVQKTKEKVKRSFS  123



>ref|XP_009345350.1| PREDICTED: uncharacterized protein LOC103937164 isoform X1 [Pyrus 
x bretschneideri]
Length=179

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = +2

Query  221  FSLPTTFP-DTSAYWTKLDSLIQQGRAFFSPPNLDFR------QgeapeameegpgeKVK  379
            FSL T+ P   + Y  K  +L  Q RA+F PPNLDFR      + E   +  +G G KV 
Sbjct  64   FSLYTSSPLRVATYLDKSKTLFNQIRAYFFPPNLDFRGSMRNIEVEPGSSGGDGAGGKVT  123

Query  380  EAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            E V KS  KSKET+EDSAKSAAK+ GETV K  +K+K + S
Sbjct  124  EVVGKSFGKSKETVEDSAKSAAKIVGETVQKTKEKVKRSFS  164



>ref|XP_010098439.1| hypothetical protein L484_012154 [Morus notabilis]
 gb|EXB75030.1| hypothetical protein L484_012154 [Morus notabilis]
Length=163

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpg-----eKVKEAVVKSVDKSKETIE  424
            W +  SL+ Q  A+F PPNL+  +                 EKVKEAV +S++K KE +E
Sbjct  64   WDRFKSLLHQPHAYFFPPNLESNEANQDMMSGSTSSRGGAGEKVKEAVTRSMEKGKENVE  123

Query  425  DSAKSAAKLAGETVGKATQKLKNTLS  502
            DSAKSAAKLAGET+ K ++K+K +LS
Sbjct  124  DSAKSAAKLAGETMHKTSEKVKKSLS  149



>ref|XP_004303818.1| PREDICTED: uncharacterized protein LOC101314483 [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 66/118 (56%), Gaps = 12/118 (10%)
 Frame = +2

Query  221  FSLPTTFP-DTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeameeg-----------p  364
            FSL T+ P   S+Y  K  SL  Q    F PPNLDF+   + +A                
Sbjct  54   FSLFTSSPLKVSSYRDKFKSLTSQLHTHFFPPNLDFKVTSSSDAEARVDQPTSPRGGGGA  113

Query  365  geKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPAKPEL  538
            GEKVKEAV KS +KSKET+ED+AKSA K  GETV K  +K+K +LS K      +PEL
Sbjct  114  GEKVKEAVSKSFEKSKETVEDTAKSAGKAVGETVQKTKEKVKRSLSDKEGHQSHEPEL  171



>ref|XP_004507555.1| PREDICTED: uncharacterized protein LOC101512441 [Cicer arietinum]
Length=139

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 8/92 (9%)
 Frame = +2

Query  200  VETAMALFS---LPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQg--eapeameegp  364
            + +A +++S   LPT+    S YW  +  L+    A+F PPN+DFR+G      A E G 
Sbjct  48   LRSAYSIYSSIFLPTS---VSQYWNMVKGLVNHTYAYFFPPNIDFRRGDGAEVVADENGA  104

Query  365  geKVKEAVVKSVDKSKETIEDSAKSAAKLAGE  460
             EKVKEA+VKS+  SK T+ED+AKSAA +AGE
Sbjct  105  CEKVKEAIVKSIGTSKATLEDAAKSAADIAGE  136



>ref|XP_009336363.1| PREDICTED: uncharacterized protein LOC103928957 [Pyrus x bretschneideri]
Length=169

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFR-----QgeapeameegpgeKVKEAVVKSVDKSKETIE  424
            W K+ ++I   +  FSPPNLDFR       +  E+ ++G G KVKEA  KS + SK T+E
Sbjct  71   WDKVKTIINDMQLQFSPPNLDFRGGDEANAKGSESDDQGMGGKVKEAAQKSFETSKHTVE  130

Query  425  DSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPA  526
            +SAKSA +  G TV K  +K+K T++S +++ PA
Sbjct  131  ESAKSAGEAVGGTVHKTAEKVKETVASPHEETPA  164



>ref|XP_008342837.1| PREDICTED: uncharacterized protein LOC103405604 isoform X1 [Malus 
domestica]
Length=169

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 58/94 (62%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFR-----QgeapeameegpgeKVKEAVVKSVDKSKETIE  424
            W K+ ++I   +  FSPPNLDFR          E  ++G G KVKEA  KS + SK T+E
Sbjct  71   WDKVKTIINDMQLQFSPPNLDFRGGDEANAXGSEGDDQGMGGKVKEAAQKSFETSKHTVE  130

Query  425  DSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPA  526
            +SAKSA +  G TV K  +K+K T++S +++ PA
Sbjct  131  ESAKSAGEAVGGTVHKTAEKVKETVASPHEETPA  164



>ref|XP_008353762.1| PREDICTED: uncharacterized protein LOC103417346 isoform X1 [Malus 
domestica]
Length=169

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 58/94 (62%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFR-----QgeapeameegpgeKVKEAVVKSVDKSKETIE  424
            W K+ ++I   +  FSPPNLDFR          E  ++G G KVKEA  KS + SK T+E
Sbjct  71   WDKVKTIINDMQLQFSPPNLDFRGGDEANAXGSEGDDQGMGGKVKEAAQKSFETSKHTVE  130

Query  425  DSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPA  526
            +SAKSA +  G TV K  +K+K T++S +++ PA
Sbjct  131  ESAKSAGEAVGGTVHKTAEKVKETVASPHEETPA  164



>ref|XP_009345351.1| PREDICTED: uncharacterized protein LOC103937164 isoform X2 [Pyrus 
x bretschneideri]
Length=177

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +2

Query  221  FSLPTTFP-DTSAYWTKLDSLIQQGRAFFSPPNLDFR----QgeapeameegpgeKVKEA  385
            FSL T+ P   + Y  K  +L  Q RA+F PPNL+      + E   +  +G G KV E 
Sbjct  64   FSLYTSSPLRVATYLDKSKTLFNQIRAYFFPPNLEGSMRNIEVEPGSSGGDGAGGKVTEV  123

Query  386  VVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            V KS  KSKET+EDSAKSAAK+ GETV K  +K+K + S
Sbjct  124  VGKSFGKSKETVEDSAKSAAKIVGETVQKTKEKVKRSFS  162



>ref|XP_003630113.1| hypothetical protein MTR_8g091950 [Medicago truncatula]
 gb|AET04589.1| hypothetical protein MTR_8g091950 [Medicago truncatula]
Length=140

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 11/93 (12%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W K+ ++I   +  FSPPNLDFR         +   E VKEAV +S DKSKE++E +AKS
Sbjct  59   WEKIKTVIHDLQMQFSPPNLDFR--------GKVEHEGVKEAVERSFDKSKESVEGTAKS  110

Query  440  AAKLAGETVGKATQKLKNTLSSKYQDPPAKPEL  538
            AA+  GET+    +K+K +  S   D  +K EL
Sbjct  111  AAEFVGETIHNTKEKVKESTDS---DKDSKAEL  140



>ref|XP_011046602.1| PREDICTED: uncharacterized protein LOC105141166 [Populus euphratica]
Length=142

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 8/104 (8%)
 Frame = +2

Query  215  ALFSLPTTFPDTSA------YWTKLDSLIQQGRAFFSPPNLDFRQg--eapeameegpge  370
            +LF+     P T++      +W  + ++  Q +A   PPNLDFR+           G  E
Sbjct  27   SLFTFSANSPATTSARTRTSFWENVKTMFNQAQASIFPPNLDFRRSDEAVGHGGVTGTAE  86

Query  371  KVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            K+KE   KSV+K K T+E+SA++AA++A ETV K  +K+K T S
Sbjct  87   KMKEGAAKSVEKGKATVENSARTAARVASETVQKIKEKVKRTAS  130



>ref|XP_009762998.1| PREDICTED: uncharacterized protein LOC104214961 isoform X1 [Nicotiana 
sylvestris]
Length=149

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W K+ S + + +  FSPP+LDFR  +     + G  E+VKEA  KS  KSKET+E++AKS
Sbjct  62   WDKVKSFLNKVQLKFSPPDLDFR-SKEVANADGGAKERVKEAAQKSFGKSKETVEETAKS  120

Query  440  AAKLAGETVGKATQKLKNTLSSKY  511
            AAK+  +TV +  +K+K ++S+++
Sbjct  121  AAKVVEQTVHRTAEKMKGSMSARH  144



>ref|XP_007215042.1| hypothetical protein PRUPE_ppa012081mg [Prunus persica]
 gb|EMJ16241.1| hypothetical protein PRUPE_ppa012081mg [Prunus persica]
Length=184

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (59%), Gaps = 9/92 (10%)
 Frame = +2

Query  254  AYWTKLDSLIQQGRAFFSPPNLDFR---------QgeapeameegpgeKVKEAVVKSVDK  406
            +Y  K  +L+ QG+A+  PP+LDFR         +         G GEKV+E V  S  K
Sbjct  82   SYLEKAKALLNQGQAYIFPPSLDFRGSGNNIYVGEEAGSRGRGGGAGEKVREVVGNSFGK  141

Query  407  SKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            SKET++ SAKSAAKL GETV K  +K++ + S
Sbjct  142  SKETVDSSAKSAAKLVGETVQKTKEKVQRSFS  173



>ref|XP_008227973.1| PREDICTED: uncharacterized protein LOC103327421 isoform X1 [Prunus 
mume]
Length=182

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 56/98 (57%), Gaps = 8/98 (8%)
 Frame = +2

Query  254  AYWTKLDSLIQQGRAFFSPPNLDFR--------QgeapeameegpgeKVKEAVVKSVDKS  409
            +Y  K  +L+ QG+AF  PP+LDFR          EA      G GEKV+E V  S  KS
Sbjct  81   SYLEKAKALLNQGQAFIFPPSLDFRGSGNNIYFGEEAGSRGGGGAGEKVREVVGNSFGKS  140

Query  410  KETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDPP  523
             ET++ SAK+AAKL GETV K  +K+K + S +    P
Sbjct  141  TETVDSSAKTAAKLVGETVQKTKEKVKRSFSDRESREP  178



>ref|XP_002316437.2| hypothetical protein POPTR_0010s25920g [Populus trichocarpa]
 gb|EEF02608.2| hypothetical protein POPTR_0010s25920g [Populus trichocarpa]
Length=160

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +2

Query  251  SAYWTKLDSLIQQGRAFFSPPNLDFR---QgeapeameegpgeKVKEAVVKSVDKSKETI  421
            +++W  + ++  Q +A   PPNLDFR   +         G GEK+KE   KSV+K K T+
Sbjct  62   TSFWENVKTMFNQAQASIFPPNLDFRWSDEAVGHGGGTGGTGEKMKEGAAKSVEKGKATV  121

Query  422  EDSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPAKPEL  538
            ++SA++AA++A ET  K  +K+K TLS          EL
Sbjct  122  DNSARTAARVASETGQKIKEKVKRTLSDHKTGTETHDEL  160



>ref|XP_008342838.1| PREDICTED: uncharacterized protein LOC103405604 isoform X2 [Malus 
domestica]
Length=167

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNL---DFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDS  430
            W K+ ++I   +  FSPPNL   D       E  ++G G KVKEA  KS + SK T+E+S
Sbjct  71   WDKVKTIINDMQLQFSPPNLEGGDEANAXGSEGDDQGMGGKVKEAAQKSFETSKHTVEES  130

Query  431  AKSAAKLAGETVGKATQKLKNTLSSKYQDPPA  526
            AKSA +  G TV K  +K+K T++S +++ PA
Sbjct  131  AKSAGEAVGGTVHKTAEKVKETVASPHEETPA  162



>ref|XP_008353763.1| PREDICTED: uncharacterized protein LOC103417346 isoform X2 [Malus 
domestica]
Length=167

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNL---DFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDS  430
            W K+ ++I   +  FSPPNL   D       E  ++G G KVKEA  KS + SK T+E+S
Sbjct  71   WDKVKTIINDMQLQFSPPNLEGGDEANAXGSEGDDQGMGGKVKEAAQKSFETSKHTVEES  130

Query  431  AKSAAKLAGETVGKATQKLKNTLSSKYQDPPA  526
            AKSA +  G TV K  +K+K T++S +++ PA
Sbjct  131  AKSAGEAVGGTVHKTAEKVKETVASPHEETPA  162



>ref|XP_008356960.1| PREDICTED: uncharacterized protein LOC103420692 isoform X1 [Malus 
domestica]
Length=169

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFR-----QgeapeameegpgeKVKEAVVKSVDKSKETIE  424
            W K+ ++I   +  FSPPNLDFR       +  E  ++G  EKVKEA  KS   SK+T+E
Sbjct  71   WDKVKTIINDMQLQFSPPNLDFRGRDKANAKGSEGDDQGMREKVKEAAQKSFKTSKQTVE  130

Query  425  DSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPA  526
            + A SA +   ETV K  +K+K T++S +++ PA
Sbjct  131  EXAISAGEAVRETVHKTEEKVKETVASPHEETPA  164



>ref|XP_009149120.1| PREDICTED: uncharacterized protein LOC103872470 [Brassica rapa]
 emb|CDY35122.1| BnaA06g11320D [Brassica napus]
Length=149

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW+KL   + +G + F PPN+DFR     +A + G GEK+KEAV +S + SK+T+E++A+
Sbjct  55   YWSKLKETLGRGHSRFFPPNIDFR--GKDDAADMGTGEKMKEAVTRSFEHSKDTVEEAAR  112

Query  437  SAAKLAGETVGKATQKLKNTLSS  505
            SAA++A +      +K+K ++S 
Sbjct  113  SAAEVACDAAEAVKEKVKRSVSG  135



>ref|XP_002533617.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28761.1| conserved hypothetical protein [Ricinus communis]
Length=148

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 59/108 (55%), Gaps = 5/108 (5%)
 Frame = +2

Query  194  PIVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeK  373
            P+V+  M + +L T      + W KL ++I   +  F PPNLDFR     +   +G G +
Sbjct  44   PLVK--MVMDTLTTLKKSHKSSWDKLKAMIHGFQLQFFPPNLDFR---GQDQEVDGAGGR  98

Query  374  VKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQD  517
            +KEA  KS++  K T E+SAKSAAK+ GE V K   K+ N   S   D
Sbjct  99   MKEAAEKSLEVGKVTAEESAKSAAKVVGEAVHKVKDKISNDEESHQHD  146



>emb|CDX81787.1| BnaC08g38140D [Brassica napus]
Length=149

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW KL   + +G A F PPN+DFR     +    G G K+KEAV +S + SK+T+E++A+
Sbjct  59   YWAKLKESLGRGHARFFPPNIDFR---GKDDASMGAGGKMKEAVTRSFEHSKDTVEEAAR  115

Query  437  SAAKLAGETVGKATQKLKNTLS  502
            SAA++A +      +K+K + S
Sbjct  116  SAAEVACDATEAVKEKVKRSFS  137



>emb|CDY40029.1| BnaC05g12860D [Brassica napus]
Length=150

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW+K    + +G + F PPN+DFR     +A E G GEK+KEAV +S + SK+T+E++A+
Sbjct  55   YWSKFKETLGRGHSRFFPPNIDFR--GKDDAAEMGAGEKMKEAVTRSFEHSKDTVEEAAR  112

Query  437  SAAKLAGETVGKATQKLKNTLS  502
            SAA++A +      +K+K ++S
Sbjct  113  SAAEVACDAAEAVKEKMKRSVS  134



>ref|XP_006580306.1| PREDICTED: uncharacterized protein LOC102663813 [Glycine max]
 gb|KHN38228.1| hypothetical protein glysoja_003893 [Glycine soja]
Length=152

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W K+ ++I   +  FSPPNLDFR     E          KEAV K   KSKET+E+SA+ 
Sbjct  65   WEKIKTVIHDLQMQFSPPNLDFRGTGWVEYDGSKGT--FKEAVEKIFGKSKETVEESAEG  122

Query  440  AAKLAGETVGKATQKLKNTLSSKYQ  514
            AAK+  E + K T+K+K +  S+++
Sbjct  123  AAKVVEEAIHKTTEKVKESSHSEHE  147



>ref|XP_002513325.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48728.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 4/95 (4%)
 Frame = +2

Query  206  TAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeK-VKE  382
            TAM  F   T    T   W +  S++   +A+  PPNLDFR+       EEG   + VKE
Sbjct  43   TAMFSFRAATI---TITLWDRARSIVNTVQAYLYPPNLDFRRSNEGREKEEGEAGEKVKE  99

Query  383  AVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            AV +S+ KSK T+EDSAK AAK+A E + K  +K+
Sbjct  100  AVGESLRKSKATVEDSAKGAAKVATERLHKTKEKV  134



>emb|CDY54373.1| BnaAnng13040D [Brassica napus]
Length=152

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW KL   + +G A F PPN+DFR     +    G G K+KEAV +S + SK+++E++A+
Sbjct  59   YWAKLKESLGRGHARFFPPNIDFR---GKDDASMGAGGKMKEAVTRSFEHSKDSVEEAAR  115

Query  437  SAAKLAGETVGKATQKLKNTLS  502
            SAA++A +      +K+K + S
Sbjct  116  SAAEVACDAAEAVKEKVKRSFS  137



>ref|XP_008232474.1| PREDICTED: uncharacterized protein LOC103331610 isoform X1 [Prunus 
mume]
 ref|XP_008245578.1| PREDICTED: uncharacterized protein LOC103343715 isoform X1 [Prunus 
mume]
Length=161

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeap----eameegpgeKVKEAVVKSVDKSKETIED  427
            W K+ ++I   +  FSPPNLDFR  +           G G K+KEA  KS +  K T+E+
Sbjct  69   WDKVKTIISDMQLQFSPPNLDFRGADEADGKDSTGGLGMGAKLKEAAHKSFETGKHTVEE  128

Query  428  SAKSAAKLAGETVGKATQKLKNTLSSKYQDPPAK  529
            SAKSA +  GET+ K  +K+K  +S  +++P A+
Sbjct  129  SAKSAGEAVGETMHKTAEKVKEKVS--HEEPHAE  160



>gb|KFK43886.1| hypothetical protein AALP_AA1G186700 [Arabis alpina]
Length=150

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW KL   + +G + F PPN+DFR     +    G GEK+KEAV +S   SK+T+E++A+
Sbjct  61   YWAKLKETLGRGHSRFFPPNIDFR---GKDDPAMGTGEKMKEAVTRSFGHSKDTVEEAAR  117

Query  437  SAAKLAGETVGKATQKLKNTLSSK  508
            SAA++A +      +++K ++S +
Sbjct  118  SAAEVACDAAEAVKERVKRSVSGR  141



>ref|XP_002866636.1| hypothetical protein ARALYDRAFT_332703 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42895.1| hypothetical protein ARALYDRAFT_332703 [Arabidopsis lyrata subsp. 
lyrata]
Length=149

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 64/118 (54%), Gaps = 9/118 (8%)
 Frame = +2

Query  149  ASKADGMEA---VRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPN  316
            A  ADG E+    +K  +P IV+T   +F     FP +S  W  +   +Q+ +    PPN
Sbjct  27   AVSADGAESDGVAKKEENPSIVKTICGIFG--KKFPPSS--WELIQGAMQKIQMKLYPPN  82

Query  317  LDFR-QgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            LDFR   +     EE   EKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  83   LDFRSNSDKNNREEEDKAEKVKEAATRSLEVSKEAIEESAKLAGDVVGEVVQKTAEKV  140



>ref|XP_009762999.1| PREDICTED: uncharacterized protein LOC104214961 isoform X2 [Nicotiana 
sylvestris]
Length=147

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W K+ S + + +  FSPP+L+ ++    +   +    +VKEA  KS  KSKET+E++AKS
Sbjct  62   WDKVKSFLNKVQLKFSPPDLESKEVANADGGAKE---RVKEAAQKSFGKSKETVEETAKS  118

Query  440  AAKLAGETVGKATQKLKNTLSSKY  511
            AAK+  +TV +  +K+K ++S+++
Sbjct  119  AAKVVEQTVHRTAEKMKGSMSARH  142



>gb|KDP25056.1| hypothetical protein JCGZ_22591 [Jatropha curcas]
Length=125

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +2

Query  224  SLPTTFPDTSAYWTKLDSLIQQGRAFFSP-PNLDFRQgeapeameegpgeKVKEAVVKSV  400
            +L  TF  ++ YW K  ++I Q +A   P PNLDFR        + G GEKVKEAV +S+
Sbjct  36   TLRRTFSFSATYWDKAKTMISQAQAHLFPSPNLDFR----GSETDRGAGEKVKEAVAESL  91

Query  401  DKSKETIEDSAKSAAKL  451
             K+K T+EDSAKSAA +
Sbjct  92   GKTKATVEDSAKSAANI  108



>ref|XP_008227974.1| PREDICTED: uncharacterized protein LOC103327421 isoform X2 [Prunus 
mume]
Length=180

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +2

Query  254  AYWTKLDSLIQQGRAFFSPPNLD------FRQgeapeameegpgeKVKEAVVKSVDKSKE  415
            +Y  K  +L+ QG+AF  PP+L+      +   EA      G GEKV+E V  S  KS E
Sbjct  81   SYLEKAKALLNQGQAFIFPPSLEGSGNNIYFGEEAGSRGGGGAGEKVREVVGNSFGKSTE  140

Query  416  TIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDPP  523
            T++ SAK+AAKL GETV K  +K+K + S +    P
Sbjct  141  TVDSSAKTAAKLVGETVQKTKEKVKRSFSDRESREP  176



>ref|XP_007048138.1| Uncharacterized protein TCM_001261 [Theobroma cacao]
 gb|EOX92295.1| Uncharacterized protein TCM_001261 [Theobroma cacao]
Length=165

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeK-VKEAVVKSVDKSKETIEDSAK  436
            W K+ ++I   +  F+PPNLDFR      A       + +KEAV KS+  SK T+E++AK
Sbjct  75   WEKIKTIIHDFQLQFTPPNLDFRGTGTATASGSDSVGENMKEAVKKSIGTSKVTVEETAK  134

Query  437  SAAKLAGETVGKATQKLKNTLSSK  508
            SAA++A   V K  +K+K  +S K
Sbjct  135  SAAEIAEGAVHKTKEKVKEIVSDK  158



>ref|XP_006427984.1| hypothetical protein CICLE_v10026701mg [Citrus clementina]
 ref|XP_006464490.1| PREDICTED: uncharacterized protein LOC102620846 [Citrus sinensis]
 gb|ESR41224.1| hypothetical protein CICLE_v10026701mg [Citrus clementina]
 gb|KDO45859.1| hypothetical protein CISIN_1g036019mg [Citrus sinensis]
Length=151

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 60/103 (58%), Gaps = 7/103 (7%)
 Frame = +2

Query  203  ETAMALFSLPTTFPDTSAY---WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeK  373
            E+++A F + T     +++   W K+ S+I++ +  FSPPNLDF+         +   EK
Sbjct  43   ESSLAQFVVETISRLRASHKSSWEKVKSIIREMQLRFSPPNLDFKGPNEANVGAKQEAEK  102

Query  374  VKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            VKEA  K+   SK  +E+SAKSAA    E V K  +K+K+++S
Sbjct  103  VKEAAKKTAGVSKMAVEESAKSAA----EAVHKTAEKVKDSVS  141



>ref|XP_004504014.1| PREDICTED: uncharacterized protein LOC101515131 [Cicer arietinum]
Length=144

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W K+ ++I   +  +SPPNLDFR       +E+G  E VKEAV KS DKSKE++E +A+S
Sbjct  65   WEKIKTVIHDLQMQYSPPNLDFR------GVEKGENEGVKEAVGKSFDKSKESVEGTARS  118

Query  440  AAKLAGETV  466
            AA+  GE +
Sbjct  119  AAEFVGEAI  127



>ref|XP_006416770.1| hypothetical protein EUTSA_v10008985mg [Eutrema salsugineum]
 gb|ESQ35123.1| hypothetical protein EUTSA_v10008985mg [Eutrema salsugineum]
Length=156

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +2

Query  251  SAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDS  430
            ++YW KL   + +G +   PPN+DFR     +    G GEK+KEAV +S + SK+T+E +
Sbjct  60   NSYWAKLKETLGRGHSRLFPPNIDFR---GKDDASMGAGEKMKEAVTRSFENSKDTVEGA  116

Query  431  AKSAAKLAGETVGKATQKLKNTLSSK  508
            A+SAA++A +      +K+K ++S +
Sbjct  117  ARSAAEVACDAAESVKEKVKRSVSGR  142



>ref|XP_009626113.1| PREDICTED: uncharacterized protein LOC104116868 [Nicotiana tomentosiformis]
Length=164

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W    S I Q +  F PPN+DFR          G GE++KEA  KS +KSKET+E++AKS
Sbjct  65   WDMAKSYINQFQLKFFPPNVDFR-SRDDGKANGGAGERMKEATQKSFEKSKETVEETAKS  123

Query  440  AAKLAGETVGKATQKLKNTLS  502
            AA++  + V K  +K+K+T+S
Sbjct  124  AAEMMEQKVQKTAEKVKDTVS  144



>ref|NP_201287.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97294.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97957.1| uncharacterized protein AT5G64820 [Arabidopsis thaliana]
Length=145

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = +2

Query  158  ADGME---AVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            ADG E   A +K  +P IV+    +F     FP +S  W  +   +Q+ +    PPNLDF
Sbjct  26   ADGAESDSAAKKEENPSIVKIISGIFG--NKFPPSS--WELIQGAMQKIQMKLYPPNLDF  81

Query  326  R-QgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            R   +     EE   EKV+EA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  82   RSNSDKSNIEEEDKAEKVREAATRSLEVSKEAIEESAKLAGDVVGEVVQKTAEKV  136



>ref|XP_010027342.1| PREDICTED: uncharacterized protein LOC104417831 [Eucalyptus grandis]
Length=119

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = +2

Query  197  IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFR-QgeapeameegpgeK  373
            I +  M   S P      S  W K+ +++   +  F PP+LDFR + +A    +   G K
Sbjct  7    IAKIVMGTVSRPKESHKIS--WIKIKTIMNNMQLHFFPPDLDFRSRDDAIVDNQNNAGSK  64

Query  374  VKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPAKPEL  538
            V+ AV KS   SK T+E++AKS A++ G+ V K  +K K ++S + +   +K EL
Sbjct  65   VEYAVKKSFGTSKVTVEETAKSTAEVVGKAVSKTAEKAKESMSDEDEGEESKSEL  119



>ref|XP_008356962.1| PREDICTED: uncharacterized protein LOC103420692 isoform X2 [Malus 
domestica]
Length=167

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeame---egpgeKVKEAVVKSVDKSKETIEDS  430
            W K+ ++I   +  FSPPNL+ R     +  E   +G  EKVKEA  KS   SK+T+E+ 
Sbjct  71   WDKVKTIINDMQLQFSPPNLEGRDKANAKGSEGDDQGMREKVKEAAQKSFKTSKQTVEEX  130

Query  431  AKSAAKLAGETVGKATQKLKNTLSSKYQDPPA  526
            A SA +   ETV K  +K+K T++S +++ PA
Sbjct  131  AISAGEAVRETVHKTEEKVKETVASPHEETPA  162



>ref|XP_010027337.1| PREDICTED: uncharacterized protein LOC104417824 [Eucalyptus grandis]
Length=157

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFR-QgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            W K+ +++   +  F PP+LDFR + +A    +   G KV+  V KS   SK T+E++AK
Sbjct  64   WIKIKTIMNNVQLHFFPPDLDFRSRDDAIVNNQNNAGSKVEHVVKKSFGTSKVTVEETAK  123

Query  437  SAAKLAGETVGKATQKLKNTLSSKYQDPPAKPEL  538
            S A++ G+ V K  +K+K ++S + +   +K EL
Sbjct  124  STAEVVGQAVRKTAEKVKESMSDEDEGEESKSEL  157



>emb|CBI21520.3| unnamed protein product [Vitis vinifera]
Length=109

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 3/88 (3%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegp---geKVKEAVVKSVDKSKETIEDS  430
            W K  S + Q +  FSPPNLDFR  +  ++        G ++KEA  +S   +   +E+S
Sbjct  17   WNKAKSFLNQLQLHFSPPNLDFRSRDIAQSRMGEGDGPGGRMKEAAEESTKSAVAAVEES  76

Query  431  AKSAAKLAGETVGKATQKLKNTLSSKYQ  514
            AKSAAK+  E V    +K+K TLSS  +
Sbjct  77   AKSAAKVVEEAVQMTAEKVKETLSSNQE  104



>ref|XP_006394106.1| hypothetical protein EUTSA_v10005069mg [Eutrema salsugineum]
 gb|ESQ31392.1| hypothetical protein EUTSA_v10005069mg [Eutrema salsugineum]
Length=152

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = +2

Query  158  ADGME---AVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            ADG E     +K  +P +V+    +F     FP +S  W  +  ++Q+ +    PPNLDF
Sbjct  31   ADGAEDDGIAKKEENPSLVKIICGIFG--KRFPPSS--WELIQGVMQKIQMKLYPPNLDF  86

Query  326  RQgeapeameegpg---eKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            R        EE      EKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  87   RSNSDKSNSEEEGEDRGEKVKEAATRSLEVSKEAIEESAKLAGDVVGEVVHKTAEKV  143



>ref|XP_009598905.1| PREDICTED: uncharacterized protein LOC104094647 [Nicotiana tomentosiformis]
Length=140

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W K+ S I Q +  F P +LDF   +     + G  E++KEA  KS  KSKET+E++AKS
Sbjct  53   WDKVKSYINQLQLKFFPADLDF-GSKEVATADGGAKERMKEAAQKSFGKSKETVEETAKS  111

Query  440  AAKLAGETVGKATQKLKNTLSSKY  511
            AAK+  +TV K  +K++ + SS +
Sbjct  112  AAKVVEQTVHKTVEKVRGSASSGH  135



>ref|XP_010462684.1| PREDICTED: uncharacterized protein LOC104743277 [Camelina sativa]
Length=148

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 65/121 (54%), Gaps = 9/121 (7%)
 Frame = +2

Query  158  ADGME----AVRKRRHPIVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            ADG+E    A ++ +  +++T    F     FP +S  W  +   +Q+ +    PPNLDF
Sbjct  28   ADGVESDGAATKEEKPSLIKTICGTFG--KKFPPSS--WELIQGAMQKIQMKLYPPNLDF  83

Query  326  R-QgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLS  502
            R   +  +  EE  GEKVKEA  ++++ SKE IE+SAK A  + GE   K  +K+    S
Sbjct  84   RSNSDKSKREEEDKGEKVKEAATRTLEVSKEAIEESAKIAGDVVGEVAQKTAEKVTKQTS  143

Query  503  S  505
            S
Sbjct  144  S  144



>ref|XP_008440136.1| PREDICTED: uncharacterized protein LOC103484692 [Cucumis melo]
Length=144

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +2

Query  266  KLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAA  445
            K+ S+I Q +  F PPNLDFR   + +  + G  ++VKEAV KS + SK+ +E+SAKSAA
Sbjct  60   KIRSIIHQMQFQFFPPNLDFR---SSDETKGGVVDEVKEAVEKSFEVSKDAVEESAKSAA  116

Query  446  KLAGETVGKATQKL  487
            K+  E V K  + L
Sbjct  117  KVMEEAVDKVKENL  130



>ref|XP_002275864.2| PREDICTED: uncharacterized protein LOC100261058 [Vitis vinifera]
Length=151

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 3/88 (3%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpge---KVKEAVVKSVDKSKETIEDS  430
            W K  S + Q +  FSPPNLDFR  +  ++          ++KEA  +S   +   +E+S
Sbjct  59   WNKAKSFLNQLQLHFSPPNLDFRSRDIAQSRMGEGDGPGGRMKEAAEESTKSAVAAVEES  118

Query  431  AKSAAKLAGETVGKATQKLKNTLSSKYQ  514
            AKSAAK+  E V    +K+K TLSS  +
Sbjct  119  AKSAAKVVEEAVQMTAEKVKETLSSNQE  146



>gb|KEH28532.1| transmembrane protein, putative [Medicago truncatula]
Length=156

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  200  VETAMALFSLPTTFPDT-SAYWTKLDSLIQQGRAFFSPPNLDFR--Qgeapeameegpge  370
            + +A +++S  + FP +   YW  + +++     +F PPN+DFR  +         G G+
Sbjct  53   LRSAYSMYS--SVFPTSIGQYWHMVKAIVNHTYTYFFPPNIDFRRGEEGEAVVDNNGAGD  110

Query  371  KVKEAVVKSVDKSKETIEDSAKSAA  445
            KVKEA+ KS+  SK T+ED+AKSAA
Sbjct  111  KVKEALAKSLGTSKATLEDAAKSAA  135



>ref|XP_010444436.1| PREDICTED: uncharacterized protein LOC104727119 [Camelina sativa]
Length=145

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 63/112 (56%), Gaps = 8/112 (7%)
 Frame = +2

Query  158  ADGMEAVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFR-Q  331
            +DG  A RK  +P +++    +F     FP +S  W  +   +Q+ +    PPNLDFR  
Sbjct  31   SDG--AARKEENPSLIKIICGIFG--KKFPPSS--WELVQGAMQKIQMKLYPPNLDFRSN  84

Query  332  geapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
             +  +  +E  GEKVKEA  ++++ SKE IE+SAK A  + GE V K  +K+
Sbjct  85   SDKSKREDEDKGEKVKEAASRTLEVSKEAIEESAKIAGDVVGEVVQKTAEKV  136



>gb|KGN48428.1| hypothetical protein Csa_6G487000 [Cucumis sativus]
Length=144

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +2

Query  266  KLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAA  445
            K+ SLI Q +  F PPNLDFR   + +  + G  +++KEAV KS   SK+ +E+SAKSAA
Sbjct  60   KIKSLIHQMQLQFFPPNLDFR---SSDETKGGVVDEMKEAVEKSFGASKDAVEESAKSAA  116

Query  446  KLAGETVGKATQKL  487
            K+  E V K  + L
Sbjct  117  KVMEEAVDKVKENL  130



>gb|KEH31328.1| hypothetical protein MTR_4g094508 [Medicago truncatula]
Length=149

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +2

Query  200  VETAMALFSLPTTFP-DTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKV  376
            +  A +++S  + FP +   YW  + +++    A+F PPNL+  +         G G+KV
Sbjct  50   LRNAYSMYS--SVFPTNIGQYWHMVKAIVNHTYAYFFPPNLERGEEGEAVVDNNGAGDKV  107

Query  377  KEAVVKSVDKSKETIEDSAKSAA  445
            KEA+ KS+  SK T+ED+AKSAA
Sbjct  108  KEALAKSLGTSKATLEDAAKSAA  130



>ref|XP_009779351.1| PREDICTED: uncharacterized protein LOC104228571 [Nicotiana sylvestris]
Length=163

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W  + S I Q +  + PPN+DFR          G GE++KEA  KS +KSKET+E++AK 
Sbjct  64   WDMVKSYINQLQLKYFPPNVDFR-SRDDGKANGGAGERMKEATQKSFEKSKETVEETAKL  122

Query  440  AAKLAGETVGKATQKLKNTLSSKYQ  514
            AA++  + V K  +K+K+T S  ++
Sbjct  123  AAEMMEQKVQKTAEKVKDTESGGHK  147



>ref|XP_010027330.1| PREDICTED: uncharacterized protein LOC104417818 [Eucalyptus grandis]
Length=157

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFR-QgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            W K+ +++   +  F PP+LDF  + +A    +   G KV+  V KS   SK T+E++AK
Sbjct  64   WIKIKTIMNNVQLHFFPPDLDFSSRDDAIVDNQNNAGSKVEHVVKKSFGTSKVTVEETAK  123

Query  437  SAAKLAGETVGKATQKLKNTLSSKYQDPPAKPEL  538
            S A++ G+ V K  +K+K ++S + +   +K EL
Sbjct  124  STAEVVGQAVRKTAEKVKESMSDEDEGEESKSEL  157



>ref|XP_010484277.1| PREDICTED: uncharacterized protein LOC104762647 [Camelina sativa]
Length=148

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 9/115 (8%)
 Frame = +2

Query  158  ADGME---AVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            ADG E   A  K  +P +++    +F     FP +S  W  +   +Q+ +    PPNLDF
Sbjct  29   ADGEESDGAATKEENPSLIKIICGIFG--KKFPPSS--WELVQGAMQKIQMKLYPPNLDF  84

Query  326  R-QgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            R   +  +  +E  GEKVKEA  ++++ SKE IE+SAK A  + GE V K  +K+
Sbjct  85   RSNSDKSKREDEDKGEKVKEAATRTLEVSKEAIEESAKIAGDVVGEVVQKTAEKV  139



>emb|CDY43565.1| BnaC02g16620D [Brassica napus]
Length=148

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = +2

Query  179  RKRRHP--IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFR----Qgea  340
            RK  +P  +++    +F     FP +S  W  + S +Q+ +    PPNLDFR    +   
Sbjct  35   RKEENPSSLLKIICGIFG--KKFPPSS--WELIQSAMQKIQMKLYPPNLDFRSNSDKNNK  90

Query  341  peameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
                 E  GEKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  91   DREGGEDKGEKVKEAATRSLEVSKEAIEESAKLAGGVVGEVVHKTAEKV  139



>gb|KFK28171.1| hypothetical protein AALP_AA8G481600 [Arabis alpina]
Length=151

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = +2

Query  158  ADGME---AVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            ADG E     +K+  P +++    +F     FP +S  W  +   +Q+ +    PPNLDF
Sbjct  30   ADGAENDGVAKKKEDPSLLKIISGIFG--KKFPPSS--WELIQGAMQKIQMKLYPPNLDF  85

Query  326  RQgeapeame---egpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            R        E   E   EKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  86   RSNSDKSNSEDKGEDKAEKVKEAATRSLEVSKEAIEESAKLAGGVVGEVVHKTAEKV  142



>ref|XP_009779353.1| PREDICTED: uncharacterized protein LOC104228573 [Nicotiana sylvestris]
Length=116

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W  + S I Q +  F PPN+D R          G GE++KEA  KS +KSKET+E++AK 
Sbjct  17   WDMVKSYISQLQLKFFPPNVDLR-SRDDGKANGGAGERMKEATQKSFEKSKETVEETAKL  75

Query  440  AAKLAGETVGKATQKLKNTLSSKYQ  514
            AA++  + V K  +K+K+T S  ++
Sbjct  76   AAEMMEQKVQKTAEKVKDTESGGHK  100



>ref|XP_011021945.1| PREDICTED: uncharacterized protein LOC105123878 [Populus euphratica]
Length=156

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpg--eKVKEAVVKSVDKSKETIEDSA  433
            W K+  +I+  +  F PPNLDFR  +  E+   G G  EK+K+ V K +  SK+T E SA
Sbjct  62   WDKVKIIIRDLQIQFYPPNLDFRSTDQEESTRSGDGGGEKMKKVVEKCIRTSKKTAETSA  121

Query  434  KSAAKLAGETVGKATQKLKNTLSS  505
            +SAA++  E + KA +K+KN LS+
Sbjct  122  ESAAEVMVEAMHKAAEKVKNRLSN  145



>ref|XP_008460283.1| PREDICTED: uncharacterized protein LOC103499155 [Cucumis melo]
Length=126

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +2

Query  203  ETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFR--QgeapeameegpgeKV  376
            E A  ++S  +T    ++YW ++  ++ +  ++  PP +DFR  +    ++        V
Sbjct  32   EAANNVYSETSTPNPPNSYWEEVRKVVNKAYSYLFPPKIDFRPGKAVEDDSGLSVEDGNV  91

Query  377  KEAVVKSVDKSKETIEDSAKSAAK  448
            KEAV KS +K+KE +EDSAK+AA+
Sbjct  92   KEAVTKSFEKTKEMVEDSAKAAAQ  115



>ref|XP_009130477.1| PREDICTED: uncharacterized protein LOC103855261 [Brassica rapa]
Length=175

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = +2

Query  179  RKRRHP--IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFR----Qgea  340
            RK  +P  +++    +F     FP +S  W  + S +Q+ +    PPNLDFR    +   
Sbjct  62   RKEENPSSLLKIICGIFG--KKFPPSS--WELIQSAMQKIQMKLYPPNLDFRSNSDKNNK  117

Query  341  peameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
                 E  GEKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  118  DREGGEDKGEKVKEAATRSLEVSKEAIEESAKLAGGVVGEVVHKTAEKV  166



>ref|XP_008811575.1| PREDICTED: uncharacterized protein LOC103722703 [Phoenix dactylifera]
Length=168

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 58/110 (53%), Gaps = 13/110 (12%)
 Frame = +2

Query  200  VETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVK  379
             E A+ + +L + + D    W KL  +       F PP   +R+ ++           VK
Sbjct  71   AERAIGMTALTSRW-DAIRTWAKLAWM------NFRPPESWYRRRDSSAGEV------VK  117

Query  380  EAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKLKNTLSSKYQDPPAK  529
            EA  +S +KSKET+  +A+SAAK+AGE + K  +K+K T+S    DP A+
Sbjct  118  EAATRSFEKSKETVAHTAESAAKVAGEAMHKTKEKVKRTVSRPEGDPDAE  167



>emb|CDY31300.1| BnaA02g34410D [Brassica napus]
Length=199

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = +2

Query  179  RKRRHP--IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFR----Qgea  340
            RK  +P  +++    +F     FP +S  W  + S +Q+ +    PPNLDFR    +   
Sbjct  86   RKEENPSSLLKIICGIFG--KKFPPSS--WELIQSAMQKIQMKLYPPNLDFRSNSDKNNK  141

Query  341  peameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
                 E  GEKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  142  DREGGEDKGEKVKEAATRSLEVSKEAIEESAKLAGGVVGEVVHKTAEKV  190



>emb|CDY14515.1| BnaC03g49440D [Brassica napus]
Length=142

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 59/113 (52%), Gaps = 10/113 (9%)
 Frame = +2

Query  161  DGMEAVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQge  337
            DG+   +K  +P +V+    +F     FP +S  W  +   +Q+ +    PPN+DFR   
Sbjct  27   DGV--AKKEENPSLVKIICGIFG--KKFPPSS--WELIQGAMQKIQTKLYPPNIDFRSNS  80

Query  338  apeameeg---pgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
                 ++      EKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  81   DKNTKDKEGEDKVEKVKEAATRSLELSKEAIEESAKLAGGVVGEAVHKTAEKV  133



>ref|XP_006282168.1| hypothetical protein CARUB_v10028427mg [Capsella rubella]
 gb|EOA15066.1| hypothetical protein CARUB_v10028427mg [Capsella rubella]
Length=143

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = +2

Query  158  ADGME----AVRKRRHPIVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            ADG +    A ++ +  +++    +F     FP +S  W  +   + + +    PPNLDF
Sbjct  24   ADGEDSDGAATKEEKPSLIKIICGIFG--KKFPPSS--WELIQGAMHKIQMKLYPPNLDF  79

Query  326  R-QgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            R   +  +  EE  GEKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  80   RSNSDKNKREEEDKGEKVKEAATRSLEVSKEAIEESAKLAGDVVGEVVHKTAEKV  134



>ref|XP_008232483.1| PREDICTED: uncharacterized protein LOC103331610 isoform X2 [Prunus 
mume]
 ref|XP_008245579.1| PREDICTED: uncharacterized protein LOC103343715 isoform X2 [Prunus 
mume]
Length=159

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 4/92 (4%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameeg--pgeKVKEAVVKSVDKSKETIEDSA  433
            W K+ ++I   +  FSPPNL+       +    G   G K+KEA  KS +  K T+E+SA
Sbjct  69   WDKVKTIISDMQLQFSPPNLEGADEADGKDSTGGLGMGAKLKEAAHKSFETGKHTVEESA  128

Query  434  KSAAKLAGETVGKATQKLKNTLSSKYQDPPAK  529
            KSA +  GET+ K  +K+K  +S  +++P A+
Sbjct  129  KSAGEAVGETMHKTAEKVKEKVS--HEEPHAE  158



>ref|XP_009150561.1| PREDICTED: uncharacterized protein LOC103873909 [Brassica rapa]
Length=146

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (53%), Gaps = 10/117 (9%)
 Frame = +2

Query  149  ASKADGMEAVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            +S  DG+   +K  +P +V+    +F     FP +S  W  +   +++ +    PPNLDF
Sbjct  27   SSDDDGV--AKKEENPSLVKIICGIFG--KKFPPSS--WELIQGAMKKIQTKLYPPNLDF  80

Query  326  RQgeapeameegpg---eKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            R   A    ++      EKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  81   RSNSANNNKDKEGEDKGEKVKEAATRSLEVSKEAIEESAKLAGGVIGEAVHKTAEKV  137



>ref|XP_004144421.1| PREDICTED: uncharacterized protein LOC101222094 [Cucumis sativus]
 ref|XP_004160989.1| PREDICTED: uncharacterized LOC101222094 [Cucumis sativus]
 gb|KGN58430.1| hypothetical protein Csa_3G642710 [Cucumis sativus]
Length=127

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = +2

Query  203  ETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDFRQgeape----ameegpge  370
            E A  ++S  +T    ++YW ++  ++ +   +  PP +DFR G+A E       +    
Sbjct  31   EAANNIYSETSTPNPPNSYWEEVRKVVNKAYTYLFPPKIDFRPGKAVEDDSGVSVKNGNV  90

Query  371  KVKEAVVKSVDKSKETIEDSAKSAAK  448
             VKEAV KS +K+KE +EDSAK+AA+
Sbjct  91   NVKEAVTKSFEKTKEMVEDSAKAAAQ  116



>ref|XP_009117739.1| PREDICTED: uncharacterized protein LOC103842825 [Brassica rapa]
Length=150

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW KL   + +G A F PPN++ +   +  A       K+KEAV +S + SK+++E++A+
Sbjct  59   YWGKLKESLGRGHARFFPPNIEGKDDPSMGAGG-----KMKEAVTRSFEHSKDSVEEAAR  113

Query  437  SAAKLAGETVGKATQKLKNTLS  502
            SAA++A +      +K+K + S
Sbjct  114  SAAEVACDAAEAVKEKVKRSFS  135



>ref|XP_003531775.1| PREDICTED: uncharacterized protein LOC100820626 isoform X1 [Glycine 
max]
Length=136

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  269  LDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKSAAK  448
            L +L+    A F PPN+DFR+ E  +  E G GEKV+EA  KS+  SK T+ED+AKSAA+
Sbjct  57   LKNLVTHTYARFFPPNIDFRREEEGQVKENGAGEKVREAFAKSLGNSKATLEDAAKSAAE  116



>ref|XP_002892924.1| hypothetical protein ARALYDRAFT_334956 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69183.1| hypothetical protein ARALYDRAFT_334956 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW KL   + +G++ F PPN  F           G GE +KEA  +S + SK T+E++A+
Sbjct  61   YWAKLRETLDRGQSHFFPPNTYF---TGKNDAPMGAGENMKEAATRSFENSKATVEEAAR  117

Query  437  SAAKLAGETVGKATQKLK  490
            SAA++  +TV  A +K+K
Sbjct  118  SAAEVVSDTVETAKEKVK  135



>emb|CDY08846.1| BnaA06g23780D [Brassica napus]
Length=147

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 62/117 (53%), Gaps = 10/117 (9%)
 Frame = +2

Query  149  ASKADGMEAVRKRRHP-IVETAMALFSLPTTFPDTSAYWTKLDSLIQQGRAFFSPPNLDF  325
            +S  DG+   +K  +P +V+    +F     FP +S  W  +   +Q+ +    PPNL F
Sbjct  28   SSDDDGV--AKKEENPSLVKIICGIFG--KKFPPSS--WELIQGAMQKIQTKLYPPNLHF  81

Query  326  RQgeapeameeg---pgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQKL  487
            R   A    ++     GEKVKEA  +S++ SKE IE+SAK A  + GE V K  +K+
Sbjct  82   RSNSANNNKDKEGEDKGEKVKEAATRSLEVSKEAIEESAKLAGGVIGEAVHKTAEKV  138



>ref|XP_010498014.1| PREDICTED: uncharacterized protein LOC104775787 [Camelina sativa]
Length=153

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW KL   + +G++ F PPN  F           G GE +KEA  +S + SK T++++A+
Sbjct  62   YWAKLRETLDRGQSHFFPPNTYF---TGKNDAPMGAGENMKEAATRSFENSKATVDEAAR  118

Query  437  SAAKLAGETVGKATQKLKNTLSSKYQDPPAKPE  535
            SAA++  ++ G   +K+K + S      P   E
Sbjct  119  SAAEVVSDSAGAVKEKVKRSFSGGATPHPTGSE  151



>ref|XP_007159763.1| hypothetical protein PHAVU_002G265200g [Phaseolus vulgaris]
 gb|ESW31757.1| hypothetical protein PHAVU_002G265200g [Phaseolus vulgaris]
Length=147

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = +2

Query  260  WTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAKS  439
            W K+ + I   +  FSPPNLDFR G       +G    +K AV KS+++SKET E+SA++
Sbjct  58   WNKIKTAINDLQMHFSPPNLDFRSGGEVREDMKGT---LKAAVQKSLERSKETFEESAET  114

Query  440  AAKLAGETVGKATQ  481
            AAK     + K  +
Sbjct  115  AAKAVETKIHKTAE  128



>emb|CDY46825.1| BnaC02g43330D [Brassica napus]
Length=135

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +2

Query  308  PPNLDFRQgeapeam--eegpgeKVKEAVVKSVDKSKETIEDSAKSAAKLAGETVGKATQ  481
            PPNLDFR           E  GEKVKEA  +S++ SKE IEDSAK A  + GE V K  +
Sbjct  65   PPNLDFRSNSDKNNKDGGEEKGEKVKEAATRSLEVSKEAIEDSAKLAGGVVGEIVHKTAE  124

Query  482  KL  487
            K+
Sbjct  125  KV  126



>ref|XP_010531935.1| PREDICTED: uncharacterized protein LOC104808101 isoform X2 [Tarenaya 
hassleriana]
Length=186

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDF--RQgeapeameegpgeKVKEAVVKSVDKSKETIEDS  430
            YW KL   + +G ++F PP +DF  +            GEKVKEA  KS +KSKET++++
Sbjct  105  YWAKLAETLGRGHSYFFPPKIDFSGKGEATGGGGSSTAGEKVKEAAAKSFEKSKETVDEA  164

Query  431  AKSAAKLAGETVGK  472
            A+S A    ETV K
Sbjct  165  ARSTA----ETVKK  174



>ref|NP_564008.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF99848.1|AC051629_15 Unknown protein [Arabidopsis thaliana]
 gb|AAG40355.1|AF325003_1 At1g16880 [Arabidopsis thaliana]
 gb|AAL87356.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45022.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98544.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29509.1| uncharacterized protein AT1G16850 [Arabidopsis thaliana]
Length=152

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = +2

Query  257  YWTKLDSLIQQGRAFFSPPNLDFRQgeapeameegpgeKVKEAVVKSVDKSKETIEDSAK  436
            YW K+   + +G++ F PPN  F           G GE +KEA  +S + SK T+E++A+
Sbjct  61   YWAKVRETLDRGQSHFFPPNTYF---TGKNDAPMGAGENMKEAATRSFEHSKATVEEAAR  117

Query  437  SAAKLAGETVGKATQKLKNTLSSKYQDPPAKPE  535
            SAA++  +T     +K+K ++S     P    E
Sbjct  118  SAAEVVSDTAEAVKEKVKRSVSGGVTQPSEGSE  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1042394327856