BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c3305_g1_i1 len=2416 path=[2394:0-551 2946:552-2415]

Length=2416
                                                                      Score     E

ref|XP_006354198.1|  PREDICTED: putative E3 ubiquitin-protein lig...    739   0.0      
ref|XP_009761167.1|  PREDICTED: putative E3 ubiquitin-protein lig...    724   0.0      
ref|XP_009626388.1|  PREDICTED: uncharacterized protein LOC104117...    706   0.0      
ref|XP_009626396.1|  PREDICTED: uncharacterized protein LOC104117...    704   0.0      
emb|CDP11068.1|  unnamed protein product                                665   0.0      
ref|XP_011080314.1|  PREDICTED: putative E3 ubiquitin-protein lig...    615   0.0      
emb|CBI16457.3|  unnamed protein product                                612   0.0      
ref|XP_002283306.2|  PREDICTED: putative E3 ubiquitin-protein lig...    606   0.0      Vitis vinifera
emb|CAN71223.1|  hypothetical protein VITISV_011730                     607   0.0      Vitis vinifera
ref|XP_010651317.1|  PREDICTED: putative E3 ubiquitin-protein lig...    607   0.0      
ref|XP_006445916.1|  hypothetical protein CICLE_v10018144mg             597   0.0      
gb|KDO56433.1|  hypothetical protein CISIN_1g041480mg                   595   0.0      
ref|XP_007014823.1|  U-box domain-containing protein 42, putative       595   0.0      
gb|EYU46326.1|  hypothetical protein MIMGU_mgv1a019255mg                585   0.0      
ref|XP_006492727.1|  PREDICTED: putative E3 ubiquitin-protein lig...    588   0.0      
ref|XP_002304021.1|  hypothetical protein POPTR_0003s21700g             587   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011025219.1|  PREDICTED: putative E3 ubiquitin-protein lig...    584   0.0      
ref|XP_009761169.1|  PREDICTED: uncharacterized protein LOC104213...    572   0.0      
gb|KHG03671.1|  Putative E3 ubiquitin-protein ligase LIN-1              562   0.0      
gb|KHG03672.1|  Putative E3 ubiquitin-protein ligase LIN-1              561   0.0      
ref|XP_008243689.1|  PREDICTED: putative E3 ubiquitin-protein lig...    541   3e-173   
ref|XP_010087396.1|  Putative E3 ubiquitin-protein ligase LIN-1         520   2e-165   
ref|XP_007139110.1|  hypothetical protein PHAVU_008G002200g             515   1e-163   
ref|XP_008338518.1|  PREDICTED: putative E3 ubiquitin-protein lig...    506   1e-159   
ref|XP_003552751.1|  PREDICTED: putative E3 ubiquitin-protein lig...    503   7e-159   
ref|XP_006603073.1|  PREDICTED: putative E3 ubiquitin-protein lig...    501   4e-158   
gb|KHN12583.1|  Putative E3 ubiquitin-protein ligase LIN-1              497   1e-156   
ref|XP_010265971.1|  PREDICTED: putative E3 ubiquitin-protein lig...    496   1e-155   
gb|KHN24966.1|  Putative E3 ubiquitin-protein ligase LIN-1              488   8e-153   
gb|KDP44413.1|  hypothetical protein JCGZ_19428                         474   3e-152   
ref|XP_009364074.1|  PREDICTED: putative E3 ubiquitin-protein lig...    486   1e-151   
ref|XP_009626404.1|  PREDICTED: putative E3 ubiquitin-protein lig...    476   2e-150   
ref|XP_010907382.1|  PREDICTED: putative E3 ubiquitin-protein lig...    481   8e-150   
ref|XP_003621006.1|  U-box domain-containing protein                    479   9e-150   
ref|XP_008786745.1|  PREDICTED: putative E3 ubiquitin-protein lig...    476   5e-149   
ref|XP_008451115.1|  PREDICTED: putative E3 ubiquitin-protein lig...    469   3e-145   
ref|XP_004149032.1|  PREDICTED: uncharacterized protein LOC101219197    468   7e-145   
gb|ACJ02343.1|  U-box domain-containing protein                         464   2e-144   Helianthus annuus
ref|XP_004491685.1|  PREDICTED: putative E3 ubiquitin-protein lig...    461   5e-143   
gb|KEH21470.1|  ubox-like protein, putative                             454   5e-141   
ref|XP_006855636.1|  hypothetical protein AMTR_s00044p00102360          445   1e-135   
ref|XP_007208177.1|  hypothetical protein PRUPE_ppa020834mg             433   6e-133   
ref|XP_006603075.1|  PREDICTED: putative E3 ubiquitin-protein lig...    426   6e-131   
ref|XP_010031863.1|  PREDICTED: putative E3 ubiquitin-protein lig...    419   4e-127   
ref|XP_008668984.1|  PREDICTED: putative E3 ubiquitin-protein lig...    377   1e-112   
tpg|DAA36304.1|  TPA: hypothetical protein ZEAMMB73_713782              374   2e-111   
gb|KGN66434.1|  hypothetical protein Csa_1G605630                       362   3e-111   
ref|XP_004296299.1|  PREDICTED: uncharacterized protein LOC101308952    367   5e-109   
ref|XP_004154671.1|  PREDICTED: uncharacterized protein LOC101231578    369   2e-108   
ref|XP_010240311.1|  PREDICTED: putative E3 ubiquitin-protein lig...    355   2e-104   
ref|XP_010240312.1|  PREDICTED: putative E3 ubiquitin-protein lig...    353   1e-103   
ref|XP_008451113.1|  PREDICTED: putative E3 ubiquitin-protein lig...    356   5e-103   
ref|XP_004976603.1|  PREDICTED: putative E3 ubiquitin-protein lig...    351   6e-103   
dbj|BAJ97801.1|  predicted protein                                      343   5e-100   
dbj|BAK01872.1|  predicted protein                                      341   2e-99    
ref|XP_006653705.1|  PREDICTED: putative E3 ubiquitin-protein lig...    325   1e-93    
dbj|BAK00804.1|  predicted protein                                      299   2e-85    
ref|XP_009385173.1|  PREDICTED: putative E3 ubiquitin-protein lig...    296   3e-83    
ref|XP_002446993.1|  hypothetical protein SORBIDRAFT_06g026520          290   2e-81    Sorghum bicolor [broomcorn]
ref|XP_007024873.1|  Transducin/WD40 repeat-like superfamily prot...    281   2e-77    
ref|XP_002297659.1|  hypothetical protein POPTR_0001s04980g             275   9e-77    Populus trichocarpa [western balsam poplar]
ref|XP_011037932.1|  PREDICTED: putative E3 ubiquitin-protein lig...    273   2e-76    
ref|XP_011037930.1|  PREDICTED: putative E3 ubiquitin-protein lig...    273   5e-76    
gb|EMS52552.1|  U-box domain-containing protein 17                      261   5e-72    
gb|KHG05796.1|  Putative E3 ubiquitin-protein ligase LIN-1              264   1e-71    
ref|XP_006603074.1|  PREDICTED: putative E3 ubiquitin-protein lig...    246   1e-65    
ref|XP_011001310.1|  PREDICTED: putative E3 ubiquitin-protein lig...    241   9e-64    
ref|XP_011001312.1|  PREDICTED: putative E3 ubiquitin-protein lig...    239   4e-63    
ref|XP_011001311.1|  PREDICTED: putative E3 ubiquitin-protein lig...    239   5e-63    
dbj|BAG94381.1|  unnamed protein product                                227   5e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002528126.1|  hypothetical protein RCOM_0146510                  222   3e-57    Ricinus communis
ref|XP_010317000.1|  PREDICTED: putative E3 ubiquitin-protein lig...    219   1e-56    
ref|XP_004233209.1|  PREDICTED: putative E3 ubiquitin-protein lig...    216   2e-55    
gb|EAZ21883.1|  hypothetical protein OsJ_05535                          214   3e-55    Oryza sativa Japonica Group [Japonica rice]
emb|CAE04155.2|  OSJNBa0088A01.24                                       214   5e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010233875.1|  PREDICTED: putative E3 ubiquitin-protein lig...    210   6e-55    
gb|EEC72569.1|  hypothetical protein OsI_06007                          214   7e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_010233874.1|  PREDICTED: putative E3 ubiquitin-protein lig...    211   8e-55    
ref|XP_006648350.1|  PREDICTED: putative E3 ubiquitin-protein lig...    211   2e-54    
ref|NP_001132610.1|  uncharacterized protein LOC100194083               205   3e-54    Zea mays [maize]
dbj|BAD25713.1|  transducin-like                                        212   4e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393279.1|  PREDICTED: putative E3 ubiquitin-protein lig...    210   1e-53    
ref|XP_004228687.1|  PREDICTED: putative E3 ubiquitin-protein lig...    202   2e-53    
gb|EAZ31770.1|  hypothetical protein OsJ_15922                          208   2e-53    Oryza sativa Japonica Group [Japonica rice]
gb|AFW70260.1|  hypothetical protein ZEAMMB73_152824                    208   7e-53    
ref|XP_008681230.1|  PREDICTED: uncharacterized protein LOC100194...    208   8e-53    
dbj|BAJ88650.1|  predicted protein                                      204   3e-52    
ref|XP_008813287.1|  PREDICTED: putative E3 ubiquitin-protein lig...    206   3e-52    
ref|XP_009393280.1|  PREDICTED: putative E3 ubiquitin-protein lig...    205   8e-52    
ref|XP_010927102.1|  PREDICTED: putative E3 ubiquitin-protein lig...    203   2e-51    
ref|XP_004951782.1|  PREDICTED: putative E3 ubiquitin-protein lig...    192   1e-47    
gb|EMT06890.1|  hypothetical protein F775_01383                         189   8e-47    
emb|CBI29071.3|  unnamed protein product                                187   5e-46    
ref|XP_002274319.3|  PREDICTED: putative E3 ubiquitin-protein lig...    187   1e-45    Vitis vinifera
ref|XP_002451611.1|  hypothetical protein SORBIDRAFT_04g004580          186   1e-45    Sorghum bicolor [broomcorn]
ref|XP_010272313.1|  PREDICTED: putative E3 ubiquitin-protein lig...    186   2e-45    
ref|XP_011037934.1|  PREDICTED: uncharacterized protein LOC105134...    181   4e-45    
ref|XP_011037929.1|  PREDICTED: putative E3 ubiquitin-protein lig...    182   6e-45    
ref|XP_011037933.1|  PREDICTED: putative E3 ubiquitin-protein lig...    181   8e-45    
ref|XP_011037931.1|  PREDICTED: putative E3 ubiquitin-protein lig...    181   1e-44    
emb|CAN67079.1|  hypothetical protein VITISV_004500                     179   2e-43    Vitis vinifera
ref|NP_001174070.1|  Os04g0584500                                       168   4e-43    
ref|XP_004295479.1|  PREDICTED: putative E3 ubiquitin-protein lig...    178   6e-43    
emb|CDP17621.1|  unnamed protein product                                178   8e-43    
ref|XP_010052587.1|  PREDICTED: putative E3 ubiquitin-protein lig...    177   1e-42    
ref|XP_010052589.1|  PREDICTED: putative E3 ubiquitin-protein lig...    177   1e-42    
ref|XP_004295167.1|  PREDICTED: uncharacterized protein LOC101310101    161   8e-41    
ref|XP_009353928.1|  PREDICTED: putative E3 ubiquitin-protein lig...    171   1e-40    
ref|XP_003547313.2|  PREDICTED: putative E3 ubiquitin-protein lig...    168   8e-40    
ref|XP_004486432.1|  PREDICTED: putative E3 ubiquitin-protein lig...    168   9e-40    
ref|XP_010052588.1|  PREDICTED: putative E3 ubiquitin-protein lig...    167   2e-39    
ref|XP_003594462.1|  hypothetical protein MTR_2g028940                  165   1e-38    
ref|XP_010092647.1|  hypothetical protein L484_006243                   164   2e-38    
ref|XP_004486431.1|  PREDICTED: putative E3 ubiquitin-protein lig...    164   2e-38    
ref|XP_006597651.1|  PREDICTED: putative E3 ubiquitin-protein lig...    164   3e-38    
ref|XP_007147520.1|  hypothetical protein PHAVU_006G131500g             161   2e-37    
gb|KDP20357.1|  hypothetical protein JCGZ_06466                         159   7e-37    
ref|XP_003534762.1|  PREDICTED: putative E3 ubiquitin-protein lig...    158   1e-36    
gb|KHN22969.1|  Putative E3 ubiquitin-protein ligase LIN                157   3e-36    
ref|XP_008383331.1|  PREDICTED: putative E3 ubiquitin-protein lig...    156   6e-36    
ref|XP_006468435.1|  PREDICTED: putative E3 ubiquitin-protein lig...    154   2e-35    
ref|XP_006448744.1|  hypothetical protein CICLE_v10014170mg             154   2e-35    
ref|XP_006468438.1|  PREDICTED: putative E3 ubiquitin-protein lig...    154   3e-35    
ref|XP_006448745.1|  hypothetical protein CICLE_v10014170mg             154   3e-35    
ref|XP_002321798.1|  hypothetical protein POPTR_0015s15790g             154   4e-35    Populus trichocarpa [western balsam poplar]
ref|XP_006586819.1|  PREDICTED: putative E3 ubiquitin-protein lig...    154   4e-35    
gb|KEH37012.1|  E3 ubiquitin-protein ligase LIN-like protein, put...    153   6e-35    
ref|XP_006376995.1|  hypothetical protein POPTR_0012s11910g             152   2e-34    
ref|XP_008225743.1|  PREDICTED: putative E3 ubiquitin-protein lig...    151   4e-34    
ref|XP_011096774.1|  PREDICTED: putative E3 ubiquitin-protein lig...    150   8e-34    
ref|XP_003594463.1|  hypothetical protein MTR_2g028940                  148   2e-33    
ref|XP_006468437.1|  PREDICTED: putative E3 ubiquitin-protein lig...    148   3e-33    
ref|XP_011040367.1|  PREDICTED: putative E3 ubiquitin-protein lig...    147   4e-33    
ref|XP_011040368.1|  PREDICTED: putative E3 ubiquitin-protein lig...    147   4e-33    
gb|EYU43698.1|  hypothetical protein MIMGU_mgv1a000899mg                147   4e-33    
gb|KGN66433.1|  hypothetical protein Csa_1G605620                       145   5e-33    
ref|XP_007213690.1|  hypothetical protein PRUPE_ppa000859mg             144   4e-32    
gb|KHG00480.1|  Putative E3 ubiquitin-protein ligase LIN-1              144   6e-32    
ref|XP_008225742.1|  PREDICTED: putative E3 ubiquitin-protein lig...    143   9e-32    
ref|XP_007157811.1|  hypothetical protein PHAVU_002G100200g             143   1e-31    
ref|XP_007157812.1|  hypothetical protein PHAVU_002G100200g             142   1e-31    
ref|XP_007157809.1|  hypothetical protein PHAVU_002G100200g             142   2e-31    
ref|XP_006495382.1|  PREDICTED: putative E3 ubiquitin-protein lig...    137   3e-31    
ref|XP_002516406.1|  hypothetical protein RCOM_1424400                  141   3e-31    Ricinus communis
ref|XP_008371843.1|  PREDICTED: putative E3 ubiquitin-protein lig...    141   5e-31    
ref|XP_009357278.1|  PREDICTED: putative E3 ubiquitin-protein lig...    140   1e-30    
gb|KDO77448.1|  hypothetical protein CISIN_1g004318mg                   139   1e-30    
gb|KDO77449.1|  hypothetical protein CISIN_1g004318mg                   139   1e-30    
ref|XP_008459082.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    139   1e-30    
gb|KDO77447.1|  hypothetical protein CISIN_1g004318mg                   139   2e-30    
ref|XP_003556483.2|  PREDICTED: putative E3 ubiquitin-protein lig...    139   2e-30    
ref|XP_006605524.1|  PREDICTED: putative E3 ubiquitin-protein lig...    138   4e-30    
gb|KCW76671.1|  hypothetical protein EUGRSUZ_D01038                     136   1e-29    
gb|AFK12759.1|  Ubox-like protein                                       124   2e-28    
gb|AFK12757.1|  Ubox-like protein                                       124   3e-28    
gb|AFK12758.1|  Ubox-like protein                                       124   4e-28    
ref|XP_009782517.1|  PREDICTED: putative E3 ubiquitin-protein lig...    131   6e-28    
gb|EEC77864.1|  hypothetical protein OsI_17130                          130   6e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_002972675.1|  hypothetical protein SELMODRAFT_413195             131   7e-28    
gb|KGN66908.1|  hypothetical protein Csa_1G713660                       131   7e-28    
ref|XP_009628932.1|  PREDICTED: putative E3 ubiquitin-protein lig...    130   1e-27    
ref|XP_006353070.1|  PREDICTED: putative E3 ubiquitin-protein lig...    128   6e-27    
ref|XP_007147519.1|  hypothetical protein PHAVU_006G131500g             126   1e-26    
ref|XP_008225744.1|  PREDICTED: putative E3 ubiquitin-protein lig...    125   3e-26    
ref|XP_004145484.1|  PREDICTED: putative E3 ubiquitin-protein lig...    125   5e-26    
ref|XP_006374716.1|  hypothetical protein POPTR_0015s15790g             118   6e-24    
sp|C6L7U1.2|LIN1_LOTJA  RecName: Full=Putative E3 ubiquitin-prote...    117   2e-23    Lotus japonicus
dbj|BAH86605.1|  U-box protein with unknown function                    117   2e-23    Lotus japonicus
ref|XP_010104461.1|  Putative E3 ubiquitin-protein ligase LIN-1         117   2e-23    
ref|XP_006853357.1|  hypothetical protein AMTR_s00032p00110960          111   5e-23    
gb|KHN37909.1|  Putative E3 ubiquitin-protein ligase LIN-1              114   2e-22    
ref|XP_003536276.1|  PREDICTED: putative E3 ubiquitin-protein lig...    114   2e-22    
ref|XP_007144197.1|  hypothetical protein PHAVU_007G136300g             112   6e-22    
ref|XP_008366744.1|  PREDICTED: putative E3 ubiquitin-protein lig...    112   8e-22    
sp|D1FP57.1|LIN2_LOTJA  RecName: Full=Putative E3 ubiquitin-prote...    109   5e-21    Lotus japonicus
gb|ACL14424.1|  putative E3 ubiquitin ligase                            109   5e-21    Lotus japonicus
ref|XP_002510542.1|  hypothetical protein RCOM_1598060                  109   6e-21    Ricinus communis
ref|XP_008242573.1|  PREDICTED: putative E3 ubiquitin-protein lig...    109   7e-21    
ref|XP_007204677.1|  hypothetical protein PRUPE_ppa000309mg             108   8e-21    
ref|XP_009334977.1|  PREDICTED: putative E3 ubiquitin-protein lig...    108   8e-21    
ref|XP_004292946.1|  PREDICTED: putative E3 ubiquitin-protein lig...    108   1e-20    
ref|XP_008221252.1|  PREDICTED: putative E3 ubiquitin-protein lig...    107   3e-20    
gb|AES64714.2|  E3 ubiquitin-protein ligase LIN-like protein, put...    104   8e-20    
ref|XP_007225466.1|  hypothetical protein PRUPE_ppa000216mg             104   2e-19    
ref|XP_002988129.1|  hypothetical protein SELMODRAFT_426843             102   5e-19    
ref|XP_009588634.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   7e-19    
ref|XP_003591660.1|  U-box domain-containing protein                    102   7e-19    
sp|D1FP53.1|LIN_MEDTR  RecName: Full=Putative E3 ubiquitin-protei...    102   8e-19    Medicago truncatula
ref|XP_009588635.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   8e-19    
ref|XP_006851973.1|  hypothetical protein AMTR_s00041p00198410          101   1e-18    
ref|XP_009773043.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   1e-18    
ref|XP_009588632.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   1e-18    
ref|XP_009588633.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   1e-18    
ref|XP_009773059.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   1e-18    
ref|XP_004496090.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   1e-18    
ref|XP_011045078.1|  PREDICTED: putative E3 ubiquitin-protein lig...    101   1e-18    
ref|XP_009773037.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   1e-18    
ref|XP_009773032.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   1e-18    
ref|XP_009773051.1|  PREDICTED: putative E3 ubiquitin-protein lig...    101   1e-18    
ref|XP_011045075.1|  PREDICTED: putative E3 ubiquitin-protein lig...    101   2e-18    
ref|XP_011045077.1|  PREDICTED: putative E3 ubiquitin-protein lig...    101   2e-18    
ref|XP_007027082.1|  Transducin/WD40 repeat-like superfamily protein    100   3e-18    
ref|XP_002307730.2|  hypothetical protein POPTR_0005s26160g             100   3e-18    Populus trichocarpa [western balsam poplar]
ref|XP_010319718.1|  PREDICTED: putative E3 ubiquitin-protein lig...    100   4e-18    
ref|XP_011083563.1|  PREDICTED: putative E3 ubiquitin-protein lig...    100   4e-18    
ref|XP_010319719.1|  PREDICTED: putative E3 ubiquitin-protein lig...    100   4e-18    
ref|XP_010319715.1|  PREDICTED: putative E3 ubiquitin-protein lig...    100   4e-18    
ref|XP_006442167.1|  hypothetical protein CICLE_v10024300mg           99.8    6e-18    
ref|XP_006492801.1|  PREDICTED: putative E3 ubiquitin-protein lig...  99.8    6e-18    
ref|XP_002325006.2|  hypothetical protein POPTR_0018s09040g           99.4    6e-18    Populus trichocarpa [western balsam poplar]
ref|XP_006357361.1|  PREDICTED: putative E3 ubiquitin-protein lig...  99.8    6e-18    
gb|KDO41596.1|  hypothetical protein CISIN_1g0007442mg                99.4    7e-18    
ref|XP_008675635.1|  PREDICTED: putative E3 ubiquitin-protein lig...  99.4    8e-18    
tpg|DAA52769.1|  TPA: hypothetical protein ZEAMMB73_576745            99.4    8e-18    
gb|EEE54168.1|  hypothetical protein OsJ_00982                        99.0    9e-18    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010230655.1|  PREDICTED: putative E3 ubiquitin-protein lig...  99.0    1e-17    
ref|NP_001042489.1|  Os01g0229700                                     99.0    1e-17    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971473.1|  PREDICTED: putative E3 ubiquitin-protein lig...  99.0    1e-17    
gb|KCW79939.1|  hypothetical protein EUGRSUZ_C01271                   98.6    1e-17    
gb|KCW79938.1|  hypothetical protein EUGRSUZ_C01271                   98.6    1e-17    
ref|XP_006580471.1|  PREDICTED: putative E3 ubiquitin-protein lig...  98.2    2e-17    
ref|XP_010050571.1|  PREDICTED: putative E3 ubiquitin-protein lig...  97.8    2e-17    
ref|XP_010656297.1|  PREDICTED: putative E3 ubiquitin-protein lig...  97.8    2e-17    
ref|XP_010656298.1|  PREDICTED: putative E3 ubiquitin-protein lig...  97.4    3e-17    
emb|CBI28040.3|  unnamed protein product                              97.4    3e-17    
ref|XP_009380565.1|  PREDICTED: putative E3 ubiquitin-protein lig...  97.4    3e-17    
emb|CBI19874.3|  unnamed protein product                              97.4    3e-17    
emb|CAN74785.1|  hypothetical protein VITISV_011516                   97.4    3e-17    Vitis vinifera
ref|XP_002279863.2|  PREDICTED: putative E3 ubiquitin-protein lig...  97.1    4e-17    Vitis vinifera
ref|XP_010664820.1|  PREDICTED: putative E3 ubiquitin-protein lig...  97.1    4e-17    
emb|CAN83797.1|  hypothetical protein VITISV_002973                   97.1    4e-17    Vitis vinifera
ref|XP_002984593.1|  hypothetical protein SELMODRAFT_423775           97.1    4e-17    
ref|XP_010064564.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  97.1    4e-17    
ref|XP_008661121.1|  PREDICTED: putative E3 ubiquitin-protein lig...  91.3    4e-17    
ref|XP_010100641.1|  Putative E3 ubiquitin-protein ligase LIN-1       97.1    4e-17    
ref|XP_006584821.1|  PREDICTED: putative E3 ubiquitin-protein lig...  96.7    4e-17    
ref|XP_002454892.1|  hypothetical protein SORBIDRAFT_03g000870        96.7    5e-17    Sorghum bicolor [broomcorn]
ref|XP_007160321.1|  hypothetical protein PHAVU_002G311800g           96.7    5e-17    
dbj|BAJ95654.1|  predicted protein                                    96.7    5e-17    
gb|KDO66446.1|  hypothetical protein CISIN_1g001349mg                 95.9    6e-17    
gb|EMT16354.1|  U-box domain-containing protein 13                    96.3    6e-17    
gb|KGN60041.1|  hypothetical protein Csa_3G872720                     96.3    6e-17    
ref|XP_004136490.1|  PREDICTED: putative E3 ubiquitin-protein lig...  96.3    6e-17    
ref|XP_003607857.1|  hypothetical protein MTR_4g083620                92.8    6e-17    
ref|XP_004162568.1|  PREDICTED: putative E3 ubiquitin-protein lig...  96.3    7e-17    
ref|XP_008466477.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  96.3    7e-17    
ref|XP_006645675.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  96.3    7e-17    
gb|KDO66444.1|  hypothetical protein CISIN_1g001349mg                 95.9    8e-17    
gb|KDO66445.1|  hypothetical protein CISIN_1g001349mg                 95.9    8e-17    
emb|CDP07391.1|  unnamed protein product                              95.9    8e-17    
ref|XP_006451205.1|  hypothetical protein CICLE_v10007255mg           95.9    9e-17    
ref|XP_002978658.1|  hypothetical protein SELMODRAFT_418457           95.9    9e-17    
ref|XP_011078302.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  95.9    9e-17    
ref|XP_009352688.1|  PREDICTED: putative E3 ubiquitin-protein lig...  95.5    1e-16    
emb|CDP03302.1|  unnamed protein product                              95.1    1e-16    
ref|XP_008462773.1|  PREDICTED: putative E3 ubiquitin-protein lig...  94.7    2e-16    
ref|XP_007013113.1|  Transducin/WD40 repeat-like superfamily protein  94.4    2e-16    
ref|XP_008352326.1|  PREDICTED: putative E3 ubiquitin-protein lig...  94.4    3e-16    
ref|XP_010062045.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  94.4    3e-16    
ref|XP_008788367.1|  PREDICTED: putative E3 ubiquitin-protein lig...  94.0    3e-16    
ref|XP_008788369.1|  PREDICTED: putative E3 ubiquitin-protein lig...  94.0    3e-16    
ref|XP_004299991.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  94.0    3e-16    
ref|XP_010915863.1|  PREDICTED: putative E3 ubiquitin-protein lig...  93.6    4e-16    
gb|KCW69116.1|  hypothetical protein EUGRSUZ_F02660                   93.6    4e-16    
ref|XP_002514271.1|  F-box and wd40 domain protein, putative          93.6    4e-16    Ricinus communis
ref|XP_010920190.1|  PREDICTED: putative E3 ubiquitin-protein lig...  93.6    4e-16    
ref|XP_010249650.1|  PREDICTED: putative E3 ubiquitin-protein lig...  93.2    5e-16    
ref|XP_003630767.1|  U-box domain-containing protein                  92.8    6e-16    
gb|KEH21350.1|  E3 ubiquitin-protein ligase LIN-like protein, put...  93.2    6e-16    
ref|XP_009788939.1|  PREDICTED: putative E3 ubiquitin-protein lig...  93.2    6e-16    
ref|XP_009788941.1|  PREDICTED: putative E3 ubiquitin-protein lig...  93.2    6e-16    
ref|XP_009788942.1|  PREDICTED: putative E3 ubiquitin-protein lig...  93.2    6e-16    
gb|EYU32945.1|  hypothetical protein MIMGU_mgv1a000874mg              92.4    7e-16    
gb|EYU38802.1|  hypothetical protein MIMGU_mgv1a023448mg              92.8    8e-16    
ref|XP_009606222.1|  PREDICTED: putative E3 ubiquitin-protein lig...  92.8    8e-16    
ref|XP_011029082.1|  PREDICTED: putative E3 ubiquitin-protein lig...  92.8    8e-16    
ref|XP_009606221.1|  PREDICTED: putative E3 ubiquitin-protein lig...  92.8    8e-16    
ref|XP_004155724.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  92.4    8e-16    
gb|KGN66817.1|  hypothetical protein Csa_1G696500                     92.4    9e-16    
ref|XP_004142566.1|  PREDICTED: putative E3 ubiquitin-protein lig...  92.4    9e-16    
ref|XP_008783309.1|  PREDICTED: putative E3 ubiquitin-protein lig...  92.4    9e-16    
ref|XP_006341274.1|  PREDICTED: putative E3 ubiquitin-protein lig...  92.4    1e-15    
ref|XP_006833370.1|  hypothetical protein AMTR_s00109p00103350        92.0    1e-15    
ref|XP_008221253.1|  PREDICTED: putative E3 ubiquitin-protein lig...  90.9    3e-15    
ref|XP_010323417.1|  PREDICTED: putative E3 ubiquitin-protein lig...  89.4    8e-15    
ref|XP_010323416.1|  PREDICTED: putative E3 ubiquitin-protein lig...  89.4    8e-15    
ref|XP_010323418.1|  PREDICTED: putative E3 ubiquitin-protein lig...  89.4    8e-15    
gb|EMT00752.1|  hypothetical protein F775_12509                       87.4    2e-14    
emb|CDY04747.1|  BnaC05g18420D                                        86.3    2e-14    
emb|CDY04746.1|  BnaC05g18430D                                        86.7    3e-14    
emb|CDY21412.1|  BnaA09g30150D                                        86.3    4e-14    
ref|XP_002300701.2|  hypothetical protein POPTR_0002s02320g           87.0    4e-14    
ref|XP_009115567.1|  PREDICTED: U-box domain-containing protein 11    85.1    1e-13    
gb|KFK44389.1|  hypothetical protein AALP_AA1G251200                  85.1    1e-13    
ref|XP_010498796.1|  PREDICTED: U-box domain-containing protein 1...  84.7    1e-13    
gb|AAB72157.1|  hypothetical protein                                  84.7    1e-13    
ref|NP_173716.1|  ARM repeat superfamily protein                      84.7    1e-13    
gb|AAO00878.1|  unknown protein                                       84.3    2e-13    
ref|XP_006306975.1|  hypothetical protein CARUB_v10008550mg           84.3    2e-13    
ref|NP_001131869.1|  uncharacterized protein LOC100193248             84.3    2e-13    
ref|XP_006416130.1|  hypothetical protein EUTSA_v10007104mg           84.0    2e-13    
ref|XP_002890550.1|  armadillo/beta-catenin repeat family protein     82.8    5e-13    
ref|XP_002454334.1|  hypothetical protein SORBIDRAFT_04g028890        82.8    6e-13    
ref|XP_008387007.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...  82.8    9e-13    
ref|XP_010460079.1|  PREDICTED: U-box domain-containing protein 11    82.0    1e-12    
gb|EAZ24511.1|  hypothetical protein OsJ_08271                        81.6    1e-12    
ref|XP_006342541.1|  PREDICTED: U-box domain-containing protein 1...  81.6    1e-12    
ref|XP_004953824.1|  PREDICTED: U-box domain-containing protein 1...  81.3    2e-12    
gb|EEC73944.1|  hypothetical protein OsI_08816                        81.3    2e-12    
ref|NP_001048024.1|  Os02g0732200                                     81.3    2e-12    
ref|XP_004297185.1|  PREDICTED: putative U-box domain-containing ...  81.6    2e-12    
ref|XP_004253124.1|  PREDICTED: U-box domain-containing protein 1...  80.5    3e-12    
gb|AFW63815.1|  putative ARM repeat-containing protein containing...  80.1    3e-12    
ref|XP_006649017.1|  PREDICTED: U-box domain-containing protein 1...  80.5    3e-12    
ref|XP_003581250.1|  PREDICTED: U-box domain-containing protein 2...  79.3    4e-12    
ref|XP_010477585.1|  PREDICTED: U-box domain-containing protein 1...  80.1    4e-12    
gb|EMT21789.1|  U-box domain-containing protein 11                    79.7    4e-12    
ref|XP_006438420.1|  hypothetical protein CICLE_v10030876mg           79.7    5e-12    
ref|XP_008650505.1|  PREDICTED: putative E3 ubiquitin-protein lig...  76.3    5e-12    
ref|XP_006483830.1|  PREDICTED: U-box domain-containing protein 1...  79.7    5e-12    
ref|XP_003570737.1|  PREDICTED: U-box domain-containing protein 4...  79.7    6e-12    
ref|XP_008223230.1|  PREDICTED: putative E3 ubiquitin-protein lig...  80.1    6e-12    
ref|XP_006282265.1|  hypothetical protein CARUB_v10028542mg           79.3    7e-12    
gb|KHG01616.1|  U-box domain-containing 15 -like protein              79.3    7e-12    
ref|XP_009110214.1|  PREDICTED: U-box domain-containing protein 4...  79.3    8e-12    
gb|KDO82482.1|  hypothetical protein CISIN_1g039015mg                 79.0    9e-12    
ref|XP_007137800.1|  hypothetical protein PHAVU_009G156600g           77.8    1e-11    
dbj|BAJ97560.1|  predicted protein                                    78.6    1e-11    
gb|AAL24123.1|  unknown protein                                       77.0    2e-11    
ref|XP_010907242.1|  PREDICTED: U-box domain-containing protein 9...  77.4    2e-11    
dbj|BAK01935.1|  predicted protein                                    77.8    2e-11    
ref|XP_002510676.1|  Spotted leaf protein, putative                   77.8    2e-11    
ref|XP_003522485.1|  PREDICTED: U-box domain-containing protein 2...  76.6    2e-11    
ref|XP_008467150.1|  PREDICTED: U-box domain-containing protein 1...  77.0    3e-11    
ref|NP_001050813.1|  Os03g0657100                                     77.4    3e-11    
ref|XP_008467149.1|  PREDICTED: U-box domain-containing protein 1...  77.0    3e-11    
ref|XP_002454851.1|  hypothetical protein SORBIDRAFT_04g038540        77.4    4e-11    
ref|XP_004135423.1|  PREDICTED: putative U-box domain-containing ...  77.0    5e-11    
ref|XP_010680211.1|  PREDICTED: U-box domain-containing protein 2...  75.9    5e-11    
gb|KGN52004.1|  hypothetical protein Csa_5G607430                     75.5    6e-11    
ref|XP_010066798.1|  PREDICTED: putative U-box domain-containing ...  76.6    6e-11    
emb|CDX96623.1|  BnaA08g21660D                                        76.6    6e-11    
gb|EMS66087.1|  U-box domain-containing protein 44                    75.9    6e-11    
dbj|BAJ86117.1|  predicted protein                                    76.3    7e-11    
ref|XP_008811326.1|  PREDICTED: U-box domain-containing protein 9...  75.5    7e-11    
gb|KDP34438.1|  hypothetical protein JCGZ_12798                       74.7    8e-11    
emb|CDP04681.1|  unnamed protein product                              74.7    8e-11    
ref|XP_002526006.1|  E3 ubiquitin ligase PUB14, putative              75.9    9e-11    
gb|KCW64840.1|  hypothetical protein EUGRSUZ_G02409                   76.3    9e-11    
ref|XP_006840583.1|  hypothetical protein AMTR_s00045p00231470        76.3    9e-11    
ref|XP_009417655.1|  PREDICTED: U-box domain-containing protein 10    75.9    9e-11    
ref|NP_001117582.1|  ARM repeat superfamily protein                   75.1    1e-10    
ref|XP_003526867.1|  PREDICTED: U-box domain-containing protein 2...  74.7    1e-10    
ref|XP_010066797.1|  PREDICTED: putative U-box domain-containing ...  75.9    1e-10    
ref|XP_007045720.1|  Armadillo/beta-catenin-like repeat family pr...  75.9    1e-10    
gb|AIV00617.1|  U-box domain-containing protein                       74.7    1e-10    
ref|NP_177765.1|  U-box domain-containing protein 43                  75.9    1e-10    
ref|XP_010066796.1|  PREDICTED: putative U-box domain-containing ...  75.9    1e-10    
gb|AAD55500.1|AC008148_10  Unknown protein                            75.1    1e-10    
ref|NP_564125.2|  senescence-associated E3 ubiquitin ligase 1         75.5    1e-10    
ref|XP_007018033.1|  Plant U-Box 15, putative                         75.1    1e-10    
gb|EYU36563.1|  hypothetical protein MIMGU_mgv1a002804mg              75.1    2e-10    
ref|XP_002890408.1|  hypothetical protein ARALYDRAFT_889531           75.1    2e-10    
ref|NP_177258.3|  ARM repeat superfamily protein                      75.1    2e-10    
ref|XP_006495051.1|  PREDICTED: U-box domain-containing protein 1...  75.1    2e-10    
ref|XP_002442085.1|  hypothetical protein SORBIDRAFT_08g010420        74.7    2e-10    
ref|XP_006448286.1|  hypothetical protein CICLE_v10014584mg           74.7    2e-10    
ref|XP_007224642.1|  hypothetical protein PRUPE_ppa026397mg           75.1    2e-10    
ref|XP_006443314.1|  hypothetical protein CICLE_v10024335mg           73.9    2e-10    
ref|XP_007221973.1|  hypothetical protein PRUPE_ppa002756mg           74.7    2e-10    
ref|XP_009103205.1|  PREDICTED: U-box domain-containing protein 1...  74.7    2e-10    
gb|ABG22055.1|  Spotted leaf protein 11, putative, expressed          74.3    2e-10    
ref|XP_004296849.1|  PREDICTED: putative E3 ubiquitin-protein lig...  75.1    2e-10    
gb|EEC69528.1|  hypothetical protein OsI_38799                        74.3    2e-10    
ref|XP_004167232.1|  PREDICTED: U-box domain-containing protein 1...  73.9    2e-10    
ref|XP_007157467.1|  hypothetical protein PHAVU_002G072000g           74.7    2e-10    
ref|XP_003631249.1|  PREDICTED: U-box domain-containing protein 2...  73.9    2e-10    
gb|EYU38026.1|  hypothetical protein MIMGU_mgv1a002670mg              74.3    2e-10    
gb|ABA99652.1|  Spotted leaf protein 11, putative, expressed          74.3    2e-10    
emb|CDP04252.1|  unnamed protein product                              73.9    2e-10    
gb|EMT14394.1|  U-box domain-containing protein 44                    74.3    2e-10    
ref|XP_006479026.1|  PREDICTED: U-box domain-containing protein 9...  73.9    2e-10    
gb|KDO42117.1|  hypothetical protein CISIN_1g012677mg                 73.6    3e-10    
ref|XP_004150480.1|  PREDICTED: U-box domain-containing protein 1...  73.9    3e-10    
sp|A2ZLU6.2|SL11_ORYSI  RecName: Full=Protein spotted leaf 11; Al...  74.3    3e-10    
ref|NP_001067077.2|  Os12g0570000                                     73.9    3e-10    
gb|EAZ20925.1|  hypothetical protein OsJ_36575                        74.3    3e-10    
ref|XP_006655674.1|  PREDICTED: U-box domain-containing protein 1...  73.6    3e-10    
gb|EAZ35525.1|  hypothetical protein OsJ_19806                        73.9    3e-10    
sp|Q5VRH9.1|PUB12_ORYSJ  RecName: Full=U-box domain-containing pr...  73.9    3e-10    
ref|XP_008218380.1|  PREDICTED: U-box domain-containing protein 9...  73.6    3e-10    
ref|XP_010254800.1|  PREDICTED: U-box domain-containing protein 5...  73.9    3e-10    
ref|NP_001056535.2|  Os06g0102700                                     73.9    3e-10    
ref|XP_004290058.1|  PREDICTED: U-box domain-containing protein 1...  73.9    4e-10    
gb|EMS50490.1|  U-box domain-containing protein 15                    73.6    4e-10    
ref|XP_010254798.1|  PREDICTED: U-box domain-containing protein 5...  73.9    4e-10    
gb|AAP50990.1|  unknown protein                                       73.9    4e-10    
ref|XP_008218381.1|  PREDICTED: U-box domain-containing protein 9...  73.2    4e-10    
ref|XP_010254799.1|  PREDICTED: U-box domain-containing protein 5...  73.9    4e-10    
gb|EAY99303.1|  hypothetical protein OsI_21270                        73.6    4e-10    
ref|XP_008388749.1|  PREDICTED: U-box domain-containing protein 9...  73.2    4e-10    
emb|CDY33646.1|  BnaC08g19460D                                        73.9    4e-10    
ref|XP_009389167.1|  PREDICTED: U-box domain-containing protein 4...  73.9    4e-10    
gb|KDO64708.1|  hypothetical protein CISIN_1g006669mg                 73.2    4e-10    
ref|XP_008810906.1|  PREDICTED: U-box domain-containing protein 2...  72.8    4e-10    
ref|XP_007225317.1|  hypothetical protein PRUPE_ppa001127mg           73.9    4e-10    
ref|XP_002863798.1|  binding protein                                  73.6    4e-10    
gb|EMT33422.1|  U-box domain-containing protein 43                    73.9    4e-10    
gb|KDO79582.1|  hypothetical protein CISIN_1g0361992mg                72.0    5e-10    
ref|XP_004290057.1|  PREDICTED: U-box domain-containing protein 1...  73.6    5e-10    
ref|XP_006435360.1|  hypothetical protein CICLE_v10003715mg           73.6    5e-10    
ref|XP_010442159.1|  PREDICTED: U-box domain-containing protein 1...  73.6    5e-10    
ref|XP_006473917.1|  PREDICTED: U-box domain-containing protein 1...  73.6    5e-10    
emb|CDY25764.1|  BnaA07g10180D                                        73.2    5e-10    
gb|KDO64707.1|  hypothetical protein CISIN_1g006669mg                 73.2    5e-10    
emb|CDY12497.1|  BnaC07g13370D                                        73.2    5e-10    
ref|XP_003573013.2|  PREDICTED: U-box domain-containing protein 1...  73.2    5e-10    
ref|XP_011088699.1|  PREDICTED: U-box domain-containing protein 1...  73.2    5e-10    
emb|CDX87606.1|  BnaA07g32670D                                        73.6    6e-10    
ref|XP_006664118.1|  PREDICTED: protein spotted leaf 11-like          73.2    6e-10    
ref|XP_007205152.1|  hypothetical protein PRUPE_ppa005364mg           72.8    6e-10    
ref|XP_010911533.1|  PREDICTED: U-box domain-containing protein 2...  72.4    6e-10    
ref|XP_002526642.1|  Spotted leaf protein, putative                   72.4    6e-10    
ref|XP_002510402.1|  Spotted leaf protein, putative                   72.8    6e-10    
ref|NP_001176902.1|  Os12g0277400                                     73.2    6e-10    
ref|NP_199049.2|  U-box domain-containing protein 15                  73.2    6e-10    
gb|EYU39768.1|  hypothetical protein MIMGU_mgv1a023902mg              72.4    6e-10    
dbj|BAB10475.1|  arm repeat containing protein                        73.2    7e-10    
ref|XP_011088698.1|  PREDICTED: U-box domain-containing protein 1...  73.2    7e-10    
ref|XP_006847226.1|  hypothetical protein AMTR_s00017p00257160        72.0    7e-10    
ref|XP_011038668.1|  PREDICTED: U-box domain-containing protein 1...  72.8    7e-10    
ref|XP_002311496.2|  hypothetical protein POPTR_0008s12760g           72.8    7e-10    
ref|XP_007045104.1|  U-box domain-containing protein 10               72.8    7e-10    
ref|XP_003602626.1|  U-box domain-containing protein                  72.0    7e-10    
dbj|BAD43348.1|  arm repeat containing protein                        72.8    7e-10    
ref|XP_009779917.1|  PREDICTED: U-box domain-containing protein 9...  72.4    7e-10    
ref|XP_009106300.1|  PREDICTED: U-box domain-containing protein 43    73.2    7e-10    
ref|XP_010415797.1|  PREDICTED: U-box domain-containing protein 1...  72.8    7e-10    
ref|XP_002446512.1|  hypothetical protein SORBIDRAFT_06g017230        72.0    8e-10    
ref|XP_009410686.1|  PREDICTED: U-box domain-containing protein 2...  72.0    8e-10    
ref|XP_011038670.1|  PREDICTED: U-box domain-containing protein 1...  72.4    8e-10    
ref|XP_006403398.1|  hypothetical protein EUTSA_v10003163mg           72.8    8e-10    
ref|XP_006300861.1|  hypothetical protein CARUB_v10019954mg           72.8    8e-10    
ref|XP_009403611.1|  PREDICTED: U-box domain-containing protein 9...  72.0    8e-10    
ref|XP_010481997.1|  PREDICTED: U-box domain-containing protein 1...  72.8    8e-10    
ref|XP_002262704.2|  PREDICTED: U-box domain-containing protein 2...  71.6    8e-10    
ref|XP_010494171.1|  PREDICTED: U-box domain-containing protein 15    72.8    9e-10    
gb|KHG28766.1|  U-box domain-containing 15 -like protein              72.4    9e-10    
gb|KCW67973.1|  hypothetical protein EUGRSUZ_F016651                  72.8    9e-10    
ref|XP_008808480.1|  PREDICTED: U-box domain-containing protein 2...  71.6    9e-10    
emb|CDX95193.1|  BnaC09g16770D                                        72.4    9e-10    
gb|KDP36771.1|  hypothetical protein JCGZ_08062                       72.8    9e-10    
emb|CDY68037.1|  BnaA09g53450D                                        72.4    1e-09    
ref|XP_006306795.1|  hypothetical protein CARUB_v10008332mg           72.8    1e-09    
emb|CAN66286.1|  hypothetical protein VITISV_011184                   71.6    1e-09    
ref|XP_011023132.1|  PREDICTED: U-box domain-containing protein 1...  72.4    1e-09    
ref|XP_008662547.1|  PREDICTED: U-box domain-containing protein 4...  72.8    1e-09    
ref|XP_006828720.1|  hypothetical protein AMTR_s00001p00030110        72.4    1e-09    
gb|EPS57490.1|  hypothetical protein M569_17328                       67.0    1e-09    
ref|XP_003531998.1|  PREDICTED: U-box domain-containing protein 2...  71.2    1e-09    
ref|XP_010940632.1|  PREDICTED: U-box domain-containing protein 12    72.4    1e-09    
ref|XP_009113439.1|  PREDICTED: U-box domain-containing protein 15    72.4    1e-09    
ref|XP_003544976.1|  PREDICTED: U-box domain-containing protein 2...  71.6    1e-09    
ref|XP_007141935.1|  hypothetical protein PHAVU_008G238500g           71.6    1e-09    
gb|KDP42027.1|  hypothetical protein JCGZ_03090                       72.0    1e-09    
dbj|BAK02562.1|  predicted protein                                    72.4    1e-09    
ref|XP_008237964.1|  PREDICTED: U-box domain-containing protein 4...  72.4    1e-09    
ref|XP_010930650.1|  PREDICTED: U-box domain-containing protein 2...  71.2    1e-09    
gb|EEC77320.1|  hypothetical protein OsI_15987                        71.2    1e-09    
ref|XP_009759338.1|  PREDICTED: U-box domain-containing protein 15    72.0    1e-09    
ref|XP_004140474.1|  PREDICTED: U-box domain-containing protein 1...  72.0    1e-09    
ref|XP_007210363.1|  hypothetical protein PRUPE_ppa001500mg           72.4    1e-09    
ref|XP_003574980.1|  PREDICTED: U-box domain-containing protein 9...  71.6    1e-09    
ref|XP_007048413.1|  Spotted leaf protein, putative                   70.1    1e-09    
ref|XP_006847114.1|  hypothetical protein AMTR_s00017p00223570        71.2    1e-09    
ref|XP_006653423.1|  PREDICTED: outer envelope protein 61, chloro...  70.1    1e-09    
ref|XP_011078792.1|  PREDICTED: U-box domain-containing protein 2...  70.9    1e-09    
ref|XP_002315888.2|  hypothetical protein POPTR_0010s12410g           72.0    1e-09    
gb|EAZ23391.1|  hypothetical protein OsJ_07085                        66.6    2e-09    
ref|XP_004489855.1|  PREDICTED: U-box domain-containing protein 1...  72.0    2e-09    
ref|XP_011023140.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-09    
ref|XP_011000894.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-09    
ref|XP_006855711.1|  hypothetical protein AMTR_s00044p00145170        72.0    2e-09    
ref|XP_002984952.1|  ubiquitin-protein ligase, PUB13                  71.6    2e-09    
ref|XP_009624791.1|  PREDICTED: U-box domain-containing protein 1...  71.2    2e-09    
ref|XP_011000892.1|  PREDICTED: U-box domain-containing protein 1...  72.0    2e-09    
ref|XP_011000893.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-09    
ref|XP_004161193.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-09    
ref|XP_004289278.1|  PREDICTED: U-box domain-containing protein 2...  70.9    2e-09    
ref|NP_001052857.1|  Os04g0437300                                     70.9    2e-09    
ref|XP_010471108.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-09    
gb|EMS45692.1|  U-box domain-containing protein 43                    72.0    2e-09    
ref|XP_009793570.1|  PREDICTED: U-box domain-containing protein 2...  70.9    2e-09    
ref|XP_002986139.1|  ubiquitin-protein ligase, PUB13                  71.6    2e-09    
ref|XP_010068460.1|  PREDICTED: U-box domain-containing protein 2...  68.6    2e-09    
ref|XP_009105771.1|  PREDICTED: U-box domain-containing protein 1...  71.2    2e-09    
gb|KEH30893.1|  armadillo/beta-catenin repeat protein                 71.2    2e-09    
ref|XP_009624790.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-09    
gb|AFW86270.1|  putative ARM repeat-containing protein containing...  71.6    2e-09    
ref|XP_004505257.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-09    



>ref|XP_006354198.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Solanum 
tuberosum]
Length=1107

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/764 (54%), Positives = 519/764 (68%), Gaps = 34/764 (4%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDRIAAKH+LQVFCDSP QARTSLLPDLWD +FLP LSHLK+W+  E   L    +K
Sbjct  340   IQKKDRIAAKHLLQVFCDSPFQARTSLLPDLWDRMFLPQLSHLKVWHDSEANFLGDLRNK  399

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS-PQLARNEDPNS  357
             SRKLK+L+K+Y+E +D GT +FAVYYKDWLTEG E P +PS++IP +S  +     + + 
Sbjct  400   SRKLKLLDKLYSENLDKGTYQFAVYYKDWLTEGAEIPLVPSIQIPLISVSREGSFSNSSH  459

Query  358   VSCIVGSFSPQPVVSKKLYDEVFR--HKNGVELDYYKEESYGGS----ASMSNGSVTEET  519
             +S  VGSFSPQPVVSKKLYDEVFR  HK G E + ++EESY  S    A  +  ++   T
Sbjct  460   LSSGVGSFSPQPVVSKKLYDEVFRRSHKLGAESEEHQEESYEISVRKPARFAAKNLVALT  519

Query  520   HCSQIVK-----IEPYATCQSYSMPITEEA------EIQEENKLVEHFSDVHPKPSIQEI  666
             + ++++K      E  AT  SY      +A      +  EE   +E F +   K +    
Sbjct  520   YSAEVIKCIDQDAELGATVDSYGASTAWDAAGVFGTDSPEEKIFMEIFGNSDMKETTTLK  579

Query  667   YGTIDAAPHSKVIKIIIERIAKAFFGQQNTE-----ESVDSERPLGLSIPTEFICPLTGL  831
                +D+   + + K I  RI KA   Q+  E     + VD       +IP EFICPLTGL
Sbjct  580   TNMLDSFAPADLTKFIFSRITKAALEQETEEVVLPAQGVDYVGRTSTNIPQEFICPLTGL  639

Query  832   VFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEH  1011
             +FEDPVTLETGQ+FERA+I +W SKGNRTCP+T + LECQ VP SNFILKRVI  W+SEH
Sbjct  640   IFEDPVTLETGQTFERASIKSWISKGNRTCPVTRRSLECQNVPCSNFILKRVITNWKSEH  699

Query  1012  WQHLLAFSSQFASDS------KAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIH  1173
             W+ LLA+ S+ A +S      K EIAVS+LE+LLI  + D+R   + QL+ LG LQFLI 
Sbjct  700   WRQLLAYFSKLAGNSGGHGWLKNEIAVSVLEQLLIALNQDQRKAALVQLLSLGILQFLIE  759

Query  1174  RFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMT  1353
             RFN GN  EK CVS LL SCIEAD+NCRN++ARN+DK+ LL +L   +L   +N   L+T
Sbjct  760   RFNRGNAREKICVSVLLCSCIEADTNCRNVVARNVDKIRLLNLLQRAELVLRRNTFLLLT  819

Query  1354  ELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQC  1533
             ELICLNRRKDA +F  GL  D+I      L TYLQ   C+QK +VAVL+LHF+LL +T  
Sbjct  820   ELICLNRRKDAKFFFKGLHKDNIVKAMHDLQTYLQDCPCEQKIMVAVLLLHFNLLAETDM  879

Query  1534  SNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFID  1713
              +   D A+DA+T+ALE S  D R  E+CCK LLILG +FS  GKIMTEDWILKQAGF++
Sbjct  880   PSTYRDDAVDAMTLALERSLSDGRSREICCKALLILGGYFSFSGKIMTEDWILKQAGFLE  939

Query  1714  RF--ESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
              F  E+ +E  ++N   +  +  M+D E+E RE+W    SA+L+GSGKKSF+ ALS CL 
Sbjct  940   GFGVENPVEE-QNNALADATVMTMEDEEQETREKWLLDASALLIGSGKKSFVEALSKCLG  998

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLAS  2067
             SGN E+VR+CLTTVAWL    A +S + SEFELSAF A+I QL  CL+HG L+EHKVLAS
Sbjct  999   SGNSEMVRICLTTVAWL--SSALASLNDSEFELSAFLAVITQLIECLQHGDLIEHKVLAS  1056

Query  2068  VCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             +CLLNFS+I ECRVLL+MI E     LE L EVTW A+EL  +I
Sbjct  1057  MCLLNFSRIQECRVLLLMIAEDFVGPLESLVEVTWTAKELYAII  1100



>ref|XP_009761167.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 isoform 
X1 [Nicotiana sylvestris]
Length=1135

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/791 (52%), Positives = 525/791 (66%), Gaps = 60/791 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDRIAAKHILQVFCDSP QART+LLPDLWD+IF  HLS+LK W+  E   L    +K
Sbjct  344   IQKKDRIAAKHILQVFCDSPFQARTNLLPDLWDHIFFRHLSNLKAWFDSEANFLGGLHNK  403

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARN-EDPNS  357
             S KLK LEK+YNE +D GT KFA+YYK+WLTEG + P +PS++IP +S Q   +  + + 
Sbjct  404   STKLKFLEKMYNENLDKGTYKFALYYKEWLTEGADIPLLPSIEIPSVSVQYEGSFSNTSH  463

Query  358   VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEE------SYGGSASMSNGSVTEET  519
             +S  VG FSPQP+VSKKLYDEVF H + +E +  +        S    +S +  ++    
Sbjct  464   LSSTVGGFSPQPMVSKKLYDEVFCHSHKLENESEEHREESYEVSVRRPSSFAAENLVALK  523

Query  520   HCSQIVK-----IEPYATCQSYSMPITEEAE------IQEENKLVEHFSDVHPKPSIQEI  666
             + +++++     +EP A   SY      +AE        EE  L+E F +   K +    
Sbjct  524   YSAEVIERIDHDVEPGAIVDSYGASTARDAEGVSGVNSPEEKNLMETFGNSDRKETTPLK  583

Query  667   YGTIDAAPHSKVIKIIIERIAKAFFGQQNTEES-VDSERPLGL-----------------  792
                 ++   + + + I  RIAKA F ++ TE+S +D+  PL L                 
Sbjct  584   SNMPESFAPANLTEFIFNRIAKAAFERKETEDSIIDAAPPLLLFSEVALALDCTPTEALL  643

Query  793   ----------------SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCP  924
                             +IP EFICPLTGL+FEDPVTLETGQ FERA+I +WFSKGNRTCP
Sbjct  644   PAQGVDYEDYVGRSSANIPQEFICPLTGLLFEDPVTLETGQIFERASITSWFSKGNRTCP  703

Query  925   ITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS------KAEIAVSILE  1086
             +T + LECQ VP +NF LKRVI  W+SEHW+ LL + S+ A DS      K EI VS+L+
Sbjct  704   VTRRLLECQIVPRTNFTLKRVITNWKSEHWRRLLTYFSKAAGDSGKHRWLKNEIVVSVLQ  763

Query  1087  KLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLI  1266
             +LLIV + DER + ++QLI LG LQFLI RFN G L EK  VS +L SCIEAD+NCRN++
Sbjct  764   QLLIVLNQDERRETLEQLISLGSLQFLIQRFNCGKLREKIRVSGILCSCIEADNNCRNVV  823

Query  1267  ARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLS  1446
             A N+DKMCLL +L +E+LE  +NA SL+TELICLNRRKDA +F+ G+  D+I      L 
Sbjct  824   AGNVDKMCLLNLLRNEELELRRNAFSLLTELICLNRRKDAKFFIKGIHKDNIVKTMNDLL  883

Query  1447  TYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCK  1626
              YLQ   C+Q+S+VAVL+LHF LL DT+  N   D A+DA+T+ALESS  DER  E+CCK
Sbjct  884   MYLQDCPCEQRSMVAVLLLHFDLLADTEMLNTYRDDAVDAMTMALESSLSDERSREICCK  943

Query  1627  GLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVRE  1806
              LLILG HFS  GKIMTEDWILKQAGF++ F+ +    E+N+  +  +  M+D EEE R+
Sbjct  944   ALLILGGHFSFSGKIMTEDWILKQAGFLEGFDVEYPDDEENKLVDATVMTMEDEEEEARK  1003

Query  1807  EWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefel  1986
             +W    SA+L+GSGKKSF+ ALS CL SGN ELVR+CLTTVAWL    A +S + SEFEL
Sbjct  1004  KWLVNASALLIGSGKKSFVEALSKCLGSGNSELVRICLTTVAWL--SSALASLTDSEFEL  1061

Query  1987  saFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEV  2166
             SAF A+I QL  CL+HG L+EHKVLAS+ LLNFSKI ECRVLLMMI E I   LE L E+
Sbjct  1062  SAFLAIISQLIECLQHGDLVEHKVLASMSLLNFSKILECRVLLMMIAEDIAGPLESLVEI  1121

Query  2167  TWVARELQTVI  2199
             TW A+EL  +I
Sbjct  1122  TWAAKELYAII  1132



>ref|XP_009626388.1| PREDICTED: uncharacterized protein LOC104117105 isoform X1 [Nicotiana 
tomentosiformis]
Length=1147

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/792 (52%), Positives = 522/792 (66%), Gaps = 61/792 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDRIAAKH+LQVFCDSP QART+LLPDLWD+IFL H S+LK W+  E   L    +K
Sbjct  355   IQKKDRIAAKHLLQVFCDSPFQARTNLLPDLWDHIFLRHFSNLKAWFDSEANFLGGLHNK  414

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQL-ARNEDPNS  357
             SRKLK LEK+YNE +D GT +FA+YYK+WLTEG E P +PS++IP +S Q      + + 
Sbjct  415   SRKLKFLEKMYNENLDNGTYQFALYYKEWLTEGAEIPLLPSIEIPSVSVQYEGSFSNSSH  474

Query  358   VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEE------SYGGSASMSNGSVTEET  519
             +S  VG FSPQPVVSK+LYDEVFRH + +E +  +        S   S+S +  ++    
Sbjct  475   LSSTVGGFSPQPVVSKRLYDEVFRHSHKLENESEEHREESYEVSVRRSSSFAAENLVALK  534

Query  520   HCSQIVK-----IEPYATCQSYSMPITEEAE------IQEENKLVEHFSDVHPKPSIQEI  666
             + ++++K     ++P A   SY      +AE        EE   +E F +   K +    
Sbjct  535   YSAEVIKCIDHDVKPGAIVDSYGASRARDAEGVFGMNSPEEKIFMEIFGNSDLKETTPLK  594

Query  667   YGTIDAAPHSKVIKIIIERIAKAFFGQQNTEES---------------------------  765
                 ++   + + + I  RIAK  F Q+ TE+S                           
Sbjct  595   SNMPESFAPANLTEFIFNRIAKTAFEQKETEDSIIHAAPPLLLFSEVALALDCTPTEVLL  654

Query  766   ----VDSERPLGLS---IPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCP  924
                 VD E  +G S   IP EFICPLTGL+FEDP TLETGQ+FERA+I +WFSKGNR CP
Sbjct  655   PAQGVDYEDYVGRSSANIPQEFICPLTGLLFEDPATLETGQTFERASITSWFSKGNRACP  714

Query  925   ITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS------KAEIAVSILE  1086
             +T + LECQ+VP +NF LK VI  W+SEHW+ LL + S+ A +S      K EI VS+L+
Sbjct  715   VTQRLLECQSVPRANFFLKHVITNWKSEHWRRLLTYFSKEAGNSGKHRWLKNEIVVSVLQ  774

Query  1087  KLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLI  1266
             +LLIV   DER + ++QLI LG LQFLI RFN G   EK CVS +L SCIE D+ CRN++
Sbjct  775   QLLIVLHQDERRETLEQLISLGSLQFLIQRFNYGKAREKICVSGILCSCIEVDNKCRNVV  834

Query  1267  ARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLS  1446
             ARN+DKMCLL +L +E+LE  +NA SL+TELICLNRRKDA +F+  +  D+I      L 
Sbjct  835   ARNVDKMCLLNLLQNEELELRRNAFSLLTELICLNRRKDAKFFIKCIHKDNIVKAMQDLL  894

Query  1447  TYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCK  1626
             TYLQ   C+Q+S+VAVL+LHF LL DT+ +N+  DGA+DAIT+ALESS  DER  E+CCK
Sbjct  895   TYLQDCPCEQRSMVAVLLLHFDLLADTEMANIYRDGAVDAITMALESSLSDERSREICCK  954

Query  1627  GLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEP-DNGRITMMDDGEEEVR  1803
              LLILG HFS  GKIMTEDWILKQAGF++ F+ +    E+N    +  +  M+D EEE R
Sbjct  955   ALLILGGHFSFSGKIMTEDWILKQAGFLEGFDVEYPDEEENNALVDATVMTMEDEEEEAR  1014

Query  1804  EEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefe  1983
             E+W    SA+L+GSGKKSF+ +LS  L SGN ELVR+CLTTVAWL    A +S + SEFE
Sbjct  1015  EKWLVNASALLIGSGKKSFVESLSKWLGSGNSELVRICLTTVAWL--SSALASLTVSEFE  1072

Query  1984  lsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAE  2163
             LSAF A+I QL  CL+HG L+EHKVLASV LLNFSK+ ECRVLLMMI E I   LE L E
Sbjct  1073  LSAFLAIITQLIECLQHGDLVEHKVLASVSLLNFSKVSECRVLLMMIAEDIAAPLETLVE  1132

Query  2164  VTWVARELQTVI  2199
             +TW A+EL  +I
Sbjct  1133  ITWTAKELYAII  1144



>ref|XP_009626396.1| PREDICTED: uncharacterized protein LOC104117105 isoform X2 [Nicotiana 
tomentosiformis]
Length=1147

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/792 (52%), Positives = 522/792 (66%), Gaps = 61/792 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDRIAAKH+LQVFCDSP QART+LLPDLWD+IFL H S+LK W+  E   L    +K
Sbjct  355   IQKKDRIAAKHLLQVFCDSPFQARTNLLPDLWDHIFLRHFSNLKAWFDSEANFLGGLHNK  414

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQL-ARNEDPNS  357
             SRKLK LEK+YNE +D GT +FA+YYK+WLTEG E P +PS++IP +S Q      + + 
Sbjct  415   SRKLKFLEKMYNENLDNGTYQFALYYKEWLTEGAEIPLLPSIEIPSVSVQYEGSFSNSSH  474

Query  358   VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEE------SYGGSASMSNGSVTEET  519
             +S  VG FSPQPVVSK+LYDEVFRH + +E +  +        S   S+S +  ++    
Sbjct  475   LSSTVGGFSPQPVVSKRLYDEVFRHSHKLENESEEHREESYEVSVRRSSSFAAENLVALK  534

Query  520   HCSQIVK-----IEPYATCQSYSMPITEEAE------IQEENKLVEHFSDVHPKPSIQEI  666
             + ++++K     ++P A   SY      +AE        EE   +E F +   K +    
Sbjct  535   YSAEVIKCIDHDVKPGAIVDSYGASRARDAEGVFGMNSPEEKIFMEIFGNSDLKETTPLK  594

Query  667   YGTIDAAPHSKVIKIIIERIAKAFFGQQNTEES---------------------------  765
                 ++   + + + I  RIAK  F Q+ TE+S                           
Sbjct  595   SNMPESFAPANLTEFIFNRIAKTAFEQKETEDSIIHAAPPLLLFSEVALALDCTPTEVLL  654

Query  766   ----VDSERPLGLS---IPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCP  924
                 VD E  +G S   IP EFICPLTGL+FEDP TLETGQ+FERA+I +WFSKGNR CP
Sbjct  655   PAQGVDYEDYVGRSSANIPQEFICPLTGLLFEDPATLETGQTFERASITSWFSKGNRACP  714

Query  925   ITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS------KAEIAVSILE  1086
             +T + LECQ+VP +NF LK VI  W+SEHW+ LL + S+ A +S      K EI VS+L+
Sbjct  715   VTQRLLECQSVPRANFFLKHVITNWKSEHWRRLLTYFSKEAGNSGKHRWLKNEIVVSVLQ  774

Query  1087  KLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLI  1266
             +LLIV   DER + ++QLI LG LQFLI RFN G   EK CVS +L SCIE D+ CRN++
Sbjct  775   QLLIVLHQDERRETLEQLISLGSLQFLIQRFNYGKAREKICVSGILCSCIEVDNKCRNVV  834

Query  1267  ARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLS  1446
             ARN+DKMCLL +L +E+LE  +NA SL+TELICLNRRKDA +F+  +  D+I      L 
Sbjct  835   ARNVDKMCLLNLLQNEELELRRNAFSLLTELICLNRRKDAKFFIKCIHKDNIVKAMQDLL  894

Query  1447  TYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCK  1626
             TYLQ   C+Q+S+VAVL+LHF LL DT+ +N+  DGA+DAIT+ALESS  DER  E+CCK
Sbjct  895   TYLQDCPCEQRSMVAVLLLHFDLLVDTEMANIYRDGAVDAITMALESSLSDERSREICCK  954

Query  1627  GLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEP-DNGRITMMDDGEEEVR  1803
              LLILG HFS  GKIMTEDWILKQAGF++ F+ +    E+N    +  +  M+D EEE R
Sbjct  955   ALLILGGHFSFSGKIMTEDWILKQAGFLEGFDVEYPDEEENNALVDATVMTMEDEEEEAR  1014

Query  1804  EEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefe  1983
             E+W    SA+L+GSGKKSF+ +LS  L SGN ELVR+CLTTVAWL    A +S + SEFE
Sbjct  1015  EKWLVNASALLIGSGKKSFVESLSKWLGSGNSELVRICLTTVAWL--SSALASLTVSEFE  1072

Query  1984  lsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAE  2163
             LSAF A+I QL  CL+HG L+EHKVLASV LLNFSK+ ECRVLLMMI E I   LE L E
Sbjct  1073  LSAFLAIITQLIECLQHGDLVEHKVLASVSLLNFSKVSECRVLLMMIAEDIAAPLETLVE  1132

Query  2164  VTWVARELQTVI  2199
             +TW A+EL  +I
Sbjct  1133  ITWTAKELYAII  1144



>emb|CDP11068.1| unnamed protein product [Coffea canephora]
Length=1103

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/769 (50%), Positives = 504/769 (66%), Gaps = 44/769 (6%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDRIAAKH+LQVF DSP QAR  LLPDLW++IFLPHLS LK+WY  E   L +  +K
Sbjct  340   LQKKDRIAAKHLLQVFVDSPFQARNVLLPDLWEHIFLPHLSELKVWYGNEANFLLNSPTK  399

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLAR-----NE  345
             +RKLK+LEKVYNE +D+GT +FAVYYKDWLTEGVE P +PS++IP +   L       N+
Sbjct  400   TRKLKLLEKVYNEILDSGTYQFAVYYKDWLTEGVEAPLLPSIQIPSIPFHLVEKADLDNQ  459

Query  346   DPNSVSCIVGSFSPQPVVSKKLYDEVFRH--KNGVELDYYKEESYGGSASMSNGSVTEET  519
              P++ S    +F PQ +VSK LYD VF+H  K   E+   +EES+  SA  S+ +  EE 
Sbjct  460   SPDA-SSPASTFLPQTMVSKTLYDSVFKHSVKPAPEVAGCEEESFDISARSSHDAAVEEN  518

Query  520   HCSQIVKIEPYATCQSYSMP-ITEEAEIQEENKLV-----------EHFSDVHPKPSIQE  663
               S+IVK        SY +    E + +    +L+           ++ S+ HP     E
Sbjct  519   SPSEIVKRTLRDDAASYLVSDFCESSFLASFEELLFIIVGAHRWGRDNSSERHP----NE  574

Query  664   IYGTID-------------AAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPT  804
               G+ D               P     ++I+  +A A F QQ  E  +++     LSIP 
Sbjct  575   KVGSHDINLKTSKSVHICTTPPAHNYNQLIVSTVANAVFEQQQPENPINAAGTSFLSIPQ  634

Query  805   EFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKR  984
             +FICPLT ++F++PVTLETGQ+FER+AI++WF KGN TCP+T K LE +AVPL+NFILKR
Sbjct  635   DFICPLTEMLFDEPVTLETGQTFERSAIIDWFGKGNTTCPVTGKILEYRAVPLTNFILKR  694

Query  985   VIDKWRSEHWQHLLAFSSQFAS--DSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGL  1158
             VI  W+ EH ++LL  +SQ     +SK EIAV ILE+L+  SS ++  ++ KQLI LGGL
Sbjct  695   VIVNWKKEHSRNLLDLASQIGESVESKDEIAVFILEQLVAASSQEDGIRSTKQLISLGGL  754

Query  1159  QFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNA  1338
             QFLI RF  G+L E+  VSALL  CI AD + RN +ARNIDK+ LLE+L S  L+S +N 
Sbjct  755   QFLIRRFQCGDLEERTRVSALLLICILADPDYRNHVARNIDKLSLLELLHSRQLKSKRNV  814

Query  1339  ISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLL  1518
             +SL+T+LICLNRRKDA  FL GLQ ++  +   +L  YLQS   +++ LVAVL+LH  L+
Sbjct  815   VSLLTQLICLNRRKDAKCFLEGLQKEETKDALHVLLVYLQSCLFEERPLVAVLLLHLDLM  874

Query  1519  TDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQ  1698
              + Q  +   + A+D ITVALESS  DE++   CC+ LLILG HFS  GK+MTEDWILKQ
Sbjct  875   VEPQEYSAYREEAVDTITVALESSLTDEKVRMKCCRALLILGGHFSFGGKVMTEDWILKQ  934

Query  1699  AGFIDRFESDLESTEDN-EPDNGRITMMDDGEEE-VREEWQARMSAMLLGSGKKSFLGAL  1872
             AGF+     D    E+N   D   + +M+D +EE  RE+W   +SA LLG G KSFL A 
Sbjct  935   AGFLVGPVYDSPDNENNILVDESIMMLMEDADEEKSREKWLMNLSASLLGDGHKSFLAAT  994

Query  1873  SMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEH  2052
             + CL S N +LVRVCLTTVAWL    A  S S +EF+LSAFSALI  LK CLE+ +L+EH
Sbjct  995   ARCLVSENSDLVRVCLTTVAWL--SSALVSLSEAEFQLSAFSALITGLKGCLEN-ELVEH  1051

Query  2053  KVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             K+LAS+ LLNFSK PECR+LLM + E I  +L+ L EVTW A+EL + I
Sbjct  1052  KILASMSLLNFSKFPECRLLLMTMAEDIAASLQSLTEVTWTAKELYSKI  1100



>ref|XP_011080314.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Sesamum 
indicum]
Length=1120

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/764 (49%), Positives = 495/764 (65%), Gaps = 37/764 (5%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE-LGMLESPDS  177
             LQ+KD IAAKH+LQVFCDSP QART+LLP+LW+N+FLPHL HLK+WY KE   + +SP  
Sbjct  360   LQKKDGIAAKHLLQVFCDSPFQARTTLLPELWENVFLPHLLHLKLWYNKESQSLADSP--  417

Query  178   KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNS  357
                 L+ LEKVYNE++D+GT +FA+YYKDW+TEG E PS+P +KIP +S QL   +  + 
Sbjct  418   VLMNLRRLEKVYNESLDSGTYRFAMYYKDWITEGGEAPSVPLIKIPSISLQLMPTDGLHG  477

Query  358   -VSCIVGSFSPQPVVSKKLYDEVFRH--KNGVELDYYKEESYGGSASMSNGSVTEETH--  522
               S      SPQP+VSKKLYDEVFRH  K+GVEL  Y+EE++  SA  SN    E+    
Sbjct  478   HTSSPASHVSPQPMVSKKLYDEVFRHSHKSGVELQAYEEENFDVSAKSSNSPAPEDKQLI  537

Query  523   -CSQIV------KIEPYATCQSYSMPITEEAEIQEENKLVE---HFSDVHPKPSIQEIYG  672
              CS           EP     S  +P+ EEA     + +     ++        + E   
Sbjct  538   LCSHDSVTSTNRNFEPDGDSSSDILPLDEEAPRLHSSAVANLHVNYRACRGNSPVDENKF  597

Query  673   TIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSE-RPLGLSIPTEFICPLTGLVFEDPV  849
              ++  P ++VI++  ++I K+    +  E   DS  +P   SIP +F+CPLTGL+FEDPV
Sbjct  598   LLEW-PENRVIEL--KQIEKSVHNAEQQENFDDSRGKPSLFSIPKDFLCPLTGLLFEDPV  654

Query  850   TLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLA  1029
             TLETGQ+FER AI++WF KG  TCP+T K L+C+AVP +N ILKRVIDKW+++H+++LLA
Sbjct  655   TLETGQTFEREAIIDWFGKGWLTCPVTRKTLQCRAVPPTNLILKRVIDKWKADHFENLLA  714

Query  1030  FSSQFASDSKAEIAVS------ILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGN  1191
               SQ A+     I V       +LE+LLI+ S DER  N +++I  GGLQFL+ RF+ G+
Sbjct  715   LLSQLAAGLNENIEVDDSMTICMLEQLLIIFSKDERIMNARRIISFGGLQFLLRRFHCGS  774

Query  1192  LNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLN  1371
               E+  +  LLS CIEADS CRN +ARNI++  LL++L  E L+   +A+ L+ ELICLN
Sbjct  775   TEERTFILPLLSCCIEADSGCRNDVARNINRSILLQLLHGEHLKLRTDAMLLLAELICLN  834

Query  1372  RRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQC-SNVCI  1548
             RR +A  FL GL  + I N    L  YLQ+   +Q  LVAVL+LH  LL++T C SN+  
Sbjct  835   RRNEAKRFLEGLHDEGIINAMDDLLVYLQTCTLEQTPLVAVLLLHLDLLSETHCSSNIYR  894

Query  1549  DGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESD  1728
               A+DA+T  LE S  +E + + C + LLILG  FS+ GK+MTEDWILK AGF++  + D
Sbjct  895   QEAVDALTTTLERSLSNETIQKKCSRALLILGGIFSSSGKLMTEDWILKLAGFLNGPDWD  954

Query  1729  LESTEDNEPDNGRIT-----MMDDGEEE-VREEWQARMSAMLLGSGKKSFLGALSMCLAS  1890
             +   E ++     I      + +DG+E+  RE W   +S  LLG GKKSFL  +S CL  
Sbjct  955   ITDKEASDITADAIARSVDLLTEDGDEDNAREMWLMSLSPSLLGDGKKSFLETVSKCLRL  1014

Query  1891  GNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASV  2070
             GN +LVRVCLTTVAWL    + +S   +EF+L AFSAL   LK CLEHGKL+EH++LAS+
Sbjct  1015  GNSDLVRVCLTTVAWL--SSSLASLPDTEFQLLAFSALFPPLKQCLEHGKLVEHRILASL  1072

Query  2071  CLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
              LLNFS IPEC +LL  I E I   LE LAEVTW A+EL TVIS
Sbjct  1073  SLLNFSTIPECSILLKKIAEEIGSCLENLAEVTWTAKELSTVIS  1116



>emb|CBI16457.3| unnamed protein product [Vitis vinifera]
Length=1084

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/779 (49%), Positives = 492/779 (63%), Gaps = 60/779 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KD+ +AKHILQVFCDSP QART LLP+LWD +FLP LSHLK+WY +E   L    S+
Sbjct  317   LQKKDKASAKHILQVFCDSPFQARTMLLPELWDYLFLPQLSHLKVWYNQEADSLADAPSR  376

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS----PQLARNED  348
              RKL++LEKVYNE +D GT++FA+YYKDWLTEGVE PS+PS+ +P +S     Q +    
Sbjct  377   QRKLELLEKVYNEILDLGTHQFAIYYKDWLTEGVEAPSVPSIHVPSVSVRGVDQGSSQSH  436

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGV-----ELDYYKEESYGGSASMSNGSVTE  513
                ++  +G FS QP+VSKKLY+ VF   N +     E++ Y E  Y    S  + +V +
Sbjct  437   YQELANPLGPFSTQPMVSKKLYNTVF--GNSIQPQVGEVEEYGEAEYNCMRSSDDSAVED  494

Query  514   E---THCSQIVK-IEPYATCQSYSMPITEEA--------EIQEENKL-----------VE  624
             +   TH S+ VK  + +A       P  E A        E +E  +L            +
Sbjct  495   KQALTHFSEAVKHTDQHAKEHLMENPYDEAAHPEDGHLLEAEESTRLHGVSAPGERDPSD  554

Query  625   HFSDVHPK---PSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLS  795
                D H +   P    ++     AP  +  +  +  +A++ F   +   S  S R    S
Sbjct  555   EVCDSHIRQVPPGSSHMF----HAPIHRANESTLRTLARSVF---DLHISSQSNRSFFSS  607

Query  796   IPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFI  975
             IP +FICPLTG +FEDPVT+ETGQ+FER AI  WF++GNR CP+T K LE   VPL+NFI
Sbjct  608   IPQDFICPLTGRLFEDPVTIETGQTFERHAIREWFNQGNRNCPVTGKALEGLGVPLTNFI  667

Query  976   LKRVIDKWRSEHWQHLLAFSSQFASDS-------KAEIAVSILEKLLIVSSIDERTKNVK  1134
             LKRVID W+SE+ +HLLAF+S+    S       K E A+  LE+ L  SS +E+  N K
Sbjct  668   LKRVIDGWKSENCRHLLAFASKVEGSSGEHGVEPKDETAIYALEQFLSGSSKEEKLTNAK  727

Query  1135  QLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSE  1314
              LI LGGLQFL  RF LGNL EK CV+AL+ SCIEAD  C+N IA+ I K CLLE+L S+
Sbjct  728   HLISLGGLQFLTRRFELGNLEEKTCVAALMCSCIEADYRCKNEIAKYIKKPCLLELLHSK  787

Query  1315  DLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAV  1494
               +S  NA+ L+TELIC++R KD T FLS  Q++ I +   +L  YLQSS  +Q+ LVAV
Sbjct  788   QAKSRTNAVLLLTELICMHRWKDVTLFLSSFQNEGIMSAMHVLLVYLQSSSPEQRPLVAV  847

Query  1495  LILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIM  1674
             L+LH  LL + +  ++  + A+DAI VALE S  DE + E CC+ LLIL  HFS  G + 
Sbjct  848   LLLHLDLLVEPRKYSIYREEAVDAIVVALEGSLTDENVREKCCRALLILTGHFSFSGDVP  907

Query  1675  TEDWILKQAGFIDRFESDLESTEDNEPDNGRI---TMMDDGEEEVREEWQARMSAMLLGS  1845
             TE WILK AG +D    DL S   N  +NG +   T+  D EE+ +EEW   +SA+LLG+
Sbjct  908   TEKWILKPAGPMDSH--DLSSC--NNEENGLLVDGTISLDAEEQAKEEWFRNLSAVLLGN  963

Query  1846  GKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKAC  2025
             G+KSFL A+S CL S + ELVRVCLTTVAWL    A SS S +EF+LSAFSALI +L+  
Sbjct  964   GQKSFLEAISKCLGSDSSELVRVCLTTVAWL--SSALSSLSDAEFQLSAFSALISRLRDN  1021

Query  2026  LEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             LE+ + +EHK+LAS  LL+FSKIPECRVLLM I E I   L  L +VTW A+ L T IS
Sbjct  1022  LENSEQIEHKILASASLLSFSKIPECRVLLMTIAEEIVVPLRSLVQVTWTAKHLYTTIS  1080



>ref|XP_002283306.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Vitis vinifera]
Length=1115

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/800 (48%), Positives = 494/800 (62%), Gaps = 74/800 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KD+ +AKHILQVFCDSP QART LLP+LWD +FLP LSHLK+WY +E   L    S+
Sbjct  320   LQKKDKASAKHILQVFCDSPFQARTMLLPELWDYLFLPQLSHLKVWYNQEADSLADAPSR  379

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS----PQLARNED  348
              RKL++LEKVYNE +D GT++FA+YYKDWLTEGVE PS+PS+ +P +S     Q +    
Sbjct  380   QRKLELLEKVYNEILDLGTHQFAIYYKDWLTEGVEAPSVPSIHVPSVSVRGVDQGSSQSH  439

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGV-----ELDYYKEESYGGSASMSNGSVTE  513
                ++  +G FS QP+VSKKLY+ VF   N +     E++ Y E  Y    S  + +V +
Sbjct  440   YQELANPLGPFSTQPMVSKKLYNTVF--GNSIQPQVGEVEEYGEAEYNCMRSSDDSAVED  497

Query  514   E---THCSQIVK-IEPYATCQSYSMPITEEA--------EIQEENKL-----------VE  624
             +   TH S+ VK  + +A       P  E A        E +E  +L            +
Sbjct  498   KQALTHFSEAVKHTDQHAKEHLMENPYDEAAHPEDGHLLEAEESTRLHGVSAPGERDPSD  557

Query  625   HFSDVH----PKPSIQEIYGTIDAAPHSKV---------IKIIIERIAKAFF--GQQNTE  759
                D H    P  S    +  I  A  S +         + I  +  ++A F   Q N E
Sbjct  558   EVCDSHIRQVPPGSSHMFHAPIHRANESTLRTLARSVFDLHISSQSNSEAIFDPNQTNME  617

Query  760   ESVD---------SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGN  912
              S           +E     SIP +FICPLTG +FEDPVT+ETGQ+FER AI  WF++GN
Sbjct  618   SSAKDLHGNCQYFNEGSFFSSIPQDFICPLTGRLFEDPVTIETGQTFERHAIREWFNQGN  677

Query  913   RTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS-------KAEIA  1071
             R CP+T K LE   VPL+NFILKRVID W+SE+ +HLLAF+S+    S       K E A
Sbjct  678   RNCPVTGKALEGLGVPLTNFILKRVIDGWKSENCRHLLAFASKVEGSSGEHGVEPKDETA  737

Query  1072  VSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSN  1251
             +  LE+ L  SS +E+  N K LI LGGLQFL  RF LGNL EK CV+AL+ SCIEAD  
Sbjct  738   IYALEQFLSGSSKEEKLTNAKHLISLGGLQFLTRRFELGNLEEKTCVAALMCSCIEADYR  797

Query  1252  CRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANI  1431
             C+N IA+ I K CLLE+L S+  +S  NA+ L+TELIC++R KD T FLS  Q++ I + 
Sbjct  798   CKNEIAKYIKKPCLLELLHSKQAKSRTNAVLLLTELICMHRWKDVTLFLSSFQNEGIMSA  857

Query  1432  TILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLI  1611
               +L  YLQSS  +Q+ LVAVL+LH  LL + +  ++  + A+DAI VALE S  DE + 
Sbjct  858   MHVLLVYLQSSSPEQRPLVAVLLLHLDLLVEPRKYSIYREEAVDAIVVALEGSLTDENVR  917

Query  1612  EMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRI---TMMD  1782
             E CC+ LLIL  HFS  G + TE WILK AG +D    DL S   N  +NG +   T+  
Sbjct  918   EKCCRALLILTGHFSFSGDVPTEKWILKPAGPMDSH--DLSSC--NNEENGLLVDGTISL  973

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             D EE+ +EEW   +SA+LLG+G+KSFL A+S CL S + ELVRVCLTTVAWL    A SS
Sbjct  974   DAEEQAKEEWFRNLSAVLLGNGQKSFLEAISKCLGSDSSELVRVCLTTVAWL--SSALSS  1031

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
              S +EF+LSAFSALI +L+  LE+ + +EHK+LAS  LL+FSKIPECRVLLM I E I  
Sbjct  1032  LSDAEFQLSAFSALISRLRDNLENSEQIEHKILASASLLSFSKIPECRVLLMTIAEEIVV  1091

Query  2143  TLECLAEVTWVARELQTVIS  2202
              L  L +VTW A+ L T IS
Sbjct  1092  PLRSLVQVTWTAKHLYTTIS  1111



>emb|CAN71223.1| hypothetical protein VITISV_011730 [Vitis vinifera]
Length=1148

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/800 (48%), Positives = 493/800 (62%), Gaps = 74/800 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KD+ +AKHILQVFCDSP QART LLP+LWD +FLP LSHLK+WY +E   L    S+
Sbjct  353   LQKKDKASAKHILQVFCDSPFQARTMLLPELWDYLFLPQLSHLKVWYNQEADSLADAPSR  412

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS----PQLARNED  348
              RKL++LEKVYNE +D GT++FA+YYKDWLTEGVE PS+PS+ +P +S     Q +    
Sbjct  413   QRKLELLEKVYNEILDLGTHQFAIYYKDWLTEGVEAPSVPSIHVPSVSVRGVDQGSSQSH  472

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGV-----ELDYYKEESYGGSASMSNGSVTE  513
                ++  +G FS QP+VSKKLY+ VF   N +     E++ Y E  Y    S  + +V +
Sbjct  473   YQELANPLGPFSTQPMVSKKLYNTVF--GNSIQPQVGEVEEYGEAEYNCMRSSDDSAVED  530

Query  514   E---THCSQIVK-IEPYATCQSYSMPITEEA--------EIQEENKL-----------VE  624
             +   TH S+ VK  + +A       P  E A        E +E  +L            +
Sbjct  531   KQALTHFSEAVKHTDQHAKEHXMENPYDEAAHPEDGHLLEAEESTRLHGVSAPGERDPSD  590

Query  625   HFSDVH----PKPSIQEIYGTIDAAPHSKV---------IKIIIERIAKAFF--GQQNTE  759
                D H    P  S    +  I  A  S +         + I  +  ++A F   Q N E
Sbjct  591   EVCDSHIRQVPPGSSHMFHAPIHRANESTLRTLARSVFDLHISSQSNSEAIFDPNQTNME  650

Query  760   ESVD---------SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGN  912
              S           +E     SIP +FICPLTG +FEDPVT+ETGQ+FER AI  WF++GN
Sbjct  651   SSAKDLHGNCQYFNEGSFFSSIPQDFICPLTGRLFEDPVTIETGQTFERHAIREWFNQGN  710

Query  913   RTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS-------KAEIA  1071
             R CP+T K LE   VPL+NFILKRVID W+SE+ +HLLAF+S+    S       K E A
Sbjct  711   RNCPVTGKALEGLGVPLTNFILKRVIDGWKSENCRHLLAFASKVEGSSGEHGVEPKDETA  770

Query  1072  VSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSN  1251
             +  LE+ L  SS +E+  N K LI LGGLQFL  RF LGNL EK CV+AL+ SCIEAD  
Sbjct  771   IYALEQFLSGSSKEEKLTNAKHLISLGGLQFLTRRFELGNLEEKTCVAALMCSCIEADYR  830

Query  1252  CRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANI  1431
             C+N IA+ I K CLLE+L S+  +S  NA+ L+TELIC++R KD T FLS  Q++ I + 
Sbjct  831   CKNEIAKYIKKPCLLELLHSKQAKSRTNAVLLLTELICMHRWKDVTLFLSSFQNEGIMSA  890

Query  1432  TILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLI  1611
               +L  YLQSS  +Q+ LVAVL+LH  LL +    ++  + A+DAI VALE S  DE + 
Sbjct  891   MHVLLVYLQSSSPEQRPLVAVLLLHLDLLVEPXKYSIYREEAVDAIVVALEGSLTDENVR  950

Query  1612  EMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRI---TMMD  1782
             E CC+ LLIL  HFS  G + TE WILK AG +D    DL S   N  +NG +   T+  
Sbjct  951   EKCCRALLILTGHFSFSGDVPTEKWILKPAGPMDSH--DLSSC--NNEENGLLVDGTISL  1006

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             D EE+ +EEW   +SA+LLG+G+KSFL A+S CL S + ELVRVCLTTVAWL    A SS
Sbjct  1007  DAEEQAKEEWFRNLSAVLLGNGQKSFLEAISKCLGSDSXELVRVCLTTVAWL--SSALSS  1064

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
              S +EF+LSAFSALI +L+  LE+ + +EHK+LAS  LL+FSKIPECRVLLM I E I  
Sbjct  1065  LSDAEFQLSAFSALISRLRDNLENSEQIEHKILASASLLSFSKIPECRVLLMTIAEEIVV  1124

Query  2143  TLECLAEVTWVARELQTVIS  2202
              L  L +VTW A+ L T IS
Sbjct  1125  PLRSLVQVTWTAKHLYTTIS  1144



>ref|XP_010651317.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Vitis vinifera]
Length=1148

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/800 (48%), Positives = 494/800 (62%), Gaps = 74/800 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KD+ +AKHILQVFCDSP QART LLP+LWD +FLP LSHLK+WY +E   L    S+
Sbjct  353   LQKKDKASAKHILQVFCDSPFQARTMLLPELWDYLFLPQLSHLKVWYNQEADSLADAPSR  412

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS----PQLARNED  348
              RKL++LEKVYNE +D GT++FA+YYKDWLTEGVE PS+PS+ +P +S     Q +    
Sbjct  413   QRKLELLEKVYNEILDLGTHQFAIYYKDWLTEGVEAPSVPSIHVPSVSVRGVDQGSSQSH  472

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGV-----ELDYYKEESYGGSASMSNGSVTE  513
                ++  +G FS QP+VSKKLY+ VF   N +     E++ Y E  Y    S  + +V +
Sbjct  473   YQELANPLGPFSTQPMVSKKLYNTVF--GNSIQPQVGEVEEYGEAEYNCMRSSDDSAVED  530

Query  514   E---THCSQIVK-IEPYATCQSYSMPITEEA--------EIQEENKL-----------VE  624
             +   TH S+ VK  + +A       P  E A        E +E  +L            +
Sbjct  531   KQALTHFSEAVKHTDQHAKEHLMENPYDEAAHPEDGHLLEAEESTRLHGVSAPGERDPSD  590

Query  625   HFSDVH----PKPSIQEIYGTIDAAPHSKV---------IKIIIERIAKAFF--GQQNTE  759
                D H    P  S    +  I  A  S +         + I  +  ++A F   Q N E
Sbjct  591   EVCDSHIRQVPPGSSHMFHAPIHRANESTLRTLARSVFDLHISSQSNSEAIFDPNQTNME  650

Query  760   ESVD---------SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGN  912
              S           +E     SIP +FICPLTG +FEDPVT+ETGQ+FER AI  WF++GN
Sbjct  651   SSAKDLHGNCQYFNEGSFFSSIPQDFICPLTGRLFEDPVTIETGQTFERHAIREWFNQGN  710

Query  913   RTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS-------KAEIA  1071
             R CP+T K LE   VPL+NFILKRVID W+SE+ +HLLAF+S+    S       K E A
Sbjct  711   RNCPVTGKALEGLGVPLTNFILKRVIDGWKSENCRHLLAFASKVEGSSGEHGVEPKDETA  770

Query  1072  VSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSN  1251
             +  LE+ L  SS +E+  N K LI LGGLQFL  RF LGNL EK CV+AL+ SCIEAD  
Sbjct  771   IYALEQFLSGSSKEEKLTNAKHLISLGGLQFLTRRFELGNLEEKTCVAALMCSCIEADYR  830

Query  1252  CRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANI  1431
             C+N IA+ I K CLLE+L S+  +S  NA+ L+TELIC++R KD T FLS  Q++ I + 
Sbjct  831   CKNEIAKYIKKPCLLELLHSKQAKSRTNAVLLLTELICMHRWKDVTLFLSSFQNEGIMSA  890

Query  1432  TILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLI  1611
               +L  YLQSS  +Q+ LVAVL+LH  LL + +  ++  + A+DAI VALE S  DE + 
Sbjct  891   MHVLLVYLQSSSPEQRPLVAVLLLHLDLLVEPRKYSIYREEAVDAIVVALEGSLTDENVR  950

Query  1612  EMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRI---TMMD  1782
             E CC+ LLIL  HFS  G + TE WILK AG +D    DL S   N  +NG +   T+  
Sbjct  951   EKCCRALLILTGHFSFSGDVPTEKWILKPAGPMDSH--DLSSC--NNEENGLLVDGTISL  1006

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             D EE+ +EEW   +SA+LLG+G+KSFL A+S CL S + ELVRVCLTTVAWL    A SS
Sbjct  1007  DAEEQAKEEWFRNLSAVLLGNGQKSFLEAISKCLGSDSSELVRVCLTTVAWL--SSALSS  1064

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
              S +EF+LSAFSALI +L+  LE+ + +EHK+LAS  LL+FSKIPECRVLLM I E I  
Sbjct  1065  LSDAEFQLSAFSALISRLRDNLENSEQIEHKILASASLLSFSKIPECRVLLMTIAEEIVV  1124

Query  2143  TLECLAEVTWVARELQTVIS  2202
              L  L +VTW A+ L T IS
Sbjct  1125  PLRSLVQVTWTAKHLYTTIS  1144



>ref|XP_006445916.1| hypothetical protein CICLE_v10018144mg [Citrus clementina]
 gb|ESR59156.1| hypothetical protein CICLE_v10018144mg [Citrus clementina]
Length=1088

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/771 (45%), Positives = 483/771 (63%), Gaps = 45/771 (6%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDR++AKH+LQVFCDSP  ART+LLP+LWD +  PHL+HLK WY +E   L    +K
Sbjct  320   IQKKDRVSAKHLLQVFCDSPFMARTTLLPELWDYLISPHLAHLKAWYKQEADSLADESNK  379

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNE----D  348
              RK+K+LEKVYNE +D+GT +FAVYYKDWLTEG+E PS+P+++IP LS Q  + +    +
Sbjct  380   PRKMKLLEKVYNEILDSGTYQFAVYYKDWLTEGIEDPSVPTIQIPSLSVQRHQRKGSFGN  439

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKE----ESYGGSASMSNGSVTEE  516
              + V+    +FSPQP VSKKLYD VF   +   +D  ++    E++   A  S GS  E+
Sbjct  440   SSEVASPAAAFSPQPTVSKKLYDAVFERASKPRVDAAEDDGEMENFDNYARSSGGSTVEK  499

Query  517   ---THCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAA  687
                T+ S+I      A  + + +P     +   E  +  + +       IQ I   +   
Sbjct  500   RTLTYSSEIEDELLLAAEEGWRLP---GVKYPAERNINSNINICCTSKKIQTI--KLYTP  554

Query  688   PHSKVIKIIIERIAKAFFGQQNTE---------ESVDSERPLGL----------SIPTEF  810
             P +K  ++ ++R+AK+ F QQ TE             SE P+ L          SIP +F
Sbjct  555   PDTKANELTLKRLAKSAFEQQQTEGCTALTISSPPSTSEAPVNLRPSFEGSFLTSIPQDF  614

Query  811   ICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVI  990
             ICPLTG +FE+PVTLE+GQ+FE  AI  W  +GNRTCP+T K L C ++PL+NFILKRVI
Sbjct  615   ICPLTGQLFEEPVTLESGQTFECEAIKEWIEQGNRTCPVTGKYLACPSLPLTNFILKRVI  674

Query  991   DKWRSEHWQHLLAFSSQFASDSKA-------EIAVSILEKLLIVSSIDERTKNVKQLICL  1149
             D W+SE+  HLLAF+ Q    S+        E A+ ILE+LL V S  ER  N K LI +
Sbjct  675   DGWKSENCMHLLAFAFQIVEKSRMNESKNGDETAIFILEQLLTVFSDQERITNAKHLISI  734

Query  1150  GGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESV  1329
             GGLQFLI RF  G L EK  V+AL+  CIEAD+ CRN +ARNI+   LLE+L S+ ++  
Sbjct  735   GGLQFLICRFESGKLEEKARVAALMCCCIEADAGCRNQMARNINVYSLLELLHSKQVKPR  794

Query  1330  QNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHF  1509
              N + L+ +LICL+RR+D +  L  +Q++++ N   +L  YLQ S  +Q+ L ++L+LH 
Sbjct  795   TNTVLLLIDLICLSRRRDVSTLLRNVQNEELVNAMHVLLLYLQRSPPEQRPLFSILLLHL  854

Query  1510  HLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWI  1689
              LL + +  ++  + A+DAITVALE S  DE++ E CC+ LLILG  FS   ++  E WI
Sbjct  855   DLLVEPRKYSIYREAAVDAITVALEESLTDEKIQEKCCRALLILGGRFSFSREVANESWI  914

Query  1690  LKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGA  1869
             LK AGF DR E +    ++N+      T +DD EE+  EEW  ++SA LLG+ K+SFL  
Sbjct  915   LKPAGFNDRCEGNSLDNDENDLPVDDSTPLDD-EEQASEEWLRKLSASLLGNRKRSFLET  973

Query  1870  LSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLE  2049
             +S  L S N +LV VCLTTVAWL    A S++  +EF+LSAFSA+I QLK  L++G+  +
Sbjct  974   VSKILGSRNSDLVSVCLTTVAWL--SHALSAQPDAEFQLSAFSAVISQLKEILQNGEQPQ  1031

Query  2050  HKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
              KVLAS+ LLNFSKIPEC  +L  I   I   L+ L EVTW  +EL  +I+
Sbjct  1032  QKVLASMSLLNFSKIPECGAVLKTIAAEIRIPLQSLTEVTWTTQELCAIIA  1082



>gb|KDO56433.1| hypothetical protein CISIN_1g041480mg [Citrus sinensis]
Length=1122

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/801 (44%), Positives = 489/801 (61%), Gaps = 71/801 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDR++AKH+LQVFCDSP  ART+LLP+LWD +  PHL+HLK WY +E   L    +K
Sbjct  320   IQKKDRVSAKHLLQVFCDSPFMARTTLLPELWDYLISPHLAHLKAWYKQEADSLADESNK  379

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNE----D  348
              RK+K+LEKVYNE +D+GT +FAVYYKDWLTEG+E PS+P+++IP LS Q  + +    +
Sbjct  380   PRKMKLLEKVYNEILDSGTYQFAVYYKDWLTEGIEDPSVPTIQIPSLSVQRHQRKGSFGN  439

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKE----ESYGGSASMSNGSVTEE  516
              + V+    +FSPQP VSKKLYD VF   +   +D  ++    E++   A  S GS  E+
Sbjct  440   SSEVASPAAAFSPQPTVSKKLYDAVFERASKPRVDAAEDDGEMENFDNYARSSGGSTVEK  499

Query  517   ---THCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQ-----EIYG  672
                T+ S+IVK   Y   +  S  I ++     E++L+    +    P ++      I  
Sbjct  500   RTLTYSSEIVKCT-YQDTEDDSPKIAQDDLFHPEDELLLAAEEGWRLPGVKYPAERNINS  558

Query  673   TID--------------AAPHSKVIKIIIERIAKAFFGQQNTE---------ESVDSERP  783
              I+                P +K  ++ ++R+AK+ F QQ TE             SE P
Sbjct  559   NINICCTSKKIQTIKLYTPPDTKANELTLKRLAKSAFEQQQTEGCTALTISSPPSTSEAP  618

Query  784   LGL---------------------SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWF  900
             + L                     SIP +FICPLTG +FE+PVTLE+GQ+FE  AI  W 
Sbjct  619   VNLRPSFEELHENDEYFDKGSFLTSIPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWI  678

Query  901   SKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKA------  1062
              +GNRTCP+T K L C ++PL+NFILKRVID W+SE+  HLLAF+ Q    S+       
Sbjct  679   EQGNRTCPVTGKYLACPSLPLTNFILKRVIDGWKSENCMHLLAFAFQIVEKSRMNESKNG  738

Query  1063  -EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIE  1239
              E A+ ILE+LL V S  ER  N K LI +GGLQFLI RF  G L EK  V+AL+  CIE
Sbjct  739   DETAIFILEQLLTVFSDQERITNAKHLISIGGLQFLICRFESGKLEEKARVAALMCCCIE  798

Query  1240  ADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDD  1419
             AD+ CRN +ARNI+   LLE+L S+ ++   N + L+ +LICL+RR+D +  L  +Q+++
Sbjct  799   ADAGCRNQMARNINVYSLLELLHSKQVKPRTNTVLLLIDLICLSRRRDVSTLLRNVQNEE  858

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLD  1599
             + N   +L  YLQ S  +Q+ L ++L+LH  LL + +  ++  + A+DAITVALE S  D
Sbjct  859   LVNAMHVLLLYLQRSPPEQRPLFSILLLHLDLLVEPRKYSIYREAAVDAITVALEESLTD  918

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             E++ E CC+ LLILG  FS   ++  E WILK AGF DR E +    ++N+      T +
Sbjct  919   EKIQEKCCRALLILGGRFSFSREVANESWILKPAGFNDRCEGNSLDNDENDLPVDDSTPL  978

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             DD EE+  EEW  ++SA LLG+ K+SFL  +S  L S N +LV VCLTTVAWL    A S
Sbjct  979   DD-EEQASEEWLRKLSASLLGNRKRSFLETVSKILGSRNSDLVSVCLTTVAWL--SHALS  1035

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
             ++  +EF+LSAFSA+I QLK  L++G+  + KVLAS+ LLNFSKIPEC  +L  I   I 
Sbjct  1036  AQPDAEFQLSAFSAVISQLKEILQNGEQPQQKVLASMSLLNFSKIPECGAVLKTIAAEIR  1095

Query  2140  DTLECLAEVTWVARELQTVIS  2202
               L+ L EVTW  +EL  +I+
Sbjct  1096  IPLQSLTEVTWTTQELCAIIA  1116



>ref|XP_007014823.1| U-box domain-containing protein 42, putative [Theobroma cacao]
 gb|EOY32442.1| U-box domain-containing protein 42, putative [Theobroma cacao]
Length=1156

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/822 (45%), Positives = 484/822 (59%), Gaps = 94/822 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDR++AKHILQVFCDSP QART+LLP+LWD +F PHLSHLK WY +E   L    + 
Sbjct  333   LQKKDRVSAKHILQVFCDSPFQARTNLLPELWDYLFFPHLSHLKAWYNQEADSLSDAVNS  392

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP---  351
              RKLK+LEKVY + +D+ T + AVYYKDWLTEGVE PS PS+ IP +S    + +D    
Sbjct  393   ERKLKLLEKVYIDILDSSTYQLAVYYKDWLTEGVEAPSFPSIHIPSVSAGKFQQDDSLAH  452

Query  352   -NSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKE-------ESYGGSASMSNGSV  507
                ++   G FSPQP+VSKK YD VF   N   L+  ++       E+   S+      V
Sbjct  453   SPQLASPAGPFSPQPMVSKKFYDAVFGRSNKPGLEEAEDNVEPHNCETCRRSSDGDTVDV  512

Query  508   TEETHCSQIVKIEPY-----ATCQS------YSMPITEEAEIQEENKLVEHFSDVH-PKP  651
              +   CS      PY     A+ +S      +S+   ++A   E+        D   P  
Sbjct  513   KQTLTCSSEAIKHPYQDNGEASSKSPQDDASFSLLAQDDASFLEDGTSSTAEKDWRLPGL  572

Query  652   SIQ---EIYGTIDAAP---------------HSKVI----KIIIERIAKAFFGQQNTEES  765
             S+Q   +I+ T + +                H+ V+    +++++R+AK+ F  Q TE  
Sbjct  573   SMQKEKDIHCTNNRSKADNIWQTTAQDFDVLHAPVLLIANELMLKRLAKSAFEPQQTECK  632

Query  766   VD--------------------------------------SERPLGLSIPTEFICPLTGL  831
             VD                                       E  L  SIP +FICPLTG 
Sbjct  633   VDVTLKGLPNPSEELIHNTLENPTKVRSSFEELHESYRFFDEESLLSSIPQDFICPLTGK  692

Query  832   VFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEH  1011
             +FEDPVTLETGQ+FER AI  WF++GNRTCP+T K LEC +VPL+NFILKRVID W+SE+
Sbjct  693   LFEDPVTLETGQTFERVAIKEWFNQGNRTCPVTGKTLECLSVPLTNFILKRVIDSWKSEN  752

Query  1012  WQHLLAF-------SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLI  1170
               H LA        S +  S S+ E    IL++LL     +ER  N K LI LGGL FLI
Sbjct  753   CTHTLALAFLIVGNSREPGSPSRGERTTFILQQLLTTLGTEERIMNTKHLISLGGLPFLI  812

Query  1171  HRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLM  1350
              RF  GNL EK  V+ALLS CIEADS+CR  IAR+I+K CL+E++CS+  +S  NA+ L+
Sbjct  813   QRFESGNLEEKTRVAALLSCCIEADSSCRYHIARDINKQCLVELICSKQDKSRGNAVLLL  872

Query  1351  TELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQ  1530
             TELICL+RRKD    LS L++++I N    L  YLQSS   Q+ LVA L+L+   L + +
Sbjct  873   TELICLSRRKDVPLLLSELKNEEIVNTMHALHVYLQSSPPVQRPLVATLLLNIDHLVEPR  932

Query  1531  CSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFI  1710
               ++    A+D IT AL++S +DE + E CC+ LLILG  FS  GK++TE WILK AGF 
Sbjct  933   KYSLYRQEALDVITEALDNSLIDEEVREKCCRALLILGGRFSLSGKLLTEGWILKLAGFN  992

Query  1711  DRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLAS  1890
             D  E  + S +  E  +   T++ + EE   E+W   +S  L+GSG+KSFL A+S CL+S
Sbjct  993   DGCE--VNSIDKEEDVDVDDTILLEDEECANEDWLRNLSVSLVGSGEKSFLKAISKCLSS  1050

Query  1891  GNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASV  2070
             GN++LV  CLTTV WL    A SS + +E  LS F  LI QLK  LE+G  +EHKVLAS+
Sbjct  1051  GNLDLVTACLTTVVWL--TSALSSLTDAEVRLSTFCTLISQLKQILENGAQVEHKVLASM  1108

Query  2071  CLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTV  2196
              LLNFSKI ECR LLM I E I   L  LA+VTW A++L  +
Sbjct  1109  SLLNFSKISECRGLLMTIIEEIAIPLRSLADVTWTAKQLYGI  1150



>gb|EYU46326.1| hypothetical protein MIMGU_mgv1a019255mg, partial [Erythranthe 
guttata]
Length=916

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/745 (47%), Positives = 461/745 (62%), Gaps = 77/745 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKEL-GMLESPDS  177
             +Q KDRI+AKH+LQVFCDSPLQARTSLLPDLWD +FLPHLSHLKIWY KE   + +SP +
Sbjct  234   IQNKDRISAKHLLQVFCDSPLQARTSLLPDLWDRLFLPHLSHLKIWYEKETRSVTDSPTN  293

Query  178   KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQL-ARNEDPN  354
                 LK+LEK YNE +D+GT  FA YYKDW+TEG E PS P +KIP LS +L  R     
Sbjct  294   ----LKILEKAYNECLDSGTYSFAKYYKDWITEGAETPSAPVIKIPSLSFRLMPRGGLYG  349

Query  355   SVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCSQI  534
               S      SPQ +VSKKLYDEVFRH              G  + +S  S +      Q+
Sbjct  350   HASSPASHVSPQTMVSKKLYDEVFRHS----------RKSGTDSEVSRSSDSPAAEDKQL  399

Query  535   VKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPHSKVIKII  714
             +      + +S +  + E+ E    N + E    + P+PSIQE +   +  PHS      
Sbjct  400   I----LYSLKSSADNLPEDPE----NPMFE-LKQIEPEPSIQENHENYEK-PHSVN----  445

Query  715   IERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILN  894
                                       S+P +F+CPLTGL+FE+PVTLETGQ+FER +I++
Sbjct  446   --------------------------SMPEDFLCPLTGLLFEEPVTLETGQTFERESIID  479

Query  895   WFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAV  1074
             WF+KG  TCP+T K L  +A P  N ILKRVIDKW+++H++HL    S+  SD      V
Sbjct  480   WFNKGFLTCPVTRKTLRSRAAPPVNLILKRVIDKWKTDHFEHLFTLLSREESDEST--TV  537

Query  1075  SILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNE-KKCVSALLSSCIEADSN  1251
              I+++LL V S DER  N +++I  GGLQFL+ RF+     E K  +  LL  CIEAD  
Sbjct  538   CIIQQLLGVFSKDERIINARRIISSGGLQFLMRRFDSARKAEDKSSILPLLLFCIEADVA  597

Query  1252  CRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANI  1431
              RN+IARNI++  LLE+L +E ++S  NA+ L+ ELICLNRR +A  F  GL  +DI + 
Sbjct  598   SRNIIARNINRWNLLELLHTEHIKSRTNAVLLLMELICLNRRNEAKCFFGGLCEEDIISA  657

Query  1432  TILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLI  1611
                L  YLQ+   +Q   VAV++LHF +L++ + SNV    A+D+IT+A+E S  D  + 
Sbjct  658   MDDLLVYLQTCPFEQTPRVAVVLLHFDILSEIETSNVYRQEAVDSITIAIERSLSDGNIR  717

Query  1612  EMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM-----  1776
             + C + LLILG  FS+ GK+MTEDWILK AGF++  +SD+   E N+     IT+     
Sbjct  718   KECSRSLLILGGFFSSSGKLMTEDWILKLAGFLNGPDSDIAEDEGND-----ITVDATVD  772

Query  1777  ---MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssv  1947
                 +  EE  RE+W   +SA L+G GKKSFL  LS CL  GN +  RVCLTTVAWL   
Sbjct  773   FFCEEGEEENEREKWLMSLSASLVGDGKKSFLDTLSKCLLLGNSDFARVCLTTVAWL---  829

Query  1948  lasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIG  2127
               S S + +EF + AFSAL+  LK CLE+G+++EHK+LAS  LLNFS IPECR+LLM IG
Sbjct  830   --SFSLNETEFRVCAFSALVSPLKQCLEYGRMVEHKILASFSLLNFSSIPECRLLLMKIG  887

Query  2128  EVIEDTLECLAEVTWVARELQTVIS  2202
             + I   L+ LAEVTW A+EL TVIS
Sbjct  888   DEIGPCLKNLAEVTWTAKELCTVIS  912



>ref|XP_006492727.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Citrus 
sinensis]
Length=1138

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/817 (43%), Positives = 488/817 (60%), Gaps = 87/817 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDR++AKH+LQVFCDSP  ART+LLP+LWD +  PHL+HLK WY +E   L    +K
Sbjct  320   IQKKDRVSAKHLLQVFCDSPFMARTTLLPELWDYLISPHLAHLKAWYKQEADSLADESNK  379

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNE----D  348
              RK+K+LEKVYNE +D+GT +FAVYYKDWLTEG+E PS+P+++IP LS Q  + +    +
Sbjct  380   PRKMKLLEKVYNEILDSGTYQFAVYYKDWLTEGIEDPSVPTIQIPSLSVQRHQRKGSFGN  439

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKE----ESYGGSASMSNGSVTEE  516
              + V+    +FSPQP VSKKLYD VF   +   +D  ++    E++   A  S GS  E+
Sbjct  440   SSEVASPAAAFSPQPTVSKKLYDAVFERASKPRVDAAEDDGEMENFDNYARSSGGSTVEK  499

Query  517   ---THCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQ-----EIYG  672
                T+ S+IVK   Y   +  S  I ++     E++L+    +    P ++      I  
Sbjct  500   RTLTYSSEIVKCT-YQDTEDDSPKIAQDDLFHPEDELLLAAEEGWRLPGVKYPAERNINS  558

Query  673   TID--------------AAPHSKVIKIIIERIAKAFFGQQNTE---------ESVDSERP  783
              I+                P +K  ++ ++R+AK+ F QQ TE             SE P
Sbjct  559   NINICCTSKKIQTIKLYTPPDTKANELTLKRLAKSAFEQQQTEGCTALTISSPPSTSEAP  618

Query  784   LGL---------------------SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWF  900
             + L                     SIP +FICPLTG +FE+PVTLE+GQ+FE  AI  W 
Sbjct  619   VNLRPSFEELHENDEYFDKGSFLTSIPQDFICPLTGQLFEEPVTLESGQTFECEAIKEWI  678

Query  901   SKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKA------  1062
              +GNRTCP+T K L C ++PL+NFILKRVID W+SE+  HLLAF+ Q    S+       
Sbjct  679   EQGNRTCPVTGKYLACPSLPLTNFILKRVIDGWKSENCMHLLAFAFQIVEKSRMNESKNG  738

Query  1063  -EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIE  1239
              E A+ ILE+LL V S  ER  N K LI +GGLQFLI RF  G L EK  V+AL+  CIE
Sbjct  739   DETAIFILEQLLTVFSDQERITNAKHLISIGGLQFLICRFESGKLEEKARVAALMCCCIE  798

Query  1240  ADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDD  1419
             AD+ CRN +ARNI+   LLE+L S+ ++   N + L+ +LICL+RR+D +  L  +Q+++
Sbjct  799   ADAGCRNQMARNINVYSLLELLHSKQVKPRTNTVLLLIDLICLSRRRDVSTLLRNVQNEE  858

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLIL----------------HFHLLTDTQCSNVCID  1551
             + N   +L  YLQ S  +Q+ L ++L+L                 F +  + +  ++  +
Sbjct  859   LVNAMHVLLLYLQRSPPEQRPLFSILLLHLDLLMTYRNQVFFSDKFMMQVEPRKYSIYRE  918

Query  1552  GAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDL  1731
              A+DAITVALE S  DE++ E CC+ LLILG  FS   ++  E WILK AGF DR E + 
Sbjct  919   AAVDAITVALEESLTDEKIQEKCCRALLILGGRFSFSREVANESWILKPAGFNDRCEGNS  978

Query  1732  ESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVR  1911
                ++N+      T +DD EE+  EEW  ++SA LLG+ K+SFL  +S  L S N +LV 
Sbjct  979   LDNDENDLPVDDSTPLDD-EEQASEEWLRKLSASLLGNRKRSFLETVSKILGSRNSDLVS  1037

Query  1912  VCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
             VCLTTVAWL    A S++  +EF+LSAFSA+I QLK  L++G+  + KVLAS+ LLNFSK
Sbjct  1038  VCLTTVAWL--SHALSAQPDAEFQLSAFSAVISQLKEILQNGEQPQQKVLASMSLLNFSK  1095

Query  2092  IPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             IPEC  +L  I   I   L+ L EVTW  +EL  +I+
Sbjct  1096  IPECGAVLKTIAAEIRIPLQSLTEVTWTTQELCAIIA  1132



>ref|XP_002304021.1| hypothetical protein POPTR_0003s21700g [Populus trichocarpa]
 gb|EEE79000.1| hypothetical protein POPTR_0003s21700g [Populus trichocarpa]
Length=1159

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/804 (45%), Positives = 478/804 (59%), Gaps = 83/804 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             L++KD+++AKH+LQVFCDSP  ART LL +LWD +F PHLSHLK WY KE   L +  SK
Sbjct  365   LRKKDKVSAKHLLQVFCDSPFLARTLLLSELWDYLFFPHLSHLKTWYKKEADPLFNTASK  424

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
               KLK L+KVYNE +D+ T +FAVYYKDWL EGVE PSIPSV IPF+S Q    +  +  
Sbjct  425   ITKLKFLDKVYNEVLDSCTYQFAVYYKDWLAEGVEAPSIPSVNIPFISQQGGTQDHSSGP  484

Query  361   SCIVGSFSPQPVVSKKLYDEVFRHKNGVEL----DYYKEESYGGSASMSNGSVTEE----  516
             +     F PQP+VSKKLYD VF H +   +    + +K +++   A+ S  S  +     
Sbjct  485   ASPAAPFLPQPMVSKKLYDAVFGHSSKPRVYDAEENWKADNFNNGANSSGSSPIQVKQTL  544

Query  517   THCSQIVKIEPYATCQSYSMPITEE----------AEIQEENKLVE-------HFSDVHP  645
             T  S++VK  P    +++S     +          +   EE KLV           D + 
Sbjct  545   TSSSEMVKY-PGQDIENHSPENLHDNTSILDNGLLSASDEEWKLVNVSVSPDTDLKDDNR  603

Query  646   KPSIQEIYG----TIDAAPHSKVIKIIIERIAKAFFGQQNTEESVD--------------  771
             K S  ++       ++++ H+K  ++ ++ +AK+ F  Q TE+S D              
Sbjct  604   KSSAGQVSAGDTHMLNSSSHTKENELTLKTLAKSVFKIQRTEDSGDLTVSDLLHPKKAIN  663

Query  772   ---------------SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSK  906
                             E  +  SIP +F+CPLT  +FEDPVTLETGQ+FER AI  WF++
Sbjct  664   ASASIEGLNGSHESFDEGSIFESIPQDFVCPLTRQLFEDPVTLETGQTFEREAIRKWFNQ  723

Query  907   GNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKA-------E  1065
             GNRTCP+T K LEC  +PL+NFILKR+ID W+ E   HLL+F+SQ   +S+A       E
Sbjct  724   GNRTCPLTGKTLECPTIPLTNFILKRMIDSWKLERCNHLLSFASQIFKNSEAYDSRQRNE  783

Query  1066  IAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEAD  1245
              A+ ILEKLL  SS +ER  N K LI LG L+FLI RF  G+L EK  V+ALLS CIEA+
Sbjct  784   DALFILEKLLASSSREERLTNAKHLISLGVLEFLIKRFEFGSLEEKTLVAALLSCCIEAE  843

Query  1246  SNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             S+CRN IA  IDK CL E+L     +S +N + L+ EL+CL+RRK  T F+SGL S+ I 
Sbjct  844   SSCRNHIAIKIDKQCLFELLHGNQSKSARNVVGLLIELVCLSRRKGVTQFISGLPSETIV  903

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             +   +L  YLQSS   ++ LVAVLILH  LL + +  ++    A+DAI++ALESS  DE+
Sbjct  904   HAMDILLVYLQSSPA-EEPLVAVLILHLDLLVEPRKYSIYRKEAVDAISMALESSLTDEK  962

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
             + E  C+ L +LG  FSA G   TE WILKQAGF    E  + S EDN        ++DD
Sbjct  963   VREQSCRALNVLGGIFSASGNSSTESWILKQAGFDKNHE--VNSREDN-------LLLDD  1013

Query  1786  -----GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvl  1950
                   EEE  EEW   +S  LL +GK S L  +S CL+SG ++LVR CLTT+AWL    
Sbjct  1014  PLSPEDEEESSEEWLRNLSESLLANGKMSILETISKCLSSGILDLVRACLTTIAWL--SC  1071

Query  1951  asssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGE  2130
               S    SE +L  F  LI  LK  LE  + +EH+VLAS+ LLN SK PEC  LLM+I E
Sbjct  1072  GISLLPDSELQLFGFPTLISGLKEILEDDEQIEHQVLASMSLLNLSKNPECGSLLMIIAE  1131

Query  2131  VIEDTLECLAEVTWVARELQTVIS  2202
              I   L+ LAEVTW A+EL  +IS
Sbjct  1132  EISVPLQSLAEVTWTAKELHAIIS  1155



>ref|XP_011025219.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Populus 
euphratica]
 ref|XP_011025220.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Populus 
euphratica]
Length=1159

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/802 (45%), Positives = 483/802 (60%), Gaps = 79/802 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             L++KD+++AKH+LQVFCDSPL ART LL +LWD +F PHLSHLK WY +E   L +  SK
Sbjct  365   LRKKDKVSAKHLLQVFCDSPLLARTLLLSELWDYLFFPHLSHLKTWYKQEADPLLNTASK  424

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
               KLK L+KVYNE +D+ T +FA YYKDWLTEG E PSIPSV IPF+S Q    +  +  
Sbjct  425   ITKLKFLDKVYNEVLDSSTYQFAFYYKDWLTEGAEAPSIPSVNIPFISQQGVSQDHSSGP  484

Query  361   SCIVGSFSPQPVVSKKLYDEVFRH--KNGVELDYYKEESY-------GGSASMSNGSVTE  513
             +     FSPQP+VSKKLYD VF H  K GV   Y  EE++       G ++S+S+    +
Sbjct  485   ASPAAPFSPQPMVSKKLYDAVFGHSSKPGV---YDAEENWKADNFNNGANSSVSSPIQVK  541

Query  514   ET--HCSQIVKIEPYATCQSYSMPITEE----------AEIQEENKLVE-------HFSD  636
             +T    S++VK  P    +++S    ++          +   +E KLV           D
Sbjct  542   QTLTSSSEMVKY-PGQDIENHSPENLQDNTSILDNGLLSASDKEWKLVNVSVSPDTDLKD  600

Query  637   VHPKPSIQEIYG----TIDAAPHSKVIKIIIERIAKAFFGQQNTEESVD-----------  771
                K S  ++       ++++ H+K  ++ ++ +AK+ F  Q TE+S D           
Sbjct  601   DFRKSSAGQVSAGDSHMLNSSSHTKENELTLKTLAKSVFKIQRTEDSGDLTVSNLSHSKK  660

Query  772   ------------------SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNW  897
                                E  +  SIP +F+CPLT  +F+DPVTLETGQ+FER AI  W
Sbjct  661   AINASASIEGLNGSHEYFDEGSIFESIPQDFVCPLTRQLFDDPVTLETGQTFEREAIRKW  720

Query  898   FSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKA-----  1062
             F++GNRTCPIT K LEC  +PL+NFILKR+ID W+ E   HLL+F+SQ  S+S+A     
Sbjct  721   FNQGNRTCPITGKTLECPTIPLTNFILKRMIDSWKLERCNHLLSFASQTFSNSEAYDSSQ  780

Query  1063  --EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCI  1236
               E A+ ILEKLL  SS +ER  N K LI LG L+FLI RF  G+L EK  V+ALLS CI
Sbjct  781   RNENALFILEKLLASSSREERLTNAKLLISLGVLEFLIKRFEFGSLEEKTLVAALLSYCI  840

Query  1237  EADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD  1416
             EA+S+CRN IA  IDK CL E+L S   +S +N + L+ EL+CL+RRK  T F+SGL S+
Sbjct  841   EAESSCRNHIAIKIDKQCLFELLYSNQSKSARNVVCLLIELVCLSRRKGVTQFISGLSSE  900

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
              I +   +L  YLQSS  ++  LVAVLILH  LL + +  ++    A+DAI++ALESS  
Sbjct  901   TIVHAMDILLVYLQSSPAEEP-LVAVLILHLDLLVEPRKYSIYRKEAVDAISMALESSLT  959

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
             DE++ E  C+ L +LG  FSA G   TE WILKQAG    F+ + E     +       +
Sbjct  960   DEKVREQSCRALNVLGGFFSASGNSSTESWILKQAG----FDKNHEVNSREDNLLLDDPL  1015

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlas  1956
             + + EEE  EEW   ++  LL +GK S L  +S CL+SG ++LVR CLTT+AWL      
Sbjct  1016  LPEDEEESSEEWLRNLAESLLANGKMSILETISKCLSSGILDLVRACLTTIAWL--SCGI  1073

Query  1957  ssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVI  2136
             S    SE +L  F  LI  L+  LE  + +EH+VLAS+ LLN SK PECR LLM+I E I
Sbjct  1074  SLLPDSELQLFGFPTLISGLEEILEDDEQIEHQVLASMSLLNLSKNPECRSLLMIIAEEI  1133

Query  2137  EDTLECLAEVTWVARELQTVIS  2202
                L+ LAEVTW A+EL  +IS
Sbjct  1134  SVPLQSLAEVTWTAKELHAIIS  1155



>ref|XP_009761169.1| PREDICTED: uncharacterized protein LOC104213366 isoform X2 [Nicotiana 
sylvestris]
Length=1001

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/642 (50%), Positives = 416/642 (65%), Gaps = 58/642 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDRIAAKHILQVFCDSP QART+LLPDLWD+IF  HLS+LK W+  E   L    +K
Sbjct  344   IQKKDRIAAKHILQVFCDSPFQARTNLLPDLWDHIFFRHLSNLKAWFDSEANFLGGLHNK  403

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARN-EDPNS  357
             S KLK LEK+YNE +D GT KFA+YYK+WLTEG + P +PS++IP +S Q   +  + + 
Sbjct  404   STKLKFLEKMYNENLDKGTYKFALYYKEWLTEGADIPLLPSIEIPSVSVQYEGSFSNTSH  463

Query  358   VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEE------SYGGSASMSNGSVTEET  519
             +S  VG FSPQP+VSKKLYDEVF H + +E +  +        S    +S +  ++    
Sbjct  464   LSSTVGGFSPQPMVSKKLYDEVFCHSHKLENESEEHREESYEVSVRRPSSFAAENLVALK  523

Query  520   HCSQIVK-----IEPYATCQSYSMPITEEAE------IQEENKLVEHFSDVHPKPSIQEI  666
             + +++++     +EP A   SY      +AE        EE  L+E F +   K +    
Sbjct  524   YSAEVIERIDHDVEPGAIVDSYGASTARDAEGVSGVNSPEEKNLMETFGNSDRKETTPLK  583

Query  667   YGTIDAAPHSKVIKIIIERIAKAFFGQQNTEES-VDSERPLGL-----------------  792
                 ++   + + + I  RIAKA F ++ TE+S +D+  PL L                 
Sbjct  584   SNMPESFAPANLTEFIFNRIAKAAFERKETEDSIIDAAPPLLLFSEVALALDCTPTEALL  643

Query  793   ----------------SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCP  924
                             +IP EFICPLTGL+FEDPVTLETGQ FERA+I +WFSKGNRTCP
Sbjct  644   PAQGVDYEDYVGRSSANIPQEFICPLTGLLFEDPVTLETGQIFERASITSWFSKGNRTCP  703

Query  925   ITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS------KAEIAVSILE  1086
             +T + LECQ VP +NF LKRVI  W+SEHW+ LL + S+ A DS      K EI VS+L+
Sbjct  704   VTRRLLECQIVPRTNFTLKRVITNWKSEHWRRLLTYFSKAAGDSGKHRWLKNEIVVSVLQ  763

Query  1087  KLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLI  1266
             +LLIV + DER + ++QLI LG LQFLI RFN G L EK  VS +L SCIEAD+NCRN++
Sbjct  764   QLLIVLNQDERRETLEQLISLGSLQFLIQRFNCGKLREKIRVSGILCSCIEADNNCRNVV  823

Query  1267  ARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLS  1446
             A N+DKMCLL +L +E+LE  +NA SL+TELICLNRRKDA +F+ G+  D+I      L 
Sbjct  824   AGNVDKMCLLNLLRNEELELRRNAFSLLTELICLNRRKDAKFFIKGIHKDNIVKTMNDLL  883

Query  1447  TYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCK  1626
              YLQ   C+Q+S+VAVL+LHF LL DT+  N   D A+DA+T+ALESS  DER  E+CCK
Sbjct  884   MYLQDCPCEQRSMVAVLLLHFDLLADTEMLNTYRDDAVDAMTMALESSLSDERSREICCK  943

Query  1627  GLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
              LLILG HFS  GKIMTEDWILKQAGF++ F+ +    E+N+
Sbjct  944   ALLILGGHFSFSGKIMTEDWILKQAGFLEGFDVEYPDDEENK  985



>gb|KHG03671.1| Putative E3 ubiquitin-protein ligase LIN-1 [Gossypium arboreum]
Length=1112

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/810 (44%), Positives = 466/810 (58%), Gaps = 83/810 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDRI+A+H+LQVFCDSP QAR  LLP LW+++F PHLSHLK WY +E   L    ++
Sbjct  310   LQKKDRISARHLLQVFCDSPSQARMYLLPKLWEDVFFPHLSHLKGWYNQEASSLSDAPNR  369

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS-------PQLAR  339
              RKLK+LEKVYNE MD+ T + A YYKDWL+EGVE P  PS+ +P +S         LAR
Sbjct  370   ERKLKLLEKVYNEIMDSSTYQLAAYYKDWLSEGVEAPPFPSIHVPSISVGNIQHDDSLAR  429

Query  340   NEDPNSVSCIVGSFSPQPVVSKKLYDEVFRH--KNGVELDYYKEESY----GGSASMSNG  501
             + D   ++      S QP+VSKKLYD VF    K G+E     E  Y    G S+  S  
Sbjct  430   SPD---LASPTSPCSAQPMVSKKLYDAVFGRSSKPGLEETEDNESHYYDTCGRSSDGSTI  486

Query  502   SVTEETHCSQIVKIEPYAT-CQSYSMPITEEAEIQEENKLVEHFSDVH-PKPSI---QEI  666
              V +   CS      PY T  ++ S    ++A   E+        +   P PSI   +E 
Sbjct  487   YVKQTLTCSSETVKYPYQTNGEASSKSPQDDASFLEDGSSSTAEEEWRLPGPSILQVKEA  546

Query  667   YGTIDAAP------HSKVI----KIIIERIAKAFFGQQNTEESVD---------SERPLG  789
             Y T+ +        H+ V+    +++++R+A+  F  Q T  + D         SE P  
Sbjct  547   YNTLQSTAQDYDKLHAPVLLTANELMLKRLAQPAFELQQTRITYDLTLSGPPNLSEDPHH  606

Query  790   LSI-------PT----------------------EFICPLTGLVFEDPVTLETGQSFERA  882
              SI       PT                      +FICPLTG  FEDPVTLETGQ+FER 
Sbjct  607   NSIAYPTTVRPTFEELHETYRRFHEQSSFSSMRNDFICPLTGKFFEDPVTLETGQTFERV  666

Query  883   AILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKA  1062
             AI  WF +GNRTCP+T K LE  +VPL+N ILK VID W+ E  +  LA +     +S+ 
Sbjct  667   AIKEWFDQGNRTCPVTGKLLEYLSVPLTNIILKHVIDSWKLEICRKNLALAFLIVGNSRE  726

Query  1063  -------EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSAL  1221
                    E A+ IL++ L   S +ERT+N K LI LGGL FL+ RF  GN+ EK  ++A+
Sbjct  727   HGLPGREEAAIFILDQFLTTLSKEERTRNTKHLISLGGLPFLLQRFKAGNVEEKIRIAAI  786

Query  1222  LSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLS  1401
             LS CIEADS CR  IAR+I+K CL E++CS+ +    NA+ L+TELICL+RRK     LS
Sbjct  787   LSCCIEADSVCRYHIARDINKRCLFELVCSKQVNLRTNAVLLLTELICLSRRKYVPLLLS  846

Query  1402  GLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL  1581
               QS++I NI   L  +L +S   Q+ L A L+L+  LL D +   +    A+DAIT AL
Sbjct  847   EFQSEEIMNIMHALHDHLLNSPPIQRPLGATLLLNIDLLVDPRKYCLYRQEAVDAITEAL  906

Query  1582  ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFE-SDLESTEDNEPD  1758
             +SS +D  + E CCK LL+LG  FS  GK++ EDWILK AGF D  E + +E  ED   D
Sbjct  907   DSSLIDGEVGEKCCKVLLMLGGRFSLSGKLLIEDWILKVAGFNDGPEVNSIEKEED--LD  964

Query  1759  NGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
              G   +++D EE    EW   +SA L+GSGK SFL A+S CL SGN +LV  CLT+VAWL
Sbjct  965   IGDSIILED-EECAIAEWLRNLSASLIGSGKVSFLEAISKCLGSGNRDLVTACLTSVAWL  1023

Query  1939  ssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLM  2118
                 ++              +LI  LK  LE+G  L+HK+LAS+ LLN SKI ECRVLLM
Sbjct  1024  ---TSALPLQTDAELQRTLCSLISHLKQSLENGAQLQHKILASMSLLNLSKISECRVLLM  1080

Query  2119  MIGEVIEDTLECLAEVTWVARELQTVISSS  2208
              I E +   L  LA++TW A+EL  +IS +
Sbjct  1081  TIAEEMVVPLRSLADITWTAKELHGIISGA  1110



>gb|KHG03672.1| Putative E3 ubiquitin-protein ligase LIN-1 [Gossypium arboreum]
Length=1100

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/798 (44%), Positives = 465/798 (58%), Gaps = 71/798 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDRI+A+H+LQVFCDSP QAR  LLP LW+++F PHLSHLK WY +E   L    ++
Sbjct  310   LQKKDRISARHLLQVFCDSPSQARMYLLPKLWEDVFFPHLSHLKGWYNQEASSLSDAPNR  369

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS-------PQLAR  339
              RKLK+LEKVYNE MD+ T + A YYKDWL+EGVE P  PS+ +P +S         LAR
Sbjct  370   ERKLKLLEKVYNEIMDSSTYQLAAYYKDWLSEGVEAPPFPSIHVPSISVGNIQHDDSLAR  429

Query  340   NEDPNSVSCIVGSFSPQPVVSKKLYDEVFRH--KNGVELDYYKEESY----GGSASMSNG  501
             + D   ++      S QP+VSKKLYD VF    K G+E     E  Y    G S+  S  
Sbjct  430   SPD---LASPTSPCSAQPMVSKKLYDAVFGRSSKPGLEETEDNESHYYDTCGRSSDGSTI  486

Query  502   SVTEETHCSQIVKIEPYAT-CQSYSMPITEEAEIQEENKLVEHFSDVH-PKPSI---QEI  666
              V +   CS      PY T  ++ S    ++A   E+        +   P PSI   +E 
Sbjct  487   YVKQTLTCSSETVKYPYQTNGEASSKSPQDDASFLEDGSSSTAEEEWRLPGPSILQVKEA  546

Query  667   YGTIDAAP------HSKVI----KIIIERIAKAFF----------------GQQNT----  756
             Y T+ +        H+ V+    +++++R+A+  F                GQ  T    
Sbjct  547   YNTLQSTAQDYDKLHAPVLLTANELMLKRLAQPAFDILAVFYLLLSSFISLGQPTTVRPT  606

Query  757   -EESVDSERPLG-----LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRT  918
              EE  ++ R         S+  +FICPLTG  FEDPVTLETGQ+FER AI  WF +GNRT
Sbjct  607   FEELHETYRRFHEQSSFSSMRNDFICPLTGKFFEDPVTLETGQTFERVAIKEWFDQGNRT  666

Query  919   CPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKA-------EIAVS  1077
             CP+T K LE  +VPL+N ILK VID W+ E  +  LA +     +S+        E A+ 
Sbjct  667   CPVTGKLLEYLSVPLTNIILKHVIDSWKLEICRKNLALAFLIVGNSREHGLPGREEAAIF  726

Query  1078  ILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCR  1257
             IL++ L   S +ERT+N K LI LGGL FL+ RF  GN+ EK  ++A+LS CIEADS CR
Sbjct  727   ILDQFLTTLSKEERTRNTKHLISLGGLPFLLQRFKAGNVEEKIRIAAILSCCIEADSVCR  786

Query  1258  NLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITI  1437
               IAR+I+K CL E++CS+ +    NA+ L+TELICL+RRK     LS  QS++I NI  
Sbjct  787   YHIARDINKRCLFELVCSKQVNLRTNAVLLLTELICLSRRKYVPLLLSEFQSEEIMNIMH  846

Query  1438  LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEM  1617
              L  +L +S   Q+ L A L+L+  LL D +   +    A+DAIT AL+SS +D  + E 
Sbjct  847   ALHDHLLNSPPIQRPLGATLLLNIDLLVDPRKYCLYRQEAVDAITEALDSSLIDGEVGEK  906

Query  1618  CCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFE-SDLESTEDNEPDNGRITMMDDGEE  1794
             CCK LL+LG  FS  GK++ EDWILK AGF D  E + +E  ED   D G   +++D EE
Sbjct  907   CCKVLLMLGGRFSLSGKLLIEDWILKVAGFNDGPEVNSIEKEED--LDIGDSIILED-EE  963

Query  1795  EVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgs  1974
                 EW   +SA L+GSGK SFL A+S CL SGN +LV  CLT+VAWL    ++      
Sbjct  964   CAIAEWLRNLSASLIGSGKVSFLEAISKCLGSGNRDLVTACLTSVAWL---TSALPLQTD  1020

Query  1975  efelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLEC  2154
                     +LI  LK  LE+G  L+HK+LAS+ LLN SKI ECRVLLM I E +   L  
Sbjct  1021  AELQRTLCSLISHLKQSLENGAQLQHKILASMSLLNLSKISECRVLLMTIAEEMVVPLRS  1080

Query  2155  LAEVTWVARELQTVISSS  2208
             LA++TW A+EL  +IS +
Sbjct  1081  LADITWTAKELHGIISGA  1098



>ref|XP_008243689.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Prunus mume]
Length=1113

 Score =   541 bits (1394),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 353/803 (44%), Positives = 466/803 (58%), Gaps = 105/803 (13%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDR++AKH+LQVFCD+P  ART+LLP+LWD++FLPHLSHLK+WY +E   L    +K
Sbjct  343   LQKKDRVSAKHLLQVFCDTPFHARTTLLPELWDHLFLPHLSHLKVWYDQEADSLADRQNK  402

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              RKLK+L K YNE +D+GT +FAVYYKDWLTEG E  + PS               P   
Sbjct  403   PRKLKLLGKAYNEILDSGTYQFAVYYKDWLTEGAESQA-PS---------------PG--  444

Query  361   SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKE----ESYGGSASMSNGSVTEETHCS  528
                     PQ +VSK+LYD VF   +  E D  ++    E++      S+GS ++    S
Sbjct  445   -------GPQSMVSKRLYDSVFGRSSKPESDEVEDDGDIENFDSCMRSSDGS-SDAKQTS  496

Query  529   QIVKIEPYATCQSYSMPITEEAE---------------IQEENK-------------LVE  624
             Q      Y T Q     + EE+                + EE K             L  
Sbjct  497   Q----HSYETVQYRYQDVEEESTKSAPEDGFLSENGLLMTEEQKWGYLGVSDLPESDLNH  552

Query  625   HFSDVHPKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQN---------TEESVDSE  777
             HF ++  + +  E    + A+  +K  K+ ++   K+ + QQ          +E S+ S 
Sbjct  553   HFDNICGENT--ESTQMLHASACAKENKLTLKTREKSNYEQQRAEASTVSNCSEASIASS  610

Query  778   RPL----------------GL---SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWF  900
              P+                G+   SIP +FICPLTG +FEDPVTLETGQ+FER AI  WF
Sbjct  611   IPIKERSSFEELHGNYFEEGIIFWSIPQDFICPLTGRLFEDPVTLETGQTFERLAIKAWF  670

Query  901   SKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQF-------ASDSK  1059
              KGN TCP+T K LEC AVPL NFILKRVI  W+SEH + LLAF+SQ         S   
Sbjct  671   DKGNSTCPVTGKSLECLAVPLHNFILKRVIHSWKSEHCRKLLAFASQVVGTSGRDGSKHY  730

Query  1060  AEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIE  1239
              E A+ +LE+LL   S +ERT+N K L+ LGGLQFL+  F LG + EK   +ALLS CIE
Sbjct  731   EERAIFMLEQLLTCFSKEERTENAKHLMSLGGLQFLLQWFELGKVKEKSRAAALLSCCIE  790

Query  1240  ADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDD  1419
             AD++CRN+IAR+I+K  ++E+L S+ ++   NA+ L+TELICL R+KD T FLSGLQ++ 
Sbjct  791   ADADCRNIIARDINKQYVMELLQSKQIKIRTNAVLLLTELICLKRKKDVTTFLSGLQNEG  850

Query  1420  IANITILLSTYLQSSHCKQK--SLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSF  1593
             I N   +L   LQSS    +    V +L +   +  + Q   +  + A+DAIT AL+ S 
Sbjct  851   IVNTMDVLLVCLQSSPANHRPLVAVLLLHVDLLVEVEPQKYGMHREEAVDAITEALDCSL  910

Query  1594  LDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRIT  1773
              D  + E CCK LLIL R+FS  GK ++  WILK A F    E +    ED    +G  T
Sbjct  911   TDANVRENCCKALLILRRYFSFSGKSLSRSWILKPADFSGSCEVNSIDNEDGSLAHG--T  968

Query  1774  MMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvla  1953
                D E+   E+W   ++  LLG+GKKSFL  LS CL S N++L+RVCL T  WL    A
Sbjct  969   SPSDDEDNSIEDWLRNLTVTLLGNGKKSFLETLSKCLGSENLDLMRVCLITAEWL--TRA  1026

Query  1954  sssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
              SS SGSEF+L+AFS+LI  LK  L++G+ +E K+LASV +LNFSKI ECRVLL    E 
Sbjct  1027  LSSLSGSEFQLTAFSSLIFPLKERLKNGEQVEQKILASVSMLNFSKISECRVLLRESTED  1086

Query  2134  IEDTLECLAEVTWVARELQTVIS  2202
             I   LE LAEVTW A+ L  +IS
Sbjct  1087  IAVPLENLAEVTWSAKLLHAIIS  1109



>ref|XP_010087396.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
 gb|EXB29006.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
Length=1086

 Score =   520 bits (1339),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 339/791 (43%), Positives = 464/791 (59%), Gaps = 95/791 (12%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQRKDR+AAKH+LQVFCDSP QAR  LLP+LWD +F PHLSHLK+WY +E   L     +
Sbjct  330   LQRKDRVAAKHLLQVFCDSPNQAREKLLPELWDYLFFPHLSHLKVWYNQEANSLADSPGR  389

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              RKL++LEKVYNE +D+GT +FAVYYKDWLTEGVE   +PS+ +P +S +  +  + +S 
Sbjct  390   PRKLQLLEKVYNEIVDSGTYQFAVYYKDWLTEGVETTPVPSIHVPSISIREIQKGNSSSH  449

Query  361   SCI-------VGSFSPQPV-VSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEE  516
                       V  FSPQP+ VSKK Y+ +F   +       K  S  G  + ++ +    
Sbjct  450   GHSSEQSSSPVDPFSPQPMMVSKKFYNALFSQSS-------KPGSADGRDTENSDNRIRS  502

Query  517   THCSQIVKIEPYATCQSYSMPITEEA---EIQEENKLV-----------------EHFSD  636
             +  S +VK     T        T+ A   E+  EN L                    FS+
Sbjct  503   SDGSAVVKETVKETNGHEEEDFTKNAPEDEVSPENGLSVTSEEKWSFPGQRVSTGRDFSE  562

Query  637   VHPKP----SIQEIYGTIDAAP-HSKVIKIIIERIAKAFF--GQQNTEESVD--------  771
                 P       E    I + P H+K  ++ ++R+AK+ F   Q ++E  V         
Sbjct  563   KFVNPVTCQETTENSQMIRSPPQHTKENELTLKRLAKSLFELQQPDSEALVHLTKVGSAS  622

Query  772   --------SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPI  927
                      ERP    IP +FICPLTG +FEDPVTLETGQ+FER AI  WF +GNR CP+
Sbjct  623   EELHGVYFEERPSFSIIPQDFICPLTGQLFEDPVTLETGQTFEREAIKAWFDQGNRACPV  682

Query  928   TSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSS  1107
             T K LEC+ VP +N +LKR++D W+S+H +HLL    Q   +S  E    +LE+LL+ S+
Sbjct  683   TGKALECKLVPFTNLVLKRLVDTWKSQHCRHLL---EQLRDES--ETTTLVLEQLLLTST  737

Query  1108  I---DERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNI  1278
                 +E   N K LI LGGL FL+ RF  G+L EK  V+AL+ SCIEA S+ RN IAR+I
Sbjct  738   AFTKEESITNAKLLISLGGLHFLLQRFECGDLQEKTRVAALVVSCIEAVSSVRNRIARDI  797

Query  1279  DKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDD--IANITILLSTY  1452
             D  C+LE+L S+ +++  N ++L+ ELICL R+KD   FLSGLQ+++  I +   +L  Y
Sbjct  798   DSKCVLEMLHSKQVKARANVVALLIELICLKRKKDVMRFLSGLQNENEGIESTLHVLLVY  857

Query  1453  LQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGL  1632
             LQS    Q+ LVAVL+L+  +L + +  ++  + A+DAIT AL++S  DE+  E CC+ L
Sbjct  858   LQSCPPPQRPLVAVLLLYLDVLVEPRKYSIYREEAVDAITEALDASLADEKTRENCCRAL  917

Query  1633  LILGRHFSAFGKIMTEDWILKQAGF-IDRFESDLESTEDNEPDNGRITMMDDGEEEVREE  1809
             LILG  FS+ GK++T  WIL QAGF +D  E+  E  ++N       + +DD E+ + E+
Sbjct  918   LILGGRFSSSGKLLTYSWILNQAGFNVDPTENSPE-IQENVSLLDDASSLDDDEQNI-EK  975

Query  1810  WQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefels  1989
             W   +S  LLG+GK+SF+ A+S C+ S N+ LV+VCLTTVAWL    + +S S +E  L 
Sbjct  976   WLRNLSTSLLGNGKRSFVDAISKCIGSENLNLVKVCLTTVAWL--SSSLASMSETELHLP  1033

Query  1990  aFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVT  2169
             AFSALI +LK  LE+G  +EHKVLAS  LLNFSKI                       VT
Sbjct  1034  AFSALISRLKDSLENGHEVEHKVLASCSLLNFSKI----------------------SVT  1071

Query  2170  WVARELQTVIS  2202
             W A  L ++IS
Sbjct  1072  WTAEMLSSIIS  1082



>ref|XP_007139110.1| hypothetical protein PHAVU_008G002200g [Phaseolus vulgaris]
 gb|ESW11104.1| hypothetical protein PHAVU_008G002200g [Phaseolus vulgaris]
Length=1082

 Score =   515 bits (1327),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 320/769 (42%), Positives = 454/769 (59%), Gaps = 56/769 (7%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+K++++AKH+LQVFCDSP QART LLP+LW+++F P  SHLK WY KE  +L    +K
Sbjct  331   MQKKNKVSAKHLLQVFCDSPFQARTMLLPELWEHLFSPQFSHLKAWYEKEEEVLVDTPNK  390

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +R+LK+L++VYNE +D+ T+ FAVYYKDWLTEGVE P+IPS+ IP +S  +  +++ +S+
Sbjct  391   TRRLKLLQEVYNEHLDSVTHIFAVYYKDWLTEGVESPTIPSIGIPSVS--VTGSQEGSSL  448

Query  361   ------SCIVGSFSPQPVVSKKLYDEVFRH--KNGVELDYYKEESYGGSASMSNGSVTEE  516
                   +  +  FSPQP+VSKKLYD +F    + GV    Y+ +      +  N    + 
Sbjct  449   GHSFESASSIDPFSPQPMVSKKLYDSMFGSFGRPGV----YQVKDVKDDGNQDN--CVKG  502

Query  517   THCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPHS  696
             +H S  VK     T +S ++  T++         +E FS      +I+   G + AA   
Sbjct  503   SHGSTFVK--QTLTYESETVKFTDQD--------IEGFSQGVAIDTIKPHKGNLVAAAEE  552

Query  697   KVIKIIIERIAKAFFGQQN----------TEESVDSERPLGLS----------IPTEFIC  816
                + + + I  +F  Q N           E++ D ++P   S          IP EFIC
Sbjct  553   WQKRNVTDDINNSFSMQTNLNNHIVDALPYEKANDLKKPNKTSYALQGSDFPSIPQEFIC  612

Query  817   PLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDK  996
              LTG +FE+PVTLETGQ+FER AI  WF KGNRTCP+T   LEC A+P +N ILKR+ID 
Sbjct  613   SLTGNLFEEPVTLETGQTFERKAIKAWFEKGNRTCPVTGNALECLAMPFTNLILKRLIDN  672

Query  997   WRSEHWQHLLAFSSQFASDSKA-------EIAVSILEKLLIVSSIDERTKNVKQLICLGG  1155
             WRSE + +LL  +SQ   +S+        E AV  LE L      +E++  VK LI LG 
Sbjct  673   WRSERFDYLLDLASQRGENSEELRLKKGDEAAVFKLESLFSSLKEEEKSTYVKHLISLGV  732

Query  1156  LQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN  1335
             L FL  RF  GN+ EK  V +LL +CI+ DS C   IAR++++ CLLE+L S++     N
Sbjct  733   LPFLFRRFEQGNVEEKSLVVSLLLNCIQVDSGCLYTIARSVNRKCLLELLSSKEATPTTN  792

Query  1336  AISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHL  1515
             AI  +TEL+ + RRKD T F+SGL  + + NI  +L  YL++S   +K L+AVL+LHF L
Sbjct  793   AILFLTELLSMKRRKDVTSFISGLAGEKVFNIMHILLLYLKNSSPFEKPLIAVLLLHFDL  852

Query  1516  LTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILK  1695
             L + Q  +   + A++AI  AL+ S  +E+  E CC+ LLIL  HFS+ GKI T+  ILK
Sbjct  853   LVEPQKFSAYREVAVNAIAEALDGSLNNEKAREKCCRALLILCGHFSSTGKIPTKTSILK  912

Query  1696  QAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALS  1875
             QAG+              E     +T+  + E++  EE   ++   L+G G+  FL +LS
Sbjct  913   QAGYNHESVEVKPHGHQKEGQQSEVTISLEDEDKRVEELLKKLIESLIGDGEGPFLKSLS  972

Query  1876  MCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHK  2055
              CL   +++LVR CL TV WL    + S+  G+   L  FS++I QLK  LE G+ LE K
Sbjct  973   RCLDCKHLDLVRACLITVTWL--SSSLSTLFGAGLPLPTFSSIISQLKGILEDGE-LELK  1029

Query  2056  VLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
              LAS+ LLNFSKI EC+ L+  + E +   L  LAEVTW A++L   +S
Sbjct  1030  ALASLSLLNFSKISECKTLMKTMAEDVAPLLHGLAEVTWTAKQLHAAVS  1078



>ref|XP_008338518.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Malus domestica]
Length=1145

 Score =   506 bits (1304),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 353/823 (43%), Positives = 467/823 (57%), Gaps = 105/823 (13%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             L +KDR++AKH+LQVFCD+P   R +LLP+LWD +FLPHL+HLK WY +E   +    +K
Sbjct  335   LLKKDRVSAKHLLQVFCDTPFHXRMTLLPELWDQLFLPHLTHLKTWYDQEADSIADRQNK  394

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP-FLSPQLARNEDPNS  357
              RKLK+L K+YNE +D+GT +FAVYYKDWLTEGVE P  P++ IP  +S Q A+     S
Sbjct  395   PRKLKLLGKMYNEMLDSGTYQFAVYYKDWLTEGVESPPTPAIHIPSVVSLQEAQQGSSES  454

Query  358   VSCIVGSFSPQP-----VVSKKLYDEVFRHK-----NGVELDYYKEESYGGSASMSNGS-  504
              S    S +P P     +VSKKLYD VF        N  E D  + E+       S+GS 
Sbjct  455   HS----SEAPSPGGSQLMVSKKLYDSVFSRASKPDPNDTE-DDGEMENLDTITRSSDGSF  509

Query  505   -VTEETHCS-QIVKIEPYATCQSYSMPITEEAEIQEENKLVEHF----------------  630
              V + T  S + V+ + + T   YS    E+  +   +     F                
Sbjct  510   VVKQXTQDSAERVQYQYHDTEDDYSKSXPEDXSLSVSSSCSRTFLKXNGLFTTEEQKWGS  569

Query  631   ---SDVHPKPSIQEIYGTIDA----AP---HSKVIKIIIERIAKAFFGQQNTEESVD---  771
                SD+ P+ ++   +G +      +P   H +  K+ ++    + F Q++ E+S D   
Sbjct  570   LGVSDL-PESNLNHQFGDMSXENSESPRXLHXQENKVTLKIHVNSVFEQKHMEDSSDHNL  628

Query  772   ------SERPLGLSI--------------------------PTEFICPLTGLVFEDPVTL  855
                   SE  +  SI                          P +FICPL G +FEDPVTL
Sbjct  629   SXISNFSEPSIASSIVNPIKARSSFEDLHGNYFEGVTFSGIPQDFICPLNGXLFEDPVTL  688

Query  856   ETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFS  1035
             ETGQ+FER AI  W  +GNRTCP+T K LEC  +PL N ILKRVI  W+SEH + LLAF+
Sbjct  689   ETGQTFERLAIKAWXDQGNRTCPVTGKALECLVLPLPNSILKRVIRSWKSEHCRKLLAFA  748

Query  1036  SQFA-------SDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNL  1194
             S          S    E A+S LE+LL   S +ERT+N K LI LGGLQFL+ RF+ G +
Sbjct  749   SHVVGTLVRDVSSHCBETAISXLEQLLTCFSNEERTENAKHLISLGGLQFLLQRFHYGKV  808

Query  1195  NEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNR  1374
              EK   +ALLS CIEAD++CRN IAR+I+K  ++E+L S+  +   NA+ L+TELICL R
Sbjct  809   EEKSRAAALLSCCIEADADCRNQIARDINKQYVMEMLQSQQFKIRTNAVLLLTELICLKR  868

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSN-VCID  1551
             +KD T FLSGLQ + + +   +L   LQSS    + LVAVL+LH  LL + + S  +  +
Sbjct  869   KKDVTTFLSGLQIEGMVDTMDVLLACLQSSPANHRPLVAVLLLHVDLLVERKLSXPLHRE  928

Query  1552  GAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFE-SD  1728
              A+DAIT AL  S  DE + + CC  LLILGR FS         WILKQ       E + 
Sbjct  929   EAVDAITEALXCSLTDENVQKNCCTALLILGRFFSCSXXSSQS-WILKQEDCSGNXEVNS  987

Query  1729  LESTEDNEPDNGRITMMD-----DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASG  1893
             L++ ED       I++ D     D  E   E+W   ++  LLG GKKSF+  LS CL S 
Sbjct  988   LDNXED-------ISLADDMSPLDEXENSSEDWLRNLTVSLLGYGKKSFVETLSKCLGSE  1040

Query  1894  NIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVC  2073
             N+EL+R+CL TV WL    A SS  GSEF+LS FS+LI  LK CL+  + +E K+LAS+ 
Sbjct  1041  NLELIRMCLITVEWL--SRALSSLPGSEFQLSXFSSLIFPLKQCLKTSEQVEQKILASMS  1098

Query  2074  LLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             +LNFSKI ECRVLL    E I   LE LAEVTW A+ L  +IS
Sbjct  1099  MLNFSKISECRVLLRENTEDIAVPLENLAEVTWSAKLLHDIIS  1141



>ref|XP_003552751.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Glycine max]
Length=1089

 Score =   503 bits (1295),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 318/779 (41%), Positives = 449/779 (58%), Gaps = 74/779 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+K++++AKH+LQVFCDSP QART LLP+LW+++F    SHLK WY K+   L    SK
Sbjct  336   MQKKNKVSAKHLLQVFCDSPFQARTVLLPELWEHLFSSQFSHLKAWYSKQAEFLVDAPSK  395

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +RKLK+L+KVYNE +D+GT+ FAVYYKDWLTEGVE P  PS+ IP  S  +  +++ +S+
Sbjct  396   TRKLKLLQKVYNEHLDSGTHIFAVYYKDWLTEGVESPPTPSIGIP--SASVMGSQEGSSL  453

Query  361   ------SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYK--------------EESYGG  480
                   +  +   SPQP+VSKKLYD +F   +   +  Y+              ++SYG 
Sbjct  454   GYSFESASSIDPLSPQPMVSKKLYDSMFGSLSKPRV--YQVKDIKDDDNIDNCMKDSYGS  511

Query  481   SASMSNGSVTEET---------HCSQIVKIEPYATCQSYSMPITEEAEIQE-ENKLVEHF  630
             +      +   ET         + SQ V I+     +  SM  +EE + +   N +   F
Sbjct  512   TIVRQTLTYESETVKFTDQDIENFSQGVAIDTIKPQKGNSMTASEEWQKRNLSNDINNSF  571

Query  631   S-----DVHPKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLS  795
             S     + H          +IDA  H K  + ++ +  K       T  S+  E P   S
Sbjct  572   SMETNLNSH----------SIDALSHEKASEPVLIKPNK-------TCSSL--EGPYFPS  612

Query  796   IPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFI  975
             IP EFICPLTG +FE+PVTLETGQ+FER AI  WF KGNRTCP+T   LEC  +P +N I
Sbjct  613   IPHEFICPLTGNLFEEPVTLETGQTFEREAIKAWFEKGNRTCPVTGNTLECVTMPFTNLI  672

Query  976   LKRVIDKWRSEHWQHLLAFSSQFASD-------SKAEIAVSILEKLLIVSSIDERTKNVK  1134
             LKR+ID W+SE + +L+   SQ   +        + E AV  LE L      ++++   K
Sbjct  673   LKRLIDTWKSELFDYLIDLPSQTVENPEELKLKKRDEAAVFKLESLFSSLKEEDKSTYAK  732

Query  1135  QLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSE  1314
              LI LG L FL  RF  GN+ EK  V +LL +CI+ DS C   IA +++K CLLE+L S+
Sbjct  733   HLISLGFLPFLFRRFEQGNVEEKSHVMSLLLNCIQVDSGCIYQIATSVNKKCLLELLHSK  792

Query  1315  DLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAV  1494
                   NAI  +TE++ + RRKD T F+SGL  + + NI  +L  YL+ S   +K L+AV
Sbjct  793   KATPTTNAILFLTEILSMKRRKDVTSFISGLAGEKVFNIMHILLMYLKKSSPFEKPLIAV  852

Query  1495  LILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIM  1674
             L+LHF LL + Q  ++  + A++AI  AL++S  DE+  E CC+ L+IL  HFS+ GKI 
Sbjct  853   LLLHFDLLVEPQKFSIYREVAVNAIAEALDASLNDEKGREKCCRALVILCSHFSSTGKIP  912

Query  1675  TEDWILKQAGFIDRFESDLESTEDNEPDNGR---ITMMDDGEEEVREEWQARMSAMLLGS  1845
             T+  ILKQAG+ +     LE       + G+   + +  +GEE+  EE   ++   L+G 
Sbjct  913   TKTSILKQAGYNN---DSLEVKPPGHEEEGQRLYVAISSEGEEKRGEELLKKLLESLIGD  969

Query  1846  GKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKAC  2025
             G+  FL  +S CL S +++LVR CL TV W     + S    +   L AF ++I QLK  
Sbjct  970   GESPFLKNISRCLDSKHLDLVRACLITVTW--LSSSLSMLFSAGLHLPAFLSIISQLKGI  1027

Query  2026  LEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             LE+G+ LE K LAS+ LLNFSKI EC+ LL  + E I   L  L +VTW A++L  ++S
Sbjct  1028  LENGE-LELKTLASLSLLNFSKISECKTLLKTMAEDIGPLLHELDDVTWTAKQLHAIVS  1085



>ref|XP_006603073.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Glycine max]
Length=1088

 Score =   501 bits (1290),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 317/775 (41%), Positives = 450/775 (58%), Gaps = 67/775 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+K++++AKH+LQVFCDSP QART LLP+LW+++F    SHLK WY K+   L    SK
Sbjct  336   MQKKNKVSAKHLLQVFCDSPFQARTVLLPELWEHLFSSQFSHLKAWYSKQAEFLVDAPSK  395

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +RKLK+L+KVYNE +D+GT+ FAVYYKDWLTEGVE P  PS+ IP  S  +  +++ +S+
Sbjct  396   TRKLKLLQKVYNEHLDSGTHIFAVYYKDWLTEGVESPPTPSIGIP--SASVMGSQEGSSL  453

Query  361   ------SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYK--------------EESYGG  480
                   +  +   SPQP+VSKKLYD +F   +   +  Y+              ++SYG 
Sbjct  454   GYSFESASSIDPLSPQPMVSKKLYDSMFGSLSKPRV--YQVKDIKDDDNIDNCMKDSYGS  511

Query  481   SASMSNGSVTEET---------HCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFS  633
             +      +   ET         + SQ V I+   T +     +T   E Q+ N      +
Sbjct  512   TIVRQTLTYESETVKFTDQDIENFSQGVAID---TIKPKGNSMTASEEWQKRNL----SN  564

Query  634   DVHPKPSIQEIYGT--IDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTE  807
             D++   S++    +  IDA  H K  + ++ +  K       T  S+  E P   SIP E
Sbjct  565   DINNSFSMETNLNSHSIDALSHEKASEPVLIKPNK-------TCSSL--EGPYFPSIPHE  615

Query  808   FICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRV  987
             FICPLTG +FE+PVTLETGQ+FER AI  WF KGNRTCP+T   LEC  +P +N ILKR+
Sbjct  616   FICPLTGNLFEEPVTLETGQTFEREAIKAWFEKGNRTCPVTGNTLECVTMPFTNLILKRL  675

Query  988   IDKWRSEHWQHLLAFSSQFASD-------SKAEIAVSILEKLLIVSSIDERTKNVKQLIC  1146
             ID W+SE + +L+   SQ   +        + E AV  LE L      ++++   K LI 
Sbjct  676   IDTWKSELFDYLIDLPSQTVENPEELKLKKRDEAAVFKLESLFSSLKEEDKSTYAKHLIS  735

Query  1147  LGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLES  1326
             LG L FL  RF  GN+ EK  V +LL +CI+ DS C   IA +++K CLLE+L S+    
Sbjct  736   LGFLPFLFRRFEQGNVEEKSHVMSLLLNCIQVDSGCIYQIATSVNKKCLLELLHSKKATP  795

Query  1327  VQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILH  1506
               NAI  +TE++ + RRKD T F+SGL  + + NI  +L  YL+ S   +K L+AVL+LH
Sbjct  796   TTNAILFLTEILSMKRRKDVTSFISGLAGEKVFNIMHILLMYLKKSSPFEKPLIAVLLLH  855

Query  1507  FHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDW  1686
             F LL + Q  ++  + A++AI  AL++S  DE+  E CC+ L+IL  HFS+ GKI T+  
Sbjct  856   FDLLVEPQKFSIYREVAVNAIAEALDASLNDEKGREKCCRALVILCSHFSSTGKIPTKTS  915

Query  1687  ILKQAGFIDRFESDLESTEDNEPDNGR---ITMMDDGEEEVREEWQARMSAMLLGSGKKS  1857
             ILKQAG+ +     LE       + G+   + +  +GEE+  EE   ++   L+G G+  
Sbjct  916   ILKQAGYNN---DSLEVKPPGHEEEGQRLYVAISSEGEEKRGEELLKKLLESLIGDGESP  972

Query  1858  FLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHG  2037
             FL  +S CL S +++LVR CL TV W     + S    +   L AF ++I QLK  LE+G
Sbjct  973   FLKNISRCLDSKHLDLVRACLITVTW--LSSSLSMLFSAGLHLPAFLSIISQLKGILENG  1030

Query  2038  KLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             + LE K LAS+ LLNFSKI EC+ LL  + E I   L  L +VTW A++L  ++S
Sbjct  1031  E-LELKTLASLSLLNFSKISECKTLLKTMAEDIGPLLHELDDVTWTAKQLHAIVS  1084



>gb|KHN12583.1| Putative E3 ubiquitin-protein ligase LIN-1 [Glycine soja]
Length=1089

 Score =   497 bits (1280),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 315/779 (40%), Positives = 447/779 (57%), Gaps = 74/779 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+K++++AKH+LQVFCDSP QART LLP+LW+++F    SHLK WY K+   L    SK
Sbjct  336   MQKKNKVSAKHLLQVFCDSPFQARTVLLPELWEHLFSSQFSHLKAWYSKQAEFLVDAPSK  395

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +RKLK+L+KVYNE +D+GT+ FAVYYKDWLTEGVE P  P + IP  S  +  +++ +S+
Sbjct  396   TRKLKLLQKVYNEHLDSGTHIFAVYYKDWLTEGVESPPTPLIGIP--SASVMGSQEGSSL  453

Query  361   ------SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYK--------------EESYGG  480
                   +  +   SPQP+VSKKLYD +F   +   +  Y+              ++SYG 
Sbjct  454   GYSFESASSIDPLSPQPMVSKKLYDSMFGSLSKPRV--YQVKDIKDDDNIDNCMKDSYGS  511

Query  481   SASMSNGSVTEET---------HCSQIVKIEPYATCQSYSMPITEEAEIQE-ENKLVEHF  630
             +      +   ET         + SQ V I+     +  SM  +EE + +   N +   F
Sbjct  512   TIVRQTLTYESETVKFTDQDIENFSQGVAIDTIKPQKGNSMTASEEWQKRNLSNDINNSF  571

Query  631   S-----DVHPKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLS  795
             S     + H          +IDA  H K  + ++ +  K       T  S+  E P   S
Sbjct  572   SMETNLNSH----------SIDALSHEKASEPVLIKPNK-------TCSSL--EGPYFPS  612

Query  796   IPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFI  975
             IP EFICPLTG +FE+PVTLETGQ+FER AI  WF KGNRTCP+T   LEC  +P +N I
Sbjct  613   IPHEFICPLTGNLFEEPVTLETGQTFEREAIKAWFEKGNRTCPVTGNTLECVTMPFTNLI  672

Query  976   LKRVIDKWRSEHWQHLLAFSSQFASD-------SKAEIAVSILEKLLIVSSIDERTKNVK  1134
             LKR+ID W+SE + +L+   SQ   +        + E AV  L  L      ++++   K
Sbjct  673   LKRLIDTWKSELFDYLIDLPSQTVENPEELKLKKRDEAAVFKLASLFSSLKEEDKSTYAK  732

Query  1135  QLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSE  1314
              LI LG L FL  RF  GN+ EK  V +LL +CI+ DS C   IA ++++ CLLE+L S+
Sbjct  733   HLISLGFLPFLFRRFEQGNVEEKSHVMSLLLNCIQVDSGCIYQIATSVNRKCLLELLHSK  792

Query  1315  DLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAV  1494
                   NAI  +TE++ + RRKD T F+SGL  + + NI  +L  YL+ S   +K L+AV
Sbjct  793   KATPTTNAILFLTEILSMKRRKDVTSFISGLAGEKVFNIMHILLMYLKKSSPFEKPLIAV  852

Query  1495  LILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIM  1674
             L+LHF LL + Q  ++  + A++AI  AL++S  DE+  E CC+ L+IL  HFS+ GKI 
Sbjct  853   LLLHFDLLVEPQKFSIYREVAVNAIAEALDASLNDEKGREKCCRALVILCSHFSSTGKIP  912

Query  1675  TEDWILKQAGFIDRFESDLESTEDNEPDNGR---ITMMDDGEEEVREEWQARMSAMLLGS  1845
             T+  ILKQAG+ +     LE       + G+   + +  +GEE+  EE   ++   L+G 
Sbjct  913   TKTSILKQAGYNN---DSLEVKPPGHEEEGQRLYVAISSEGEEKRGEELLKKLLESLIGD  969

Query  1846  GKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKAC  2025
             G+  FL  +S CL S +++LVR CL TV W     + S    +   L AF ++I QLK  
Sbjct  970   GESPFLKNISRCLDSKHLDLVRACLITVTW--LSSSLSMLFSAGLHLPAFLSIISQLKGI  1027

Query  2026  LEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             LE+G+ LE K LAS+ LLNFSKI EC+ LL  + E I   L  L +VTW A++L  ++S
Sbjct  1028  LENGE-LELKTLASLSLLNFSKISECKTLLKTMAEDIGPLLHELDDVTWTAKQLHAIVS  1085



>ref|XP_010265971.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Nelumbo 
nucifera]
Length=1148

 Score =   496 bits (1277),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 326/814 (40%), Positives = 448/814 (55%), Gaps = 124/814 (15%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDR++AKH+LQVFCDSP  ARTSLLP+LWD +FLPHL+HL++WY +E   +    S+
Sbjct  375   LQKKDRVSAKHLLQVFCDSPFLARTSLLPELWDYLFLPHLTHLRVWYNQEADSIPDTSSR  434

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              +KLK+LEK YNE ++TGT++FAVYYKDWLTEGVE P++PS++ P +S +L  + D +  
Sbjct  435   QKKLKLLEKAYNEVLNTGTHQFAVYYKDWLTEGVEGPALPSIQFPSVSVKLVVDGDSDGN  494

Query  361   SCIVGSFS-----PQPVVSKKLYDEVFRHKNGVELDYYKEESYG-GSASMS----NGSVT  510
             S  +G        P+ ++SKKL+  VF   N  +LD   E   G G A       N   T
Sbjct  495   SPELGPGQVDPALPKMMISKKLHTAVFGQSN--KLDGLDEVEDGEGEAEFDICARNFDFT  552

Query  511   EETHCSQIVKIEPYATCQSYSMPITEEAEIQ---------------EENKL---------  618
              E    +++      TC    +       +Q               E  +L         
Sbjct  553   VEKDRQRVIFSPEPGTCIGQHIKENSPKTLQVDASHAPNGLLMRDGETRRLDMVTLLEVG  612

Query  619   ---VEHFSDVHPKP-SIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVD-----  771
                +   S  H  P S  E+       PH+K  ++I+E++A + F  Q+   S+D     
Sbjct  613   EYDITDISLWHTTPRSTHELL----MLPHTKANELILEKLAMSVFPLQHN--SIDFTATT  666

Query  772   -------------SERPLGL-----------SIPTEFICPLTGLVFEDPVTLETGQSFER  879
                          SE   G            SI  EF+CPLTG +FEDPVTLETGQ+FER
Sbjct  667   HISHSKISNMRSHSEGSDGFYEYFNETSFFSSIRKEFLCPLTGCLFEDPVTLETGQTFER  726

Query  880   AAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFAS---  1050
              AI  WF +G R CP+T +KL+C  VP +NF+LKRV+D W+SE+ + LLA +SQ A+   
Sbjct  727   EAIKEWFKQGKRVCPVTGRKLDCLLVPSANFVLKRVVDSWKSENCKILLALASQIAAGSV  786

Query  1051  ----DSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
                  SK E A+ ILE LL   + +E+  N   LI LGGLQFLI R   GNL EK  V A
Sbjct  787   EHGFKSKGEAAIFILENLLNCLNKEEKMTNTTHLISLGGLQFLIRRLESGNLEEKTRVVA  846

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFL  1398
             LL  CI+AD + RN IARNI K  LLE+L S+ ++S  NA+ L+TELICL RR + T FL
Sbjct  847   LLRCCIKADGSSRNYIARNIKKSSLLELLHSKQVKSQTNAVLLLTELICLGRRTEITAFL  906

Query  1399  SGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
             + L  + I     +L  YLQSS  +QK LVAVL+LHF LL + +  ++  + AID IT+A
Sbjct  907   NDLLKEGIMYTMHVLLVYLQSSPSEQKPLVAVLLLHFDLLVEPRKCSIYREEAIDTITMA  966

Query  1579  LESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFID-----RFESDLESTE  1743
             L+    D +  E CCK LLILG  FS  G++  E+W+L+Q+GF D       + D+ES +
Sbjct  967   LDHCLTDRKGQEECCKALLILGGRFSFSGEVSIENWLLRQSGFCDWCEAGSLDKDVESVQ  1026

Query  1744  DNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLT  1923
              +E       +  + EEE +E W   ++A LL +     L + S      N E      +
Sbjct  1027  IDE------DIPWEEEEEAKEIWLRHLAAALLVAWLSHALASFS------NTEFQLSVFS  1074

Query  1924  TVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPEC  2103
             T+                         + +LK  LE G+ +E++VL+S+ LLNFSKI EC
Sbjct  1075  TI-------------------------VPRLKENLEKGERIENRVLSSMSLLNFSKISEC  1109

Query  2104  RVLLMMIGEVIEDTLECLAEVTWVARELQTVISS  2205
             RVLLM I + I   L  L EVTW A++L  ++S 
Sbjct  1110  RVLLMKIADEIVIPLRSLVEVTWTAKQLHKILSG  1143



>gb|KHN24966.1| Putative E3 ubiquitin-protein ligase LIN-1 [Glycine soja]
Length=1103

 Score =   488 bits (1255),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 306/739 (41%), Positives = 434/739 (59%), Gaps = 64/739 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+K++++AKH+LQVFCDSP QART LLP+LW+++F P  SHLK WYIKE   LE   SK
Sbjct  330   MQKKNKVSAKHLLQVFCDSPFQARTVLLPELWEHLFSPQFSHLKAWYIKEAEFLEDAPSK  389

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +RKLK+L+KVYNE +D+GT+ FAVYYKDWLTEGVE P IPS+ IP  S  +  +++ NS+
Sbjct  390   TRKLKLLQKVYNEHLDSGTHVFAVYYKDWLTEGVESPPIPSIGIP--SASVTGSQEGNSL  447

Query  361   ------SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEES--------YGGS--ASM  492
                   +  +   SPQP+VSKKLYD +F   +   +   K+ +          GS  +++
Sbjct  448   GYSFESASSIDPLSPQPMVSKKLYDSMFGDSSKSRVYQVKDINDDDNLDNCMKGSCGSTI  507

Query  493   SNGSVTEETHCSQI-----------VKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDV  639
                ++T E+   +            V I+        SM  +EE    ++  LV+   D+
Sbjct  508   VRQTLTYESETVKFTDQDIEDFSIGVAIDTIKPHNGNSMTASEE---WQKRNLVD---DI  561

Query  640   HPKPSIQEIYGT--IDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFI  813
             +   S++    +  IDA  H K  ++++++  K          S   E     SIP EFI
Sbjct  562   NNSFSMKTNLSSHSIDALSHEKASELVLKKPNKT---------SSTLEGSYFPSIPHEFI  612

Query  814   CPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVID  993
             CPLTG +FE+PVTLETGQ+FER AI  WF KGNRTCP+T   LEC  +P +N ILKR+ID
Sbjct  613   CPLTGDLFEEPVTLETGQTFEREAIKAWFEKGNRTCPVTGNNLECVTMPFTNLILKRLID  672

Query  994   KWRSEHWQHLLAFSSQFASD-------SKAEIAVSILEKLLIVSSIDERTKNVKQLICLG  1152
              W+SE   +L+ FS Q   +        + E AV  LE        ++++   K LI LG
Sbjct  673   NWKSERLDYLIDFSFQTVENLEELKLKKRDEAAVFKLESHFSSLKEEDKSTYAKHLISLG  732

Query  1153  GLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQ  1332
              L FL  RF  GN+ EK  V +LL +CI+ DS C   IAR++++ CL+E+L S++     
Sbjct  733   VLPFLFRRFEQGNVKEKSHVVSLLLNCIQVDSGCIYQIARSVNRKCLVELLHSKEATPTT  792

Query  1333  NAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFH  1512
             NAI  +TEL+ + RRKD T F+SGL  + + NI  +L  YL+ S   +K L+AVL+LHF 
Sbjct  793   NAIIFLTELLSMKRRKDVTSFISGLAGEKVFNIMHILLMYLKKSSPFEKPLIAVLLLHFD  852

Query  1513  LLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWIL  1692
             LL + Q   +  + A++AI  AL++S  DE+  E CC+ LLIL  HFS+ GKI T   IL
Sbjct  853   LLVEPQKFGIYREVAVNAIAEALDASLNDEKGREKCCRALLILCSHFSSTGKIPTMTSIL  912

Query  1693  KQAGFIDRFESDLESTEDNEPDNGR-----ITMMDDGEEEVREEWQARMSAMLLGSGKKS  1857
             KQAG+ +     LE       + G+     I++  + EE+  EE   ++   L+G G+  
Sbjct  913   KQAGYNN---DSLEVKPPGHEEEGQQLYVTISVSSEDEEKRGEELLKKLLESLIGDGESP  969

Query  1858  FLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHG  2037
             FL ++S CL + +++LVR CL TV W     + SS   +   L AF ++I QLK  LE+G
Sbjct  970   FLKSISRCLDTNHLDLVRTCLITVTW--LSSSLSSLFSAGLHLPAFLSIISQLKGILENG  1027

Query  2038  KLLEHKVLASVCLLNFSKI  2094
             + LE K LAS+ LLNFSKI
Sbjct  1028  E-LELKTLASLSLLNFSKI  1045



>gb|KDP44413.1| hypothetical protein JCGZ_19428 [Jatropha curcas]
Length=694

 Score =   474 bits (1219),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 304/700 (43%), Positives = 417/700 (60%), Gaps = 97/700 (14%)
 Frame = +1

Query  322   SPQLARNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRH--KNGVELDYYKEESYGGSASMS  495
             S  L R  DP         FSPQP+VSKKLY+ VF H  K G+    Y+ +    + +  
Sbjct  15    SSGLGRPSDP---------FSPQPMVSKKLYEAVFCHSTKPGI----YEAKDDVEADTFD  61

Query  496   NGSVTEE----------THCSQIVKIEPYATCQSYSMPITEE---------AEIQEENKL  618
             NG+ T +          T+ S+IVK       + +    T+          +  +EE KL
Sbjct  62    NGTTTSDSTSVEVKLALTYPSEIVKYLDGERVKDFLDSATDNKFLSDNVILSASKEERKL  121

Query  619   VEHFSDVHP------------KPSIQEIYG-TIDAAPHSKVIKIIIERIAKAFFGQQNTE  759
             VE    V P            +P    + G  ++   ++K   +I++  AK+ FG Q TE
Sbjct  122   VE--VSVSPETDMNDETRKSNRPEEPAVDGHMLNTVSNAKENVLILKNFAKSIFGLQQTE  179

Query  760   ESVD---------SE-RPLGL----------------------SIPTEFICPLTGLVFED  843
             +S D         SE +P+ +                      S+P +FICPLTG +F++
Sbjct  180   DSHDLTISAFSHSSEVQPIKVLATYEDKLDGTYEYFDNGSFLESVPQDFICPLTGKLFDN  239

Query  844   PVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHL  1023
             PVTLETGQ+FE+ AI  WF++GNRTCP+T K LEC  VP SNFILKRVID W+ EH  HL
Sbjct  240   PVTLETGQTFEKEAIKEWFNQGNRTCPVTGKTLECATVPFSNFILKRVIDSWKLEHCSHL  299

Query  1024  LAFSSQFASDS-------KAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFN  1182
             LA +SQ  S+S       + E  + ILE+LL   S +ER  N K  + LGGL+FLI R N
Sbjct  300   LAVASQVLSNSVKHESMARYETTIFILEQLLTTFSREERVANAKHFVSLGGLEFLIGRIN  359

Query  1183  LGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELI  1362
              G+L EK  V+AL+S CIEAD++CRN IAR +DK CL E+L S+  +  +NA+ L+TEL+
Sbjct  360   SGDLEEKTRVAALISCCIEADASCRNQIARKVDKRCLFELLHSKQPKYRRNAVFLLTELL  419

Query  1363  CLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNV  1542
             CL+RRKD   FL+GL++++I N   +L  YLQ+   +++  V++L+LH  LL + Q  ++
Sbjct  420   CLSRRKDVKLFLTGLENEEIRNTMRILLIYLQNCQPEERPWVSMLLLHLDLLIEPQEYSI  479

Query  1543  CIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFE  1722
               + A+DAI +ALE S  DE++ E  C+ LL LG  FSA GK +TE WIL QAGF + +E
Sbjct  480   YKEEAVDAIAMALEDSLTDEKIRENSCRALLALGGRFSASGKSLTESWILNQAGFNNNYE  539

Query  1723  SDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIE  1902
             +D  S ED+   +    M D  EEE   EW   +S  L+G+GK+SFL  +S CLA+GN++
Sbjct  540   TD--SEEDDLLLDDSFAMKD--EEETINEWLKNLSTSLIGNGKRSFLVTMSKCLAAGNLD  595

Query  1903  LVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLN  2082
             LV+ CLTT+AWL     SS+ S +E+ +SAFSALI +LK  LE+G+ +EHKVLAS+ LLN
Sbjct  596   LVKTCLTTIAWL-----SSALSDAEYHISAFSALISRLKENLENGERIEHKVLASMSLLN  650

Query  2083  FSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             FSKIPECRVLLM I E I   L  L EVTW A++L  +IS
Sbjct  651   FSKIPECRVLLMTIAEEIVIPLRRLVEVTWTAKKLYAIIS  690



>ref|XP_009364074.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Pyrus 
x bretschneideri]
Length=1169

 Score =   486 bits (1251),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 345/827 (42%), Positives = 463/827 (56%), Gaps = 112/827 (14%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             L +KDR++AKH+LQVFCD+P  AR +LLP+LWD +FLPHL+HLK WY +E   +    +K
Sbjct  358   LLKKDRVSAKHLLQVFCDTPFHARMTLLPELWDRLFLPHLTHLKTWYDQEADSIADTQNK  417

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS----PQLARNED  348
              RKLK+L K+YNE +D+GT +FAVYYKDWLTEGVE P  P++ IP ++     Q   +E 
Sbjct  418   PRKLKLLGKMYNEMLDSGTYQFAVYYKDWLTEGVESPPTPAIHIPSVTSLQEAQQGSSES  477

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVF------------------------RHKNG-----  441
              +S +   G   PQ +VSKKLYD VF                        R  +G     
Sbjct  478   HSSEAPSPG--GPQLMVSKKLYDSVFSRASKPDPNDTEDDGEMENLDTCTRISDGSFVVK  535

Query  442   ---------VELDYYKEESYGGSASMSNGSVTEETHCSQ-IVKIEPYATCQSYSMPITEE  591
                      V+  Y+  E     ++  +GS++    CS+  +K       +         
Sbjct  536   QITQDSAETVQYQYHDTEDDYSKSAPGDGSLSVSLSCSKTFLKENGLFATEEQKWGYHGV  595

Query  592   AEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVD  771
             +++ E N L   F D+  + S  E    +DA  +   +KI +  +    F Q+  E+S D
Sbjct  596   SDLSESN-LNHQFGDMSGENS--EGPRMLDAQENKLTLKIHVNSV----FEQKPMEDSSD  648

Query  772   SE--------RPLGLSIPTEFICP---------LTGLVFEDPV-----------------  849
                        P   SI +  + P         L G  FE+ V                 
Sbjct  649   HNLSTISNFSEP---SIASSIVNPIKARSSFDDLHGNYFEEGVTFSGIPQDFICPLNGRL  705

Query  850   -----TLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHW  1014
                  TLETGQ+FER AI  W  +GNRTCP+T K LEC  +PL N ILKRVI  W+SEH 
Sbjct  706   FEDPVTLETGQTFERLAIKTWLDQGNRTCPVTGKALECLVLPLPNSILKRVIRSWKSEHC  765

Query  1015  QHLLAFSSQF-------ASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIH  1173
             + LLAF+S          S    E A+S+LE+LL   S +ERT+N K LI LGGLQFL+ 
Sbjct  766   RKLLAFASHVVGTLVRDVSSHCDETAISVLEQLLTCFSNEERTENAKHLISLGGLQFLLQ  825

Query  1174  RFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMT  1353
             RF+ G + EK   +ALL  CIEAD++CRN IAR+I+K  ++E+L S+  +   NA+ L+T
Sbjct  826   RFHYGKVEEKSRAAALLLCCIEADADCRNQIARDINKQYVMEMLQSQQFKIRTNAVLLLT  885

Query  1354  ELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQC  1533
             ELICL R+KD T FLSGLQ + + +   +L   LQSS    + LVAVL+LH  LL + + 
Sbjct  886   ELICLKRKKDVTTFLSGLQIEGMVDTMDVLLACLQSSPANHRPLVAVLLLHVDLLVERKL  945

Query  1534  S-NVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFI  1710
             S  +  + A+DAIT AL+ S  DE + + CC  LLILGR FS   K  ++ WILKQ    
Sbjct  946   SMPLHREEAVDAITEALDCSLTDENVQKNCCTALLILGRFFSCSRK-SSQSWILKQEDCS  1004

Query  1711  DRFESDLESTEDNEPD---NGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMC  1881
                E +   + DNE D      ++ +D+GE    E+W   ++  LLG GKKSF+  LS C
Sbjct  1005  GNSEVN---SLDNEEDISLADDMSPLDEGENS-SEDWLRNLTVSLLGYGKKSFVETLSKC  1060

Query  1882  LASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVL  2061
             L S N+EL+R+CL TV WL    A SS SGSEF+LSAFS+LI  LK CL+  + +E K+L
Sbjct  1061  LGSENLELIRMCLITVEWL--SRALSSLSGSEFQLSAFSSLIFPLKQCLKTSEQVEQKIL  1118

Query  2062  ASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             AS+ +LNFSKI ECRVLL    E I   LE LAEVTW A+ L  +IS
Sbjct  1119  ASMSMLNFSKISECRVLLRENTEDIAVPLENLAEVTWSAKLLHDIIS  1165



>ref|XP_009626404.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X3 
[Nicotiana tomentosiformis]
Length=933

 Score =   476 bits (1226),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 270/564 (48%), Positives = 355/564 (63%), Gaps = 58/564 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+KDRIAAKH+LQVFCDSP QART+LLPDLWD+IFL H S+LK W+  E   L    +K
Sbjct  355   IQKKDRIAAKHLLQVFCDSPFQARTNLLPDLWDHIFLRHFSNLKAWFDSEANFLGGLHNK  414

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQL-ARNEDPNS  357
             SRKLK LEK+YNE +D GT +FA+YYK+WLTEG E P +PS++IP +S Q      + + 
Sbjct  415   SRKLKFLEKMYNENLDNGTYQFALYYKEWLTEGAEIPLLPSIEIPSVSVQYEGSFSNSSH  474

Query  358   VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEE------SYGGSASMSNGSVTEET  519
             +S  VG FSPQPVVSK+LYDEVFRH + +E +  +        S   S+S +  ++    
Sbjct  475   LSSTVGGFSPQPVVSKRLYDEVFRHSHKLENESEEHREESYEVSVRRSSSFAAENLVALK  534

Query  520   HCSQIVK-----IEPYATCQSYSMPITEEAE------IQEENKLVEHFSDVHPKPSIQEI  666
             + ++++K     ++P A   SY      +AE        EE   +E F +   K +    
Sbjct  535   YSAEVIKCIDHDVKPGAIVDSYGASRARDAEGVFGMNSPEEKIFMEIFGNSDLKETTPLK  594

Query  667   YGTIDAAPHSKVIKIIIERIAKAFFGQQNTEES---------------------------  765
                 ++   + + + I  RIAK  F Q+ TE+S                           
Sbjct  595   SNMPESFAPANLTEFIFNRIAKTAFEQKETEDSIIHAAPPLLLFSEVALALDCTPTEVLL  654

Query  766   ----VDSERPLGLS---IPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCP  924
                 VD E  +G S   IP EFICPLTGL+FEDP TLETGQ+FERA+I +WFSKGNR CP
Sbjct  655   PAQGVDYEDYVGRSSANIPQEFICPLTGLLFEDPATLETGQTFERASITSWFSKGNRACP  714

Query  925   ITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS------KAEIAVSILE  1086
             +T + LECQ+VP +NF LK VI  W+SEHW+ LL + S+ A +S      K EI VS+L+
Sbjct  715   VTQRLLECQSVPRANFFLKHVITNWKSEHWRRLLTYFSKEAGNSGKHRWLKNEIVVSVLQ  774

Query  1087  KLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLI  1266
             +LLIV   DER + ++QLI LG LQFLI RFN G   EK CVS +L SCIE D+ CRN++
Sbjct  775   QLLIVLHQDERRETLEQLISLGSLQFLIQRFNYGKAREKICVSGILCSCIEVDNKCRNVV  834

Query  1267  ARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLS  1446
             ARN+DKMCLL +L +E+LE  +NA SL+TELICLNRRKDA +F+  +  D+I      L 
Sbjct  835   ARNVDKMCLLNLLQNEELELRRNAFSLLTELICLNRRKDAKFFIKCIHKDNIVKAMQDLL  894

Query  1447  TYLQSSHCKQKSLVAVLILHFHLL  1518
             TYLQ   C+Q+S+VAVL+LHF LL
Sbjct  895   TYLQDCPCEQRSMVAVLLLHFDLL  918



>ref|XP_010907382.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 [Elaeis 
guineensis]
Length=1150

 Score =   481 bits (1237),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 315/844 (37%), Positives = 449/844 (53%), Gaps = 137/844 (16%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             L +K+R++AKH+LQVFC+SP QART LLP LWD +FLPH SHL+ WY KE   +    S+
Sbjct  329   LHKKNRVSAKHLLQVFCNSPYQARTILLPGLWDRLFLPHFSHLREWYDKEAEFIPRTSSR  388

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNS-  357
              +K K+L KVYN+ +D GT + A YYK+WL E    P++PS+ +P  S    R E  N+ 
Sbjct  389   VKKTKLLGKVYNDILDMGTYQIADYYKEWLMEENGSPALPSIPVP--SSSYPRREGSNAT  446

Query  358   ----VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHC  525
                 VS      S QP+VS++LY+ VF     +E     EE  G    +        T  
Sbjct  447   DLAVVSSARSPASSQPMVSRRLYESVFSQTKKME---EAEELKGREEEIEEEQFIVHTRS  503

Query  526   SQ-----IVKIEPYATCQSYSMPITEEAEIQEENKLVE----------HFSDVHPKPSIQ  660
             S+       +  P +  Q+     T   E +E +   E            +D   K    
Sbjct  504   SESPIQEYEEYSPNSVIQTQEDNNTSSQEPKESSNGDEWTTNESCNACKVNDFRVKNPTV  563

Query  661   EIYGTIDA------------APHSKVIKIIIERIAKAFFG---QQNTEESVDSE-RPLGL  792
             E +G   +            AP +K  ++ + ++A+A F    Q  + ES  SE +  GL
Sbjct  564   ECHGIQSSPAILGCACFPYLAPQTKENELTLRKLAQAVFKPQVQMGSVESTGSEVKNSGL  623

Query  793   --------------------------------SIPTEFICPLTGLVFEDPVTLETGQSFE  876
                                             SIP +F+CPLT  +F+DPVTLETGQ+FE
Sbjct  624   LSKNSDRNSAALSSSAESIEDYDDVDRGSFFSSIPKDFMCPLTRQLFKDPVTLETGQTFE  683

Query  877   RAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASD-  1053
              AAI  WF +GNRTCP+T ++L+  +VP+ NF+LKR+ID W+SE  ++LL F++Q A + 
Sbjct  684   GAAIKEWFDQGNRTCPVTGRELKYLSVPVMNFVLKRLIDAWKSERCKNLLIFATQIAENA  743

Query  1054  ------SKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVS  1215
                   SK E A+ I+E+LL   S +E+ +N + LI LGGL FLIHR   GNL EK CV+
Sbjct  744   TKQDRKSKDESALYIIEQLLTGFSTEEQMENARHLIALGGLDFLIHRLEQGNLKEKTCVA  803

Query  1216  ALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAIS-----------------  1344
              LL  CI+A+  CR+ +A N+   C+L++L S    S  NA+                  
Sbjct  804   GLLLCCIKANGCCRSYLALNLKSSCILDLLHSNHFRSRTNAVLLLIELICLESWFGSSDP  863

Query  1345  -----------------LMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCK  1473
                              L+T     +RR   T FLSGLQ+D I N    L  +LQ+S  +
Sbjct  864   QIKSFKFYYRIAFYLHILLTACFGCHRRTAITLFLSGLQTDAIVNTMHALLVHLQTSPPE  923

Query  1474  QKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHF  1653
             ++ LVAVL+L F L+ +    ++  + A+D IT+AL     D+++I    + LL+LG +F
Sbjct  924   ERVLVAVLLLQFDLVVEPCRYSIYREEALDGITLALNCCSFDQKVIPYSRRALLMLGGYF  983

Query  1654  SAFGKIMTEDWILKQAGFIDRF--ESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMS  1827
             S+ G+I+TE W+L+QAG+ D    ES LE                  E + +E+W   ++
Sbjct  984   SSSGEILTEAWLLQQAGYSDGGVEESTLE------------------EAKEKEKWLKNVT  1025

Query  1828  AMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALI  2007
               LL SGK+SFL  LS CL  GN ELVR CL TVAWL       S   +  +LSAF+ALI
Sbjct  1026  LALLHSGKRSFLETLSKCLGYGNPELVRACLATVAWL--SHVLLSLPAAGHQLSAFAALI  1083

Query  2008  CQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
              +LK  +E+ + +EH+VLAS+ L NFSKI ECRVLL    EV ++ L+ L+++TW A++L
Sbjct  1084  PRLKESIENYEQIEHRVLASIALFNFSKIMECRVLLSFADEV-QNPLKNLSDITWTAKQL  1142

Query  2188  QTVI  2199
                I
Sbjct  1143  YATI  1146



>ref|XP_003621006.1| U-box domain-containing protein [Medicago truncatula]
 gb|ABN09772.1| U box [Medicago truncatula]
 gb|AES77224.1| ubox-like protein, putative [Medicago truncatula]
Length=1073

 Score =   479 bits (1232),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 306/773 (40%), Positives = 449/773 (58%), Gaps = 61/773 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELG-MLESPDS  177
             +QRK +++AKH+LQVFCDSP QAR  LLP+LW+ +F   LS LK WY  + G ++    +
Sbjct  317   IQRKKKVSAKHLLQVFCDSPFQARAILLPELWERLFSSQLSDLKKWYNNKEGEIVLDIQN  376

Query  178   KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS------PQLAR  339
             K+RK+K+L+KVYNE +D+GT  FA+YYKDWL+EGVE P+IPS+ IP LS        L  
Sbjct  377   KARKIKILQKVYNENLDSGTQLFALYYKDWLSEGVETPTIPSIGIPSLSITSRQGSSLGH  436

Query  340   NEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGV---ELD-------YYKEESYGGSAS  489
             + + +S +     FSPQ +VSKKLYD  F  K  V   ELD        Y+  SYG  ++
Sbjct  437   SFESSSSN---EPFSPQAMVSKKLYDSFFGSKPQVYEVELDEDEDSFENYERGSYG--ST  491

Query  490   MSNGSVTEETHCSQIV-----KIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPS  654
             +   ++  E+   + +     +  P      + +P    +         E + D + + +
Sbjct  492   IVKKTLIYESETVKYIDQSTEEFTPRVPVHEFYIPRKGTSRTA-----AEEWKDRNSRNA  546

Query  655   IQEIYGT--------IDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEF  810
              ++ +           +  PH K  +I I++        Q  + +   +     SIP EF
Sbjct  547   TRKYFSIETNSNSHIFNDQPHEKENEISIKKT-------QPNKITSTIDGSYSPSIPQEF  599

Query  811   ICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVI  990
             ICPLT  +FE+PVTLE+GQ+FER AI  WF KGNRTCP+T   LEC  +P SN ILKR+I
Sbjct  600   ICPLTRNIFEEPVTLESGQTFERKAIKAWFQKGNRTCPVTGNTLECVVIPFSNLILKRLI  659

Query  991   DKWRSEHWQHLLAFSSQFASDSKA-------EIAVSILEKLLIVSSIDERTKNVKQLICL  1149
             D W+SE +  LL F+SQ   +SK        E  V  L+ LL     ++++   K +I L
Sbjct  660   DNWKSEDFDRLLDFASQTFENSKEIKLKKRDEDIVFKLQVLLSSLKKEDKSTYAKHIISL  719

Query  1150  GGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESV  1329
             G L FL  RF  GNL EK  V  +L +CI +DS+C   IAR +++  LLE+L S+D+   
Sbjct  720   GVLSFLCRRFEQGNLEEKSHVIEILLNCIRSDSSCIYKIARGVNRKFLLELLHSKDVTPT  779

Query  1330  QNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHF  1509
             +NAI  +TEL+ + RRKD T F+SGL  +D+ +   ++  YL++S   +K L+AVL+LHF
Sbjct  780   KNAILFLTELLSMKRRKDVTSFISGLVGEDVVSTMHIVLMYLKNSSPIEKPLIAVLLLHF  839

Query  1510  HLLTDT-QCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDW  1686
              LL +  Q  ++ I+ A+ AI  AL++S  D+++ + CC+ +LIL  HFS+ G I     
Sbjct  840   ELLVEQPQKFSIYIEMAVKAIAEALDASLNDDKVQKKCCRAILILCGHFSSTGMITNNTS  899

Query  1687  ILKQAGFIDRFESDLESTE-DNEPDNGRITMMD-DGEEEVREEWQARMSAMLLGSGKKSF  1860
             ILKQ G+ +   S+L+S   D+E     +T+   D EEE+ EE+ A +   ++G G+  F
Sbjct  900   ILKQEGY-NNGSSELKSPSLDDEDQRLNVTISSEDEEEEMDEEFMANLLESMIGDGESLF  958

Query  1861  LGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGK  2040
             L  +S CL S +++L+R CL TV WL    + S +  +   L AF A+I QLK  LE+G+
Sbjct  959   LKTISKCLDSRHVDLMRACLITVTWL--SSSLSKQYNAGLHLPAFLAIISQLKGILENGE  1016

Query  2041  LLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVI  2199
              LE K LAS+ L NFSKI ECR LL ++ + I   L  L +V W A++L  ++
Sbjct  1017  -LELKALASMSLFNFSKISECRTLLKIMADDIAPLLHGLVDVLWTAKKLHAIL  1068



>ref|XP_008786745.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Phoenix 
dactylifera]
Length=1046

 Score =   476 bits (1225),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 303/789 (38%), Positives = 442/789 (56%), Gaps = 115/789 (15%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+K+ ++AKH+LQVFC+SP QART LLP LW+++FLPHLSHL+ WY KE   +    S+
Sbjct  313   LQKKNTVSAKHLLQVFCNSPYQARTILLPGLWEHLFLPHLSHLREWYEKEAEFIPRTSSR  372

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              +K K+LEKVYN+ +D GT + A YYK+WL E    P++PS+ +P               
Sbjct  373   VKKTKLLEKVYNDILDMGTYQIADYYKEWLMEENGAPALPSIPVP---------------  417

Query  361   SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSAS-MSNGSVTEETHCSQIV  537
                  S+ P+            +  N  +LD         S+  M N   T+E+ C+ + 
Sbjct  418   ----SSYPPR------------KGSNAADLDVASSAGSPASSQPMGNERTTKES-CN-LC  459

Query  538   KIEPYATCQSYSMPITEEAEIQEENKLV-EHFSDVHPKPSIQEIYGTIDAAPHSKVIKII  714
             K++ +                 +ENKL+    +    KP +  +  T     +S ++   
Sbjct  460   KVDDFQA---------------KENKLILRKLAQAVFKPQMGNVESTGSEVKNSGLLSKN  504

Query  715   IERIAKAFFGQQNTEESVDSERPLGL--SIPTEFICPLTGLVFEDPVTLETGQSFERAAI  888
              +R ++A      + E  ++        SIP +F+CPLTG +F+DPVTLETGQ+FERAAI
Sbjct  505   SDRNSEALSSSAESIEDYEAADRSSFFSSIPRDFMCPLTGQLFKDPVTLETGQTFERAAI  564

Query  889   LNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASD-----  1053
               WF +GNRTCP+T ++L+  +VP+ NF+LKR+ID W+SEH ++LL F++Q A D     
Sbjct  565   KEWFDRGNRTCPVTGRELKYLSVPVMNFVLKRLIDSWKSEHCKNLLIFATQIAGDPTKQD  624

Query  1054  --SKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLS  1227
               SK E A+ I+E+LL   S +E+ +N + LI LGGL FLIHRF LGNL EK CV+ LL 
Sbjct  625   CKSKDESALYIIEQLLTGFSTEEQMENARHLITLGGLDFLIHRFELGNLKEKSCVAGLLL  684

Query  1228  SCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISL---------MTELIC-----  1365
              CI+AD  CR+ +A N+   C LE+L      S  NA+ L         MT L+C     
Sbjct  685   CCIKADGCCRSYLAMNLKSSCFLELLYGNHFTSRTNAVLLLIELICLERMTFLLCSLVHY  744

Query  1366  ------------------------------LNRRKDATYFLSGLQSDDIANITILLSTYL  1455
                                            +RR   T FLSGLQ++ I +    L  YL
Sbjct  745   RTNIQINIYYHTITLLAFYLHILLTVACFGCHRRTAITMFLSGLQTEAIVDTMKALLVYL  804

Query  1456  QSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLL  1635
             Q+S  +++ LVAVL+L F L+ +    ++  + A+D+IT+AL     D+++I    + LL
Sbjct  805   QTSPPEERVLVAVLLLQFDLVVEPCRYSIYREEALDSITLALNCCSFDQKVIPNSRRALL  864

Query  1636  ILGRHFSAFGKIMTEDWILKQAGFID-RFESDLESTEDNEPDNGRITMMDDGEEEVREEW  1812
             +LG +FS  G+I+ E  +L+QAG+ D  F +     E++       T+ ++  E  +E+W
Sbjct  865   MLGGYFSLSGEILAEARLLQQAGYSDVGFANSDGGVEES-------TLEEEANE--KEKW  915

Query  1813  QARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsa  1992
                ++  LL SGK+SFL  LS CL  GN+ELVR CL TVAWL       S S +  +LSA
Sbjct  916   LKNVTLALLRSGKRSFLETLSKCLGYGNLELVRACLATVAWL--SHVLVSLSAAGHQLSA  973

Query  1993  FSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTW  2172
             FSALI +LK  LE+ + +EH+VLAS+ L NFSKI ECRVLLM   + +++ L+ L ++TW
Sbjct  974   FSALIPRLKESLENCEQIEHRVLASMSLFNFSKITECRVLLMSFADELQNPLKDLLDITW  1033

Query  2173  VARELQTVI  2199
              A++L   I
Sbjct  1034  TAKQLYATI  1042



>ref|XP_008451115.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Cucumis melo]
Length=1180

 Score =   469 bits (1208),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 307/791 (39%), Positives = 451/791 (57%), Gaps = 79/791 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q K R +AKHILQVFC+   QAR  L P+LWD++FLPHL H+K WY  E   L +   +
Sbjct  407   IQNKKRSSAKHILQVFCNLTFQARIVLFPELWDDLFLPHLLHIKSWYDYEADSLVNAPKQ  466

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP---  351
             SRK K+L+KVYNET+D+GT K+AVYYKDWLT G+E    PS+ +P +S +    E P   
Sbjct  467   SRKQKLLDKVYNETLDSGTCKYAVYYKDWLT-GIEALE-PSIVVPAVSFEGVDQESPVNN  524

Query  352   NSVSCIVGSF-SPQPVVSKKLYDEVF-RHKNGV-----------ELD-------------  453
             ++ + +   F SP  +VSKKLYD +F   KN              LD             
Sbjct  525   STATTLCNDFVSPNLMVSKKLYDAMFATSKNQAAPHTEIEWELENLDNCVRSSNSSNVSK  584

Query  454   ----YYKEESYG---GSASMSNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAEIQEE-  609
                 YY + +      + + S GS TE T  S+  K + + T   Y++    E +  +E 
Sbjct  585   HTQIYYSDTTKDLDQDTDADSMGSTTENTSSSENCKAQEWKT---YNINALSEMDGSDEF  641

Query  610   -------NKLVEHFSDVHPKPSIQ-EIYGTID-AAPHSKVIKIIIERIAKAFFGQQNTEE  762
                    N  ++ F  +H + +     Y     A P  + IK+       +     ++ E
Sbjct  642   CSSTTWKNNEID-FEVLHAQSNTDGNSYSRQKLAQPSHEPIKV-----NPSLREPNDSYE  695

Query  763   SVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKL  942
             S D E     S+P +FICPLTG +++DPVTLETGQSFE+ AI  W  +G+RTCP+T KKL
Sbjct  696   SSD-EISSVFSLPKDFICPLTGQLYQDPVTLETGQSFEKTAIKAWLDQGHRTCPVTGKKL  754

Query  943   ECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFA-------SDSKAEIAVSILEKLLIV  1101
             E  A+PL+NFIL+RVI  W S   ++ LAF SQ         +++K+E  + IL++ L  
Sbjct  755   ETLAIPLTNFILQRVIKNWNSNRRRNFLAFLSQRVHSSEKSMTNNKSETTIFILDQFLTA  814

Query  1102  SSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNID  1281
                 E  +N   LI  G L+FLI  F  GNL EK  V ALLS CI+AD  CRN IA  I 
Sbjct  815   GGKVEAMENANYLIANGYLRFLIQLFESGNLEEKTRVLALLSRCIQADEQCRNQIADEIS  874

Query  1282  KMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQS  1461
                L+ +L S+ ++S+++ + L+T+LI L RRKD T FLS L  +D  +    +  YL+S
Sbjct  875   ISSLVNLLHSKQVKSLESVVQLLTKLIFLKRRKDVTLFLSRLLKEDSEDTLQAILVYLRS  934

Query  1462  SHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLIL  1641
             S   Q+ LVAVL+LHF+L+ ++   ++ ++ A+DAI  AL++S  ++++ E CC+ +LIL
Sbjct  935   SPPVQRPLVAVLLLHFNLVVESLQQSMYMEEALDAIIKALDASLTNQKIRESCCEAILIL  994

Query  1642  GRHF---SAFGKIMTEDWILKQAGFIDRFESD-LESTEDNEPDNGRITMMDDGEEEVREE  1809
             G HF     FG +      LK+ GFI+  E D ++  E+N   N ++    + E++  EE
Sbjct  995   GGHFPLRETFGSM-----TLKEVGFINFCEVDSIDYKEENPEMNKKLV---EDEKQAIEE  1046

Query  1810  WQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefels  1989
             W+ +++  L+ S K+ F   +S CLA G+++LV V L+T+ WL    +       +F   
Sbjct  1047  WRRKLTLSLMKSVKQPFFEIISKCLAIGSLDLVGVGLSTLTWL--SFSLPRLPAPKFHPL  1104

Query  1990  aFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVT  2169
               S LI  LKACL++  L+EHK+LAS CLLN SKI ECR++++ I + IED L  +AE++
Sbjct  1105  TLSDLISLLKACLQNSMLVEHKILASTCLLNLSKIAECRLIVIAIRKEIEDPLRSIAEIS  1164

Query  2170  WVARELQTVIS  2202
               A+ L  +I+
Sbjct  1165  QSAKHLYAIIT  1175



>ref|XP_004149032.1| PREDICTED: uncharacterized protein LOC101219197 [Cucumis sativus]
Length=1159

 Score =   468 bits (1204),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 299/755 (40%), Positives = 428/755 (57%), Gaps = 78/755 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q K   +AKHILQVFC+ P QAR  L P+LWD++FLPHL H+K WY  E   L +   +
Sbjct  396   IQNKKNSSAKHILQVFCNLPFQARNGLFPELWDDLFLPHLLHIKSWYDYEADSLVNAPKQ  455

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP---  351
             SRK K+L+KVYNET+D+ T K+AVYYKDWLT G+E P  PS+ +P +S +    E P   
Sbjct  456   SRKQKLLDKVYNETLDSSTCKYAVYYKDWLT-GIEAPE-PSIVVPAVSFEGVDQESPVNN  513

Query  352   NSVSCIVGSF-SPQPVVSKKLYDEVF------------------------RHKNGVELDY  456
             +S + +   F SP  +VSKKLYD +F                        R  N   +  
Sbjct  514   SSATTLCNDFVSPNLMVSKKLYDAMFATSKNQGAPHTEIEWELENRDNCIRSSNSSNVSK  573

Query  457   YKEESYGGSASM--------SNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAEIQEE-  609
             + +  Y  +           S GS TE T   +  K + + T   Y++    E +  +E 
Sbjct  574   HTQIYYSDTTKDLDQDTDEDSTGSTTENTSSFENCKGQEWKT---YNINALSEMDGSDEI  630

Query  610   -------NKLVEHFSDVHPKPSIQEIYGTIDAAPHSKVIKIIIE--RIAKAFFGQQNTEE  762
                    N  ++ F  +H + + +      ++    K+ +  ++  ++  +     ++ E
Sbjct  631   CSSTTCKNNEID-FEVLHAQSNTEG-----NSYSQQKLAQPCLDPIKVNPSLREPNDSYE  684

Query  763   SVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKL  942
             S D ER   LS+P +FICPLTG +++DPVTLETGQSFE+ AI  W  +G+RTCP+T KKL
Sbjct  685   SSD-ERSSFLSLPKDFICPLTGELYQDPVTLETGQSFEKTAIKAWLDQGHRTCPVTGKKL  743

Query  943   ECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS-------KAEIAVSILEKLLIV  1101
             E  A+PL+NF+L+RVI  W S   ++ LAF SQ    S       K+E  + IL+  L  
Sbjct  744   ETLAIPLTNFVLQRVIKNWNSNRRRNFLAFLSQGVHSSEKSMINNKSETTIFILDHFLAA  803

Query  1102  SSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNID  1281
                 E  +N   LI  G L+FLI  F  GNL EK  V ALLS CI+AD  CRN IA  I 
Sbjct  804   GGKVEAMENANYLIANGYLRFLIQLFESGNLEEKTRVLALLSRCIQADEQCRNQIANEIS  863

Query  1282  KMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQS  1461
                L+ +L S+ ++S+++ + L+T+LICL RRKD T FLS L  +D  N    +  YL+S
Sbjct  864   ISSLVNLLHSKQVKSLESVVQLLTKLICLKRRKDVTLFLSSLLKEDSENTLQAVLVYLRS  923

Query  1462  SHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLIL  1641
             S   Q+ LVAVL+LHF+L+ ++Q  ++ ++ A+DAI  AL+ S  ++++ E CCK +LIL
Sbjct  924   SPPVQRPLVAVLLLHFNLVVESQQQSMYMEEALDAIIKALDDSLTNQKIRESCCKAILIL  983

Query  1642  GRHFS---AFGKIMTEDWILKQAGFIDRFESD-LESTEDNEPDNGRITMMDDGEEEVREE  1809
             G HFS    FG        LK+ GFI+  E D L+S E+N   N +  + D  E++  EE
Sbjct  984   GGHFSLPETFGST-----TLKEIGFINFVEVDSLDSKEENPEMNNKKLVED--EKQAIEE  1036

Query  1810  WQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefels  1989
             WQ +++  L+ S K+ F   +S CLA G+++LV V L+T+ WL    +       +F   
Sbjct  1037  WQRKLTLSLVKSVKQPFFAIISKCLAIGSLDLVGVGLSTLTWL--SFSLPLLPAPKFHPL  1094

Query  1990  aFSALICQLKACLEHGKLLEHKVLASVCLLNFSKI  2094
             A S LIC LK CL++  L+EHK+LAS CLLN SKI
Sbjct  1095  ALSDLICLLKDCLQNSMLVEHKILASTCLLNLSKI  1129



>gb|ACJ02343.1| U-box domain-containing protein [Helianthus annuus]
Length=1050

 Score =   464 bits (1193),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 269/621 (43%), Positives = 388/621 (62%), Gaps = 60/621 (10%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+K+RI AKH+LQ+FCDSP  ART+L+P+LW+N+F PHLSHL+ WY +E+  L      
Sbjct  325   LQKKERIVAKHLLQMFCDSPFSARTTLVPELWENVFHPHLSHLESWYNQEVNSLADDPHN  384

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQ--LARNEDPN  354
             +RKLK L+KVY + +D+GT +FA+YYKDW+T+GVE PSIPS+ +P +S Q  L+   + N
Sbjct  385   TRKLKQLKKVYYDILDSGTYQFALYYKDWITDGVEAPSIPSIHVPMISVQKVLSVGVNGN  444

Query  355   SVSCIVGSFSPQPVVSKKLYDEVF--RHKN---GVELDYYKEESYGGSASMSNGSVTEET  519
             ++     SFS   +VSKKLYD+VF   HK+    VE   Y + S   + S     V ++ 
Sbjct  445   ALDFGSPSFSSHAIVSKKLYDDVFGQMHKSVTAEVEDYQYSQRSEDDTYSFDGSVVEDKR  504

Query  520   HCSQIVKIEPYA-------------TCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQ  660
               +  ++ + Y              +C  Y +      ++Q+   + +   ++    + +
Sbjct  505   TLTYPLEEDGYKDLDVKRGWETFQLSCNLYML---SNFQMQQGEIIAQEELELQRANTFE  561

Query  661   EIYGT--IDAAPHSKVIKIIIERIAKAFFGQQNTEE-----------------SVDSERP  783
              + GT  + + P +KV ++ ++R+AK  FG Q TE                  + D E  
Sbjct  562   GLEGTNMLQSLPVAKVNELTLKRLAKFVFGLQQTENQLHLDVTKHPDSSPIKSNADGEH-  620

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
               L+IP +++CPLTG +FEDPVTLETGQ++ER AI+ WFSKGN+TCP+T K LE Q VP 
Sbjct  621   FFLNIPEDYMCPLTGHIFEDPVTLETGQTYERVAIMEWFSKGNKTCPVTGKTLEYQTVPF  680

Query  964   SNFILKRVIDKWRSEHWQHLLAFSSQ-----FASDSKAEIAVSILEKLLIVSSIDERTKN  1128
             +N ILKR+ID W+S+H + +L+ +S+        + KAE AV ILE+LL V   +E T N
Sbjct  681   TNSILKRLIDSWKSKHSREMLSSASRPMGSPREHEYKAEAAVFILEQLLTVFGREENTAN  740

Query  1129  VKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLC  1308
              K L+ LGGLQFLI RF  GNL+EK  V+ALLS CIEADS+CRN +AR +DK  +LE+L 
Sbjct  741   AKHLLALGGLQFLIQRFQYGNLDEKTRVAALLSMCIEADSSCRNHVARYVDKEGVLELLH  800

Query  1309  SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLV  1488
              ++++S  NA+ L+ +LICLNRRKD  +FLSGLQ + I            S   +QK LV
Sbjct  801   CKEVKSRSNAVFLLFDLICLNRRKDVRFFLSGLQKEVI------------SCSLEQKPLV  848

Query  1489  AVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGK  1668
             AVL+LH  LL D Q  ++  + A+D IT AL++S  DE++ E CC+ LLI+G   S  G 
Sbjct  849   AVLLLHLDLLVDQQKYSIYREEAVDTITSALDTSLFDEKVRETCCRALLIMGARISLSGT  908

Query  1669  IMTEDWILKQAGFIDRFESDL  1731
             ++T+D+ L++AGF +R E D+
Sbjct  909   VITQDYNLQKAGFYNRPELDV  929



>ref|XP_004491685.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cicer 
arietinum]
Length=1060

 Score =   461 bits (1185),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 309/767 (40%), Positives = 437/767 (57%), Gaps = 61/767 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+K +++AKH+LQVFCDSP QART LLP+LW+++F P L HLK WY  +    E+    
Sbjct  316   MQKKKKVSAKHLLQVFCDSPFQARTILLPELWEHLFYPQLCHLKEWYNNK----EAEIVD  371

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +RKLK L+KVYNE +D+GT  FAVYYKDWL EGVE P+IPS+  P  S            
Sbjct  372   TRKLKFLQKVYNEHLDSGTQIFAVYYKDWLIEGVETPTIPSIGFPSFSVTSP-------S  424

Query  361   SCIVGSFSPQPVVSKKLYDEVFRHKNGVEL--------DYYKEESYGGSASMSNGSV-TE  513
             S    +FSPQ +VSKKLYD  F   +  E+            E S+      S GS   +
Sbjct  425   SESSETFSPQAMVSKKLYDSFFGKYSKPEIYEVDDDDDGDKDEGSFENCERGSYGSTFVK  484

Query  514   ET--HCSQIVKIEPYATCQSYSMPITEEA-------------EIQEENKLVEHFSDVHPK  648
             +T  + S+ VK    +T + ++  ++  A             E +E N +         +
Sbjct  485   KTLIYESETVKFSDQST-EDFTPSVSVHAFYPQKGTSRIAAEEWKERNSINAPRKYFSLE  543

Query  649   PSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTG  828
              ++    G  DA PH K  +I + +  K          S   E     SIP EFICPLT 
Sbjct  544   ANLNSHIG--DALPHEKANEISLRKPNKI---------SSILEGSYFPSIPQEFICPLTK  592

Query  829   LVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSE  1008
              +FE+PVTLE+GQ++ER +I  WF KGN+TCP+T   LEC  +P +N +LKR+ID W+SE
Sbjct  593   NIFEEPVTLESGQTYERKSIKAWFEKGNKTCPVTENTLECVVIPCTNLLLKRLIDNWKSE  652

Query  1009  HWQHLLAFSSQFASDSKA-------EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFL  1167
              +  LL F+SQ    SK        E AV +L+ L       +++   K LI LG L FL
Sbjct  653   DFNRLLDFASQTVEYSKELKLKKRDEAAVFMLQGLFSSLKDGDKSTYAKHLISLGVLSFL  712

Query  1168  IHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISL  1347
               RF  GNL EK  V  LL +CIE DS+C   IAR++++ C LE+L S+++    NAI L
Sbjct  713   FRRFEFGNLEEKSHVLELLLNCIEEDSSCIYKIARSVNRKCFLELLHSKEVTPTTNAILL  772

Query  1348  MTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDT  1527
             +TEL+ + RRKD + F+SGL  +++ +   +L  YL++S   +K L+AVL+LHF LL + 
Sbjct  773   LTELLSIKRRKDFSSFISGLMGENVFSTMHILLMYLKNSSPIEKPLIAVLLLHFDLLVEQ  832

Query  1528  -QCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAG  1704
              Q   +  + A++AI  AL+ S  DE++ + CC+ LLIL  HFS+ G I T   ILKQAG
Sbjct  833   PQKFRIYREMAVNAIAEALDGSLNDEKIRKKCCRALLILCGHFSSTGMITTRTSILKQAG  892

Query  1705  FIDRFESDLE--STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSM  1878
             + +   S+L+    +D+E     IT+  + EEE  EE+  ++   L+G G+  FL  +S 
Sbjct  893   Y-NNGSSELKYPGHDDDEDQQLDITISLEDEEERDEEFLMKLLESLIGDGESPFLKTISR  951

Query  1879  CLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKV  2058
             CL   +++LVR CL TV WL    + S    +   L AF A+I QLK  L++G+ LE K 
Sbjct  952   CLDCRHVDLVRACLITVTWL--SSSLSKLFHAGLHLPAFLAIISQLKGILQNGE-LELKT  1008

Query  2059  LASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             LAS+ LLNFSKI E R LL ++ E I   L  L +V W A++L  ++
Sbjct  1009  LASMSLLNFSKISEYRTLLKIMAEDIAPLLHGLVDVIWTAKKLHAIV  1055



>gb|KEH21470.1| ubox-like protein, putative [Medicago truncatula]
Length=1037

 Score =   454 bits (1169),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 295/740 (40%), Positives = 430/740 (58%), Gaps = 61/740 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELG-MLESPDS  177
             +QRK +++AKH+LQVFCDSP QAR  LLP+LW+ +F   LS LK WY  + G ++    +
Sbjct  317   IQRKKKVSAKHLLQVFCDSPFQARAILLPELWERLFSSQLSDLKKWYNNKEGEIVLDIQN  376

Query  178   KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS------PQLAR  339
             K+RK+K+L+KVYNE +D+GT  FA+YYKDWL+EGVE P+IPS+ IP LS        L  
Sbjct  377   KARKIKILQKVYNENLDSGTQLFALYYKDWLSEGVETPTIPSIGIPSLSITSRQGSSLGH  436

Query  340   NEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGV---ELD-------YYKEESYGGSAS  489
             + + +S +     FSPQ +VSKKLYD  F  K  V   ELD        Y+  SYG  ++
Sbjct  437   SFESSSSN---EPFSPQAMVSKKLYDSFFGSKPQVYEVELDEDEDSFENYERGSYG--ST  491

Query  490   MSNGSVTEETHCSQIV-----KIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPS  654
             +   ++  E+   + +     +  P      + +P    +         E + D + + +
Sbjct  492   IVKKTLIYESETVKYIDQSTEEFTPRVPVHEFYIPRKGTSRTA-----AEEWKDRNSRNA  546

Query  655   IQEIYGT--------IDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEF  810
              ++ +           +  PH K  +I I++        Q  + +   +     SIP EF
Sbjct  547   TRKYFSIETNSNSHIFNDQPHEKENEISIKKT-------QPNKITSTIDGSYSPSIPQEF  599

Query  811   ICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVI  990
             ICPLT  +FE+PVTLE+GQ+FER AI  WF KGNRTCP+T   LEC  +P SN ILKR+I
Sbjct  600   ICPLTRNIFEEPVTLESGQTFERKAIKAWFQKGNRTCPVTGNTLECVVIPFSNLILKRLI  659

Query  991   DKWRSEHWQHLLAFSSQFASDSKA-------EIAVSILEKLLIVSSIDERTKNVKQLICL  1149
             D W+SE +  LL F+SQ   +SK        E  V  L+ LL     ++++   K +I L
Sbjct  660   DNWKSEDFDRLLDFASQTFENSKEIKLKKRDEDIVFKLQVLLSSLKKEDKSTYAKHIISL  719

Query  1150  GGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESV  1329
             G L FL  RF  GNL EK  V  +L +CI +DS+C   IAR +++  LLE+L S+D+   
Sbjct  720   GVLSFLCRRFEQGNLEEKSHVIEILLNCIRSDSSCIYKIARGVNRKFLLELLHSKDVTPT  779

Query  1330  QNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHF  1509
             +NAI  +TEL+ + RRKD T F+SGL  +D+ +   ++  YL++S   +K L+AVL+LHF
Sbjct  780   KNAILFLTELLSMKRRKDVTSFISGLVGEDVVSTMHIVLMYLKNSSPIEKPLIAVLLLHF  839

Query  1510  HLLTDT-QCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDW  1686
              LL +  Q  ++ I+ A+ AI  AL++S  D+++ + CC+ +LIL  HFS+ G I     
Sbjct  840   ELLVEQPQKFSIYIEMAVKAIAEALDASLNDDKVQKKCCRAILILCGHFSSTGMITNNTS  899

Query  1687  ILKQAGFIDRFESDLESTE-DNEPDNGRITMMD-DGEEEVREEWQARMSAMLLGSGKKSF  1860
             ILKQ G+ +   S+L+S   D+E     +T+   D EEE+ EE+ A +   ++G G+  F
Sbjct  900   ILKQEGY-NNGSSELKSPSLDDEDQRLNVTISSEDEEEEMDEEFMANLLESMIGDGESLF  958

Query  1861  LGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGK  2040
             L  +S CL S +++L+R CL TV WL    + S +  +   L AF A+I QLK  LE+G+
Sbjct  959   LKTISKCLDSRHVDLMRACLITVTWL--SSSLSKQYNAGLHLPAFLAIISQLKGILENGE  1016

Query  2041  LLEHKVLASVCLLNFSKIPE  2100
              LE K LAS+ L NFSKI E
Sbjct  1017  -LELKALASMSLFNFSKISE  1035



>ref|XP_006855636.1| hypothetical protein AMTR_s00044p00102360 [Amborella trichopoda]
 gb|ERN17103.1| hypothetical protein AMTR_s00044p00102360 [Amborella trichopoda]
Length=1247

 Score =   445 bits (1145),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 301/823 (37%), Positives = 440/823 (53%), Gaps = 115/823 (14%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDR +A+H+LQVFCDSP QAR +L+ DLW++ FLPHLSHLK+WY +E   +    S 
Sbjct  446   LQKKDRASARHLLQVFCDSPFQARVTLVSDLWEHFFLPHLSHLKVWYSQEAEFILKSSSG  505

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED----  348
             S ++K+L+K+Y E +D+GT +FAVYY++WL EG E P IP V IP  S   +  E     
Sbjct  506   SSRMKLLDKLYGEQLDSGTYQFAVYYEEWLKEGAEAPPIPCVSIPSSSVYGSSRESSHGP  565

Query  349   -PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHC  525
              P   S  + S S QPV+ K LY  VF   N ++          G   ++NG    +   
Sbjct  566   SPKQDSSPIISNSEQPVIRKSLYKAVFGSLNNID----------GLGEVNNGKGDGD---  612

Query  526   SQIVKIEPYATCQSYSMPITEEAEIQEEN-KLVEHFSDV---HPKPSIQEIYGTIDAAPH  693
                  ++ ++TC + ++P  ++  IQ E+ KL     D+    P  +  E   + DA   
Sbjct  613   -----LDGHSTCAT-TVPAEDDERIQSEHAKLASDLGDILEEQPARNTPE-NASHDADSQ  665

Query  694   SK----------VIK------------------------IIIERIAKAFFGQQNTEESVD  771
             S+          VIK                         I++++AK  F  ++++E++D
Sbjct  666   SRNPLKAWGSPRVIKELEEEEDNIPGCSAATEGAISPHQFILKKLAKDVFQMRDSDETMD  725

Query  772   SERPLGL-----------------------------------------SIPTEFICPLTG  828
             S  P+ +                                         S P +FICPLTG
Sbjct  726   SLAPINVPDIETKRDIRFDSRSELCGTESASESSNFDTNKASFRSFFQSTPKDFICPLTG  785

Query  829   LVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSE  1008
              +FEDPVTLETGQ+FER+AI  W  +GN+ CP T + LE   VP +NF+LKRV+D W+ E
Sbjct  786   QLFEDPVTLETGQTFERSAIEEWLRRGNKMCPTTKQALEYLTVPSTNFVLKRVLDAWKLE  845

Query  1009  HWQHLLAFS------SQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLI  1170
             H++++   +      S    +SK   AV ++E+LL  S+ +E   N K LI LGGL+FLI
Sbjct  846   HYRYITCVTEPSVNLSMHNQESKDTEAVHVIEQLLTGSNREESIDNAKHLISLGGLEFLI  905

Query  1171  HRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLM  1350
              RF  G+L EK  ++ L   CI+AD  CR+ + +NI    +LE+L S+   S    +SL+
Sbjct  906   ERFEFGDLEEKTIIAYLFCCCIKADGGCRDYLVKNITGSLILELLQSKQSRSRAIVVSLL  965

Query  1351  TELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQ  1530
             TELICL+RR   T FL G Q++ + N T +L  YLQ+S  +Q+ LVA L+L   LL + +
Sbjct  966   TELICLHRRTVITAFLRGFQNEGVPNTTHILLVYLQTSPLEQRPLVATLLLQLDLLGEPR  1025

Query  1531  CSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFI  1710
               ++  + AI+ I  AL  S  DE +    C+ LLILG  FS  G+   E W+LKQAGF 
Sbjct  1026  RYSIYREEAINGIVAALNCSLNDENVRPQLCRALLILGGRFSYLGEASIEAWLLKQAGFS  1085

Query  1711  DRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLAS  1890
               +    +   +  P +   TM    EE+  EE+   M+  LL   +K FL +LS C+  
Sbjct  1086  SDYLKSRKDIHELLPIDD--TMQKAEEEKAWEEYSKNMAISLL-RDRKPFLDSLSKCILK  1142

Query  1891  GNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASV  2070
                +L  V L TVAW+    A +S   SE  LSAFS L   LK+ LE+GK +E +VLAS+
Sbjct  1143  EVPQLSSVGLVTVAWI--TRALASLHDSELLLSAFSVLAPCLKSSLENGKRVEDQVLASL  1200

Query  2071  CLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVI  2199
              +  F   P+C+ LL++  + + + LE L++ TW AR +  V+
Sbjct  1201  SVAYFLDNPDCQSLLLVFVKEMMEPLEHLSKETWTARSILAVV  1243



>ref|XP_007208177.1| hypothetical protein PRUPE_ppa020834mg [Prunus persica]
 gb|EMJ09376.1| hypothetical protein PRUPE_ppa020834mg [Prunus persica]
Length=1040

 Score =   433 bits (1114),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 318/748 (43%), Positives = 421/748 (56%), Gaps = 94/748 (13%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDR++AKH+L VFCD+P  ART+LLP+LWD++FLPHLSHLK+WY +E   L    +K
Sbjct  369   LQKKDRVSAKHLLLVFCDTPFHARTTLLPELWDHLFLPHLSHLKVWYDQEADSLADRQNK  428

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              RKLK+L K YNE +D+GT +FAVYYKDWLTEG E PSIPS+ IP +S Q  +    +S 
Sbjct  429   PRKLKLLGKAYNEILDSGTYQFAVYYKDWLTEGAESPSIPSIPIPSVSLQEFQQGGSHSH  488

Query  361   SCIVGS-FSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCSQIV  537
             S    S   PQ +VSK+LYD VF   +  E D  +++                       
Sbjct  489   SSEAPSPGGPQSMVSKRLYDSVFGRSSKPESDEAEDDG----------------------  526

Query  538   KIEPYATCQSYSMPITEEAEIQEENKLVEH---FSDVHPKPSIQEIYGTIDAAPHSKVIK  708
              IE + +C   S    +  + +      E    F  + P+  I  + G +   P +    
Sbjct  527   DIENFDSCMRSSDGSADAKQKKLHGNYFEEGIIFWSI-PQDFICPLTGRLFEDPVTLETG  585

Query  709   IIIERIA-KAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAA  885
                ER+A KA+F + N                   ICP+TG                   
Sbjct  586   QTFERLAIKAWFDKGNR------------------ICPVTG-------------------  608

Query  886   ILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKA-  1062
                             K LEC AVPL NFILKRVI  W+SEH + LLAF+SQ    S   
Sbjct  609   ----------------KSLECLAVPLHNFILKRVIHSWKSEHCRKLLAFASQVVGTSGRD  652

Query  1063  ------EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALL  1224
                   E A+ +LE+LL   S +ERT+N K L  LGGLQFL+  F LG + EK   +ALL
Sbjct  653   GSKHYDERAIFVLEQLLTCFSKEERTENAKHLTSLGGLQFLLQLFELGKVEEKSRAAALL  712

Query  1225  SSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSG  1404
             S CIEAD++CRN+IAR+I+K  ++E+L S+ ++   NA+ L+TELICL  +KD T FLSG
Sbjct  713   SCCIEADADCRNIIARDINKQYVMELLQSKQIKIRTNAVLLLTELICLKGKKDVTTFLSG  772

Query  1405  LQSDDIANITILLSTYLQSSHCKQKS--LVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
             LQ++ I N   +L   LQSS    +S   V +L +   +  + Q   +  + A+DAIT A
Sbjct  773   LQNEGIVNAMDVLLVCLQSSPANHRSLVAVLLLHVDLLVEVEPQKYGMHREEAVDAITEA  832

Query  1579  LESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPD  1758
             L+ S  D  + E CCK LLIL R+FS  GK+++  WILK A F    E +    ED    
Sbjct  833   LDCSLTDANVRENCCKALLILRRYFSFSGKLLSRSWILKPADFSGSCEVNSVDNEDGSLA  892

Query  1759  NGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
             +G      D E+   E+W   ++  LLG+GKKSFL  LS CL S N++L+RVCL T  WL
Sbjct  893   HG--ASPSDDEDNSIEDWLRNLTVTLLGNGKKSFLETLSKCLGSENLDLMRVCLITAEWL  950

Query  1939  ssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLM  2118
                 A SS SGSEF+L+AFS+LI  LK  L++G+ +E K+LASV +LNFSKI ECRVLL 
Sbjct  951   --SRALSSLSGSEFQLTAFSSLIFPLKERLKNGEQVEQKILASVSMLNFSKISECRVLLR  1008

Query  2119  MIGEVIEDTLECLAEVTWVARELQTVIS  2202
                E I   LE LAEVTW A+ L  +IS
Sbjct  1009  ESTEDIAVPLENLAEVTWSAKLLHAIIS  1036



>ref|XP_006603075.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X4 [Glycine max]
Length=953

 Score =   426 bits (1095),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 255/611 (42%), Positives = 357/611 (58%), Gaps = 65/611 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             +Q+K++++AKH+LQVFCDSP QART LLP+LW+++F    SHLK WY K+   L    SK
Sbjct  336   MQKKNKVSAKHLLQVFCDSPFQARTVLLPELWEHLFSSQFSHLKAWYSKQAEFLVDAPSK  395

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +RKLK+L+KVYNE +D+GT+ FAVYYKDWLTEGVE P  PS+ IP  S  +  +++ +S+
Sbjct  396   TRKLKLLQKVYNEHLDSGTHIFAVYYKDWLTEGVESPPTPSIGIP--SASVMGSQEGSSL  453

Query  361   ------SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYK--------------EESYGG  480
                   +  +   SPQP+VSKKLYD +F   +   +  Y+              ++SYG 
Sbjct  454   GYSFESASSIDPLSPQPMVSKKLYDSMFGSLSKPRV--YQVKDIKDDDNIDNCMKDSYGS  511

Query  481   SASMSNGSVTEET---------HCSQIVKIEPYATCQSYSMPITEEAEIQE-ENKLVEHF  630
             +      +   ET         + SQ V I+     +  SM  +EE + +   N +   F
Sbjct  512   TIVRQTLTYESETVKFTDQDIENFSQGVAIDTIKPQKGNSMTASEEWQKRNLSNDINNSF  571

Query  631   S-----DVHPKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLS  795
             S     + H          +IDA  H K  + ++ +  K       T  S+  E P   S
Sbjct  572   SMETNLNSH----------SIDALSHEKASEPVLIKPNK-------TCSSL--EGPYFPS  612

Query  796   IPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFI  975
             IP EFICPLTG +FE+PVTLETGQ+FER AI  WF KGNRTCP+T   LEC  +P +N I
Sbjct  613   IPHEFICPLTGNLFEEPVTLETGQTFEREAIKAWFEKGNRTCPVTGNTLECVTMPFTNLI  672

Query  976   LKRVIDKWRSEHWQHLLAFSSQFASD-------SKAEIAVSILEKLLIVSSIDERTKNVK  1134
             LKR+ID W+SE + +L+   SQ   +        + E AV  LE L      ++++   K
Sbjct  673   LKRLIDTWKSELFDYLIDLPSQTVENPEELKLKKRDEAAVFKLESLFSSLKEEDKSTYAK  732

Query  1135  QLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSE  1314
              LI LG L FL  RF  GN+ EK  V +LL +CI+ DS C   IA +++K CLLE+L S+
Sbjct  733   HLISLGFLPFLFRRFEQGNVEEKSHVMSLLLNCIQVDSGCIYQIATSVNKKCLLELLHSK  792

Query  1315  DLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAV  1494
                   NAI  +TE++ + RRKD T F+SGL  + + NI  +L  YL+ S   +K L+AV
Sbjct  793   KATPTTNAILFLTEILSMKRRKDVTSFISGLAGEKVFNIMHILLMYLKKSSPFEKPLIAV  852

Query  1495  LILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIM  1674
             L+LHF LL + Q  ++  + A++AI  AL++S  DE+  E CC+ L+IL  HFS+ GKI 
Sbjct  853   LLLHFDLLVEPQKFSIYREVAVNAIAEALDASLNDEKGREKCCRALVILCSHFSSTGKIP  912

Query  1675  TEDWILKQAGF  1707
             T+  ILKQAG+
Sbjct  913   TKTSILKQAGY  923



>ref|XP_010031863.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Eucalyptus 
grandis]
 ref|XP_010031864.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Eucalyptus 
grandis]
 ref|XP_010031865.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Eucalyptus 
grandis]
 ref|XP_010031866.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Eucalyptus 
grandis]
 ref|XP_010031867.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Eucalyptus 
grandis]
 gb|KCW51262.1| hypothetical protein EUGRSUZ_J00838 [Eucalyptus grandis]
Length=1110

 Score =   419 bits (1078),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 307/794 (39%), Positives = 431/794 (54%), Gaps = 100/794 (13%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KDR +AKH+LQVF DSP QART+LLP+LW+N+F PHLSHLK W+ +E   LE   +K
Sbjct  351   LQKKDRASAKHLLQVFSDSPFQARTTLLPELWENLFYPHLSHLKRWHSQEADSLEDNSNK  410

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              R+LK+L+KV NE +D+GT +FAVYYKDWLTEG E PSIPS+ IP LS Q  +       
Sbjct  411   ERRLKLLDKVCNEILDSGTYQFAVYYKDWLTEGFEAPSIPSLNIPSLSIQEFQFNGSLGH  470

Query  361   SC----IVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCS  528
             S     +VG F  QP+VS+KLY++VF   N   LD          A + N   +  +  S
Sbjct  471   SAELHKVVGPFYAQPMVSRKLYEDVFGSSNKPRLD-------DAEAEVDNCQSSVSSGSS  523

Query  529   QIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPHSKVIK  708
              I +++   TC S ++  T++        +VE ++  +P+          D A    +  
Sbjct  524   SI-EVKQTLTCSSETLKHTDQC-------IVESYTQ-NPQ----------DKALEDGLPL  564

Query  709   IIIE----RIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLV------FEDPVTLE  858
             I+ E    R   +   + N +E  +S R   +    + I   +          ED  + E
Sbjct  565   IVGEGRGSREVSSSLAEANDDEGSNSGRSQKIGDGAQQIQYSSTYTIRVKFPLEDSGSQE  624

Query  859   TGQSFERAAILNWFSKGNRTCPITSKKLE-------------------------------  945
             + Q    ++IL  F      CP+T K  E                               
Sbjct  625   SFQEQSFSSILKHF-----ICPLTGKLFEDPVTLETGQTYERVAISKWFDQGNRTCPMTG  679

Query  946   ----CQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS-------KAEIAVSILEKL  1092
                 C ++PL+N ++KRVI  W SE  +   AF+ Q    S       K   A+S LE+L
Sbjct  680   KTLECLSLPLTNIVIKRVIHSWTSECCKDHDAFALQTVVKSEGHKVEHKDTGAISKLEQL  739

Query  1093  LIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIAR  1272
             LI S    RT N  QLI LGGL++LI RF  G   E+  V  L+  CIEAD++CRN IA 
Sbjct  740   LITSDKAARTANAGQLISLGGLEYLIQRFGSGPTEERMIVLELILCCIEADASCRNQIAE  799

Query  1273  NIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTY  1452
              I    LL++L S+ ++  +NA+ L+ ++ICLNRRKD   FL  L ++++ N   +L  Y
Sbjct  800   GISSKFLLDLLHSKQIQVRKNAVCLLIQIICLNRRKDVVSFLGNLLNEEMVNAMHVLLLY  859

Query  1453  LQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGL  1632
             LQS+   +K LVA+L+LHF LL + +  ++  + A+DAI++AL+ S  DE + E CCK L
Sbjct  860   LQSAPDVEKPLVALLLLHFDLLAEPRKYSIYREEAVDAISLALDLSLNDENVQESCCKAL  919

Query  1633  LILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD-----GEEE  1797
             LI G HFS    +  EDWILKQ G  + +++    T DNE       + DD      E+ 
Sbjct  920   LIFGGHFSFSQMVSPEDWILKQEGCSETYKA---ITCDNEQYG---FLADDTCSFENEDL  973

Query  1798  VREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgse  1977
                EW   +   LLGS ++SF+ AL  CL S +  +VR CL TVAWL    A SS   +E
Sbjct  974   AHREWLNNLLGSLLGSRRRSFIDALLKCLRSRDSNMVRACLITVAWL--SSALSSLGNAE  1031

Query  1978  felsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECL  2157
              +LS FSAL+ QLK  LE G+ +EHK+LAS  LLNF KIPECRVLL+ + E +   L  +
Sbjct  1032  HQLSVFSALVPQLKEKLESGEKVEHKILASFSLLNFCKIPECRVLLLTMSEEMTSPLRSI  1091

Query  2158  AEVTWVARELQTVI  2199
             A+V+  A++L  +I
Sbjct  1092  ADVSGTAKQLYALI  1105



>ref|XP_008668984.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 [Zea mays]
Length=964

 Score =   377 bits (969),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 246/756 (33%), Positives = 400/756 (53%), Gaps = 56/756 (7%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ++D  AA H L+ FC +P +ART LLP LWD +F P LSHL+ W  +E     +  S 
Sbjct  244   LQKRDHSAAVHALEAFCLAPREARTVLLPALWDRLFRPGLSHLRTWRDRE----SASASA  299

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP--FLSPQLARNEDPN  354
               +++ +EKV+   +D GT   A YY+DWL    +  ++P V  P   + P   R     
Sbjct  300   DERVEEVEKVFLGVLDDGTRALACYYRDWLLGRTDAMALPDVPAPPSTVHPSTPRCSAST  359

Query  355   S--VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMS--------NGS  504
             S  +S  V   S    ++K  YD++ R    +E +         + +++        +G+
Sbjct  360   SYDISSEVMFGSGSSSLAKFAYDDIMRASEEIEEEEEAVYPEAAAEAVTVLHQDQERDGA  419

Query  505   VTEETHCSQIVKIEPYATCQSYS-MPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTID  681
               EE               +SY+  P+ EE E    N   E F D H +   QE     D
Sbjct  420   GGEE---------------RSYTPTPLAEENEPVPNNVDRETF-DPHVE---QEPNKQSD  460

Query  682   A-APHSKVI-KIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTL  855
             A A H  +     I+ +   F       ++  +E  +  ++P++F+CPLT  +F +PVT+
Sbjct  461   ARASHPPISDNSAIDLLTLEFCEAPLQSDTNGNELSIFSTVPSDFLCPLTRQIFSNPVTI  520

Query  856   ETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFS  1035
             ETGQ+FER AI+ W  +G RTCP+T + L    VP +N +LKR++D WRSEH++HL +  
Sbjct  521   ETGQTFERHAIVQWLDRGFRTCPVTGQDLSSSTVPDTNRVLKRLVDSWRSEHFKHLTSGG  580

Query  1036  SQFASDSKAEIAVSILEKLL-IVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             +        ++ VS ++K L     + E+    + L+ +GG+ FL+ +F  G  +E+  V
Sbjct  581   AGL----DVKLTVSAIDKALGSARDVSEKFDRARHLMAIGGIDFLLCKFQEGGGDEQPRV  636

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATY  1392
             +  L SCI A+ +CR+ +A  +D   +L +L S+ L + + A+ L+ EL+CL RR+    
Sbjct  637   AEHLLSCIRAEGSCRDYVAIKMDGSSILRLLQSKVLSTRRTAVDLLMELVCLRRREMVEL  696

Query  1393  FLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAIT  1572
              L G +++ I     +L  YL+S   ++++ +A L++    L +   +N   + AI AIT
Sbjct  697   LLHGSRAESIVEAMDVLLEYLRSLPAEEQAPIAALLMRLDALVEPNRNNTYREEAIKAIT  756

Query  1573  VALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
              +L     ++ ++    + LL+LG  F+  G +  EDW+L+ AGF+D   +   +++   
Sbjct  757   RSLRCCLSEDTVVPSTRRALLLLGGQFTFSGDLHAEDWMLEHAGFVDPSRATTATSD---  813

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSG---KKSFLGALSMCLASGNIELVRVCLT  1923
                    ++ D +    + W   ++A LLGS    ++ FL ALS CL S N  LV  CLT
Sbjct  814   ------AVVHDKKAAENDAWLRHVAAALLGSRSGIRRPFLEALSRCLGSPNAGLVGACLT  867

Query  1924  TVAWLssv-lasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPE  2100
             T AWLS    +      ++  L+AFSAL+ +LK CL  G+ + H+VLA+V L NFS+IP+
Sbjct  868   TAAWLSRSLASLDEDGATDTSLAAFSALVPRLKQCLAPGRPVRHRVLAAVSLHNFSRIPD  927

Query  2101  CRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS  2208
             CR LLM++ + + D L  LA++TW A +L   + S+
Sbjct  928   CRELLMLLADGMRDHLAELAQLTWTAGQLSAELHSN  963



>tpg|DAA36304.1| TPA: hypothetical protein ZEAMMB73_713782 [Zea mays]
Length=980

 Score =   374 bits (961),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 251/772 (33%), Positives = 402/772 (52%), Gaps = 72/772 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ++D  AA H L+ FC +P +ART LLP LWD +F P LSHL+ W  +E     +  S 
Sbjct  244   LQKRDHSAAVHALEAFCLAPREARTVLLPALWDRLFRPGLSHLRTWRDRE----SASASA  299

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP--FLSPQLARNEDPN  354
               +++ +EKV+   +D GT   A YY+DWL    +  ++P V  P   + P   R     
Sbjct  300   DERVEEVEKVFLGVLDDGTRALACYYRDWLLGRTDAMALPDVPAPPSTVHPSTPRCSAST  359

Query  355   S--VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMS--------NGS  504
             S  +S  V   S    ++K  YD++ R    +E +         + +++        +G+
Sbjct  360   SYDISSEVMFGSGSSSLAKFAYDDIMRASEEIEEEEEAVYPEAAAEAVTVLHQDQERDGA  419

Query  505   VTEETHCSQIVKIEPYATCQSYS-MPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTID  681
               EE               +SY+  P+ EE E    N   E F D H +   QE     D
Sbjct  420   GGEE---------------RSYTPTPLAEENEPVPNNVDRETF-DPHVE---QEPNKQSD  460

Query  682   A-APH------SKVIKIIIERIAKAFFGQQNTEESVDSERPLGL-----------SIPTE  807
             A A H      S +  + +E  A  F         + SE PL             ++P++
Sbjct  461   ARASHPPISDNSAIDLLTLEFCAYNFVLMGVISCKLISEAPLQSDTNGNELSIFSTVPSD  520

Query  808   FICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRV  987
             F+CPLT  +F +PVT+ETGQ+FER AI+ W  +G RTCP+T + L    VP +N +LKR+
Sbjct  521   FLCPLTRQIFSNPVTIETGQTFERHAIVQWLDRGFRTCPVTGQDLSSSTVPDTNRVLKRL  580

Query  988   IDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLL-IVSSIDERTKNVKQLICLGGLQF  1164
             +D WRSEH++HL +  +        ++ VS ++K L     + E+    + L+ +GG+ F
Sbjct  581   VDSWRSEHFKHLTSGGAGL----DVKLTVSAIDKALGSARDVSEKFDRARHLMAIGGIDF  636

Query  1165  LIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAIS  1344
             L+ +F  G  +E+  V+  L SCI A+ +CR+ +A  +D   +L +L S+ L + + A+ 
Sbjct  637   LLCKFQEGGGDEQPRVAEHLLSCIRAEGSCRDYVAIKMDGSSILRLLQSKVLSTRRTAVD  696

Query  1345  LMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTD  1524
             L+ EL+CL RR+     L G +++ I     +L  YL+S   ++++ +A L++    L +
Sbjct  697   LLMELVCLRRREMVELLLHGSRAESIVEAMDVLLEYLRSLPAEEQAPIAALLMRLDALVE  756

Query  1525  TQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAG  1704
                +N   + AI AIT +L     ++ ++    + LL+LG  F+  G +  EDW+L+ AG
Sbjct  757   PNRNNTYREEAIKAITRSLRCCLSEDTVVPSTRRALLLLGGQFTFSGDLHAEDWMLEHAG  816

Query  1705  FIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSG---KKSFLGALS  1875
             F+D   +   +++          ++ D +    + W   ++A LLGS    ++ FL ALS
Sbjct  817   FVDPSRATTATSD---------AVVHDKKAAENDAWLRHVAAALLGSRSGIRRPFLEALS  867

Query  1876  MCLASGNIELVRVCLTTVAWLssv-lasssrsgsefelsaFSALICQLKACLEHGKLLEH  2052
              CL S N  LV  CLTT AWLS    +      ++  L+AFSAL+ +LK CL  G+ + H
Sbjct  868   RCLGSPNAGLVGACLTTAAWLSRSLASLDEDGATDTSLAAFSALVPRLKQCLAPGRPVRH  927

Query  2053  KVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS  2208
             +VLA+V L NFS+IP+CR LLM++ + + D L  LA++TW A +L   + S+
Sbjct  928   RVLAAVSLHNFSRIPDCRELLMLLADGMRDHLAELAQLTWTAGQLSAELHSN  979



>gb|KGN66434.1| hypothetical protein Csa_1G605630 [Cucumis sativus]
Length=553

 Score =   362 bits (930),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 213/494 (43%), Positives = 299/494 (61%), Gaps = 38/494 (8%)
 Frame = +1

Query  751   NTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPIT  930
             ++ ES D ER   LS+P +FICPLTG +++DPVTLETGQSFE+ AI  W  +G+RTCP+T
Sbjct  83    DSYESSD-ERSSFLSLPKDFICPLTGELYQDPVTLETGQSFEKTAIKAWLDQGHRTCPVT  141

Query  931   SKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDS-------KAEIAVSILEK  1089
              KKLE  A+PL+NF+L+RVI  W S   ++ LAF SQ    S       K+E  + IL+ 
Sbjct  142   GKKLETLAIPLTNFVLQRVIKNWNSNRRRNFLAFLSQGVHSSEKSMINNKSETTIFILDH  201

Query  1090  LLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIA  1269
              L      E  +N   LI  G L+FLI  F  GNL EK  V ALLS CI+AD  CRN IA
Sbjct  202   FLAAGGKVEAMENANYLIANGYLRFLIQLFESGNLEEKTRVLALLSRCIQADEQCRNQIA  261

Query  1270  RNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLST  1449
               I    L+ +L S+ ++S+++ + L+T+LICL RRKD T FLS L  +D  N    +  
Sbjct  262   NEISISSLVNLLHSKQVKSLESVVQLLTKLICLKRRKDVTLFLSSLLKEDSENTLQAVLV  321

Query  1450  YLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKG  1629
             YL+SS   Q+ LVAVL+LHF+L+ ++Q  ++ ++ A+DAI  AL+ S  ++++ E CCK 
Sbjct  322   YLRSSPPVQRPLVAVLLLHFNLVVESQQQSMYMEEALDAIIKALDDSLTNQKIRESCCKA  381

Query  1630  LLILGRHFS---AFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEV  1800
             +LILG HFS    FG        LK+ GFI+  E D                    E++ 
Sbjct  382   ILILGGHFSLPETFGSTT-----LKEIGFINFVEED--------------------EKQA  416

Query  1801  REEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsef  1980
              EEWQ +++  L+ S K+ F   +S CLA G+++LV V L+T+ WL    +       +F
Sbjct  417   IEEWQRKLTLSLVKSVKQPFFAIISKCLAIGSLDLVGVGLSTLTWL--SFSLPLLPAPKF  474

Query  1981  elsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLA  2160
                A S LIC LK CL++  L+EHK+LAS CLLN SKI ECR++++ I + IED L  +A
Sbjct  475   HPLALSDLICLLKDCLQNSMLVEHKILASTCLLNLSKIAECRLIVIAIRKEIEDPLRSIA  534

Query  2161  EVTWVARELQTVIS  2202
             E++  A+ L  +I+
Sbjct  535   EISQSAKHLYAIIT  548



>ref|XP_004296299.1| PREDICTED: uncharacterized protein LOC101308952 [Fragaria vesca 
subsp. vesca]
Length=932

 Score =   367 bits (942),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 211/510 (41%), Positives = 292/510 (57%), Gaps = 54/510 (11%)
 Frame = +1

Query  7     RKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSKSR  186
             +KDR++AKH+LQVFCDSP  ART LLP+LWD +FLPHLSHLK+WY +E   +    +  R
Sbjct  416   KKDRVSAKHLLQVFCDSPFTARTILLPELWDYLFLPHLSHLKVWYDQEADSVADAQNGPR  475

Query  187   KLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS-PQLARNEDPNSVS  363
             KL++L KVYN+ +D+GT +FA+YYKDWLTEG+E P IPSV IP +S  Q+ +       S
Sbjct  476   KLELLGKVYNDILDSGTYQFALYYKDWLTEGIESPCIPSVPIPSVSLRQVQQGSSHGYSS  535

Query  364   CIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKE----ESYGGSASMSNGS---VTEETH  522
              +     PQ +VS+KLYD VF   +  E+   K+    ESY       +GS   V E  +
Sbjct  536   EMASPAGPQSMVSRKLYDSVFGRASKTEVYEVKDDGQIESYEDCMRTPDGSAVVVQERPY  595

Query  523   CSQIVKI-------EPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTID  681
               +  +        +P  +          E  ++ E +         P+  + + +G I 
Sbjct  596   SGEAAQYGYRDIEEDPSKSALENESLAGNELSMEPEQQWSFSRDSDPPESDLNDQFGNIS  655

Query  682   AA-------PHSKV---IKIIIERIAKAFFGQQNT-------------EESVDSERPLG-  789
                      PH      +++  + + K+     N+             +E   SE  LG 
Sbjct  656   KENTESTKMPHQPAPEKMELTQKGVTKSISTGSNSSQASITSSIINPVKEKSSSEELLGN  715

Query  790   --------LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLE  945
                      SIP +F+CPL+G +FEDPVTLETGQ+FER+AI  WF +GNRTCP+T K LE
Sbjct  716   YVEEGIDLSSIPQDFLCPLSGELFEDPVTLETGQTFERSAIRAWFDEGNRTCPVTGKALE  775

Query  946   CQAVPLSNFILKRVIDKWRSEHWQHLLAFSS-------QFASDSKAEIAVSILEKLLIVS  1104
               AVPL+N ILKRVI  W+SEH + LLA++S       +  S    E  + +LE+LL   
Sbjct  776   SPAVPLTNLILKRVIHSWKSEHSRQLLAYASHVVGTSGRVGSKHHDETIIFVLEQLLTCF  835

Query  1105  SIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDK  1284
             S  ERT N + LI LG LQFL+ RF +G   EK  V+AL S C+EAD++CR+LIA +I+K
Sbjct  836   SKKERTANARHLISLGCLQFLLQRFEIGKEEEKSRVAALFSCCMEADADCRSLIASSINK  895

Query  1285  MCLLEVLCSEDLESVQNAISLMTELICLNR  1374
              CL+E+L  +++    NA+ LMTELICL R
Sbjct  896   HCLVELLQGKEVNLRTNAVLLMTELICLKR  925



>ref|XP_004154671.1| PREDICTED: uncharacterized protein LOC101231578 [Cucumis sativus]
Length=1077

 Score =   369 bits (946),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 247/652 (38%), Positives = 360/652 (55%), Gaps = 77/652 (12%)
 Frame = +1

Query  52    DSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSKSRKLKVLEKVYNETMDT  231
             +S L A   L  +LWD++FLPHL H+K WY  E   L +   +SRK K+L+KVYNET+D+
Sbjct  379   NSKLSACAHLYLELWDDLFLPHLLHIKSWYDYEADSLVNAPKQSRKQKLLDKVYNETLDS  438

Query  232   GTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP---NSVSCIVGSF-SPQPVV  399
              T K+AVYYKDWLT G+E P  PS+ +P +S +    E P   +S + +   F SP  +V
Sbjct  439   STCKYAVYYKDWLT-GIEAPE-PSIVVPAVSFEGVDQESPVNNSSATTLCNDFVSPNLMV  496

Query  400   SKKLYDEVF------------------------RHKNGVELDYYKEESYGGSASM-----  492
             SKKLYD +F                        R  N   +  + +  Y  +        
Sbjct  497   SKKLYDAMFATSKNQGAPHTEIEWELENRDNCIRSSNSSNVSKHTQIYYSDTTKDLDQDT  556

Query  493   ---SNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAEIQEE--------NKLVEHFSDV  639
                S GS TE T   +  K + + T   Y++    E +  +E        N  ++ F  +
Sbjct  557   DEDSTGSTTENTSSFENCKGQEWKT---YNINALSEMDGSDEICSSTTCKNNEID-FEVL  612

Query  640   HPKPSIQEIYGTIDAAPHSKVIKIIIE--RIAKAFFGQQNTEESVDSERPLGLSIPTEFI  813
             H + + +      ++    K+ +  ++  ++  +     ++ ES D ER   LS+P +FI
Sbjct  613   HAQSNTEG-----NSYSQQKLAQPCLDPIKVNPSLREPNDSYESSD-ERSSFLSLPKDFI  666

Query  814   CPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVID  993
             CPLTG +++DPVTLETGQSFE+ AI  W  +G+RTCP+T KKLE  A+PL+NF+L+RVI 
Sbjct  667   CPLTGELYQDPVTLETGQSFEKTAIKAWLDQGHRTCPVTGKKLETLAIPLTNFVLQRVIK  726

Query  994   KWRSEHWQHLLAFSSQFASDS-------KAEIAVSILEKLLIVSSIDERTKNVKQLICLG  1152
              W S   ++ LAF SQ    S       K+E  + IL+  L      E  +N   LI  G
Sbjct  727   NWNSNRRRNFLAFLSQGVHSSEKSMINNKSETTIFILDHFLAAGGKVEAMENANYLIANG  786

Query  1153  GLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQ  1332
              L+FLI  F  GNL EK  V ALLS CI+AD  CRN IA  I    L+ +L S+ ++S++
Sbjct  787   YLRFLIQLFESGNLEEKTRVLALLSRCIQADEQCRNQIANEISISSLVNLLHSKQVKSLE  846

Query  1333  NAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFH  1512
             + + L+T+LICL RRKD T FLS L  +D  N    +  YL+SS   Q+ LVAVL+LHF+
Sbjct  847   SVVQLLTKLICLKRRKDVTLFLSSLLKEDSENTLQAVLVYLRSSPPVQRPLVAVLLLHFN  906

Query  1513  LLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFS---AFGKIMTED  1683
             L+ ++Q  ++ ++ A+DAI  AL+ S  ++++ E CCK +LILG HFS    FG      
Sbjct  907   LVVESQQQSMYMEEALDAIIKALDDSLTNQKIRESCCKAILILGGHFSLPETFGST----  962

Query  1684  WILKQAGFIDRFESD-LESTEDN-EPDNGRITMMDDGEEEVREEWQARMSAM  1833
               LK+ GFI+  E D L+S E+N E +N ++ +   G  +  EE +A M A+
Sbjct  963   -TLKEIGFINFVEVDSLDSKEENPEMNNKKLVLAGSGISD--EERKASMDAV  1011



>ref|XP_010240311.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Brachypodium distachyon]
Length=960

 Score =   355 bits (911),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 255/768 (33%), Positives = 404/768 (53%), Gaps = 70/768 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESP---  171
             LQRKD  +A H L+ FC +P +ART LLP LWD +F P LSHL+ W  +E     +    
Sbjct  228   LQRKDHSSAVHALEAFCLAPREARTVLLPALWDRLFRPALSHLRAWRDREFSSAATAAAS  287

Query  172   --DSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWL---TEGVEPPSIPSVKIPFLSPQLA  336
               D+   K   +EK + + +D GT   A YY+DWL   TE +  PS+P+     L     
Sbjct  288   SVDAGRVKKDAVEKAFLDALDGGTRSLACYYRDWLLGRTEAMALPSVPAPPSTALLAAGG  347

Query  337   RNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEE  516
                  +S +  +GS            D  F   +     +  EE+ G    +    + E 
Sbjct  348   AARFSSSTTYDIGS------------DVAFSSGSQSPAMFAIEETPGQPELVEKEEIVE-  394

Query  517   THCSQIVKIEPY--------ATCQSYS-MPITEEAEIQEENKLVEHFSDVHPKPSIQE--  663
                ++ V +E          A+  SY+  P  EE E    N+L    S+  PK  I++  
Sbjct  395   ---AKAVDVESVFHECDGGEASSTSYTPTPRAEEHE-PVPNELAMEASE--PKSQIEDER  448

Query  664   -IYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSER---PLGLSIPTEFICPLTGL  831
              ++G  ++  +  +  +    +    F + +     D ++    +  + P++F+CPLT  
Sbjct  449   SMHGARESTSYLPIRDMSAIDLLTLEFCEGSLRSGTDGDQVHPSIFSTTPSDFLCPLTRQ  508

Query  832   VFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEH  1011
             +F  PVT+ETGQ+FER AI+ W  +G R CP+T ++LE  +VP +N +LKR+ID W+SEH
Sbjct  509   IFNRPVTIETGQTFERHAIVQWLERGIRACPVTGQELETLSVPDTNRVLKRLIDSWKSEH  568

Query  1012  WQHLLAFSSQFASDSKA---EIAVSILEKLLIVSSID--ERTKNVKQLICLGGLQFLIHR  1176
              + L     Q  ++S+    ++ V++++++L  S  D  E+ +  + L+ +GG+ F +HR
Sbjct  569   CKSL-----QLDTESRVPEEKLNVAVVDQVLD-SGCDPAEQIQRARHLMAIGGVDFHLHR  622

Query  1177  FNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTE  1356
             F  G + +K   +  L  CI+A+  CRN +A  +D    + ++ SE + +   A+ L+ E
Sbjct  623   FQEGTVEQKARAAEHLLLCIQAEGGCRNYVAVGLDGESAIRLVHSEVVSARSAAVRLLAE  682

Query  1357  LICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHF-HLLTDTQC  1533
             L+CL RR+     + GL +  IA    +L  +L+SS  ++++LVAVL+L+F H L +   
Sbjct  683   LLCLRRREMVELVIRGLCTTSIAETMNVLLQHLRSSPVEEQALVAVLLLYFDHTLEEPHR  742

Query  1534  SNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFID  1713
             ++ C + A   +T +L     DE ++    K LLILG HFS  G ++ E W+L+QAGF+D
Sbjct  743   NSKCREEAARILTESLTRCVSDENVVPNTRKALLILGGHFSFSGDLLAEHWMLEQAGFVD  802

Query  1714  RFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASG  1893
                 D  +T  N         + D E    E W   ++ +LLGSG++ FL ALS  L S 
Sbjct  803   ----DSSATSVNSD-----AAVQDTESAEEEAWPGHVTTVLLGSGRRPFLAALSRGLISP  853

Query  1894  NIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGK-----LLEHKV  2058
             N  L   CLTT AWL    + +S   ++ +L+AF+AL+ +LK CL            H+V
Sbjct  854   NAGLAAACLTTAAWL--SRSLASLDATDTQLAAFAALVPRLKQCLAGTGSSAHLQARHRV  911

Query  2059  LASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             LA+V L NFSKIP+CRVLLM++ + + D L  LAE+T  A +L   +S
Sbjct  912   LAAVTLHNFSKIPDCRVLLMLLADGLRDHLAELAELTRTAGQLYAELS  959



>ref|XP_010240312.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Brachypodium distachyon]
Length=958

 Score =   353 bits (906),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 248/763 (33%), Positives = 400/763 (52%), Gaps = 62/763 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESP---  171
             LQRKD  +A H L+ FC +P +ART LLP LWD +F P LSHL+ W  +E     +    
Sbjct  228   LQRKDHSSAVHALEAFCLAPREARTVLLPALWDRLFRPALSHLRAWRDREFSSAATAAAS  287

Query  172   --DSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWL---TEGVEPPSIPSVKIPFLSPQLA  336
               D+   K   +EK + + +D GT   A YY+DWL   TE +  PS+P+     L     
Sbjct  288   SVDAGRVKKDAVEKAFLDALDGGTRSLACYYRDWLLGRTEAMALPSVPAPPSTALLAAGG  347

Query  337   RNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEE  516
                  +S +  +GS            D  F   +     +  EE+ G    +    + E 
Sbjct  348   AARFSSSTTYDIGS------------DVAFSSGSQSPAMFAIEETPGQPELVEKEEIVE-  394

Query  517   THCSQIVKIEP-YATC---QSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQE---IYGT  675
                ++ V +E  +  C   ++ S   T     +E   +    +    +P I++   ++G 
Sbjct  395   ---AKAVDVESVFHECDGGEASSTSYTPTPRAEEHEPVPNELAMEASEPKIEDERSMHGA  451

Query  676   IDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSER---PLGLSIPTEFICPLTGLVFEDP  846
              ++  +  +  +    +    F + +     D ++    +  + P++F+CPLT  +F  P
Sbjct  452   RESTSYLPIRDMSAIDLLTLEFCEGSLRSGTDGDQVHPSIFSTTPSDFLCPLTRQIFNRP  511

Query  847   VTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLL  1026
             VT+ETGQ+FER AI+ W  +G R CP+T ++LE  +VP +N +LKR+ID W+SEH + L 
Sbjct  512   VTIETGQTFERHAIVQWLERGIRACPVTGQELETLSVPDTNRVLKRLIDSWKSEHCKSL-  570

Query  1027  AFSSQFASDSKA---EIAVSILEKLLIVSSID--ERTKNVKQLICLGGLQFLIHRFNLGN  1191
                 Q  ++S+    ++ V++++++L  S  D  E+ +  + L+ +GG+ F +HRF  G 
Sbjct  571   ----QLDTESRVPEEKLNVAVVDQVLD-SGCDPAEQIQRARHLMAIGGVDFHLHRFQEGT  625

Query  1192  LNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLN  1371
             + +K   +  L  CI+A+  CRN +A  +D    + ++ SE + +   A+ L+ EL+CL 
Sbjct  626   VEQKARAAEHLLLCIQAEGGCRNYVAVGLDGESAIRLVHSEVVSARSAAVRLLAELLCLR  685

Query  1372  RRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHF-HLLTDTQCSNVCI  1548
             RR+     + GL +  IA    +L  +L+SS  ++++LVAVL+L+F H L +   ++ C 
Sbjct  686   RREMVELVIRGLCTTSIAETMNVLLQHLRSSPVEEQALVAVLLLYFDHTLEEPHRNSKCR  745

Query  1549  DGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESD  1728
             + A   +T +L     DE ++    K LLILG HFS  G ++ E W+L+QAGF+D    D
Sbjct  746   EEAARILTESLTRCVSDENVVPNTRKALLILGGHFSFSGDLLAEHWMLEQAGFVD----D  801

Query  1729  LESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELV  1908
               +T  N         + D E    E W   ++ +LLGSG++ FL ALS  L S N  L 
Sbjct  802   SSATSVNSD-----AAVQDTESAEEEAWPGHVTTVLLGSGRRPFLAALSRGLISPNAGLA  856

Query  1909  RVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGK-----LLEHKVLASVC  2073
               CLTT AWL    + +S   ++ +L+AF+AL+ +LK CL            H+VLA+V 
Sbjct  857   AACLTTAAWL--SRSLASLDATDTQLAAFAALVPRLKQCLAGTGSSAHLQARHRVLAAVT  914

Query  2074  LLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVIS  2202
             L NFSKIP+CRVLLM++ + + D L  LAE+T  A +L   +S
Sbjct  915   LHNFSKIPDCRVLLMLLADGLRDHLAELAELTRTAGQLYAELS  957



>ref|XP_008451113.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Cucumis melo]
 ref|XP_008451114.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Cucumis melo]
Length=1206

 Score =   356 bits (913),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 203/482 (42%), Positives = 301/482 (62%), Gaps = 21/482 (4%)
 Frame = +1

Query  790   LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSN  969
              S+P +FICPLTG +++DPVTLETGQSFE+ AI  W  +G+RTCP+T KKLE  A+PL+N
Sbjct  730   FSLPKDFICPLTGQLYQDPVTLETGQSFEKTAIKAWLDQGHRTCPVTGKKLETLAIPLTN  789

Query  970   FILKRVIDKWRSEHWQHLLAFSSQFA-------SDSKAEIAVSILEKLLIVSSIDERTKN  1128
             FIL+RVI  W S   ++ LAF SQ         +++K+E  + IL++ L      E  +N
Sbjct  790   FILQRVIKNWNSNRRRNFLAFLSQRVHSSEKSMTNNKSETTIFILDQFLTAGGKVEAMEN  849

Query  1129  VKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLC  1308
                LI  G L+FLI  F  GNL EK  V ALLS CI+AD  CRN IA  I    L+ +L 
Sbjct  850   ANYLIANGYLRFLIQLFESGNLEEKTRVLALLSRCIQADEQCRNQIADEISISSLVNLLH  909

Query  1309  SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLV  1488
             S+ ++S+++ + L+T+LI L RRKD T FLS L  +D  +    +  YL+SS   Q+ LV
Sbjct  910   SKQVKSLESVVQLLTKLIFLKRRKDVTLFLSRLLKEDSEDTLQAILVYLRSSPPVQRPLV  969

Query  1489  AVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHF---SA  1659
             AVL+LHF+L+ ++   ++ ++ A+DAI  AL++S  ++++ E CC+ +LILG HF     
Sbjct  970   AVLLLHFNLVVESLQQSMYMEEALDAIIKALDASLTNQKIRESCCEAILILGGHFPLRET  1029

Query  1660  FGKIMTEDWILKQAGFIDRFESD-LESTEDNEPDNGRITMMDDGEEEVREEWQARMSAML  1836
             FG +      LK+ GFI+  E D ++  E+N   N ++    + E++  EEW+ +++  L
Sbjct  1030  FGSM-----TLKEVGFINFCEVDSIDYKEENPEMNKKLV---EDEKQAIEEWRRKLTLSL  1081

Query  1837  LGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQL  2016
             + S K+ F   +S CLA G+++LV V L+T+ WL    +       +F     S LI  L
Sbjct  1082  MKSVKQPFFEIISKCLAIGSLDLVGVGLSTLTWL--SFSLPRLPAPKFHPLTLSDLISLL  1139

Query  2017  KACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTV  2196
             KACL++  L+EHK+LAS CLLN SKI ECR++++ I + IED L  +AE++  A+ L  +
Sbjct  1140  KACLQNSMLVEHKILASTCLLNLSKIAECRLIVIAIRKEIEDPLRSIAEISQSAKHLYAI  1199

Query  2197  IS  2202
             I+
Sbjct  1200  IT  1201


 Score =   142 bits (357),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            +Q K R +AKHILQVFC+   QAR  L P+LWD++FLPHL H+K WY  E   L +   +
Sbjct  407  IQNKKRSSAKHILQVFCNLTFQARIVLFPELWDDLFLPHLLHIKSWYDYEADSLVNAPKQ  466

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP---  351
            SRK K+L+KVYNET+D+GT K+AVYYKDWLT G+E    PS+ +P +S +    E P   
Sbjct  467  SRKQKLLDKVYNETLDSGTCKYAVYYKDWLT-GIEALE-PSIVVPAVSFEGVDQESPVNN  524

Query  352  NSVSCIVGSF-SPQPVVSKKLYDEVF  426
            ++ + +   F SP  +VSKKLYD +F
Sbjct  525  STATTLCNDFVSPNLMVSKKLYDAMF  550



>ref|XP_004976603.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Setaria 
italica]
Length=959

 Score =   351 bits (901),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 242/751 (32%), Positives = 398/751 (53%), Gaps = 61/751 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQR+D  AA H L+ FC +P +ART LLP LWD +F P LSHL+ W  +E     +  S 
Sbjct  240   LQRRDHSAAVHSLEAFCLAPREARTLLLPALWDRLFRPGLSHLRAWRDRE----SAAASS  295

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWL---TEGVEPPSI--PSVKIPFLSPQLARNE  345
               + K +EK + + +D GT   A YY+DWL   T+ +  P +  P   +   +P+ + + 
Sbjct  296   DERAKEVEKTFADAVDEGTRALACYYRDWLLGRTDAMALPGVPAPPSTVHAGAPRYSAST  355

Query  346   DPNSVSCIV---GSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASM--SNGSVT  510
               +  S +V   G  SP    +K  YD   +    +E +         + S+     +V 
Sbjct  356   SYDISSDVVFSSGGSSP----AKFAYDGTMQRSEEIEEEDEVHAIAADAESVFYECEAVE  411

Query  511   EETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAP  690
               +H +  +++E      + S   T E ++++E               I+E   +    P
Sbjct  412   ARSH-TPALQVEGNVLTTNNSAKETFEPQVEDE--------------PIKESDASTSYRP  456

Query  691   HSKVIKIIIERIAKAFFGQQNTEESVDSER-PLGLSIPTEFICPLTGLVFEDPVTLETGQ  867
              S +  I +  +    F +   +   D     +  ++P++F+CPLT  +F +PVT+ETGQ
Sbjct  457   ISDMSAIDLLTLE---FCEGPLQSDADGNHFSIFATVPSDFLCPLTRQIFNNPVTIETGQ  513

Query  868   SFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFA  1047
             +FER AI+ W  +G RTCP T ++L   ++P +N +LKR+ID W+SE  ++L++ S+   
Sbjct  514   TFERHAIVQWLDRGFRTCPFTGQELLSLSIPDTNRVLKRLIDGWKSERCKNLVSGSTGL-  572

Query  1048  SDSKAEIAVSILEKLL-IVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALL  1224
                + +++V++++K+      + E+    + L+ +GG+ FL+H F  G  +E++ V+  L
Sbjct  573   ---EEKLSVTVIDKVFSSAGDMSEKLDKARHLMAIGGIDFLLHEFQEGGGDEQQRVAEHL  629

Query  1225  SSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSG  1404
               CI A+ +CRN +A  ID   +L +L SE   + + A  L+TEL CL RR+     L G
Sbjct  630   LFCIRAEGSCRNYVAIKIDGSSVLRLLHSEVRSARRIAAGLLTELTCLRRREMFELLLRG  689

Query  1405  LQSDDIANITI-LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL  1581
             L ++ +   T+ +L  +L+S   + ++ VAVL+LHF  L +    ++  + A   IT +L
Sbjct  690   LGTESVVMRTMDVLLEHLRSLPVQDQASVAVLLLHFDALVEPNEDSIYREEAAKIITHSL  749

Query  1582  ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDN  1761
                  ++ ++    K LL+L  +FS  G ++ EDW+LKQAGF+D   +   S++      
Sbjct  750   RRCMSEDNVVPGTRKALLLLAGYFSFSGDLLVEDWMLKQAGFVDGSRASPTSSD------  803

Query  1762  GRITMMDDGEEEVREEWQARMSAMLLGSG--KKSFLGALSMCLASGNIELVRVCLTTVAW  1935
                 +  D E    E W    +A LLG G  ++ FL ALS CL S + +LV  CL T AW
Sbjct  804   ---VVAQDKEAAGNEAWLRHAAAALLGRGGVRRPFLEALSRCLGSPDADLVAACLATAAW  860

Query  1936  Lssvlass-------srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKI  2094
             LS  LA+S       + + ++  L+AFSAL+ +LK CL   +   H+VLA+V L NFS I
Sbjct  861   LSRSLAASLDDDATNTGTDTDASLAAFSALVPRLKQCLAPSRPARHRVLAAVSLHNFSMI  920

Query  2095  PECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
             P+CR LL+++ + + D L  LA +T  A +L
Sbjct  921   PDCRELLVLLADGLRDHLAELAGLTSTAGQL  951



>dbj|BAJ97801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=953

 Score =   343 bits (880),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 256/770 (33%), Positives = 402/770 (52%), Gaps = 83/770 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLE-SPDS  177
             LQ+KD  +A H L+ FC +P +ART LLP LWD +F P L+HLK W  +E       PD+
Sbjct  220   LQKKDHSSAVHALEAFCLAPREARTVLLPALWDRLFRPGLTHLKAWRDRESAAARPKPDA  279

Query  178   KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED---  348
             +S   K +EK++ + +D GT   A YY+DWL    E  ++PSV  P  +   A       
Sbjct  280   RS---KDVEKLFLDALDDGTRALACYYRDWLLGRTEVMALPSVPAPPSTAPPATAPSTAP  336

Query  349   ------PNSVSCIVGS------FSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASM  492
                     S +  +GS       +P P +   + +E  R   GV+     EE     A  
Sbjct  337   PSATRFSTSTTYDIGSDVAYSSGTPSPAIF--VIEETPRQPEGVQ-----EEGKAADAD-  388

Query  493   SNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLV-EHFSDVHPKPSIQEIY  669
             S+GSV  E    ++    P            EEA +   N L  E F     +P I++  
Sbjct  389   SSGSVFHECDDGEVRSCSPTPR---------EEASVLMPNMLANEAF-----EPRIEDER  434

Query  670   GT--------IDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLT  825
             G         + A   S +  + +E        Q +  +    E  +  + P++F+CPLT
Sbjct  435   GKGADESTNYLPARDMSAIDLLTLEFCEGPL--QTSGADGSQVEATIFSTTPSDFLCPLT  492

Query  826   GLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRS  1005
               +F  PVT+ETGQ+FER AI++WF +G RTCP+T ++LE  +VP +N +L R+ID W++
Sbjct  493   RQIFNRPVTIETGQTFERHAIVHWFDRGLRTCPVTGQELEALSVPDTNRVLTRLIDAWKA  552

Query  1006  EHWQHLLAFSSQFASDSKAEIAVSILEKLLIVS-SIDERTKNVKQLICLGGLQFLIHRFN  1182
             EH + L           + ++ V++++++L    S+ E+T+  + L+ +GG+ F +HR  
Sbjct  553   EHCRSLRVAD---GGPPEEKLNVAVVDRVLDAGRSVSEQTERARHLMAIGGVDFHLHRLR  609

Query  1183  LGNLNEKKCVSA-LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTEL  1359
              G   E++  +A  L  C+ A+ +CR+ +A  +    ++ +L SE + +   A+ L+ EL
Sbjct  610   EGREEEQRARAAEHLLLCVRAEGSCRSYVAVRVHGESVVRLLRSEVVSARSAAVRLLVEL  669

Query  1360  ICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSN  1539
             + L RR+    F+ GL ++       +L  +L+SS  ++++LVAVL+L+F    D   S 
Sbjct  670   LRLRRREMVELFIRGLCTESATETMDVLLRHLRSSPAEERALVAVLLLYF----DRTLSP  725

Query  1540  VCIDG---------AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWIL  1692
                DG         A+  +T +L    +DE ++    K LL+LG HFS  G ++ ED +L
Sbjct  726   DEPDGSNGSGYREEAVRTLTESLRRCLIDENVVPNTRKALLMLGGHFSFSGDLLAEDRML  785

Query  1693  KQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGAL  1872
             +QAGF D   +    T D          + + E    E W   ++A+LLGSG++ FL AL
Sbjct  786   EQAGFADDTPAATPVTSD--------ATVQETEAAENEAWLEHVTAVLLGSGRRPFLAAL  837

Query  1873  SMCLASGNIELVRVCLTTVAWLssvlass--srsgsefelsaFSALICQLKACLEHGKL-  2043
             S C+ S +  LV  CLTT  WLS  LA++    + ++ +L+AFSAL+ +LK CL  G   
Sbjct  838   SGCMGSPDAGLVAACLTTAGWLSRSLAATPLRDTHTDMQLAAFSALVPRLKRCLAGGAAH  897

Query  2044  --LEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
                 H+VLA+V L NFSKIP+CRVLLM++ + +   L  LAE+T  A +L
Sbjct  898   LQARHRVLAAVTLHNFSKIPDCRVLLMLLADGLRGHLADLAELTRTAGQL  947



>dbj|BAK01872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=936

 Score =   341 bits (875),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 256/770 (33%), Positives = 401/770 (52%), Gaps = 83/770 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLE-SPDS  177
             LQ+KD  +A H L+ FC +P +ART LLP LWD +F P L+HLK W  +E       PD+
Sbjct  203   LQKKDHSSAVHALEAFCLAPREARTVLLPALWDRLFRPGLTHLKAWRDRESAAARPKPDA  262

Query  178   KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED---  348
             +S   K +EK++ + +D GT   A YY+DWL    E  ++PSV  P  +   A       
Sbjct  263   RS---KDVEKLFLDALDDGTRALACYYRDWLLGRTEVMALPSVPAPPSTAPPATAPSTAP  319

Query  349   ------PNSVSCIVGS------FSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASM  492
                     S +  +GS       +P P +   + +E  R   GV+     EE     A  
Sbjct  320   PSATRFSTSTTYDIGSDVAYSSGTPSPAIF--VIEETPRLPEGVQ-----EEGKAADAD-  371

Query  493   SNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLV-EHFSDVHPKPSIQEIY  669
             S+GSV  E    ++    P            EEA +   N L  E F     +P I++  
Sbjct  372   SSGSVFHECDDGEVRSCSPTPR---------EEASVLMPNMLANEAF-----EPRIEDER  417

Query  670   GT--------IDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLT  825
             G         + A   S +  + +E        Q +  +    E  +  + P++F+CPLT
Sbjct  418   GKGADESTNYLPARDMSAIDLLTLEFCEGPL--QTSGADGSQVEATIFSTTPSDFLCPLT  475

Query  826   GLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRS  1005
               +F  PVT+ETGQ+FER AI++WF +G RTCP+T ++LE  +VP +N +L R+ID W++
Sbjct  476   RQIFNRPVTIETGQTFERHAIVHWFDRGLRTCPVTGQELEALSVPDTNRVLTRLIDAWKA  535

Query  1006  EHWQHLLAFSSQFASDSKAEIAVSILEKLLIVS-SIDERTKNVKQLICLGGLQFLIHRFN  1182
             EH + L           + ++ V++++++L    S+ E+T+  + L+ +GG+ F +HR  
Sbjct  536   EHCRSLRVAD---GGPPEEKLNVAVVDRVLGAGRSVSEQTERARHLMAIGGVDFHLHRLR  592

Query  1183  LGNLNEKKCVSA-LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTEL  1359
              G   E++  +A  L  C+ A+  CR+ +A  +    ++ +L SE + +   A+ L+ EL
Sbjct  593   EGREEEQRARAAEHLLLCVRAEGGCRSYVAVRVHGESVVRLLRSEVVSARSAAVRLLVEL  652

Query  1360  ICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSN  1539
             + L RR+    F+ GL ++       +L  +L+SS  ++++LVAVL+L+F    D   S 
Sbjct  653   LRLRRREMVELFIRGLCTESATETMDVLLRHLRSSPAEERALVAVLLLYF----DRTLSP  708

Query  1540  VCIDG---------AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWIL  1692
                DG         A+  +T +L    +DE ++    K LL+LG HFS  G ++ ED +L
Sbjct  709   DEPDGSNGSGYREEAVRTLTESLRRCLIDENVVPNTRKALLMLGGHFSFSGDLLAEDRML  768

Query  1693  KQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGAL  1872
             +QAGF D   +    T D          + + E    E W   ++A+LLGSG++ FL AL
Sbjct  769   EQAGFADDTPAATPVTSD--------ATVQETEAAENEAWLEHVTAVLLGSGRRPFLAAL  820

Query  1873  SMCLASGNIELVRVCLTTVAWLssvlass--srsgsefelsaFSALICQLKACLEHGKL-  2043
             S C+ S +  LV  CLTT  WLS  LA++    + ++ +L+AFSAL+ +LK CL  G   
Sbjct  821   SGCMGSPDAGLVAACLTTAGWLSRSLAATPLRDTHTDMQLAAFSALVPRLKRCLAGGAAH  880

Query  2044  --LEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
                 H+VLA+V L NFSKIP+CRVLLM++ + +   L  LAE+T  A +L
Sbjct  881   LQARHRVLAAVTLHNFSKIPDCRVLLMLLADGLRGHLADLAELTRTAGQL  930



>ref|XP_006653705.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2-like [Oryza 
brachyantha]
Length=913

 Score =   325 bits (833),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 238/703 (34%), Positives = 367/703 (52%), Gaps = 80/703 (11%)
 Frame = +1

Query  118   LSHLKIWYIKELGMLESPDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSI  297
             LSHL+ W   E     S D+K   +K +EK +   +D GT   A YY+DWL    E  S+
Sbjct  272   LSHLRAWRDSESAAAASSDTK---VKDVEKKFVAVVDDGTRALACYYRDWLLGRTEVMSL  328

Query  298   PSVK-----IPFLSPQLARNED---PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELD  453
             P V      +P  +P+ + +      + V+C  GS+SP    +K   DE         L 
Sbjct  329   PVVPAPPSTVPASAPRFSTSTSYDIGSDVACSSGSYSP---ATKFALDET-------PLQ  378

Query  454   YYKEESYGGSASMSNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFS  633
             + +EE            V E+T  ++ V +E    C              ++N   E  S
Sbjct  379   FDQEE---------EAVVGEKTADAESVFLE----CDDTEAKSHTHTFQTQKN---EPMS  422

Query  634   DVHPKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFI  813
             D   K S QE+   +     + V ++ I       F                 +IP +F+
Sbjct  423   DELAKASEQELLSEVPLQSETDVSQVSI-------FA----------------TIPNDFL  459

Query  814   CPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVID  993
             CPLT  +F  PVT+ETGQ+FER AI+ WF +G + CPIT ++LE  ++P  N +LKR+ID
Sbjct  460   CPLTRQIFNRPVTIETGQTFERHAIVQWFDRGIKMCPITGQELESLSIPDINRVLKRLID  519

Query  994   KWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIV-SSIDERTKNVKQLICLGGLQFLI  1170
              W+SE+ + L++ S+      + ++ V ++  +L       E ++N + L+ +GG+ FL+
Sbjct  520   NWKSENCKTLVSESTY----PEEKLTVRVMRNVLSAERKTSENSENTRYLMAIGGIDFLL  575

Query  1171  HRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLM  1350
             HRF+ G   EK   + LL  CI A+ +CRN +A  +    +++++ SE + +  +A+ L+
Sbjct  576   HRFHGGGEEEKAQAAELLVLCIRAEGSCRNYVAIRLSSSSVVQLIHSEVISARSSAVRLL  635

Query  1351  TELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHF-HLLTDT  1527
              EL+CL RR+    FL GL+++       LL  + +SS  ++++L AVL+LHF   L + 
Sbjct  636   IELLCLRRREMVELFLRGLRTELTMETMNLLLEHTRSSSVEEQALGAVLLLHFDRALVEP  695

Query  1528  QCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF  1707
                +V  + A   IT +L     +E  +    K LL+LG HFS  G ++ EDWILKQAGF
Sbjct  696   HRDSVYREEAAKIITHSLRCCLSEENAVANTRKALLLLGGHFSFSGDLLAEDWILKQAGF  755

Query  1708  IDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
             +D        +     D+       +G+E+  E W   ++A+LLG G++ FL ALSMC+ 
Sbjct  756   VD-------GSRGTHADSDAAVQDKEGDED--EAWLRDVTAVLLGRGRRPFLEALSMCMG  806

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHG---KLLEHKV  2058
             S +  L   CLTT AWL    +  S   ++ +L+AF ALI +LK CL  G   +   H+V
Sbjct  807   SPDHGLAAACLTTAAWL--SRSLQSIDATDVQLAAFLALIPRLKQCLAAGDQPQTRHHRV  864

Query  2059  LASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
             LASV L N SKIP+CRVLLM++ + + D L  LAE+TW A +L
Sbjct  865   LASVTLYNISKIPDCRVLLMLLADGLRDHLGELAELTWTAGQL  907



>dbj|BAK00804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   299 bits (765),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 236/733 (32%), Positives = 375/733 (51%), Gaps = 83/733 (11%)
 Frame = +1

Query  112   PHLSHLKIWYIKELGMLE-SPDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEP  288
             P L+HLK W  +E       PD++S   K +EK++ + +D GT   A YY+DWL    E 
Sbjct  61    PGLTHLKAWRDRESAAARPKPDARS---KDVEKLFLDALDDGTRALACYYRDWLLGRTEV  117

Query  289   PSIPSVKIPFLSPQLARNED---------PNSVSCIVGS------FSPQPVVSKKLYDEV  423
              ++PSV  P  +   A               S +  +GS       +P P +   + +E 
Sbjct  118   MALPSVPAPPSTAPPATAPSTAPPSATRFSTSTTYDIGSDVAYSSGTPSPAIF--VIEET  175

Query  424   FRHKNGVELDYYKEESYGGSASMSNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAEIQ  603
              R   GV+     EE     A  S+GSV  E    ++    P            EEA + 
Sbjct  176   PRQPEGVQ-----EEGKAADAD-SSGSVFHECDDGEVRSCSPTPR---------EEASVL  220

Query  604   EENKLV-EHFSDVHPKPSIQEIYGT--------IDAAPHSKVIKIIIERIAKAFFGQQNT  756
               N L  E F     +P I++  G         + A   S +  + +E        Q + 
Sbjct  221   MPNMLANEAF-----EPRIEDERGKGADESTNYLPARDMSAIDLLTLEFCEGPL--QTSG  273

Query  757   EESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSK  936
              +    E  +  + P++F+CPLT  +F  PVT+ETGQ+FER AI++WF +G RTCP+T +
Sbjct  274   ADGSQVEATIFSTTPSDFLCPLTRQIFNRPVTIETGQTFERHAIVHWFDRGLRTCPVTGQ  333

Query  937   KLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVS-SID  1113
             +LE  +VP +N +L R+ID W++EH + L           + ++ V++++++L    S+ 
Sbjct  334   ELEALSVPDTNRVLTRLIDAWKAEHCRSLRVAD---GGPPEEKLNVAVVDRVLDAGRSVS  390

Query  1114  ERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA-LLSSCIEADSNCRNLIARNIDKMC  1290
             E+T+  + L+ +GG+ F +HR   G   E++  +A  L  C+ A+  CR+ +A  +    
Sbjct  391   EQTERARHLMAIGGVDFHLHRLREGREEEQRARAAEHLLLCVRAEGGCRSYVAVRVHGES  450

Query  1291  LLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHC  1470
             ++ +L SE + +   A+ L+ EL+ L RR+    F+ GL ++       +L  +L+SS  
Sbjct  451   VVRLLRSEVVSARSAAVRLLVELLRLRRREMVELFIRGLCTESATETMDVLLRHLRSSPA  510

Query  1471  KQKSLVAVLILHFHLLTDTQCSNVCIDG---------AIDAITVALESSFLDERLIEMCC  1623
             ++++LVAVL+L+F    D   S    DG         A+  +T +L    +DE ++    
Sbjct  511   EERALVAVLLLYF----DRTLSPDEPDGSNGSGYREEAVRTLTESLRRCLIDENVVPNTR  566

Query  1624  KGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVR  1803
             K LL+LG HFS  G ++ ED +L+QAGF D   +    T D          + + E    
Sbjct  567   KALLMLGGHFSFSGDLLAEDRMLEQAGFADDTPAATPVTSD--------ATVQETEAAEN  618

Query  1804  EEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass--srsgse  1977
             E W   ++A+LLGSG++ FL ALS C+ S +  LV  CLTT  WLS  LA++    + ++
Sbjct  619   EAWLEHVTAVLLGSGRRPFLAALSGCMGSPDAGLVAACLTTAGWLSRSLAATPLRDTHTD  678

Query  1978  felsaFSALICQLKACLEHGKL---LEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTL  2148
              +L+AFSAL+ +LK CL  G       H+VLA+V L NFSKIP+CRVLLM++ + +   L
Sbjct  679   MQLAAFSALVPRLKRCLAGGAAHLQARHRVLAAVTLHNFSKIPDCRVLLMLLADGLRGHL  738

Query  2149  ECLAEVTWVAREL  2187
               LAE+T  A +L
Sbjct  739   ADLAELTRTAGQL  751



>ref|XP_009385173.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
[Musa acuminata subsp. malaccensis]
Length=906

 Score =   296 bits (758),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 172/437 (39%), Positives = 265/437 (61%), Gaps = 14/437 (3%)
 Frame = +1

Query  805   EFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKR  984
             +++CPL G +F++PVT+ET   FE  A+    ++  +  P+T ++L CQ+VP +N +L +
Sbjct  472   DYVCPLKGQLFKEPVTIETEHIFESVAMKECLNQA-KASPVTGQQLSCQSVPDTNSVLNQ  530

Query  985   VIDKWRSEHWQHLLAFSSQFASD-------SKAEIAVSILEKLLIVSSIDERTKNVKQLI  1143
             ++D W SE+  +LL   +Q   +       SK ++A+ I+++LL     +E+ +N + LI
Sbjct  531   LVDGWVSENCWNLLIIMAQLTKNETEGDKKSKDDLALEIVDRLLAGCGKEEQMENARNLI  590

Query  1144  CLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLE  1323
              LGGL+FLIHRF  G+ N K  V   L  CI A   CRN +A N+ +  +LE+L S+ + 
Sbjct  591   ALGGLRFLIHRFETGSFNVKTRVIGFLLCCINAKGWCRNYLADNLKRSSVLELLHSKQIS  650

Query  1324  SVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLIL  1503
             +  NA+ L+ ELICL+RR+D T FLSGL  + IAN    L  +L S   ++K+LVAVL+L
Sbjct  651   ARTNAVLLLIELICLSRRRDITSFLSGLLKETIANTMHALLVHLYSLPAQEKALVAVLLL  710

Query  1504  HFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTED  1683
             HF L+  T   ++    A+D IT++L     D+R I    + LL+LG HFS  G+I+ + 
Sbjct  711   HFDLVLGTSKRSIYKKEAVDGITLSLNCCLSDKRAIPNSQRALLMLGGHFSKSGEILIDS  770

Query  1684  WILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFL  1863
             W+L+Q GFID   + + + +DN+ D     +++D E + +E+W   ++ +L+G+G+KSF+
Sbjct  771   WLLQQGGFIDGLFNTI-NYDDNKDDE---DLLED-EAKQKEKWLKDVTLVLIGNGRKSFM  825

Query  1864  GALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKL  2043
               LS CL SG   LVR CL T AW+ S       S  +   + FS  I QLK  LE    
Sbjct  826   ETLSRCLVSGIQGLVRTCLVTAAWM-SHALVLLSSSHQIPSAVFSDFIPQLKQRLEEDDQ  884

Query  2044  LEHKVLASVCLLNFSKI  2094
             +EH++LASV LLN SK+
Sbjct  885   IEHRILASVSLLNLSKV  901


 Score =   133 bits (335),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 94/142 (66%), Gaps = 3/142 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++++DR+ A H+LQVFC +PL+ART LLPDLW+ +FLPHLSHLK W+ KE+  +      
Sbjct  177  IRKEDRMTADHLLQVFCTAPLEARTILLPDLWNQLFLPHLSHLKAWHKKEVESIAQTPCG  236

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
            ++K+K+L+K+Y++ M+ GT+ FAVYYK+WL E  + PS+PS+  P  S         +++
Sbjct  237  AKKMKLLDKMYDDVMNRGTHIFAVYYKEWLIEAKKAPSLPSIDAPSASSSRMIQRGSHAI  296

Query  361  SCIVGSFSPQPVVSKKLYDEVF  426
                      P+VS+K Y+ V 
Sbjct  297  H---RDDVYSPMVSQKSYEAVL  315



>ref|XP_002446993.1| hypothetical protein SORBIDRAFT_06g026520 [Sorghum bicolor]
 gb|EES11321.1| hypothetical protein SORBIDRAFT_06g026520 [Sorghum bicolor]
Length=866

 Score =   290 bits (743),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 215/741 (29%), Positives = 350/741 (47%), Gaps = 130/741 (18%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ++D  AA H L+ FC +P +ART LLP LWD +F   LSHL+ W  +E     +  S 
Sbjct  236   LQKRDHSAAVHALETFCLAPREARTVLLPALWDRLFRSGLSHLRTWRDRE----SAAASA  291

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLS-----PQLARNE  345
               ++K +EKV+ + +D GT   A YY+DWL    +  ++P +  P  +     P+ + + 
Sbjct  292   DERVKEVEKVFVDVLDEGTRALACYYRDWLLGRTDAMALPDIPAPLSTVHASAPRCSAST  351

Query  346   DPN-SVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETH  522
               + S   + GS S  P  +K  YD+  R    +E    +EE+    A+    +V  +  
Sbjct  352   SYDISSDVMFGSGSSSP--TKFAYDDTMRPSERIE----EEEAVYSEAAADAVTVLPDHE  405

Query  523   CSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPHSKV  702
               +    E   T +S ++         +EN  V       P    +E +      PH   
Sbjct  406   SDEAGGEERSYTPRSPTL-------FGQENVPV-------PDSLDRETF-----EPH---  443

Query  703   IKIIIERIAKAFFGQQNTEESVD-SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFER  879
                        F  +   +   D +E  +  ++P +F+CPLT  +F +PVT+ETGQ+FER
Sbjct  444   -----------FLSEVPLQSDTDGNELSIFATVPNDFLCPLTRQIFNNPVTIETGQTFER  492

Query  880   AAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSK  1059
              AI+ W  +G R CP+T + L    VP +N +LKR+ID W+SEH +HL++ S++      
Sbjct  493   HAIVQWLDRGFRMCPVTGQDLSSLTVPDTNRVLKRLIDNWKSEHCKHLISESARL----D  548

Query  1060  AEIAVSILEKLL-IVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCI  1236
              ++ + +++K L     + E+    + L+ +GG+ FL+H+F  G  +E+  V+  L    
Sbjct  549   VKLTLLLIDKALDSAEDMSEKLDKARHLMAIGGIDFLLHKFQEGWGDEQPRVAEHL----  604

Query  1237  EADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD  1416
                                  +LC     S +N +++  +  C+         L  LQS+
Sbjct  605   ---------------------LLCIRAEGSCRNYVAIKIDGSCV---------LRLLQSE  634

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
              ++     +     S++ ++                          A   IT +L     
Sbjct  635   VLSARRTAVEPNRNSAYREE--------------------------AAKTITHSLRCCLS  668

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
             D+  +    + LL+LG +F+  G ++ EDW+LKQAGFID   +   S++          +
Sbjct  669   DDNAVPSTRRALLLLGGNFAFSGDLLAEDWMLKQAGFIDHSRATAASSD---------AV  719

Query  1777  MDDGEEEVREEWQARMSAMLLGSG---KKSFLGALSMCLA-SGNIELVRVCLTTVAWLss  1944
             + D E    E W   ++A LLG     ++ FL ALS CL  S +  LV  CLTT  WLS 
Sbjct  720   IHDKESAENEAWLRHVAAALLGGSIGIRRPFLEALSKCLGGSTDAGLVGACLTTAGWLSR  779

Query  1945  vlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMI  2124
              L     + +      FSAL+ +LK CL  G+   H+VLA+V L +FS+IP+CR LLM++
Sbjct  780   ALDEDGAADTSLAA--FSALVPRLKQCLAPGRPARHRVLAAVSLHHFSRIPDCRELLMLL  837

Query  2125  GEVIEDTLECLAEVTWVAREL  2187
              + + D L  L++ TW A +L
Sbjct  838   ADGLRDHLADLSQQTWTAGQL  858



>ref|XP_007024873.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY27495.1| Transducin/WD40 repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=971

 Score =   281 bits (718),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 239/793 (30%), Positives = 368/793 (46%), Gaps = 123/793 (16%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
             L++ DRI+A+H+LQVFCDS   ART LLPDLW++ FLPHL HLK+WY KEL  L + +  
Sbjct  222   LEKTDRISARHLLQVFCDSAFLARTHLLPDLWEHFFLPHLLHLKVWYHKELEFLSNLEYG  281

Query  175   SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
              K +++K L ++YN+ +D GT KFA+YYK+WL  G + P++P+V +P  SP    ++   
Sbjct  282   EKEKRMKALSELYNDQIDMGTVKFAMYYKEWLKIGAKAPAVPTVPLP-TSPSYRSSDSYA  340

Query  355   SVSCIVGSFSPQPVVSKKLYDEVF---RHKNGVELDYY------------------KEES  471
             S S I          +K LY  VF     +  +ELD+                    +E 
Sbjct  341   SHSSI----------NKNLYRAVFGATTERQSMELDHRIRASMDICRLEEEENECTDDEY  390

Query  472   YGGSASMSNGSVTEETHCSQIVKIEPYA-----------TCQSYSMPITEEAEIQEENKL  618
             Y G   + N + T     ++  + E +            TCQ+         +    N  
Sbjct  391   YNGCNYVHNKTKTRRRSSTRTPETESWTETRKSDHFRLFTCQTGPTECLVNGKSVVRNNS  450

Query  619   VEHFSDVH-PKPSIQEIYGTI-------------------------DAAPHSKVIKI-II  717
             ++    VH P   + +   TI                         D A  + + K  +I
Sbjct  451   MKKEEKVHLPMSDLSKAIATICSSDSLSDCEIAIRVMTKAWLESHADPAVETALAKAPVI  510

Query  718   ERIAKAFFGQQNTEESVDSERPLGLSIPTEFICP----LTGLVFEDP------VTLETGQ  867
             E I +  F   +     D    L +SI  EF+         ++  DP        L    
Sbjct  511   EGILEVLFASSD-----DEILELAISILAEFVARNEVNRQMMLNSDPQLEIFLRLLRNSS  565

Query  868   SFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF--SSQ  1041
              F +AA+L +  K     P   + +  + VPL    + RV++    E  Q L     S Q
Sbjct  566   LFLKAAVLLYLLK-----PKAKQMISTEWVPL----VLRVLE--LGEQLQTLFTVRCSPQ  614

Query  1042  FASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSAL  1221
              A       A   L++LL   + D   +N  Q++ LGGL  LI  F +G + E+   + +
Sbjct  615   VA-------AFYFLDQLLTGFNEDRNLENATQVVSLGGLSLLIRNFEIGGVLERNNAALI  667

Query  1222  LSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLS  1401
             +S CI AD +CRN +A  ++K  L+E++ +   +S    ++L+ EL+CLNRR   T FL+
Sbjct  668   ISCCIRADGSCRNYLADKLNKASLIELIVANRNDSNGTVVALLAELLCLNRRTQITKFLN  727

Query  1402  GLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
              L +     N T +L   LQ +  +++ LVA ++L   LL D    +V  + A++AI  A
Sbjct  728   DLLNGWRGLNTTHILLACLQRALPEERPLVAAILLQLDLLGDPLRCSVYREEAVEAIIEA  787

Query  1579  LESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPD  1758
             L+    +E++ E   + L++LG  FS  G+  TE+W+L+QAGF ++ E    S E     
Sbjct  788   LDCEKCNEKIQEQSARALMMLGGRFSCMGEATTENWLLQQAGFHEKLEDSFHSKE-----  842

Query  1759  NGRITMMDD---GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTV  1929
                  ++DD    EEE    WQ + +  LL SG K FL +LS  +  G   L R  L TV
Sbjct  843   -----IVDDILHEEEEAIVHWQRKAAIALLNSGNKRFLASLSNSMVKGIPSLARASLLTV  897

Query  1930  AWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRV  2109
             AW+SS L S      +      S L+ QL     + + LE +VLAS  L    K  E   
Sbjct  898   AWMSSFLHSVRDKDFQSMAC--SILVPQLLESSNYNQALEERVLASFSLQRLIKSSEYTS  955

Query  2110  LLMMIGEVIEDTL  2148
             ++  + E + + L
Sbjct  956   IISSLDETLVNPL  968



>ref|XP_002297659.1| hypothetical protein POPTR_0001s04980g [Populus trichocarpa]
 gb|EEE82464.1| hypothetical protein POPTR_0001s04980g [Populus trichocarpa]
Length=760

 Score =   275 bits (704),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 168/392 (43%), Positives = 218/392 (56%), Gaps = 58/392 (15%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KD+ +AKH+LQVFCDSP  ART LL +LWD +F PHLSHLK WY +E   L    SK
Sbjct  365   LQKKDKASAKHLLQVFCDSPFLARTLLLSELWDYLFFPHLSHLKTWYKQEADALFRKPSK  424

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
               KLK L KVYNET+D+ T +FAVYYKDWLTEGVE PSIPSV IPF S Q    +  +  
Sbjct  425   ITKLKFLAKVYNETLDSCTYQFAVYYKDWLTEGVEAPSIPSVDIPFTSQQGGSRDHSSGP  484

Query  361   SCIVGSFSPQPVVSKKLYDEVFRHKNGVEL----DYYKEESYGGSASMSNGSVTEETHCS  528
             +     FSPQP VSKKLYD VF   +   +    D  K E++   A +S  S  E  H  
Sbjct  485   ASPSAPFSPQPTVSKKLYDAVFGRSSKPRVHEAEDNGKAENFNNGAHISGSSPIEIKHTV  544

Query  529   QI---VKIEPYATCQSYSMP-ITEEAEI---------QEENKLV--------EHFSDVHP  645
              I   +   P    +++S   + +   I          +E KLV        +  +D   
Sbjct  545   TISFKMVTYPGQDIENHSPENVPDNTSIPGKGLLTASNKEWKLVKVSVSPGTDLNADTCN  604

Query  646   KPSIQEIYGT----IDAAPHSKVIKIIIERIAKAFFGQQNTEESVD--------------  771
               + +E  G     ++++ H+K  ++ ++ +AK+ F  Q TE+S D              
Sbjct  605   SSAREEPEGDTTHMLNSSSHTKENELALKTLAKSVFELQRTEDSGDPTVSDLSHSKKAIN  664

Query  772   ----SERPLGL-----------SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSK  906
                 SE P G            SIP +FICPLTG +FEDPVTLETGQ+FER AI  WF +
Sbjct  665   ADASSEGPNGSHEHFDEGSIFDSIPHDFICPLTGQLFEDPVTLETGQTFEREAIREWFDQ  724

Query  907   GNRTCPITSKKLECQAVPLSNFILKRVIDKWR  1002
             GN+TCP++ K L C  VPL+N ILK VID W+
Sbjct  725   GNKTCPVSGKTLACSTVPLTNSILKLVIDSWK  756



>ref|XP_011037932.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X4 
[Populus euphratica]
Length=701

 Score =   273 bits (698),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 204/345 (59%), Gaps = 22/345 (6%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KD+ +AKH+LQVFCD+P  ART LL +LWD +F PHLSHLK WY KE   L     K
Sbjct  365   LQKKDKASAKHLLQVFCDAPFLARTLLLSELWDYLFFPHLSHLKTWYKKEADALFRKPRK  424

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              +KLK L K+YNET+D+ T +FAVYYKDWLTEGVE PS+PSV IPF S Q    +  +  
Sbjct  425   IKKLKFLAKIYNETLDSCTYQFAVYYKDWLTEGVEAPSVPSVDIPFTSQQGGSQDHSSGP  484

Query  361   SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCSQIVK  540
             +     FSPQP VSKKLYD VF   +   +  ++ E  G + +++NG+     H S    
Sbjct  485   ASPSAPFSPQPTVSKKLYDAVFGRSSKPRV--HEAEDNGKAENLNNGA-----HISGSSP  537

Query  541   IE-PYATCQSYSMPITEEAEIQEENKLVEHFSDVHPKP---SIQEIYGTIDAA------P  690
             IE  +    S+ M      +I  EN   E+  D    P   S Q +   +         P
Sbjct  538   IEIKHTVTISFKMVTYPGQDI--ENHSPENVPDNTSIPCRQSTQTLLVKVSQNISRLFLP  595

Query  691   HSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQS  870
                V+ +++     A  G   + E  D E  +  SIP +FICPLTG +F+DPVTLETGQ+
Sbjct  596   LQIVVWMLMMHSPSA--GPHGSHEHFD-EGSIFDSIPQDFICPLTGQLFDDPVTLETGQT  652

Query  871   FERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRS  1005
             FER AI  WF +GN+TCP++ K L C  VPL+N ILK VID W+S
Sbjct  653   FEREAIREWFDRGNKTCPVSGKTLACSTVPLTNSILKLVIDSWKS  697



>ref|XP_011037930.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 isoform 
X2 [Populus euphratica]
Length=767

 Score =   273 bits (699),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 166/408 (41%), Positives = 218/408 (53%), Gaps = 82/408 (20%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+KD+ +AKH+LQVFCD+P  ART LL +LWD +F PHLSHLK WY KE   L     K
Sbjct  365   LQKKDKASAKHLLQVFCDAPFLARTLLLSELWDYLFFPHLSHLKTWYKKEADALFRKPRK  424

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              +KLK L K+YNET+D+ T +FAVYYKDWLTEGVE PS+PSV IPF S Q    +  +  
Sbjct  425   IKKLKFLAKIYNETLDSCTYQFAVYYKDWLTEGVEAPSVPSVDIPFTSQQGGSQDHSSGP  484

Query  361   SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCSQIVK  540
             +     FSPQP VSKKLYD VF   +   +  ++ E  G + +++NG+     H S    
Sbjct  485   ASPSAPFSPQPTVSKKLYDAVFGRSSKPRV--HEAEDNGKAENLNNGA-----HISGSSP  537

Query  541   IE-PYATCQSYSMPITEEAEIQEENKLVEHFSD-----------------------VHPK  648
             IE  +    S+ M      +I  EN   E+  D                       V P 
Sbjct  538   IEIKHTVTISFKMVTYPGQDI--ENHSPENVPDNTSIPGKGLLTAPNKEWKLVQVSVSPG  595

Query  649   PSI----------QEIYGT----IDAAPHSKVIKIIIERIAKAFFGQQNTEESVD-----  771
               +          QE  G     ++++ H+K  ++ ++ +AK+ F  Q TE+S D     
Sbjct  596   TDLNVDTCNSSARQEPEGDTTNMLNSSSHTKENELALKTLAKSVFELQRTEDSGDPTVSD  655

Query  772   -------------------SERPLGL-----------SIPTEFICPLTGLVFEDPVTLET  861
                                SE P G            SIP +FICPLTG +F+DPVTLET
Sbjct  656   LSHFSDLSHSKKAINPDASSEGPHGSHEHFDEGSIFDSIPQDFICPLTGQLFDDPVTLET  715

Query  862   GQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRS  1005
             GQ+FER AI  WF +GN+TCP++ K L C  VPL+N ILK VID W+S
Sbjct  716   GQTFEREAIREWFDRGNKTCPVSGKTLACSTVPLTNSILKLVIDSWKS  763



>gb|EMS52552.1| U-box domain-containing protein 17 [Triticum urartu]
Length=697

 Score =   261 bits (666),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 163/447 (36%), Positives = 260/447 (58%), Gaps = 23/447 (5%)
 Frame = +1

Query  793   SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNF  972
             + P++F+CPLT  +F  PVT+ETGQ+FER AI++WF +G RTCP+T ++LE  +VP +N 
Sbjct  126   TAPSDFLCPLTRQIFNRPVTIETGQTFERHAIVHWFDRGLRTCPVTGQELEALSVPDTNR  185

Query  973   ILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVS-SIDERTKNVKQLICL  1149
             +L R+ID W++EH +  L  +   A + K  +AV  ++++L    S+ E+T+  + L+ +
Sbjct  186   VLTRLIDAWKAEHCRS-LRVADGGAPEEKLNVAV--VDRVLDAGLSVSEQTERARHLMAI  242

Query  1150  GGLQFLIHRFNLGNLNEKKCVSA-LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLES  1326
             GG+ F +HR   G   E++  +A  L  C+ A+ + R+ +A  +    ++ +L SE + +
Sbjct  243   GGVDFHLHRLRDGKEEEQRARAAEHLLLCVRAEGSVRSYVAVRVHGESVVRLLRSEVVSA  302

Query  1327  VQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILH  1506
                A+ LM EL+ L RR+    F+ GL +  +     +L  +L+SS  ++++LVAVL+L+
Sbjct  303   RSAAVRLMVELLRLRRREMVELFIRGLCTGSVTETMDVLLQHLRSSPVEERALVAVLLLY  362

Query  1507  FHLL-----TDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKI  1671
             F         D + S+V  + A   +T +L    +DE ++    K LL+LG +FS  G +
Sbjct  363   FDRTLSVDEPDRRNSSVYREEAARILTESLRRCLIDENVVPNTRKALLMLGGNFSFSGDL  422

Query  1672  MTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGK  1851
             + ED +L+QAGF D        T D          + + E    E W   ++  LLGSG+
Sbjct  423   LAEDRMLEQAGFADDTPGATAVTSD--------ATVQETEAAENEAWLEHVTTALLGSGR  474

Query  1852  KSFLGALSMCLASGNIELVRVCLTTVAWLssvlass--srsgsefelsaFSALICQLKAC  2025
             + FL ALS C++S +  LV  CLTT  WLS  LAS+    + ++ +L+AFSAL+ +LK C
Sbjct  475   RPFLAALSGCMSSPDAGLVAACLTTAGWLSRSLASTPLRDTHTDMQLAAFSALVPRLKRC  534

Query  2026  LEHGKLL---EHKVLASVCLLNFSKIP  2097
             L  G       H+VLA+V L NFSKIP
Sbjct  535   LAGGATHLHPRHRVLAAVTLHNFSKIP  561


 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLES-PDS  177
            LQ+KD  +A H L+ FC +P +ART LLP LWD +F P LSHLK W  +E     S PD+
Sbjct  7    LQKKDHSSAVHALEAFCLAPREARTVLLPALWDRLFRPGLSHLKAWRDRESAAARSKPDA  66

Query  178  KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIP  300
            + +   V+EK++ E +D GT   A YY+DWL    E  ++P
Sbjct  67   RVK--DVVEKLFVEALDEGTRALACYYRDWLLGRTEAMALP  105



>gb|KHG05796.1| Putative E3 ubiquitin-protein ligase LIN-1 [Gossypium arboreum]
Length=985

 Score =   264 bits (675),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 238/771 (31%), Positives = 368/771 (48%), Gaps = 120/771 (16%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
             L+R  RI+A+H+LQVFCDS   ART LLPDLW+++FLPHL HLK+WY KEL +L + D  
Sbjct  217   LERNHRISARHLLQVFCDSAFLARTHLLPDLWEHLFLPHLLHLKVWYHKELELLSNLDYG  276

Query  175   SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
              K +++KVL K+YN+ MD GT KFA+YYK+WL  G + P++P+V      P  +     +
Sbjct  277   EKEKRMKVLCKLYNDQMDMGTAKFAMYYKEWLKIGAKAPAVPTV------PLPSSPSFRS  330

Query  355   SVSCIVGSFSPQPVVSKKLYDEVFR--------------------HKNGVELDYYKEESY  474
             S      SF+ +  +++ LY  VF                     H    E ++  EE+Y
Sbjct  331   SRRRSSDSFASRSSINRNLYRTVFGTTELQSIELDHRIRASMDICHLQAEENEFTDEENY  390

Query  475   GGSASMSNGSVTEETHCSQIVKIEPYATCQSYSMPITEEAE--------------IQEEN  612
              G   + N + T  +  SQI     Y T ++  +P T +++              +    
Sbjct  391   NGCNYVHNMTKTRRSSSSQI-----YRTPRTDLLPETRKSDHFRLFTCQSGPTECLVNGK  445

Query  613   KLVEHFS-----DVH-PKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFF---GQQNTEES  765
              +V H S     +VH P   +     TI ++ +    +I +  + KA+    G    E +
Sbjct  446   NVVRHSSMRRKDNVHLPLSDLSRSIATICSSDNLTECEIAVRLLTKAWLESHGGPAIEAA  505

Query  766   V------------------DSERPLGLSIPTEFICP----LTGLVFEDP------VTLET  861
             +                  D    L +SI  EF+         ++  DP        L  
Sbjct  506   IAKAPVIEGILEVLFASSDDEILELAISILAEFVARSEVNRQIILNSDPHLEIFLRLLRN  565

Query  862   GQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF--S  1035
                F +AA+L +  K     P   + +    VPL    + RV++    E  Q L     S
Sbjct  566   SSLFLKAAVLLYLIK-----PKAKQMISTDWVPL----VLRVLE--FGEQLQTLFTVRCS  614

Query  1036  SQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVS  1215
              Q A       A  +L++LL   + D   +N  Q++ LGGL  LI    +G + E+   +
Sbjct  615   PQVA-------AFYVLDQLLTGFNEDRNLENASQVVSLGGLNLLIRNVEMGGVLERNNAA  667

Query  1216  ALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYF  1395
              ++S CI AD +CRN +A  I+K  LLE++     +S  + I+L+TEL+CLNRR   T F
Sbjct  668   MIISCCIRADGSCRNYVADKINKASLLELIVGNHKDSNGSVIALLTELLCLNRRTQITKF  727

Query  1396  LSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAIT  1572
             L+ L +     N   +L  YLQ +  +++ LVA ++L   LL D    +V  + A++AI 
Sbjct  728   LNDLLNGWGGLNTMHILMVYLQKAQPEERPLVAAILLQLDLLGDPLRYSVYREEAVEAIV  787

Query  1573  VALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
              AL+    ++R+ E   + L++LG  FS  G+  TE+W+L+QAGF +         E   
Sbjct  788   EALDCEKCNDRIQEQAARALMMLGGCFSYVGEATTENWLLEQAGFHETLGDSFHGKE---  844

Query  1753  PDNGRITMMDD---GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLT  1923
                    ++D+    E+E  + WQ + +  LL SG K FL ALS  +A+G   L R  L 
Sbjct  845   -------IVDEILHEEKEAIKNWQRKAAIALLNSGNKKFLAALSNSMANGIPSLARASLL  897

Query  1924  TVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCL  2076
             TVAW+SS L S      +      S L+ +L     + + +E  VLAS+ L
Sbjct  898   TVAWMSSFLHSVRDKDFQSMAC--SVLVPRLLESSNYSRAIEETVLASISL  946



>ref|XP_006603074.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X3 [Glycine max]
Length=1000

 Score =   246 bits (629),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 158/385 (41%), Positives = 227/385 (59%), Gaps = 9/385 (2%)
 Frame = +1

Query  1057  KAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCI  1236
             + E AV  LE L      ++++   K LI LG L FL  RF  GN+ EK  V +LL +CI
Sbjct  618   RDEAAVFKLESLFSSLKEEDKSTYAKHLISLGFLPFLFRRFEQGNVEEKSHVMSLLLNCI  677

Query  1237  EADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD  1416
             + DS C   IA +++K CLLE+L S+      NAI  +TE++ + RRKD T F+SGL  +
Sbjct  678   QVDSGCIYQIATSVNKKCLLELLHSKKATPTTNAILFLTEILSMKRRKDVTSFISGLAGE  737

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
              + NI  +L  YL+ S   +K L+AVL+LHF LL + Q  ++  + A++AI  AL++S  
Sbjct  738   KVFNIMHILLMYLKKSSPFEKPLIAVLLLHFDLLVEPQKFSIYREVAVNAIAEALDASLN  797

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGR---  1767
             DE+  E CC+ L+IL  HFS+ GKI T+  ILKQAG+ +     LE       + G+   
Sbjct  798   DEKGREKCCRALVILCSHFSSTGKIPTKTSILKQAGYNN---DSLEVKPPGHEEEGQRLY  854

Query  1768  ITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssv  1947
             + +  +GEE+  EE   ++   L+G G+  FL  +S CL S +++LVR CL TV W    
Sbjct  855   VAISSEGEEKRGEELLKKLLESLIGDGESPFLKNISRCLDSKHLDLVRACLITVTW--LS  912

Query  1948  lasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIG  2127
              + S    +   L AF ++I QLK  LE+G+ LE K LAS+ LLNFSKI EC+ LL  + 
Sbjct  913   SSLSMLFSAGLHLPAFLSIISQLKGILENGE-LELKTLASLSLLNFSKISECKTLLKTMA  971

Query  2128  EVIEDTLECLAEVTWVARELQTVIS  2202
             E I   L  L +VTW A++L  ++S
Sbjct  972   EDIGPLLHELDDVTWTAKQLHAIVS  996


 Score =   169 bits (427),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 108/148 (73%), Gaps = 8/148 (5%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            +Q+K++++AKH+LQVFCDSP QART LLP+LW+++F    SHLK WY K+   L    SK
Sbjct  336  MQKKNKVSAKHLLQVFCDSPFQARTVLLPELWEHLFSSQFSHLKAWYSKQAEFLVDAPSK  395

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
            +RKLK+L+KVYNE +D+GT+ FAVYYKDWLTEGVE P  PS+ IP  S  +  +++ +S+
Sbjct  396  TRKLKLLQKVYNEHLDSGTHIFAVYYKDWLTEGVESPPTPSIGIP--SASVMGSQEGSSL  453

Query  361  ------SCIVGSFSPQPVVSKKLYDEVF  426
                  +  +   SPQP+VSKKLYD +F
Sbjct  454  GYSFESASSIDPLSPQPMVSKKLYDSMF  481



>ref|XP_011001310.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Populus euphratica]
Length=995

 Score =   241 bits (615),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 210/707 (30%), Positives = 342/707 (48%), Gaps = 80/707 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
             L++ DRI+A+H+L VFCDSP  AR  LLPD+W++  LPHL HLK+WY +EL  L      
Sbjct  212   LEKNDRISARHLLYVFCDSPFLARAHLLPDIWEHFLLPHLLHLKVWYHEELEALSDSQHV  271

Query  175   SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSV---KIPFLSPQLARNE  345
              + R++K L KVYN+ MD GT +FA+YY +WL  G + P++P+V    IP  +  + R  
Sbjct  272   EEERRMKALSKVYNDRMDMGTIQFALYYNEWLKVGAKAPTVPAVPLPSIPSYATSMRRTS  331

Query  346   DP-NSVSCIVGSFSPQ----PVVSKKLYDEVFRHKNGVE----------LDYYKEESYGG  480
             D   S S I  +F  +    P + ++  D  FR++  ++          +D YK+ SY  
Sbjct  332   DSYKSRSSINTNFRYRAVFGPTLERQSKDFDFRNRASMDTWSIEEDKVCIDEYKDCSY--  389

Query  481   SASMSNGSVTEETHCSQIVKI-------EPYA-------TCQSYSMPITEEAEIQEENKL  618
              A+ +N + T     SQ   I       EP         TCQ+ S        I   +  
Sbjct  390   -ATANNKTRTTRRQSSQNYAISNHYTWHEPLKSELSRPFTCQNVSSECLGNGNIIVRSNS  448

Query  619   VEHFSDVH-PKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLS  795
             + +    H P   +     TI ++      +  I   AKA+       +S+ S    G  
Sbjct  449   IRNEETTHLPPIDLSRTISTICSSDSLTECETAIRVTAKAWL------DSIGSNVIAGAL  502

Query  796   IPTEFICPLTGLVFE--DPVTLETGQSFERAAILNWFSKGNRTCPITS--------KKLE  945
                  I  L   +F   D   LE   S     ++   ++ NR   + S        K L 
Sbjct  503   SKAPVIEGLLEFLFASTDDEVLELAISILAELVVR--NEANRLIVLNSDPQLKIFMKLLR  560

Query  946   CQAVPLSN----FILKRVIDKWRSEHWQHLLAFSSQFASDSKA---------EIAVSILE  1086
               ++ L      ++LK    +  S  W  L+    +F    +          + A+  L 
Sbjct  561   SNSLFLKVAVLLYLLKPKAKQMISLEWVALVLRVLEFGGQLQTLFTVRCMPEKAAMYFLG  620

Query  1087  KLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLI  1266
             +LL     +   +N  Q++ LGGL FL+  F +G++ E+   + L+  CI A+ + RN +
Sbjct  621   QLLTGFDEERNLENASQVVALGGLSFLVRTFEIGDIIERNHAATLMLCCIRANGSSRNYL  680

Query  1267  ARNIDKMCLLEVLCSEDLESVQNAI-SLMTELICLNRRKDATYFLSGLQSD--DIANITI  1437
             A N++K  +L+++     +  +  + +L+ +L+CL+RR     FL+GL +    +  + I
Sbjct  681   AENLNKDSILQLIVLGIQKKFKGYVFTLLADLLCLSRRTWIIKFLTGLCNGWGGLNTMHI  740

Query  1438  LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEM  1617
              L  YLQ +  +++ LVA ++L   L+ D   SN+  + A++AIT +LE      ++ E 
Sbjct  741   FL-VYLQRASPEERPLVAAVLLQLDLMGDLSQSNLYREEAVEAITESLECHNCSTKVQEQ  799

Query  1618  CCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEE  1797
               K LL+LG  FS  G+   E+W+L+QAGF +R     +S +  E  +G +    + EE+
Sbjct  800   SAKALLMLGGCFSYSGEASAEEWLLRQAGFHERLR---DSFQRKEIVDGNL----NEEED  852

Query  1798  VREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
               E+WQ +++ +LL SG K FL ALS  + +G   LV+  L TVAW+
Sbjct  853   AMEDWQGKVAVVLLNSGGKRFLSALSNSIVNGIPILVQSSLVTVAWM  899



>ref|XP_011001312.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X3 
[Populus euphratica]
Length=994

 Score =   239 bits (609),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 209/707 (30%), Positives = 341/707 (48%), Gaps = 81/707 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
             L++ DRI+A+H+L VFCDSP  AR  LLPD+W++  LPHL HLK+WY +EL  L      
Sbjct  212   LEKNDRISARHLLYVFCDSPFLARAHLLPDIWEHFLLPHLLHLKVWYHEELEALSDSQHV  271

Query  175   SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSV---KIPFLSPQLARNE  345
              + R++K L KVYN+ MD GT +FA+YY +WL  G + P++P+V    IP  +  + R  
Sbjct  272   EEERRMKALSKVYNDRMDMGTIQFALYYNEWLKVGAKAPTVPAVPLPSIPSYATSMRRTS  331

Query  346   DP-NSVSCIVGSFSPQ----PVVSKKLYDEVFRHKNGVE----------LDYYKEESYGG  480
             D   S S I  +F  +    P + ++  D  FR++  ++          +D YK+ SY  
Sbjct  332   DSYKSRSSINTNFRYRAVFGPTLERQSKDFDFRNRASMDTWSIEEDKVCIDEYKDCSY--  389

Query  481   SASMSNGSVTEETHCSQIVKI-------EPYA-------TCQSYSMPITEEAEIQEENKL  618
               + +N + T     SQ   I       EP         TCQ+ S        I   +  
Sbjct  390   --ATNNKTRTTRRQSSQNYAISNHYTWHEPLKSELSRPFTCQNVSSECLGNGNIIVRSNS  447

Query  619   VEHFSDVH-PKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLS  795
             + +    H P   +     TI ++      +  I   AKA+       +S+ S    G  
Sbjct  448   IRNEETTHLPPIDLSRTISTICSSDSLTECETAIRVTAKAWL------DSIGSNVIAGAL  501

Query  796   IPTEFICPLTGLVFE--DPVTLETGQSFERAAILNWFSKGNRTCPITS--------KKLE  945
                  I  L   +F   D   LE   S     ++   ++ NR   + S        K L 
Sbjct  502   SKAPVIEGLLEFLFASTDDEVLELAISILAELVVR--NEANRLIVLNSDPQLKIFMKLLR  559

Query  946   CQAVPLSN----FILKRVIDKWRSEHWQHLLAFSSQFASDSKA---------EIAVSILE  1086
               ++ L      ++LK    +  S  W  L+    +F    +          + A+  L 
Sbjct  560   SNSLFLKVAVLLYLLKPKAKQMISLEWVALVLRVLEFGGQLQTLFTVRCMPEKAAMYFLG  619

Query  1087  KLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLI  1266
             +LL     +   +N  Q++ LGGL FL+  F +G++ E+   + L+  CI A+ + RN +
Sbjct  620   QLLTGFDEERNLENASQVVALGGLSFLVRTFEIGDIIERNHAATLMLCCIRANGSSRNYL  679

Query  1267  ARNIDKMCLLEVLCSEDLESVQNAI-SLMTELICLNRRKDATYFLSGLQSD--DIANITI  1437
             A N++K  +L+++     +  +  + +L+ +L+CL+RR     FL+GL +    +  + I
Sbjct  680   AENLNKDSILQLIVLGIQKKFKGYVFTLLADLLCLSRRTWIIKFLTGLCNGWGGLNTMHI  739

Query  1438  LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEM  1617
              L  YLQ +  +++ LVA ++L   L+ D   SN+  + A++AIT +LE      ++ E 
Sbjct  740   FL-VYLQRASPEERPLVAAVLLQLDLMGDLSQSNLYREEAVEAITESLECHNCSTKVQEQ  798

Query  1618  CCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEE  1797
               K LL+LG  FS  G+   E+W+L+QAGF +R     +S +  E  +G +    + EE+
Sbjct  799   SAKALLMLGGCFSYSGEASAEEWLLRQAGFHERLR---DSFQRKEIVDGNL----NEEED  851

Query  1798  VREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
               E+WQ +++ +LL SG K FL ALS  + +G   LV+  L TVAW+
Sbjct  852   AMEDWQGKVAVVLLNSGGKRFLSALSNSIVNGIPILVQSSLVTVAWM  898



>ref|XP_011001311.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 isoform 
X2 [Populus euphratica]
Length=994

 Score =   239 bits (609),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 207/706 (29%), Positives = 341/706 (48%), Gaps = 79/706 (11%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
             L++ DRI+A+H+L VFCDSP  AR  LLPD+W++  LPHL HLK+WY +EL  L      
Sbjct  212   LEKNDRISARHLLYVFCDSPFLARAHLLPDIWEHFLLPHLLHLKVWYHEELEALSDSQHV  271

Query  175   SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSV---KIPFLSPQLARNE  345
              + R++K L KVYN+ MD GT +FA+YY +WL  G + P++P+V    IP  +  + R  
Sbjct  272   EEERRMKALSKVYNDRMDMGTIQFALYYNEWLKVGAKAPTVPAVPLPSIPSYATSMRRTS  331

Query  346   DP----NSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVE----------LDYYKEESYGGS  483
             D     +S++  +      P + ++  D  FR++  ++          +D YK+ SY   
Sbjct  332   DSYKSRSSINTNLYRAVFGPTLERQSKDFDFRNRASMDTWSIEEDKVCIDEYKDCSY---  388

Query  484   ASMSNGSVTEETHCSQIVKI-------EPYA-------TCQSYSMPITEEAEIQEENKLV  621
             A+ +N + T     SQ   I       EP         TCQ+ S        I   +  +
Sbjct  389   ATANNKTRTTRRQSSQNYAISNHYTWHEPLKSELSRPFTCQNVSSECLGNGNIIVRSNSI  448

Query  622   EHFSDVH-PKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSI  798
              +    H P   +     TI ++      +  I   AKA+       +S+ S    G   
Sbjct  449   RNEETTHLPPIDLSRTISTICSSDSLTECETAIRVTAKAWL------DSIGSNVIAGALS  502

Query  799   PTEFICPLTGLVFE--DPVTLETGQSFERAAILNWFSKGNRTCPITS--------KKLEC  948
                 I  L   +F   D   LE   S     ++   ++ NR   + S        K L  
Sbjct  503   KAPVIEGLLEFLFASTDDEVLELAISILAELVVR--NEANRLIVLNSDPQLKIFMKLLRS  560

Query  949   QAVPLSN----FILKRVIDKWRSEHWQHLLAFSSQFASDSKA---------EIAVSILEK  1089
              ++ L      ++LK    +  S  W  L+    +F    +          + A+  L +
Sbjct  561   NSLFLKVAVLLYLLKPKAKQMISLEWVALVLRVLEFGGQLQTLFTVRCMPEKAAMYFLGQ  620

Query  1090  LLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIA  1269
             LL     +   +N  Q++ LGGL FL+  F +G++ E+   + L+  CI A+ + RN +A
Sbjct  621   LLTGFDEERNLENASQVVALGGLSFLVRTFEIGDIIERNHAATLMLCCIRANGSSRNYLA  680

Query  1270  RNIDKMCLLEVLCSEDLESVQNAI-SLMTELICLNRRKDATYFLSGLQSD--DIANITIL  1440
              N++K  +L+++     +  +  + +L+ +L+CL+RR     FL+GL +    +  + I 
Sbjct  681   ENLNKDSILQLIVLGIQKKFKGYVFTLLADLLCLSRRTWIIKFLTGLCNGWGGLNTMHIF  740

Query  1441  LSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMC  1620
             L  YLQ +  +++ LVA ++L   L+ D   SN+  + A++AIT +LE      ++ E  
Sbjct  741   L-VYLQRASPEERPLVAAVLLQLDLMGDLSQSNLYREEAVEAITESLECHNCSTKVQEQS  799

Query  1621  CKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEV  1800
              K LL+LG  FS  G+   E+W+L+QAGF +R     +S +  E  +G +    + EE+ 
Sbjct  800   AKALLMLGGCFSYSGEASAEEWLLRQAGFHERLR---DSFQRKEIVDGNL----NEEEDA  852

Query  1801  REEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
              E+WQ +++ +LL SG K FL ALS  + +G   LV+  L TVAW+
Sbjct  853   MEDWQGKVAVVLLNSGGKRFLSALSNSIVNGIPILVQSSLVTVAWM  898



>dbj|BAG94381.1| unnamed protein product [Oryza sativa Japonica Group]
Length=714

 Score =   227 bits (578),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 159/472 (34%), Positives = 248/472 (53%), Gaps = 40/472 (8%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ KD  +A H+L+ FC +P +ARTSLLP LWD +F   LSHLK W  +E     S D++
Sbjct  235   LQEKDHSSAVHVLEAFCLAPHEARTSLLPALWDRLFRSGLSHLKAWRDRESATAASSDTR  294

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP-------FLSPQLAR  339
                +K +EK++ E +D GT   A YY+DWL    +  S+P V  P        L    + 
Sbjct  295   ---VKDVEKMFVEAVDDGTRALACYYRDWLLGRSQAMSLPVVPAPPSTVLASALRFSTST  351

Query  340   NEDPNS-VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEE  516
             + D  S V+C  GS+SP     K   DE           Y +E      A +   +   E
Sbjct  352   SYDIGSDVACSSGSYSP---AVKFALDETPSQ-------YDREIEEEEEAEVDEKTADAE  401

Query  517   THCSQIVKIEPYATCQSYSMPI-TEEAEIQEE---NKLVEHFSDVHPKPSIQEIYGTIDA  684
             +   +    EP    +SY+  + TEE E+  +   N+  E  S+        E    +  
Sbjct  402   SVFHECDGTEP----KSYTHSLQTEENELMPDKLANEASERKSEDERSRQPDESTSYV--  455

Query  685   APHSKVIKIIIERIAKAFFGQQNTEESVD-SERPLGLSIPTEFICPLTGLVFEDPVTLET  861
              P S +  I +  +   F    + +   D S+  +  +IP++F+CPLT  +F  PVT+ET
Sbjct  456   -PISDITAIDLPTLE--FCEGPDLQSDTDGSQISIFATIPSDFLCPLTRQIFNRPVTIET  512

Query  862   GQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQ  1041
             GQ+FER AI+ WF KG R CPIT ++LE  ++P  N +LKR+ID W+SEH + L + S+ 
Sbjct  513   GQTFERHAIVQWFDKGIRMCPITGQELESLSIPDINRVLKRLIDNWKSEHCKTLNSESTC  572

Query  1042  FASDSKAEIAVSILEKLLIVS-SIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
                  + E+  + +E +L       E+ +  ++L+ +GG+ FL+H+F+ G  +EK   + 
Sbjct  573   ----PEKELTATFVENVLSSECETSEKLEKARRLMAIGGIDFLLHKFHGGGEDEKAQAAE  628

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNR  1374
             LL  CI A+ +CRN +A  I    ++++L SE + +  +A+ L+ EL+CL R
Sbjct  629   LLLLCIRAEGSCRNYMAIRICNSSVVQLLHSEVISARSSAVRLLVELLCLKR  680



>ref|XP_002528126.1| hypothetical protein RCOM_0146510 [Ricinus communis]
 gb|EEF34256.1| hypothetical protein RCOM_0146510 [Ricinus communis]
Length=1050

 Score =   222 bits (565),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 153/397 (39%), Positives = 211/397 (53%), Gaps = 73/397 (18%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+KDR ++K++LQVFCDSP  ART LLP+LWD +F PHLSH+K WY +E   L +  SK
Sbjct  356  LQKKDRASSKYLLQVFCDSPFSARTILLPELWDFLFFPHLSHMKEWYNQEADSLLNTPSK  415

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +KL++L+KVYNET+D+GT +FAVYYKDWLTEGVE PS+P++ IP +S Q     +P   
Sbjct  416  IKKLELLDKVYNETLDSGTYQFAVYYKDWLTEGVEAPSLPTLHIPKMSVQEVEQLNPKDH  475

Query  361  SCIVGS----FSPQPVVSKKLYDEVFRHKN---GVELDYYKEESYGGSASMSNGSVTEET  519
            S  +      FSPQP+VSKKLY+ VF H +     E +  + ++    A++S+GS  E  
Sbjct  476  SSGLSRPSDPFSPQPMVSKKLYEAVFSHSSRPVSYEAEDGEADNLDNVATISDGSAYEVK  535

Query  520  HC----SQIVKI-------EPYATCQS----YSMPITEEAEIQEENKLVEHFSDVHPKPS  654
                   +IVK          +   Q     Y   +T E   +EE KL +    + P P 
Sbjct  536  QTIMDSPEIVKYLDQDTENGSFKDAQDNTCLYHNGLTSE---KEEWKLPK----MSPPPE  588

Query  655  IQEIY---------------GTIDAAPHSKVIKIIIERIAKAFFGQQNTEES--------  765
                Y                 ++A  H+K  + I+  +AK+    Q T++S        
Sbjct  589  SDCNYEIRSSNRQEERAGDDAMLNAFSHTKANESILMSLAKSVIELQQTDDSGVIYSKQT  648

Query  766  --VDSERPLG------------LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFS  903
              V S   L              S+P +FICPL+G +FE+PVTLETGQ+FE+ AI  W  
Sbjct  649  NVVTSCEELDGTYQYFDDGSFLASVPQDFICPLSGQIFENPVTLETGQTFEQQAIREWIR  708

Query  904  KGN-----RTCPITSKKLECQAVPLSNFILKRVIDKW  999
             G      R   + S  +E  A    N I+KR IDKW
Sbjct  709  FGELEEKIRVAALLSCCIEADA-SCRNHIIKR-IDKW  743


 Score =   219 bits (559),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 161/357 (45%), Positives = 212/357 (59%), Gaps = 49/357 (14%)
 Frame = +1

Query  1183  LGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELI  1362
              G L EK  V+ALLS CIEAD++CRN I + IDK  LLE+L S+  +S +NA+ L+TEL+
Sbjct  709   FGELEEKIRVAALLSCCIEADASCRNHIIKRIDKWGLLELLHSKQPKSRRNAVLLLTELL  768

Query  1363  CLNRRKDATYFL---SGLQ-----------------------------SDDIANITILLS  1446
             CL+R     +FL   +GL                              ++++ N   +L 
Sbjct  769   CLSR--SVIFFLVIMAGLAFKLFTWKNIPTLDNFWSLALSEVKGKEKPNEELMNAMHILL  826

Query  1447  TYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCK  1626
              YLQ+S  +Q+  VAV    F +  +          A+DAI +ALESS  DE++ E  C+
Sbjct  827   MYLQNSPPEQRPWVAVEHHKFSIYREE---------AVDAIVMALESSLTDEKVCEKTCR  877

Query  1627  GLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVRE  1806
              LL LG  FSA GK +TE W+LKQAGF   +E  L S E++   +   ++  +GEEE   
Sbjct  878   ALLALGGRFSASGKSLTESWVLKQAGFNKIYE--LNSHEEDSLCDDSFSL--EGEEETTN  933

Query  1807  EWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefel  1986
             EW   +SA LLG+GKKSFL A+S CLASGN+ L+  CL T+AWL    A S+ S +EF L
Sbjct  934   EWLRNLSASLLGNGKKSFLEAISKCLASGNLNLIEACLATIAWL--SSALSALSDAEFHL  991

Query  1987  saFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECL  2157
             SAFSALI  LK  LE+G+ +E KVLAS+ L+NFSKIPECRVLLM I E I   L  L
Sbjct  992   SAFSALISGLKESLENGEQIELKVLASMSLINFSKIPECRVLLMTIAEEIAVPLRAL  1048



>ref|XP_010317000.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Solanum lycopersicum]
Length=1004

 Score =   219 bits (559),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 235/808 (29%), Positives = 385/808 (48%), Gaps = 113/808 (14%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
             L++ DRIAA+H+LQVF DSP  ART LLP+LW+++FLPHL HLKIW+ +EL +L S D  
Sbjct  214   LEKNDRIAARHLLQVFVDSPCIARTHLLPELWEHLFLPHLLHLKIWHTQELEVLSSSDYA  273

Query  175   SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF---LSPQLARNE  345
              K + +KVL K+YN+ +D GT KFA+YYK WL  G + P++PSV +P     S    R+ 
Sbjct  274   EKEKHMKVLNKLYNDHVDIGTTKFALYYKQWLKVGAQAPAVPSVPLPSKVGYSTSRRRSM  333

Query  346   DPNSVSCIVGSFSPQ-----PVVSKKLYDEVFRHKNGVELDY--------------YKEE  468
             D  + +  V + S       P+  +K  D+    +NG+  DY              +K+ 
Sbjct  334   DSVTSNSSVKNNSLYRAVFGPITERKSMDDA---RNGI-WDYEEDEKEKILSIGDDFKQS  389

Query  469   SYG--------GSASMSNGSVTEET--HCSQIVKIEPYATCQSY-------------SMP  579
             +Y          S+S SN +   +   H  +     PY +CQS              S+ 
Sbjct  390   NYSPKKTVVHRRSSSQSNRTPKHDQWDHTHKKSDRFPYFSCQSEPVECLREGNSKIGSVS  449

Query  580   ITEEAEI--QEENKLVEHFSDVHPKPSIQEIYGTI--------DAAPHSKVIKI-----I  714
             I +E EI     N L      +    S+ E    I        D+    + +K      +
Sbjct  450   IRKEEEIIPSVSNDLSRAIFAICSSDSLSECELAIRLVAKSWLDSHGDLETVKRLSTTPV  509

Query  715   IERIAKAFFGQQNTEESVDSERPLGLSIPTEFIC--PLTGLVFEDPVT--------LETG  864
             IE I    F  ++     D    L +SI  E +      G +  +  +        L + 
Sbjct  510   IEGIVNVLFASED-----DEILELAISILAELVTRKETNGQIILNSDSQLDIFLRLLRSS  564

Query  865   QSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQF  1044
               F +AAIL +  +     P   + +  + +PL   +L+             +L F+ Q 
Sbjct  565   SLFLKAAILLYLVQ-----PKAKQMISIEWIPL---VLR-------------VLEFADQL  603

Query  1045  AS-----DSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKC  1209
              +      S  E A  +L++LL     D+  +N +Q+I LGGL  L+ R   GN++EK  
Sbjct  604   QTLFTVQRSPQEAAYYLLDQLLTGFDEDKNFENCRQVISLGGLSLLLRRVETGNVSEKSK  663

Query  1210  VSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAI-SLMTELICLNRRKDA  1386
             V++++  C+++D +CR+ +A+N++K CLL +L  ++  + +  + +L+T+L+C++++   
Sbjct  664   VASVMYYCVQSDGSCRHYLAKNLNKDCLLPLLLLQNQHNTRGHVFALLTDLLCIDKQIQR  723

Query  1387  TYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAID  1563
               FL GL S   + N   +L  YLQ +  +++ +++ ++L   LL D    +V  +  I+
Sbjct  724   IEFLRGLLSGWGMVNALHILLLYLQRAQQEERPVISAILLQLDLLGDPNECSVYREEVIE  783

Query  1564  AITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE  1743
              I  AL     +E++     + LLILG  FS  G+ + E  +LK+AG+ D    D     
Sbjct  784   EIIKALNCQVFNEKVQVQSARALLILGSCFSYAGEPVVEQCLLKEAGY-DENAGD-SYLG  841

Query  1744  DNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLT  1923
              N   N    +  + EEE    WQ + + +LL SG K  L  L   +A+G   L R  L 
Sbjct  842   KNFILNSHTNLFQNEEEEATRNWQRKTAIVLLNSGNKRLLSGLVDSIANGIPCLGRASLV  901

Query  1924  TVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPEC  2103
             TV W+              +   +S LI +L   L++   +E +VLAS+ LL  +   + 
Sbjct  902   TVTWM--SNFFCFIEDKGVQSLVYSELIPELIKLLKYNNAIEERVLASLSLLKLANNSDY  959

Query  2104  RVLLMMIGEVIEDTLECLAEVTWVAREL  2187
                L  + + + + L  L+EVTW A+EL
Sbjct  960   LAKLSPLDKELINDLHQLSEVTWTAKEL  987



>ref|XP_004233209.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Solanum lycopersicum]
Length=1002

 Score =   216 bits (550),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 234/815 (29%), Positives = 390/815 (48%), Gaps = 129/815 (16%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
             L++ DRIAA+H+LQVF DSP  ART LLP+LW+++FLPHL HLKIW+ +EL +L S D  
Sbjct  214   LEKNDRIAARHLLQVFVDSPCIARTHLLPELWEHLFLPHLLHLKIWHTQELEVLSSSDYA  273

Query  175   SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF---LSPQLARNE  345
              K + +KVL K+YN+ +D GT KFA+YYK WL  G + P++PSV +P     S    R+ 
Sbjct  274   EKEKHMKVLNKLYNDHVDIGTTKFALYYKQWLKVGAQAPAVPSVPLPSKVGYSTSRRRSM  333

Query  346   DPNSVSCIVGSFSPQ-----PVVSKKLYDEVFRHKNGVELDY--------------YKEE  468
             D  + +  V + S       P+  +K  D+    +NG+  DY              +K+ 
Sbjct  334   DSVTSNSSVKNNSLYRAVFGPITERKSMDDA---RNGI-WDYEEDEKEKILSIGDDFKQS  389

Query  469   SYG--------GSASMSNGSVTEET--HCSQIVKIEPYATCQSY-------------SMP  579
             +Y          S+S SN +   +   H  +     PY +CQS              S+ 
Sbjct  390   NYSPKKTVVHRRSSSQSNRTPKHDQWDHTHKKSDRFPYFSCQSEPVECLREGNSKIGSVS  449

Query  580   ITEEAEI--QEENKLVEHFSDVHPKPSIQEIYGTI--------DAAPHSKVIKI-----I  714
             I +E EI     N L      +    S+ E    I        D+    + +K      +
Sbjct  450   IRKEEEIIPSVSNDLSRAIFAICSSDSLSECELAIRLVAKSWLDSHGDLETVKRLSTTPV  509

Query  715   IERIAKAFFGQQNTEESVDSERPLGLSIPTEFIC--PLTGLVFEDPVT--------LETG  864
             IE I    F  ++     D    L +SI  E +      G +  +  +        L + 
Sbjct  510   IEGIVNVLFASED-----DEILELAISILAELVTRKETNGQIILNSDSQLDIFLRLLRSS  564

Query  865   QSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQF  1044
               F +AAIL +  +     P   + +  + +PL   +L+             +L F+ Q 
Sbjct  565   SLFLKAAILLYLVQ-----PKAKQMISIEWIPL---VLR-------------VLEFADQL  603

Query  1045  AS-----DSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKC  1209
              +      S  E A  +L++LL     D+  +N +Q+I LGGL  L+ R   GN++EK  
Sbjct  604   QTLFTVQRSPQEAAYYLLDQLLTGFDEDKNFENCRQVISLGGLSLLLRRVETGNVSEKSK  663

Query  1210  VSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAI-SLMTELICLNRRKDA  1386
             V++++  C+++D +CR+ +A+N++K CLL +L  ++  + +  + +L+T+L+C++++   
Sbjct  664   VASVMYYCVQSDGSCRHYLAKNLNKDCLLPLLLLQNQHNTRGHVFALLTDLLCIDKQIQR  723

Query  1387  TYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAID  1563
               FL GL S   + N   +L  YLQ +  +++ +++ ++L   LL D    +V  +  I+
Sbjct  724   IEFLRGLLSGWGMVNALHILLLYLQRAQQEERPVISAILLQLDLLGDPNECSVYREEVIE  783

Query  1564  AITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE  1743
              I  AL     +E++     + LLILG  FS  G+ + E  +LK+AG+           +
Sbjct  784   EIIKALNCQVFNEKVQVQSARALLILGSCFSYAGEPVVEQCLLKEAGY-----------D  832

Query  1744  DNEPDN--GRITMMD-----DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIE  1902
             +N  D+  G+  +++     + EEE    WQ + + +LL SG K  L  L   +A+G   
Sbjct  833   ENAGDSYLGKNFILNSHTNLNEEEEATRNWQRKTAIVLLNSGNKRLLSGLVDSIANGIPC  892

Query  1903  LVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLN  2082
             L R  L TV W+              +   +S LI +L   L++   +E +VLAS+ LL 
Sbjct  893   LGRASLVTVTWM--SNFFCFIEDKGVQSLVYSELIPELIKLLKYNNAIEERVLASLSLLK  950

Query  2083  FSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
              +   +    L  + + + + L  L+EVTW A+EL
Sbjct  951   LANNSDYLAKLSPLDKELINDLHQLSEVTWTAKEL  985



>gb|EAZ21883.1| hypothetical protein OsJ_05535 [Oryza sativa Japonica Group]
Length=922

 Score =   214 bits (546),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 209/379 (55%), Gaps = 18/379 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNE-KKCVSALLSSCIEAD  1245
             A+  L++LL+   +D   +N KQ+I LGGL  L++R +  +  E KKC+S LL+SCI+AD
Sbjct  550   ALYFLDQLLMGFDVDRNVENAKQMIALGGLDLLMNRIDGSDSRESKKCIS-LLTSCIQAD  608

Query  1246  SNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
              +CR+ +  N+ K  ++++L     ++   A++L++EL+CLNR      FL  L++    
Sbjct  609   GSCRHYLVDNLKKEPIVQLLVGNQKKASSAALNLLSELVCLNRTTQILEFLKELKNGGCL  668

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             N   +L  YLQ +   Q  L AV++L   LL D+   +V  + AIDA+  ALE      +
Sbjct  669   NTMHILLVYLQQAPIAQHPLAAVMLLQLDLLGDSSQYSVYREEAIDAMVAALEHGSHSRK  728

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
             L E C + LL+L   FS+ G+ + E W+LK+AG  D        TE  +  + R+     
Sbjct  729   LQEQCARALLLLAGRFSSSGEPIAEAWLLKRAGLDDSLSESFRRTEIFKDKSARVE----  784

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EE++ EE   +++ MLL SG K FL ALS C++ G   L R CL TV W+      SS 
Sbjct  785   -EEKIVEERLKKLALMLLNSGNKKFLTALSNCISDGIPSLARACLITVTWM------SSS  837

Query  1966  sgsefelsaFSALICQLKAC-----LEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGE  2130
                    + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   L  + +
Sbjct  838   LSPLHGCNTFQPLACSILATKLVDSLSYDRVLEERVLASLSLLNLVRHPECLEKLYPLKK  897

Query  2131  VIEDTLECLAEVTWVAREL  2187
                ++L+ LAEVTW A+EL
Sbjct  898   DTVESLQDLAEVTWTAKEL  916


 Score =   123 bits (309),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R D ++A+H+LQVF D+P  AR +LLPDLWD++FLPHL HLK+W+  E  +  +PD +
Sbjct  149  MERNDHVSARHLLQVFVDAPYLARKNLLPDLWDHVFLPHLLHLKVWFTAEADL--APDDR  206

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG  279
            SR++K L+++YN+ +++GT +FA+YYK+WL  G
Sbjct  207  SRRMKTLQRLYNDHLNSGTAQFAIYYKEWLKSG  239



>emb|CAE04155.2| OSJNBa0088A01.24 [Oryza sativa Japonica Group]
Length=879

 Score =   214 bits (544),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 152/452 (34%), Positives = 235/452 (52%), Gaps = 40/452 (9%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ KD  +A H+L+ FC +P +ARTSLLP LWD +F   LSHLK W  +E     S D++
Sbjct  235   LQEKDHSSAVHVLEAFCLAPHEARTSLLPALWDRLFRSGLSHLKAWRDRESATAASSDTR  294

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP-------FLSPQLAR  339
                +K +EK++ E +D GT   A YY+DWL    +  S+P V  P        L    + 
Sbjct  295   ---VKDVEKMFVEAVDDGTRALACYYRDWLLGRSQAMSLPVVPAPPSTVLASALRFSTST  351

Query  340   NEDPNS-VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEE  516
             + D  S V+C  GS+SP     K   DE           Y +E      A +   +   E
Sbjct  352   SYDIGSDVACSSGSYSP---AVKFALDETPSQ-------YDREIEEEEEAEVDEKTADAE  401

Query  517   THCSQIVKIEPYATCQSYSMPI-TEEAEIQEE---NKLVEHFSDVHPKPSIQEIYGTIDA  684
             +   +    EP    +SY+  + TEE E+  +   N+  E  S+        E    +  
Sbjct  402   SVFHECDGTEP----KSYTHSLQTEENELMPDKLANEASERKSEDERSRQPDESTSYV--  455

Query  685   APHSKVIKIIIERIAKAFFGQQNTEESVD-SERPLGLSIPTEFICPLTGLVFEDPVTLET  861
              P S +  I +  +   F    + +   D S+  +  +IP++F+CPLT  +F  PVT+ET
Sbjct  456   -PISDITAIDLPTLE--FCEGPDLQSDTDGSQISIFATIPSDFLCPLTRQIFNRPVTIET  512

Query  862   GQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQ  1041
             GQ+FER AI+ WF KG R CPIT ++LE  ++P  N +LKR+ID W+SEH + L + S+ 
Sbjct  513   GQTFERHAIVQWFDKGIRMCPITGQELESLSIPDINRVLKRLIDNWKSEHCKTLNSESTC  572

Query  1042  FASDSKAEIAVSILEKLLIVS-SIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
                  + E+  + +E +L       E+ +  ++L+ +GG+ FL+H+F+ G  +EK   + 
Sbjct  573   ----PEKELTATFVENVLSSECETSEKLEKARRLMAIGGIDFLLHKFHGGGEDEKAQAAE  628

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSE  1314
             LL  CI A+ +CRN +A  I    ++++L SE
Sbjct  629   LLLLCIRAEGSCRNYMAIRICNSSVVQLLHSE  660


 Score =   145 bits (367),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 126/210 (60%), Gaps = 12/210 (6%)
 Frame = +1

Query  1567  ITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTED  1746
             IT +L  S  +E ++    K LL+LG HFS  G ++ ED +LKQAGF+D        ++ 
Sbjct  677   ITHSLRCSLSEENVVANIRKALLLLGGHFSFSGDLLAEDRMLKQAGFVDGSRVTRADSDA  736

Query  1747  NEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTT  1926
                D GR       E+EV   W   ++A LLGSG++ FL ALSMC++S N +L  VCLTT
Sbjct  737   AVQDKGR------DEDEV---WLRDVTAALLGSGRRPFLEALSMCMSSPNHDLAAVCLTT  787

Query  1927  VAWLssvlasssrsgsefelsaFSALICQLKACLEHGK-LLEHKVLASVCLLNFSKIPEC  2103
              AWLS  LAS   +  +     FSALI +LK  L   +   +H+VLASV L NFSKIP+C
Sbjct  788   AAWLSRSLASIDAADVQLAA--FSALIPRLKQRLAGDRSQAQHRVLASVTLYNFSKIPDC  845

Query  2104  RVLLMMIGEVIEDTLECLAEVTWVARELQT  2193
             R LLM++ + + D L  LAE+TW A +L T
Sbjct  846   RALLMLLADGLRDHLVELAELTWTAGQLIT  875



>ref|XP_010233875.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Brachypodium distachyon]
Length=607

 Score =   210 bits (535),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 135/378 (36%), Positives = 202/378 (53%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL    +D   +N  Q+I LGGL  L+ R  +G+  E K   +LL+SCI+AD 
Sbjct  230   AFYFLDQLLTGFDVDRNVENANQMIALGGLDMLMRRLEIGDTRESKICISLLNSCIQADG  289

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR+ +A N+ K  ++++L     ++   A++L+TELICLNR      FL  L++    N
Sbjct  290   SCRSYLADNLKKEPVVQLLIGNHKKASAAALNLLTELICLNRATHMVEFLKELKNGGCLN  349

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L A+++L   LL D    +V  +  IDAIT ALE S    ++
Sbjct  350   TMQILLVYLQQAPLVQHPLAAIMLLQLDLLGDPLQYSVYREEGIDAITAALEHSSHSRKV  409

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LL+L   FS+ GK + E W+LK+AG           TE  +  + R       
Sbjct  410   QEQCARALLLLAGRFSSSGKPIAEAWLLKRAGLDGSLSESFRRTEIFKNKSARAE-----  464

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE+V EE   +++ MLL +G K FL ALS C++ G   LVR CL T+ W+      SS  
Sbjct  465   EEKVVEERLKKLALMLLNTGNKRFLVALSNCISDGIPALVRACLVTITWM------SSSL  518

Query  1969  gsefelsaFSALICQLKA-----CLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   L+ + + 
Sbjct  519   SPLHGCNTFQPLACSILAPKLLDSLSYDRVLEERVLASLSLLNLVRHPECLEKLLPLKKD  578

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L  L E+TW A+EL
Sbjct  579   TVESLRDLTEMTWTAKEL  596



>gb|EEC72569.1| hypothetical protein OsI_06007 [Oryza sativa Indica Group]
Length=977

 Score =   214 bits (545),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 209/379 (55%), Gaps = 18/379 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNE-KKCVSALLSSCIEAD  1245
             A+  L++LL+   +D   +N KQ+I LGGL  L++R +  +  E KKC+S LL+SCI+AD
Sbjct  605   ALYFLDQLLMGFDVDRNVENAKQMIALGGLDLLMNRIDGSDSRESKKCIS-LLTSCIQAD  663

Query  1246  SNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
              +CR+ +  N+ K  ++++L     ++   A++L++EL+CLNR      FL  L++    
Sbjct  664   GSCRHYLVDNLKKEPIVQLLVGNQKKASSAALNLLSELVCLNRTTQILEFLKELKNGGCL  723

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             N   +L  YLQ +   Q  L AV++L   LL D+   +V  + AIDA+  ALE      +
Sbjct  724   NTMHILLVYLQQAPIAQHPLAAVMLLQLDLLGDSSQYSVYREEAIDAMVAALEHGSHSRK  783

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
             L E C + LL+L   FS+ G+ + E W+LK+AG  D        TE  +  + R+     
Sbjct  784   LQEQCARALLLLAGRFSSSGEPIAEAWLLKRAGLDDSLSESFRRTEIFKDKSARVE----  839

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EE++ EE   +++ MLL SG K FL ALS C++ G   L R CL TV W+      SS 
Sbjct  840   -EEKIVEERLKKLALMLLNSGNKKFLTALSNCISDGIPSLARACLITVTWM------SSS  892

Query  1966  sgsefelsaFSALICQLKAC-----LEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGE  2130
                    + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   L  + +
Sbjct  893   LSPLHGCNTFQPLACSILATKLVDSLSYDRVLEERVLASLSLLNLVRHPECLEKLYPLKK  952

Query  2131  VIEDTLECLAEVTWVAREL  2187
                ++L+ LAEVTW A+EL
Sbjct  953   DTVESLQDLAEVTWTAKEL  971


 Score =   123 bits (309),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R D ++A+H+LQVF D+P  AR +LLPDLWD++FLPHL HLK+W+  E  +  +PD +
Sbjct  204  MERNDHVSARHLLQVFVDAPYLARKNLLPDLWDHVFLPHLLHLKVWFTAEADL--APDDR  261

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG  279
            SR++K L+++YN+ +++GT +FA+YYK+WL  G
Sbjct  262  SRRMKTLQRLYNDHLNSGTAQFAIYYKEWLKSG  294



>ref|XP_010233874.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Brachypodium distachyon]
Length=676

 Score =   211 bits (537),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 135/378 (36%), Positives = 202/378 (53%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL    +D   +N  Q+I LGGL  L+ R  +G+  E K   +LL+SCI+AD 
Sbjct  299   AFYFLDQLLTGFDVDRNVENANQMIALGGLDMLMRRLEIGDTRESKICISLLNSCIQADG  358

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR+ +A N+ K  ++++L     ++   A++L+TELICLNR      FL  L++    N
Sbjct  359   SCRSYLADNLKKEPVVQLLIGNHKKASAAALNLLTELICLNRATHMVEFLKELKNGGCLN  418

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L A+++L   LL D    +V  +  IDAIT ALE S    ++
Sbjct  419   TMQILLVYLQQAPLVQHPLAAIMLLQLDLLGDPLQYSVYREEGIDAITAALEHSSHSRKV  478

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LL+L   FS+ GK + E W+LK+AG           TE  +  + R       
Sbjct  479   QEQCARALLLLAGRFSSSGKPIAEAWLLKRAGLDGSLSESFRRTEIFKNKSARAE-----  533

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE+V EE   +++ MLL +G K FL ALS C++ G   LVR CL T+ W+      SS  
Sbjct  534   EEKVVEERLKKLALMLLNTGNKRFLVALSNCISDGIPALVRACLVTITWM------SSSL  587

Query  1969  gsefelsaFSALICQLKA-----CLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   L+ + + 
Sbjct  588   SPLHGCNTFQPLACSILAPKLLDSLSYDRVLEERVLASLSLLNLVRHPECLEKLLPLKKD  647

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L  L E+TW A+EL
Sbjct  648   TVESLRDLTEMTWTAKEL  665



>ref|XP_006648350.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Oryza 
brachyantha]
Length=775

 Score =   211 bits (537),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 209/379 (55%), Gaps = 18/379 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNE-KKCVSALLSSCIEAD  1245
             A+ +L++LL+   +D   +N KQ+I LGGL  L++R +  +  E KKC+S LL SCI+AD
Sbjct  403   ALYLLDQLLMGFDVDRNVENAKQMIALGGLDLLMNRIDGSDSRESKKCIS-LLISCIQAD  461

Query  1246  SNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
              +CR+ +   + K  ++++L     ++   A++L++EL+CLNR      FL  L++    
Sbjct  462   GSCRHYLVEKLKKEPIVQLLVGNQKKTSAAALNLLSELVCLNRTTQILEFLKELKNGGCL  521

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             N   +L  YLQ +   Q  L AV++L   LL D+   +V  + AIDA+  ALE S    +
Sbjct  522   NTMHILLVYLQQAPISQHPLAAVMLLQLDLLGDSSQYSVYREEAIDAMVAALERSSHSRK  581

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
             L E C + LL+L   FS+ G+ + E W+LK+AG  D        TE  +  + R+     
Sbjct  582   LQEQCARALLLLAGRFSSSGEPIAEAWLLKRAGLDDSLSESFRRTEIFKDKSARVE----  637

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EE++ EE   +++ MLL SG K FL ALS C++ G   L R CL TV W+      SS 
Sbjct  638   -EEKIVEERLKKLALMLLNSGNKKFLTALSNCISDGIPSLARACLITVTWM------SSS  690

Query  1966  sgsefelsaFSALICQLKAC-----LEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGE  2130
                    + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   L  + +
Sbjct  691   LSPLHGCNTFQPLACSILATKLLDSLSYDRVLEERVLASLSLLNLVRHPECLEKLFPLKK  750

Query  2131  VIEDTLECLAEVTWVAREL  2187
                ++L+ LAEVTW A+EL
Sbjct  751   DTMESLQDLAEVTWTAKEL  769


 Score =   119 bits (297),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLE--SPD  174
            ++R D ++A+H+LQVF D+P  AR +LLPDLWD++FLPHL HLK+W+  E  ++     D
Sbjct  1    MERNDHVSARHLLQVFVDAPYLARKNLLPDLWDHVFLPHLLHLKVWFTGEADLVADWDAD  60

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
             +SR++K L+++YN+ ++ GT +FA+YYK+WL  G E
Sbjct  61   DRSRRMKSLQRLYNDHLNNGTAQFALYYKEWLKSGAE  97



>ref|NP_001132610.1| uncharacterized protein LOC100194083 [Zea mays]
 gb|ACF81528.1| unknown [Zea mays]
Length=460

 Score =   205 bits (521),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 132/378 (35%), Positives = 204/378 (54%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+   +D   +N KQ+I LGGL  LI R   G+  E +   ALL++C++AD 
Sbjct  88    AFYFLDQLLMGFDVDRNVENAKQMIALGGLDLLIGRLGAGDARESRHCIALLTTCVQADG  147

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR+ +A ++ K  L+++L     ++   +++LM+EL+CLNR      F+  L++    N
Sbjct  148   SCRHYLADSLKKEPLVQLLAGNQRKASAASLNLMSELVCLNRTSKIVEFVKELKNSGCLN  207

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L A ++L   LL D    +V  + AI+AI  ALE S    ++
Sbjct  208   TMHVLLVYLQQAPLVQHPLAATMLLQLDLLGDPSQYSVYREEAIEAIVAALEHSSQSRKV  267

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LLIL   FS+ G+ + E W+LK+AG  D        +E  +  + R       
Sbjct  268   QEQCARALLILAGRFSSSGEPVAEAWLLKRAGLDDSLSESFRRSEVFKDKSVRAE-----  322

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE++ EE Q  ++ MLL SG + FL ALS C++ G   L R CL +VAW+      SS  
Sbjct  323   EEKLVEERQKNLALMLLKSGGRRFLTALSSCISDGTPSLSRSCLVSVAWM------SSSL  376

Query  1969  gsefelsaFSALICQLKA-----CLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   +  + + 
Sbjct  377   SPLRGCNDFQPLACSVLASKLLDSLSYDRVLEERVLASLSLLNVVRHPECMEKVFPLKKE  436

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L+ LAEVTW A+EL
Sbjct  437   TIESLQDLAEVTWTAKEL  454



>dbj|BAD25713.1| transducin-like [Oryza sativa Japonica Group]
Length=986

 Score =   212 bits (539),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 139/388 (36%), Positives = 211/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNE-KKCVSALLSSCIEAD  1245
             A+  L++LL+   +D   +N KQ+I LGGL  L++R +  +  E KKC+S LL+SCI+AD
Sbjct  605   ALYFLDQLLMGFDVDRNVENAKQMIALGGLDLLMNRIDGSDSRESKKCIS-LLTSCIQAD  663

Query  1246  SNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATY---------FL  1398
              +CR+ +  N+ K  ++++L     ++   A++L++EL+CLNR  D T          FL
Sbjct  664   GSCRHYLVDNLKKEPIVQLLVGNQKKASSAALNLLSELVCLNRYNDYTLLIRTTQILEFL  723

Query  1399  SGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
               L++    N   +L  YLQ +   Q  L AV++L   LL D+   +V  + AIDA+  A
Sbjct  724   KELKNGGCLNTMHILLVYLQQAPIAQHPLAAVMLLQLDLLGDSSQYSVYREEAIDAMVAA  783

Query  1579  LESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPD  1758
             LE      +L E C + LL+L   FS+ G+ + E W+LK+AG  D        TE  +  
Sbjct  784   LEHGSHSRKLQEQCARALLLLAGRFSSSGEPIAEAWLLKRAGLDDSLSESFRRTEIFKDK  843

Query  1759  NGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
             + R+      EE++ EE   +++ MLL SG K FL ALS C++ G   L R CL TV W+
Sbjct  844   SARVE-----EEKIVEERLKKLALMLLNSGNKKFLTALSNCISDGIPSLARACLITVTWM  898

Query  1939  ssvlasssrsgsefelsaFSALICQLKAC-----LEHGKLLEHKVLASVCLLNFSKIPEC  2103
                   SS        + F  L C + A      L + ++LE +VLAS+ LLN  + PEC
Sbjct  899   ------SSSLSPLHGCNTFQPLACSILATKLVDSLSYDRVLEERVLASLSLLNLVRHPEC  952

Query  2104  RVLLMMIGEVIEDTLECLAEVTWVAREL  2187
                L  + +   ++L+ LAEVTW A+EL
Sbjct  953   LEKLYPLKKDTVESLQDLAEVTWTAKEL  980


 Score =   123 bits (309),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R D ++A+H+LQVF D+P  AR +LLPDLWD++FLPHL HLK+W+  E  +  +PD +
Sbjct  204  MERNDHVSARHLLQVFVDAPYLARKNLLPDLWDHVFLPHLLHLKVWFTAEADL--APDDR  261

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG  279
            SR++K L+++YN+ +++GT +FA+YYK+WL  G
Sbjct  262  SRRMKTLQRLYNDHLNSGTAQFAIYYKEWLKSG  294



>ref|XP_009393279.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=988

 Score =   210 bits (535),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 143/373 (38%), Positives = 208/373 (56%), Gaps = 7/373 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +LE+LL+   +D   +N KQL+ LGGL  LI R   G+  E +  ++LL+ CI AD 
Sbjct  617   AFYLLEQLLMGFDVDRNVENSKQLVALGGLDLLIRRLEAGDAQESRNCASLLARCIRADG  676

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR  +A NI K  ++++L ++  +S  +AISL++EL+CLNR       L  L+ D   N
Sbjct  677   SCRQYLAMNIKKTPIVQLLGNQQ-KSHGSAISLLSELLCLNRTTQIMTLLKELKDDGFLN  735

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
             I  +L  YL  +  +Q+ + A L+L   LL D    ++  + AIDA+  ALE +  ++++
Sbjct  736   IMHVLLVYLHQAPLEQRPVAAALLLQLDLLGDPLQYSIHREEAIDALIAALERNLHNKKI  795

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LL+LG  FS  G+  +E W+LK+AG  D       S E    DN     M   
Sbjct  796   QEKCSRALLLLGGRFSCSGEATSEAWLLKRAGLHDSLSDSFRSKEIFVDDN-----MRPE  850

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE+V EEW  +++ +LL SG K FL ALS C+A G   L R CL TVAW+SS L S    
Sbjct  851   EEKVTEEWLRKLAIVLLSSGNKRFLVALSNCMADGIPGLARSCLVTVAWMSSSLVSWHNV  910

Query  1969  gsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTL  2148
                  L   S L  +L   L + +  E +VLAS+ L NF + PEC   L  + +    +L
Sbjct  911   NHLQSLVC-STLAPRLFESLSYHRAQEERVLASLSLFNFVRYPECLPKLFPMDKETICSL  969

Query  2149  ECLAEVTWVAREL  2187
             + LA+VTW A+EL
Sbjct  970   QDLAQVTWTAKEL  982


 Score =   115 bits (288),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R DR++AKH+LQVF D+P  AR +LLPDLWD+  LPHL HLK+WY KE+ ++ S D++
Sbjct  216  IERNDRVSAKHLLQVFVDAPYLARKNLLPDLWDHFLLPHLLHLKVWYNKEVELVASWDAE  275

Query  181  SR--KLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             R  ++K L + YN+ MD GT +FAVYY+DW+  G + P +P+V +P
Sbjct  276  DRDQRMKGLNRAYNDQMDAGTAQFAVYYRDWIKSGGKAPPVPTVSLP  322



>ref|XP_004228687.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 [Solanum 
lycopersicum]
 ref|XP_010315977.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 [Solanum 
lycopersicum]
 ref|XP_010315982.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 [Solanum 
lycopersicum]
Length=448

 Score =   202 bits (514),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 113/143 (79%), Gaps = 2/143 (1%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            +Q KDRIAAKH+LQVFCDSP QARTSLLPDLWD +FLPHLSHLK+W+  E   L    +K
Sbjct  277  IQNKDRIAAKHLLQVFCDSPFQARTSLLPDLWDRVFLPHLSHLKVWHDSEANFLRDLRNK  336

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
            SRKLK+L+K+Y E +D GT  FAVYYKDWLTEG E P +PS++IP +S  ++R    +++
Sbjct  337  SRKLKLLDKLYTENLDKGTYLFAVYYKDWLTEGAEIPLLPSIQIPSIS--VSRQGSFSNL  394

Query  361  SCIVGSFSPQPVVSKKLYDEVFR  429
            S  VG FSPQPVVSKKLYDEVFR
Sbjct  395  SSSVGGFSPQPVVSKKLYDEVFR  417



>gb|EAZ31770.1| hypothetical protein OsJ_15922 [Oryza sativa Japonica Group]
Length=850

 Score =   208 bits (530),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 149/448 (33%), Positives = 233/448 (52%), Gaps = 61/448 (14%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ KD  +A H+L+ FC +P +ARTSLLP LWD +F   LSHLK W  +E     S D++
Sbjct  235   LQEKDHSSAVHVLEAFCLAPHEARTSLLPALWDRLFRSGLSHLKAWRDRESATAASSDTR  294

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWL---TEGVEPPSIPSVKIPFLSPQL----AR  339
                +K +EK++ E +D GT   A YY+DWL   ++ +  P +P+     L+  L    + 
Sbjct  295   ---VKDVEKMFVEAVDDGTRALACYYRDWLLGRSQAMSLPVVPAPPSTVLASALRFSTST  351

Query  340   NEDPNS-VSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEE  516
             + D  S V+C  GS+S  P V K   DE           Y +E      A +   +   E
Sbjct  352   SYDIGSDVACSSGSYS--PAV-KFALDETPSQ-------YDREIEEEEEAEVDEKTADAE  401

Query  517   THCSQIVKIEPYATCQSYSMPI-TEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPH  693
             +   +    EP    +SY+  + TEE E+   +KL    S+                   
Sbjct  402   SVFHECDGTEP----KSYTHSLQTEENELMP-DKLANEASER------------------  438

Query  694   SKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSF  873
                 K++ E       G     ++  S+  +  +IP++F+CPLT  +F  PVT+ETGQ+F
Sbjct  439   ----KLLSE-------GPDLQSDTDGSQISIFATIPSDFLCPLTRQIFNRPVTIETGQTF  487

Query  874   ERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASD  1053
             ER AI+ WF KG R CPIT ++LE  ++P  N +LKR+ID W+SEH + L + S+     
Sbjct  488   ERHAIVQWFDKGIRMCPITGQELESLSIPDINRVLKRLIDNWKSEHCKTLNSESTC----  543

Query  1054  SKAEIAVSILEKLLIVS-SIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSS  1230
              + E+  + +E +L       E+ +  ++L+ +GG+ FL+H+F+ G  +EK   + LL  
Sbjct  544   PEKELTATFVENVLSSECETSEKLEKARRLMAIGGIDFLLHKFHGGGEDEKAQAAELLLL  603

Query  1231  CIEADSNCRNLIARNIDKMCLLEVLCSE  1314
             CI A+ +CRN +A  I    ++++L SE
Sbjct  604   CIRAEGSCRNYMAIRICNSSVVQLLHSE  631


 Score =   145 bits (367),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 126/210 (60%), Gaps = 12/210 (6%)
 Frame = +1

Query  1567  ITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTED  1746
             IT +L  S  +E ++    K LL+LG HFS  G ++ ED +LKQAGF+D        ++ 
Sbjct  648   ITHSLRCSLSEENVVANIRKALLLLGGHFSFSGDLLAEDRMLKQAGFVDGSRVTRADSDA  707

Query  1747  NEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTT  1926
                D GR       E+EV   W   ++A LLGSG++ FL ALSMC++S N +L  VCLTT
Sbjct  708   AVQDKGR------DEDEV---WLRDVTAALLGSGRRPFLEALSMCMSSPNHDLAAVCLTT  758

Query  1927  VAWLssvlasssrsgsefelsaFSALICQLKACLEHGK-LLEHKVLASVCLLNFSKIPEC  2103
              AWLS  LAS   +  +     FSALI +LK  L   +   +H+VLASV L NFSKIP+C
Sbjct  759   AAWLSRSLASIDAADVQLAA--FSALIPRLKQRLAGDRSQAQHRVLASVTLYNFSKIPDC  816

Query  2104  RVLLMMIGEVIEDTLECLAEVTWVARELQT  2193
             R LLM++ + + D L  LAE+TW A +L T
Sbjct  817   RALLMLLADGLRDHLVELAELTWTAGQLIT  846



>gb|AFW70260.1| hypothetical protein ZEAMMB73_152824 [Zea mays]
Length=994

 Score =   208 bits (530),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 132/378 (35%), Positives = 204/378 (54%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+   +D   +N KQ+I LGGL  LI R   G+  E +   ALL++C++AD 
Sbjct  622   AFYFLDQLLMGFDVDRNVENAKQMIALGGLDLLIGRLGAGDARESRHCIALLTTCVQADG  681

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR+ +A ++ K  L+++L     ++   +++LM+EL+CLNR      F+  L++    N
Sbjct  682   SCRHYLADSLKKEPLVQLLAGNQRKASAASLNLMSELVCLNRTSKIVEFVKELKNSGCLN  741

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L A ++L   LL D    +V  + AI+AI  ALE S    ++
Sbjct  742   TMHVLLVYLQQAPLVQHPLAATMLLQLDLLGDPSQYSVYREEAIEAIVAALEHSSQSRKV  801

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LLIL   FS+ G+ + E W+LK+AG  D        +E  +  + R       
Sbjct  802   QEQCARALLILAGRFSSSGEPVAEAWLLKRAGLDDSLSESFRRSEVFKDKSVRAE-----  856

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE++ EE Q  ++ MLL SG + FL ALS C++ G   L R CL +VAW+      SS  
Sbjct  857   EEKLVEERQKNLALMLLKSGGRRFLTALSSCISDGTPSLSRSCLVSVAWM------SSSL  910

Query  1969  gsefelsaFSALICQLKA-----CLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   +  + + 
Sbjct  911   SPLRGCNDFQPLACSVLASKLLDSLSYDRVLEERVLASLSLLNVVRHPECMEKVFPLKKE  970

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L+ LAEVTW A+EL
Sbjct  971   TIESLQDLAEVTWTAKEL  988


 Score =   120 bits (302),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 88/145 (61%), Gaps = 9/145 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML---ESP  171
            ++R DR+AA+H++QVF D+P  AR  LLPDLWD++FLPHL HLK+W+ +E   L      
Sbjct  212  MERNDRVAARHLMQVFADAPGLARRELLPDLWDHVFLPHLLHLKVWFAREADDLVAGRDA  271

Query  172  DSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP  351
            D +  ++K L+++Y++ MD+GT +FAVYYK+WL  G   P          +P+     + 
Sbjct  272  DDRRTRMKALQRLYSDHMDSGTAQFAVYYKEWLQSGAAAPPPVPSVPLPSTPRSFDGREK  331

Query  352  NSVSCIVGSFSPQPVVSKKLYDEVF  426
            +S S    S      +++ LY+ VF
Sbjct  332  SSASVHRTS------INRDLYNAVF  350



>ref|XP_008681230.1| PREDICTED: uncharacterized protein LOC100194083 isoform X1 [Zea 
mays]
Length=995

 Score =   208 bits (529),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 132/378 (35%), Positives = 204/378 (54%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+   +D   +N KQ+I LGGL  LI R   G+  E +   ALL++C++AD 
Sbjct  623   AFYFLDQLLMGFDVDRNVENAKQMIALGGLDLLIGRLGAGDARESRHCIALLTTCVQADG  682

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR+ +A ++ K  L+++L     ++   +++LM+EL+CLNR      F+  L++    N
Sbjct  683   SCRHYLADSLKKEPLVQLLAGNQRKASAASLNLMSELVCLNRTSKIVEFVKELKNSGCLN  742

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L A ++L   LL D    +V  + AI+AI  ALE S    ++
Sbjct  743   TMHVLLVYLQQAPLVQHPLAATMLLQLDLLGDPSQYSVYREEAIEAIVAALEHSSQSRKV  802

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LLIL   FS+ G+ + E W+LK+AG  D        +E  +  + R       
Sbjct  803   QEQCARALLILAGRFSSSGEPVAEAWLLKRAGLDDSLSESFRRSEVFKDKSVRAE-----  857

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE++ EE Q  ++ MLL SG + FL ALS C++ G   L R CL +VAW+      SS  
Sbjct  858   EEKLVEERQKNLALMLLKSGGRRFLTALSSCISDGTPSLSRSCLVSVAWM------SSSL  911

Query  1969  gsefelsaFSALICQLKA-----CLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   +  + + 
Sbjct  912   SPLRGCNDFQPLACSVLASKLLDSLSYDRVLEERVLASLSLLNVVRHPECMEKVFPLKKE  971

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L+ LAEVTW A+EL
Sbjct  972   TIESLQDLAEVTWTAKEL  989


 Score =   120 bits (302),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 88/145 (61%), Gaps = 9/145 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML---ESP  171
            ++R DR+AA+H++QVF D+P  AR  LLPDLWD++FLPHL HLK+W+ +E   L      
Sbjct  213  MERNDRVAARHLMQVFADAPGLARRELLPDLWDHVFLPHLLHLKVWFAREADDLVAGRDA  272

Query  172  DSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP  351
            D +  ++K L+++Y++ MD+GT +FAVYYK+WL  G   P          +P+     + 
Sbjct  273  DDRRTRMKALQRLYSDHMDSGTAQFAVYYKEWLQSGAAAPPPVPSVPLPSTPRSFDGREK  332

Query  352  NSVSCIVGSFSPQPVVSKKLYDEVF  426
            +S S    S      +++ LY+ VF
Sbjct  333  SSASVHRTS------INRDLYNAVF  351



>dbj|BAJ88650.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=717

 Score =   204 bits (519),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 199/378 (53%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL    ID   +N KQ+I LGGL  L+ R  +G+  E +   +LL+SC++AD 
Sbjct  345   AFYFLDQLLTGFDIDRNVENAKQMIALGGLDLLMSRLEVGDARESRICISLLTSCVQADG  404

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR  +A N+ K  L+++L     ++   A++LM+EL CLNR      FL  L++    N
Sbjct  405   SCRYYLADNLKKEPLVQLLVGNQKKASAAALNLMSELTCLNRTCQTVEFLKELKNGGCLN  464

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L AV++L   LL D    +V    AIDAI  ALE S    ++
Sbjct  465   TMQILLVYLQQAPPVQHPLAAVMLLQLDLLGDPLQYSVYRAEAIDAIMAALEHSSQSVKV  524

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LL+L   FS+ G+ + E W+LK+AG           TE  +    R       
Sbjct  525   QEQCARALLLLAGRFSSSGEPIAEAWLLKRAGVDGSLSESFRRTEIFKNKGARAE-----  579

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE+V EE   +++ +L+ +G K FL ALS C++ G   LVR CL TVAW+      SS  
Sbjct  580   EEKVVEERLKKLALVLVKTGNKRFLAALSNCISDGIPALVRACLVTVAWM------SSSL  633

Query  1969  gsefelsaFSALICQLKAC-----LEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L +  ++E +VLA++ LLN  + PEC   L+ +   
Sbjct  634   SPLHGCNTFQPLACSVLAVKLLDRLSYDTVMEERVLAALSLLNLVRHPECLEGLLPLKRD  693

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L  LA+VTW A+EL
Sbjct  694   TTESLRDLADVTWTAKEL  711



>ref|XP_008813287.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 [Phoenix 
dactylifera]
Length=970

 Score =   206 bits (524),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 140/378 (37%), Positives = 214/378 (57%), Gaps = 5/378 (1%)
 Frame = +1

Query  1054  SKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSC  1233
             S    A+  L++LL+   +D   +N KQ++ LGGL  LI +  +G+ NE+K  ++LL +C
Sbjct  590   SPKSAALYFLDQLLMGFDVDRNVENAKQMVALGGLDLLIRKLEMGDANERKRCASLLVTC  649

Query  1234  IEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS  1413
             ++AD  CR+ +A NI K  ++++L    L+S  +A+ L++EL+CLNR      FL  L++
Sbjct  650   VQADGKCRDYLAGNIKKASIIQLLLGNQLKSKGSALFLLSELVCLNRTTQIIRFLKELKN  709

Query  1414  DDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSF  1593
                 N   +L  YLQ +  +Q+ L A ++L   LL D    +V  +  I+ I  ALE + 
Sbjct  710   GGCLNTMHVLLVYLQQAPLEQRPLAAAILLLLDLLGDPLQYSVYREEGIETIVAALEWNL  769

Query  1594  LDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRIT  1773
               + + E C + LL+LG  FS  G+ + E W+LK AG  D       S      +N ++ 
Sbjct  770   HRKEVQEQCSRALLLLGGRFSCLGETIAETWLLKGAGLDDGPSDSFTSKVIPAVENAKV-  828

Query  1774  MMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvla  1953
                D EE+  EEW  +++ +LL SGKK FL ALS C+A G   L R CL TVAW+SS L+
Sbjct  829   ---DEEEKTTEEWLRKLAMVLLTSGKKRFLVALSNCIADGIPSLSRSCLVTVAWISSSLS  885

Query  1954  sssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
             S   + S   L+  S L  +L   L + + LE +VLAS+ LLNF + PEC   +  + + 
Sbjct  886   SLHSANSLQPLAC-SILAPRLLESLSYDRALEERVLASLSLLNFVRHPECLSKIFPLDKE  944

Query  2134  IEDTLECLAEVTWVAREL  2187
               + L+ LA+VTW A+EL
Sbjct  945   TINLLQDLAQVTWTAKEL  962


 Score =   125 bits (314),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 79/113 (70%), Gaps = 2/113 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R D ++A+H+LQVF D+P  AR +LLPDLWD+ FLPHL HLK+WY KE  ++   + +
Sbjct  195  IERNDWVSARHLLQVFVDAPFLARKNLLPDLWDHFFLPHLLHLKVWYSKEAELVAGWEVE  254

Query  181  SR--KLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQL  333
             R  ++K L + YN+ MD GT +FA+YYK+WL  G + P +PSV +P  +  L
Sbjct  255  DRDQRMKGLNRAYNDQMDGGTAQFALYYKEWLKVGGKAPPVPSVSLPLRASYL  307



>ref|XP_009393280.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=983

 Score =   205 bits (521),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 139/373 (37%), Positives = 203/373 (54%), Gaps = 12/373 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +LE+LL+   +D   +N KQL+ LGGL  LI R   G+  E +  ++LL+ CI AD 
Sbjct  617   AFYLLEQLLMGFDVDRNVENSKQLVALGGLDLLIRRLEAGDAQESRNCASLLARCIRADG  676

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR  +A NI K  ++++L ++  +S  +AISL++EL+CLNR       L  L+ D   N
Sbjct  677   SCRQYLAMNIKKTPIVQLLGNQQ-KSHGSAISLLSELLCLNRTTQIMTLLKELKDDGFLN  735

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
             I  +L  YL  +  +Q+      +    LL      ++  + AIDA+  ALE +  ++++
Sbjct  736   IMHVLLVYLHQAPLEQRP-----VAAALLLQLDLLYSIHREEAIDALIAALERNLHNKKI  790

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LL+LG  FS  G+  +E W+LK+AG  D       S E    DN     M   
Sbjct  791   QEKCSRALLLLGGRFSCSGEATSEAWLLKRAGLHDSLSDSFRSKEIFVDDN-----MRPE  845

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE+V EEW  +++ +LL SG K FL ALS C+A G   L R CL TVAW+SS L S    
Sbjct  846   EEKVTEEWLRKLAIVLLSSGNKRFLVALSNCMADGIPGLARSCLVTVAWMSSSLVSWHNV  905

Query  1969  gsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTL  2148
                  L   S L  +L   L + +  E +VLAS+ L NF + PEC   L  + +    +L
Sbjct  906   NHLQSLVC-STLAPRLFESLSYHRAQEERVLASLSLFNFVRYPECLPKLFPMDKETICSL  964

Query  2149  ECLAEVTWVAREL  2187
             + LA+VTW A+EL
Sbjct  965   QDLAQVTWTAKEL  977


 Score =   115 bits (288),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R DR++AKH+LQVF D+P  AR +LLPDLWD+  LPHL HLK+WY KE+ ++ S D++
Sbjct  216  IERNDRVSAKHLLQVFVDAPYLARKNLLPDLWDHFLLPHLLHLKVWYNKEVELVASWDAE  275

Query  181  SR--KLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             R  ++K L + YN+ MD GT +FAVYY+DW+  G + P +P+V +P
Sbjct  276  DRDQRMKGLNRAYNDQMDAGTAQFAVYYRDWIKSGGKAPPVPTVSLP  322



>ref|XP_010927102.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN, partial 
[Elaeis guineensis]
Length=966

 Score =   203 bits (517),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 201/350 (57%), Gaps = 5/350 (1%)
 Frame = +1

Query  1054  SKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSC  1233
             S    A+  L++LL+   +D   +N KQ++ LGGL  LI R  +G+ +++K  ++LL  C
Sbjct  603   SPKSAALYFLDQLLMGFDVDRNVENAKQMVALGGLDLLIKRLEMGDAHDRKRCASLLVPC  662

Query  1234  IEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS  1413
             I+AD  CR+ +A NI K  ++++L    L+S  +A+ L++EL+CLNR      FL  L++
Sbjct  663   IQADGRCRDYLAGNIKKASIIQLLLGNQLKSKGSALFLLSELVCLNRTTQIIRFLKELKN  722

Query  1414  DDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSF  1593
             D   N   +L  YLQ +  +Q+ L A ++L   LL D    +V  +  IDAI  ALE + 
Sbjct  723   DGCLNTMHVLLVYLQQAPLEQRPLAAAILLLLDLLGDPLQYSVYREEGIDAIVAALEWNL  782

Query  1594  LDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRIT  1773
               + + E C + LL+LG  FS  G+   E W+LK+AG  D       S E    +N ++ 
Sbjct  783   HHKEVQEQCSRALLLLGGRFSCLGETTAETWLLKRAGLDDGPSDSFRSKEIPAVENAKV-  841

Query  1774  MMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvla  1953
                D EE++ EEW  +++ +LL SGKK FL ALS C+A G   L R CL T+AW+SS L+
Sbjct  842   ---DEEEKMTEEWLRKLAMVLLTSGKKRFLVALSNCIADGIPSLARSCLVTIAWMSSSLS  898

Query  1954  sssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPEC  2103
             S   + S   L+  S L  +L   L + + LE +VLAS+ LLNF + PEC
Sbjct  899   SLHGANSLQPLAC-SILAPRLFESLNYDRALEERVLASLSLLNFVRHPEC  947


 Score =   121 bits (303),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R D ++A+H+LQVF D+P  AR +LLPDLWD+ FLPHL HLK+WY KE  ++   + +
Sbjct  208  IERNDWVSARHLLQVFVDAPFLARKNLLPDLWDHFFLPHLLHLKVWYSKEAELVAGWEVE  267

Query  181  SR--KLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQL  333
             R  ++K L + Y + MD GT +FA+YYK+WL  G + P +P+V +P  +  L
Sbjct  268  DRDQRMKGLNRAYIDQMDGGTAQFALYYKEWLKVGGKAPPVPAVSLPLRTSYL  320



>ref|XP_004951782.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Setaria 
italica]
Length=937

 Score =   192 bits (487),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 138/378 (37%), Positives = 205/378 (54%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+   +D   +N KQ+I LGGL  LI R   G+  E +   ALL++CI+AD 
Sbjct  565   AFYFLDQLLMGFDVDRNIENAKQMIALGGLDLLISRLEAGDARESRHCIALLTTCIQADG  624

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR+ +A N+ K  ++++L     ++   A++ ++EL+CLNR      FL  L++    N
Sbjct  625   SCRHYLADNLKKEPIVQLLVGNQKKASAAALNFISELVCLNRTTKIVEFLKELKNSGCLN  684

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L AVL+L   LL D    +V  + AIDA+  ALESS   +++
Sbjct  685   TMHILLVYLQQAPLVQHPLAAVLLLQLDLLGDPLQYSVYREEAIDAMISALESSSRSKKV  744

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LLIL   FS+ G+ + E W+LK+AG  D        TE  +  + R       
Sbjct  745   QEQCARALLILAGRFSSSGEPIAEAWLLKRAGLDDSLSESFRRTEIFKDKSVRAE-----  799

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE+V EE   +++ MLL SG K FL ALS C++ G   L R CL TV W+      SS  
Sbjct  800   EEKVVEERLKKLALMLLNSGGKRFLAALSNCISDGIPSLSRSCLITVTWM------SSSL  853

Query  1969  gsefelsaFSALICQLKA-----CLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   +  + + 
Sbjct  854   SPLGGCNDFQPLACSVLAPNLLDSLSYDRVLEERVLASLSLLNVVRHPECMEKVFPLKKD  913

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L+ LAEVTW A+EL
Sbjct  914   TIESLQDLAEVTWTAKEL  931


 Score =   123 bits (309),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLES--PD  174
            ++R DR+AA+H+LQVF D+P  AR  LLPDLWD +FLPHL HLK+W+  E+ ++     D
Sbjct  161  MERNDRVAARHLLQVFADAPGLARRDLLPDLWDRVFLPHLLHLKVWFTNEVELVAGWDAD  220

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG  279
             + R++K L+++YN+ MD+GT +FA+YYK+WL  G
Sbjct  221  DRCRRMKSLQRLYNDNMDSGTAQFAMYYKEWLKSG  255



>gb|EMT06890.1| hypothetical protein F775_01383 [Aegilops tauschii]
Length=811

 Score =   189 bits (479),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 122/352 (35%), Positives = 186/352 (53%), Gaps = 18/352 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL    ID   +N KQ+I LGGL  L+ R  +G+  E +   +LL+SC++AD 
Sbjct  470   AFYFLDQLLTGFDIDRNVENAKQMIALGGLDLLMSRLEVGDARESRICISLLTSCVQADG  529

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR  ++ ++ K  L+++L   + ++   A++LM+EL CLNR      FL  L+S    N
Sbjct  530   SCRYYLSDHLKKEPLVQLLVGNEKKASAAALNLMSELTCLNRTSQMVEFLKELKSGGCLN  589

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L AV++L   LL D    +V    AIDA+  ALE S    ++
Sbjct  590   TMQILLVYLQQAPPVQHPLAAVMLLQLDLLGDPLQYSVYRQEAIDAMMAALEHSSESVKV  649

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LL+L   FS+ G+ + E W+LK+AG           TE  +    R       
Sbjct  650   QEQCARALLLLAGRFSSSGEPIAEAWLLKRAGVDGSLSESFRRTEIFKNKGARAE-----  704

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE+V EE   +++ +L+ +G K FL ALS C++ G   LVR CL TVAW+      SS  
Sbjct  705   EEKVVEERLKKLALVLVKTGNKRFLAALSNCISDGIPTLVRACLVTVAWM------SSSL  758

Query  1969  gsefelsaFSALICQLKAC-----LEHGKLLEHKVLASVCLLNFSK--IPEC  2103
                   + F  L C + A      L + +++E +VLAS+ LLN  +  +P+C
Sbjct  759   SPLHGCNTFQPLACSVLAAKLLDRLSYDRVMEERVLASLSLLNLVRHPVPDC  810


 Score =   114 bits (286),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 75/104 (72%), Gaps = 5/104 (5%)
 Frame = +1

Query  19   IAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE----LGMLESPDSKSR  186
            +AA+H+LQVF D+P  AR +LLPDLW ++FLPHL HL++W   E     G  ++    S 
Sbjct  7    LAARHLLQVFVDAPHLARRTLLPDLWAHVFLPHLLHLEVWLANESELVAGCGDADGRSSS  66

Query  187  KLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE-PPSIPSVKIP  315
            ++K L+++Y++ MD+GT +FA+YYK+WL  G + PP+IPSV +P
Sbjct  67   RMKTLQRLYDDQMDSGTAQFAMYYKEWLKHGGDAPPAIPSVPLP  110



>emb|CBI29071.3| unnamed protein product [Vitis vinifera]
Length=941

 Score =   187 bits (475),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 138/384 (36%), Positives = 214/384 (56%), Gaps = 9/384 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+  + D+  +N +Q++ +GGL  L+ R   G+   +   ++++S CI+AD 
Sbjct  538   AYYFLDQLLMGFNEDQNLENARQVVSIGGLSLLVKRIETGDACGRNNAASIISCCIQADG  597

Query  1249  NCRNLIARNIDKMCLLEVLC-SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             +CR+ +A N++K  +LE+L       S   A +L+TELICLNRR   T FL GLQ+    
Sbjct  598   SCRHYLANNLNKASILELLVLGNQKNSSSCAFALLTELICLNRRTQITKFLDGLQNGGAH  657

Query  1426  -NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +L  YLQ +  +++ LVA L+L   LL D   S+V  + A++ I  AL+    +E
Sbjct  658   LNTMHILLVYLQRAPPEERPLVAALLLQLDLLGDPSKSSVYREEAVETIIAALDCQTCNE  717

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE--DNEPDNGRITM  1776
             ++ +   K L+ILG  FS  G+   E W+L+QAG  +  E  L +TE   NE  N     
Sbjct  718   KVQQQSSKTLMILGGRFSYTGEASAEKWLLQQAGLEEISEDSLHNTEIFVNEIMNS--GS  775

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlas  1956
             +++ EEE  E WQ + +  L  SG K FL ALS  +A+G   L R  L TV+W+S+ L S
Sbjct  776   LENDEEEATENWQKKAAIALFRSGNKRFLSALSDSIANGIPCLARASLVTVSWMSNFLCS  835

Query  1957  ssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIG-EV  2133
                    +     S L+ QL   L + + +E +V+AS  LLN +K  EC  +L  +  E 
Sbjct  836   MEDESFRWMAC--SILVPQLIELLSYNRDVEERVIASYSLLNLAKNSECTSMLSSLDHEE  893

Query  2134  IEDTLECLAEVTWVARELQTVISS  2205
             + ++L  L+ VTW A EL ++I+S
Sbjct  894   LVNSLRNLSLVTWTANELMSIITS  917


 Score =   146 bits (368),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DRI+A+H+LQVFCD+P  ART LLPDLW++ FLPHL HLK+WY  EL  L +P+  
Sbjct  135  LEKNDRISARHLLQVFCDAPFLARTDLLPDLWEHFFLPHLLHLKVWYANELEFLSNPNFG  194

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K ++   L K+YN+ MD GT +FA YYKDWL  GV+ P IPSV +P      +R    N
Sbjct  195  DKEKRAIALSKIYNDQMDMGTRQFAFYYKDWLKVGVKAPPIPSVPLP------SRPSYGN  248

Query  355  SVSCIVGSFSPQPVVSKKLYDEVF  426
            S+     SFS    ++K LY  VF
Sbjct  249  SMRRSSDSFSSNLSINKNLYQAVF  272



>ref|XP_002274319.3| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Vitis vinifera]
Length=1036

 Score =   187 bits (474),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 138/384 (36%), Positives = 214/384 (56%), Gaps = 9/384 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+  + D+  +N +Q++ +GGL  L+ R   G+   +   ++++S CI+AD 
Sbjct  633   AYYFLDQLLMGFNEDQNLENARQVVSIGGLSLLVKRIETGDACGRNNAASIISCCIQADG  692

Query  1249  NCRNLIARNIDKMCLLEVLC-SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             +CR+ +A N++K  +LE+L       S   A +L+TELICLNRR   T FL GLQ+    
Sbjct  693   SCRHYLANNLNKASILELLVLGNQKNSSSCAFALLTELICLNRRTQITKFLDGLQNGGAH  752

Query  1426  -NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +L  YLQ +  +++ LVA L+L   LL D   S+V  + A++ I  AL+    +E
Sbjct  753   LNTMHILLVYLQRAPPEERPLVAALLLQLDLLGDPSKSSVYREEAVETIIAALDCQTCNE  812

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE--DNEPDNGRITM  1776
             ++ +   K L+ILG  FS  G+   E W+L+QAG  +  E  L +TE   NE  N     
Sbjct  813   KVQQQSSKTLMILGGRFSYTGEASAEKWLLQQAGLEEISEDSLHNTEIFVNEIMNS--GS  870

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlas  1956
             +++ EEE  E WQ + +  L  SG K FL ALS  +A+G   L R  L TV+W+S+ L S
Sbjct  871   LENDEEEATENWQKKAAIALFRSGNKRFLSALSDSIANGIPCLARASLVTVSWMSNFLCS  930

Query  1957  ssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIG-EV  2133
                    +     S L+ QL   L + + +E +V+AS  LLN +K  EC  +L  +  E 
Sbjct  931   MEDESFRWMAC--SILVPQLIELLSYNRDVEERVIASYSLLNLAKNSECTSMLSSLDHEE  988

Query  2134  IEDTLECLAEVTWVARELQTVISS  2205
             + ++L  L+ VTW A EL ++I+S
Sbjct  989   LVNSLRNLSLVTWTANELMSIITS  1012


 Score =   146 bits (369),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DRI+A+H+LQVFCD+P  ART LLPDLW++ FLPHL HLK+WY  EL  L +P+  
Sbjct  230  LEKNDRISARHLLQVFCDAPFLARTDLLPDLWEHFFLPHLLHLKVWYANELEFLSNPNFG  289

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K ++   L K+YN+ MD GT +FA YYKDWL  GV+ P IPSV +P      +R    N
Sbjct  290  DKEKRAIALSKIYNDQMDMGTRQFAFYYKDWLKVGVKAPPIPSVPLP------SRPSYGN  343

Query  355  SVSCIVGSFSPQPVVSKKLYDEVF  426
            S+     SFS    ++K LY  VF
Sbjct  344  SMRRSSDSFSSNLSINKNLYQAVF  367



>ref|XP_002451611.1| hypothetical protein SORBIDRAFT_04g004580 [Sorghum bicolor]
 gb|EES04587.1| hypothetical protein SORBIDRAFT_04g004580 [Sorghum bicolor]
Length=993

 Score =   186 bits (473),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 204/378 (54%), Gaps = 16/378 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+   +D   +N KQ+I LGGL  LI R   G+  E +   ALL++CI+AD 
Sbjct  621   AFYFLDQLLMGFDVDRNIENAKQMIALGGLDLLISRLEAGDARESRHCIALLTTCIQADG  680

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CR+ +A N+ K  L+++L     ++   +++LM+EL+CLNR      F+  L++    N
Sbjct  681   SCRHYLADNLKKEPLVQLLVGNQKKASAASLNLMSELVCLNRTTKIVEFVKELKNSGCLN  740

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                +L  YLQ +   Q  L A+++L   LL D    +V  + AI+AI  ALE S    ++
Sbjct  741   TMHILLVYLQQAPLVQHPLAAIMLLQLDLLGDPLQYSVYREEAIEAIIAALEHSSQSRKV  800

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E C + LLIL   FS  G+ + E W+LK+AG  D        +E  +  + R       
Sbjct  801   QEQCARALLILAGRFSTSGEPIAEAWLLKRAGLDDSLSESFRRSEIFKDKSVRAE-----  855

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
             EE++ EE   +++ MLL SG K FL ALS C++ G   L R CL T+AW+      SS  
Sbjct  856   EEKLVEERLKKLALMLLKSGDKRFLMALSNCISDGIPNLSRSCLITIAWM------SSSL  909

Query  1969  gsefelsaFSALICQLKA-----CLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                   + F  L C + A      L + ++LE +VLAS+ LLN  + PEC   +  + + 
Sbjct  910   SPLRGCNDFQPLACSILASNLLDSLSYDRVLEERVLASLSLLNVVRHPECMEKVFPLKKE  969

Query  2134  IEDTLECLAEVTWVAREL  2187
               ++L+ LAEVTW A+EL
Sbjct  970   TIESLQDLAEVTWTAKEL  987


 Score =   127 bits (320),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 90/144 (63%), Gaps = 8/144 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLES--PD  174
            ++R DR+AA+H++QVF D+P  AR  LLPDLWD++FLPHL HLK+W+ KE+ ++     D
Sbjct  218  MERNDRVAARHLMQVFADAPGLARRDLLPDLWDHVFLPHLLHLKVWFTKEVDLVAGWDAD  277

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             + R++K L+++YN+ MD+GT +FA+YYK+WL  G   P           P+     + N
Sbjct  278  DRCRRMKTLQRLYNDHMDSGTAQFAMYYKEWLKSGAAAPPPVPSVPLPSMPRNFDGREKN  337

Query  355  SVSCIVGSFSPQPVVSKKLYDEVF  426
            S S    S      +++ LY+ VF
Sbjct  338  SASVHRTS------INRDLYNAVF  355



>ref|XP_010272313.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Nelumbo 
nucifera]
Length=1000

 Score =   186 bits (471),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 136/381 (36%), Positives = 214/381 (56%), Gaps = 9/381 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +L++LL   + D   +N +Q++ LGGL  L+     G+  + +  +++++SCI+AD 
Sbjct  620   AFYLLDQLLTGFNEDGNLENARQVVALGGLSLLVRSLETGD-PQSRSAASIITSCIQADG  678

Query  1249  NCRNLIARNIDKMCLLEVLC-SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDD-I  1422
             +CRN +A NI+K  +L++L       S  + +SL+ EL+CLNRR + T FL+GL++++  
Sbjct  679   SCRNYLANNINKASILQLLILGNRSRSSGSILSLLIELLCLNRRTEITSFLNGLKNNEER  738

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +L  YLQ +  +Q+SLVA ++L   LL D+   +V  + A+DAI  AL+    +E
Sbjct  739   LNTMHILLVYLQWAPPEQRSLVAAILLQLDLLEDSFQYSVYREEAVDAIITALDCKTCNE  798

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ +   + LL+LG  FS  G+  TE W+LKQAGF D  +      E    +     ++ 
Sbjct  799   KVQQQSARSLLLLGGRFSYMGEASTETWLLKQAGFDDSTDDSFHGKEIVYDE----ILIQ  854

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + EEE  + W  + + +LL SGK  FL ALS C+A+G   L R  L TVAWLS  L S  
Sbjct  855   NEEEESIQNWLRKAATVLLTSGKNRFLVALSECMANGIPYLARASLITVAWLSRSLTSIQ  914

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
              S  +      S L+ +L   L + + LE +VLAS+ LL   K  EC  ++  +   +  
Sbjct  915   DSSLQSTAC--SILVPRLIETLNYDRALEERVLASLSLLCLIKNSECISMISPLSNEMMG  972

Query  2143  TLECLAEVTWVARELQTVISS  2205
              L  LA VTW A EL ++ +S
Sbjct  973   PLRNLALVTWTAEELLSIATS  993


 Score =   143 bits (360),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 96/148 (65%), Gaps = 9/148 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            L++ DRI+A+H+LQVFCDSP  ART LLPDLW++ FLPH  HLKIWY KE  ++ + +S 
Sbjct  223  LEKNDRISARHLLQVFCDSPFLARTHLLPDLWEHFFLPHFLHLKIWYSKEEELILNWESG  282

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K RK+K L KVYNE MD GT++FA+YYK+WL  G + P +PSV +P      A      
Sbjct  283  EKERKMKALIKVYNEKMDMGTSQFALYYKEWLKVGAKAPPMPSVSLPSRPSYGAAKRRGT  342

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFRHKN  438
            S    +GS   Q  ++K LY  VF   N
Sbjct  343  S----LGS---QASLNKSLYRAVFGRIN  363



>ref|XP_011037934.1| PREDICTED: uncharacterized protein LOC105134983 isoform X6 [Populus 
euphratica]
Length=618

 Score =   181 bits (460),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+KD+ +AKH+LQVFCD+P  ART LL +LWD +F PHLSHLK WY KE   L     K
Sbjct  365  LQKKDKASAKHLLQVFCDAPFLARTLLLSELWDYLFFPHLSHLKTWYKKEADALFRKPRK  424

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +KLK L K+YNET+D+ T +FAVYYKDWLTEGVE PS+PSV IPF S Q    +  +  
Sbjct  425  IKKLKFLAKIYNETLDSCTYQFAVYYKDWLTEGVEAPSVPSVDIPFTSQQGGSQDHSSGP  484

Query  361  SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGS  504
            +     FSPQP VSKKLYD VF   +   +  ++ E  G + +++NG+
Sbjct  485  ASPSAPFSPQPTVSKKLYDAVFGRSSKPRV--HEAEDNGKAENLNNGA  530



>ref|XP_011037929.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Populus euphratica]
Length=795

 Score =   182 bits (463),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+KD+ +AKH+LQVFCD+P  ART LL +LWD +F PHLSHLK WY KE   L     K
Sbjct  365  LQKKDKASAKHLLQVFCDAPFLARTLLLSELWDYLFFPHLSHLKTWYKKEADALFRKPRK  424

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +KLK L K+YNET+D+ T +FAVYYKDWLTEGVE PS+PSV IPF S Q    +  +  
Sbjct  425  IKKLKFLAKIYNETLDSCTYQFAVYYKDWLTEGVEAPSVPSVDIPFTSQQGGSQDHSSGP  484

Query  361  SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGS  504
            +     FSPQP VSKKLYD VF   +   +  ++ E  G + +++NG+
Sbjct  485  ASPSAPFSPQPTVSKKLYDAVFGRSSKPRV--HEAEDNGKAENLNNGA  530


 Score =   113 bits (282),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  793   SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNF  972
             SIP +FICPLTG +F+DPVTLETGQ+FER AI  WF +GN+TCP++ K L C  VPL+N 
Sbjct  721   SIPQDFICPLTGQLFDDPVTLETGQTFEREAIREWFDRGNKTCPVSGKTLACSTVPLTNS  780

Query  973   ILKRVIDKWRS  1005
             ILK VID W+S
Sbjct  781   ILKLVIDSWKS  791



>ref|XP_011037933.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 isoform 
X5 [Populus euphratica]
Length=688

 Score =   181 bits (459),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+KD+ +AKH+LQVFCD+P  ART LL +LWD +F PHLSHLK WY KE   L     K
Sbjct  365  LQKKDKASAKHLLQVFCDAPFLARTLLLSELWDYLFFPHLSHLKTWYKKEADALFRKPRK  424

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +KLK L K+YNET+D+ T +FAVYYKDWLTEGVE PS+PSV IPF S Q    +  +  
Sbjct  425  IKKLKFLAKIYNETLDSCTYQFAVYYKDWLTEGVEAPSVPSVDIPFTSQQGGSQDHSSGP  484

Query  361  SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGS  504
            +     FSPQP VSKKLYD VF   +   +  ++ E  G + +++NG+
Sbjct  485  ASPSAPFSPQPTVSKKLYDAVFGRSSKPRV--HEAEDNGKAENLNNGA  530



>ref|XP_011037931.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 isoform 
X3 [Populus euphratica]
Length=712

 Score =   181 bits (459),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+KD+ +AKH+LQVFCD+P  ART LL +LWD +F PHLSHLK WY KE   L     K
Sbjct  365  LQKKDKASAKHLLQVFCDAPFLARTLLLSELWDYLFFPHLSHLKTWYKKEADALFRKPRK  424

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
             +KLK L K+YNET+D+ T +FAVYYKDWLTEGVE PS+PSV IPF S Q    +  +  
Sbjct  425  IKKLKFLAKIYNETLDSCTYQFAVYYKDWLTEGVEAPSVPSVDIPFTSQQGGSQDHSSGP  484

Query  361  SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGS  504
            +     FSPQP VSKKLYD VF   +   +  ++ E  G + +++NG+
Sbjct  485  ASPSAPFSPQPTVSKKLYDAVFGRSSKPRV--HEAEDNGKAENLNNGA  530



>emb|CAN67079.1| hypothetical protein VITISV_004500 [Vitis vinifera]
Length=1049

 Score =   179 bits (455),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 136/403 (34%), Positives = 212/403 (53%), Gaps = 33/403 (8%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL+  + D+  +N +Q++ +GGL  L+ R   G+   +   ++++S CI+AD 
Sbjct  632   AYYFLDQLLMGFNEDQNLENARQVVSIGGLSLLVKRIETGDACGRNNAASIISCCIQADG  691

Query  1249  NCRNLIARNIDKMCLLEVLC-SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             +CR+ +A N++K  +LE+L       S   A +L+TELICLNRR   T FL GLQ+    
Sbjct  692   SCRHYLANNLNKASILELLVLGNQKNSSSCAFALLTELICLNRRTQITKFLDGLQNGGAH  751

Query  1426  -NITILLSTYLQSSHCKQKSL-------------------VAVLILHFHLLTDTQCSNVC  1545
              N   +L  YLQ +  +++ L                   VAV+     L  D   S+V 
Sbjct  752   LNTMHILLVYLQRAPPEERPLVAALLLQLDLLTLEQPPHGVAVI-----LQGDPSKSSVY  806

Query  1546  IDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFES  1725
              + A++ I  AL+    +E++ +   K L+ILG  FS  G+   E W+L+QAG  +  E 
Sbjct  807   REEAVETIIAALDCQTCNEKVQQQSSKTLMILGGRFSYTGEASAEKWLLQQAGLEEISED  866

Query  1726  DLESTE--DNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNI  1899
              L +TE   NE  N     +++ EEE  E WQ + +  L  SG K FL ALS  +A+G  
Sbjct  867   SLHNTEIFVNEIMNS--GSLENDEEEATENWQKKAAIALFRSGNKRFLSALSDSIANGIP  924

Query  1900  ELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLL  2079
              L R  L TV+W+S+ L S       +     S L+ QL   L + + +E +V+AS  LL
Sbjct  925   CLARASLVTVSWMSNFLCSMEDESFRWMAC--SILVPQLIELLSYNRDVEERVIASYSLL  982

Query  2080  NFSKIPECRVLLMMIG-EVIEDTLECLAEVTWVARELQTVISS  2205
             N +K  EC  +L  +  E + ++L  L+ VTW A EL ++I+S
Sbjct  983   NLAKNSECTSMLSSLDHEELVNSLRNLSLVTWTANELMSIITS  1025


 Score =   146 bits (368),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DRI+A+H+LQVFCD+P  ART LLPDLW++ FLPHL HLK+WY  EL  L +P+  
Sbjct  229  LEKNDRISARHLLQVFCDAPFLARTDLLPDLWEHFFLPHLLHLKVWYANELEFLSNPNFG  288

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K ++   L K+YN+ MD GT +FA YYKDWL  GV+ P IPSV +P      +R    N
Sbjct  289  DKEKRAIALSKIYNDQMDMGTRQFAFYYKDWLKVGVKAPPIPSVPLP------SRPSYGN  342

Query  355  SVSCIVGSFSPQPVVSKKLYDEVF  426
            S+     SFS    ++K LY  VF
Sbjct  343  SMRRSSDSFSSNLSINKNLYQAVF  366



>ref|NP_001174070.1| Os04g0584500 [Oryza sativa Japonica Group]
 emb|CAE03752.2| OSJNBa0013K16.1 [Oryza sativa Japonica Group]
 dbj|BAH92798.1| Os04g0584500 [Oryza sativa Japonica Group]
Length=290

 Score =   168 bits (426),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 116/284 (41%), Positives = 165/284 (58%), Gaps = 13/284 (5%)
 Frame = +1

Query  1348  MTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHF-HLLTD  1524
             +T+    +RR+    FL GL+++       LL  +L+ S  ++++L AVL+LHF H L +
Sbjct  14    LTKYFNCHRREIVELFLRGLRTELTMETMNLLLEHLRRSPNEEQALGAVLLLHFDHALVE  73

Query  1525  TQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAG  1704
                 +V  + A   IT +L  S  +E ++    K LL+LG HFS  G ++ ED +LKQAG
Sbjct  74    PHRDSVYREEAAKIITHSLRCSLSEENVVANIRKALLLLGGHFSFSGDLLAEDRMLKQAG  133

Query  1705  FIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCL  1884
             F+D        ++    D GR       E+EV   W   ++A LLGSG++ FL ALSMC+
Sbjct  134   FVDGSRVTRADSDAAVQDKGR------DEDEV---WLRDVTAALLGSGRRPFLEALSMCM  184

Query  1885  ASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGK-LLEHKVL  2061
             +S N +L  VCLTT AWLS  LAS   +  +     FSALI +LK  L   +   +H+VL
Sbjct  185   SSPNHDLAAVCLTTAAWLSRSLASIDAADVQLAA--FSALIPRLKQRLAGDRSQAQHRVL  242

Query  2062  ASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQT  2193
             ASV L NFSKIP+CR LLM++ + + D L  LAE+TW A +L T
Sbjct  243   ASVTLYNFSKIPDCRALLMLLADGLRDHLVELAELTWTAGQLIT  286



>ref|XP_004295479.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Fragaria 
vesca subsp. vesca]
Length=1005

 Score =   178 bits (452),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 143/434 (33%), Positives = 222/434 (51%), Gaps = 39/434 (9%)
 Frame = +1

Query  970   FILKRVIDKWRSEHWQHL----LAFSSQFASD-----SKAEIAVSILEKLLIVSSIDERT  1122
             ++LK    + +S  W  L    L F  Q  +      S    A+ +L++LL     D   
Sbjct  587   YLLKPKAKQMKSLEWVALVLRVLEFGDQLQTLFTVRCSPQAAALYLLDQLLTGFDEDRNL  646

Query  1123  KNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-  1299
             +N +Q++ LGGL  L+ +   G+ +E+  V++++S C+ AD NCRN +A  +DK  LLE 
Sbjct  647   ENARQVVSLGGLSLLVKQIEKGDTHERNSVASIISCCVRADGNCRNYLADFLDKPSLLEL  706

Query  1300  VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD--DIANITILLSTYLQSSHCK  1473
             ++      S  +A +L+ E++CL+RR   T  L GL+     +  + ILL  YLQ +  +
Sbjct  707   IVLGNGSNSTCSAFALLIEILCLSRRTKITKILDGLKEGCCGLNTMQILL-VYLQRASAE  765

Query  1474  QKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHF  1653
             ++ LVA ++L   L+ D    +V  + AI+A+  AL+    D ++ E   + LL+LG  F
Sbjct  766   ERPLVAAILLQLDLMGDPYRCSVYREEAIEAMIGALDCQTCDVKVQERSARSLLMLGGWF  825

Query  1654  SAFGKIMTEDWILKQAGFI----DRF---ESDLESTEDNEPDNGRITMMDDGEEEVREEW  1812
             S  G+  TE W+L+QAGF     D F   E  L S ED               EE  E W
Sbjct  826   SYTGEASTEHWLLQQAGFSYSSRDSFHFREGFLHSNED---------------EEATENW  870

Query  1813  QARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsa  1992
             Q + + +L  SG K  L ALS  +A+G   L RV L T++W+SS L++      +     
Sbjct  871   QRKAAIVLFRSGNKKLLVALSDSIANGIPSLARVSLVTLSWMSSYLSTVGNEHLKSMAC-  929

Query  1993  FSALICQLKACLEHGKLLEHKVLASVCLLNFSKIP--ECRVLLMMIGEVIEDTLECLAEV  2166
              S L+ QL   L+  K +E +VLAS  LLN  K    E   +L  +   +   L+ L+ V
Sbjct  930   -SILVPQLLESLKFHKDVEERVLASYSLLNLVKSSGDEYIPMLSSVDREVLSKLQNLSLV  988

Query  2167  TWVARELQTVISSS  2208
             TW A EL ++I+S+
Sbjct  989   TWTANELISIITSN  1002


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            ++R D ++AKH+LQVFCDSP  ART LLPDLW+++FLPHL HLKIWY +E+ ++     K
Sbjct  221  IERNDLVSAKHLLQVFCDSPSLARTHLLPDLWEHLFLPHLLHLKIWYSQEIEVVSHSFEK  280

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE-PPSIPSVKIPFL  321
             +++K + KVYN+ MD GT KFA YYK+WL  G E PP  P V +P +
Sbjct  281  EKRMKSITKVYNDQMDLGTTKFAQYYKEWLKVGSEAPPVAPEVPLPLV  328



>emb|CDP17621.1| unnamed protein product [Coffea canephora]
Length=1016

 Score =   178 bits (451),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 130/395 (33%), Positives = 214/395 (54%), Gaps = 23/395 (6%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   L++LL     D+  +N +  + +GGL  L+ R  +G++ EK   ++++  CI+AD 
Sbjct  625   AYYFLDQLLNCFDEDKNMENARYAVAVGGLNLLLRRVEIGDIVEKNKAASIIYYCIQADG  684

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGL-QSDDIA  1425
             +CR+ +A+N +    + +L  +D ++   A +L+TEL CL+R  +    LS L +     
Sbjct  685   SCRHYLAQNFNNQAFISLLALKDKKTQNRAFALLTELFCLHRHHERIELLSKLIKGWGRM  744

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTD------------TQCSNVCIDGAIDAI  1569
             N   +L  YLQ +  +++ LVA L+L   +L D            ++CS V    A++ I
Sbjct  745   NTLHILLVYLQKAQPEERPLVAALLLQLDILGDPSLLGLELPVDSSECS-VYRYEAVEEI  803

Query  1570  TVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDN  1749
               A++   L+E++ E   + LLIL  HFS  G+ + E W+LKQAGF    E+ L+++  N
Sbjct  804   VKAMDCQVLNEQVQEQSARALLILAGHFSYTGEPVAETWLLKQAGFD---ENSLDASSCN  860

Query  1750  EPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTV  1929
             +      T +   +EE  E W+ R + +LL SG+++ L ALS  +A+G   L R  L TV
Sbjct  861   KVAFNNFTNLVREDEEA-ENWRRRTAMILLKSGRRNLLVALSDSMANGIPRLARASLVTV  919

Query  1930  AWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPEC--  2103
              W+SS L SS     +      S L  QL   L +   +E ++LAS  LLN  K  +   
Sbjct  920   TWISSFLHSSGERSLQPLAC--SILAPQLIEALNYENSMEERILASFSLLNLLKGSDGVD  977

Query  2104  RVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS  2208
             R+  +M  E++ + L+ L++VTW A+EL +VI+SS
Sbjct  978   RLQRLMTKELVNE-LDNLSQVTWTAKELISVITSS  1011


 Score =   137 bits (346),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 84/106 (79%), Gaps = 4/106 (4%)
 Frame = +1

Query  7    RKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLES---PDS  177
            + DR++A+H+LQVFCDSP  ART+LLP++W+++FLPHL H+KIWY +EL  L +   PD 
Sbjct  228  KSDRVSARHLLQVFCDSPHIARTNLLPEVWEHLFLPHLLHIKIWYNEELESLSNSMYPDE  287

Query  178  KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
            ++ K+K L+K YN+ MD GT KFA+YYK+WL +G + P++PSV +P
Sbjct  288  ET-KMKALDKAYNDQMDIGTQKFALYYKEWLKDGAKAPAVPSVHLP  332



>ref|XP_010052587.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Eucalyptus grandis]
Length=1011

 Score =   177 bits (450),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 129/380 (34%), Positives = 205/380 (54%), Gaps = 9/380 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +L +L+     D+  +N + ++ LGGL  LI R ++G   E+   + L S CI+AD 
Sbjct  631   AFYMLNQLVFGFDEDKNLENARYMVSLGGLNLLIKRIDVGEFQERTNAAVLTSCCIQADG  690

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DIA  1425
              CRN +A NI+K  LLE++  E  +   +A++L+ E +CL+RR +   FL G++S     
Sbjct  691   TCRNYVAENINKASLLELIVLEYQKKSTHALNLLIEFLCLSRRSEINKFLCGVKSRWGGL  750

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             N   +L  YLQ +  +++ L A+++L   LL D    ++  + A++AI  AL+   + E 
Sbjct  751   NAMQVLLIYLQRASLEKRPLFAIILLQLDLLGDCGMCSLYREEALEAIIAALDCQLVSEN  810

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
             + E   + LL+LG HF + G+ +TE W+L++ GF +  + D+    +N    G  T  DD
Sbjct  811   IQEQVARSLLMLGGHFLSTGEPVTEQWLLQKLGFPE--DPDMALHSENTV-LGTTTPRDD  867

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EEE  E W  + + +LL +G+  FL ALS+ + +G   LVR  + TV+WLS  L     
Sbjct  868   EEEET-ENWLRKTALVLLRNGR--FLTALSVAIENGIPVLVRAGIVTVSWLSRFLHLVED  924

Query  1966  sgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDT  2145
                + E    S L+ Q+   L   + LE +VLAS  LLN  K       L ++ E +   
Sbjct  925   GDLQLEAC--SILMPQMLKSLNFDRALEERVLASSSLLNLIKSSGRLSTLSVLNEELMSL  982

Query  2146  LECLAEVTWVARELQTVISS  2205
             L  L++VTW A EL   IS+
Sbjct  983   LCNLSQVTWTADELLCFIST  1002


 Score =   137 bits (344),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 120/226 (53%), Gaps = 22/226 (10%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            L++ DRI+A+H+LQVFCDSP  ART LLPDLW+++FLPHL HL++WY +E+  L S D  
Sbjct  220  LEKNDRISARHLLQVFCDSPFLARTHLLPDLWEHLFLPHLLHLRVWYTREVEFLSSSDDV  279

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF-LSPQLARNEDP  351
               RKLK L K+YN+ +D GT +FA+YYK WL  GVE PS+P V +P   S + +RN  P
Sbjct  280  EDERKLKCLSKLYNDQLDMGTARFALYYKQWLKVGVEAPSVPDVPLPLKQSHEFSRNVKP  339

Query  352  NSVSC-------IVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVT  510
                         + S++    +S  LY  VF    G +LD    +   GS     GSV 
Sbjct  340  QRTHSHRLTRRQSLDSYTTHSSISGNLYQAVF----GCQLDRRSMDLECGSRKF--GSVD  393

Query  511  EETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPK  648
            E   CS          C S  +   E   I   N       D+ PK
Sbjct  394  EGNLCSS------EENCSSTRIIHDETLRISSRNYCENQKVDLWPK  433



>ref|XP_010052589.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X3 
[Eucalyptus grandis]
 gb|KCW76670.1| hypothetical protein EUGRSUZ_D01038 [Eucalyptus grandis]
Length=983

 Score =   177 bits (449),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 129/380 (34%), Positives = 205/380 (54%), Gaps = 9/380 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +L +L+     D+  +N + ++ LGGL  LI R ++G   E+   + L S CI+AD 
Sbjct  603   AFYMLNQLVFGFDEDKNLENARYMVSLGGLNLLIKRIDVGEFQERTNAAVLTSCCIQADG  662

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DIA  1425
              CRN +A NI+K  LLE++  E  +   +A++L+ E +CL+RR +   FL G++S     
Sbjct  663   TCRNYVAENINKASLLELIVLEYQKKSTHALNLLIEFLCLSRRSEINKFLCGVKSRWGGL  722

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             N   +L  YLQ +  +++ L A+++L   LL D    ++  + A++AI  AL+   + E 
Sbjct  723   NAMQVLLIYLQRASLEKRPLFAIILLQLDLLGDCGMCSLYREEALEAIIAALDCQLVSEN  782

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
             + E   + LL+LG HF + G+ +TE W+L++ GF +  + D+    +N    G  T  DD
Sbjct  783   IQEQVARSLLMLGGHFLSTGEPVTEQWLLQKLGFPE--DPDMALHSENTV-LGTTTPRDD  839

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EEE  E W  + + +LL +G+  FL ALS+ + +G   LVR  + TV+WLS  L     
Sbjct  840   EEEET-ENWLRKTALVLLRNGR--FLTALSVAIENGIPVLVRAGIVTVSWLSRFLHLVED  896

Query  1966  sgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDT  2145
                + E    S L+ Q+   L   + LE +VLAS  LLN  K       L ++ E +   
Sbjct  897   GDLQLEAC--SILMPQMLKSLNFDRALEERVLASSSLLNLIKSSGRLSTLSVLNEELMSL  954

Query  2146  LECLAEVTWVARELQTVISS  2205
             L  L++VTW A EL   IS+
Sbjct  955   LCNLSQVTWTADELLCFIST  974


 Score =   137 bits (344),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 120/226 (53%), Gaps = 22/226 (10%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            L++ DRI+A+H+LQVFCDSP  ART LLPDLW+++FLPHL HL++WY +E+  L S D  
Sbjct  192  LEKNDRISARHLLQVFCDSPFLARTHLLPDLWEHLFLPHLLHLRVWYTREVEFLSSSDDV  251

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF-LSPQLARNEDP  351
               RKLK L K+YN+ +D GT +FA+YYK WL  GVE PS+P V +P   S + +RN  P
Sbjct  252  EDERKLKCLSKLYNDQLDMGTARFALYYKQWLKVGVEAPSVPDVPLPLKQSHEFSRNVKP  311

Query  352  NSVSC-------IVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVT  510
                         + S++    +S  LY  VF    G +LD    +   GS     GSV 
Sbjct  312  QRTHSHRLTRRQSLDSYTTHSSISGNLYQAVF----GCQLDRRSMDLECGSRKF--GSVD  365

Query  511  EETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPK  648
            E   CS          C S  +   E   I   N       D+ PK
Sbjct  366  EGNLCSS------EENCSSTRIIHDETLRISSRNYCENQKVDLWPK  405



>ref|XP_004295167.1| PREDICTED: uncharacterized protein LOC101310101 [Fragaria vesca 
subsp. vesca]
Length=258

 Score =   161 bits (407),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 147/253 (58%), Gaps = 9/253 (4%)
 Frame = +1

Query  1453  LQSSHCKQKSLVAVLILHFHLLTDTQCSNVCI--DGAIDAITVALESSFLDERLIEMCCK  1626
             LQSS   Q+ L AVL+ +  +L  T+     I    A+DAI  +L+ S  D  + E CCK
Sbjct  8     LQSSLPNQRPLAAVLLFYLDILVSTKPQEYSIYRSVAVDAIAESLDCSLTDVNVRENCCK  67

Query  1627  GLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDN-GRITMMDDGEEEVR  1803
              L ILG HFS  GK+++E WI K+A        ++ S E+ E  +    T   D E+ + 
Sbjct  68    ALRILGLHFSMSGKLLSEKWITKEA----EPNGEVNSVENEEDGSLASDTYPLDDEDNLT  123

Query  1804  EEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefe  1983
             E W   ++  LLG GKKS L  LS CL S + +LVR+CL T  WLS  L+S S S  +  
Sbjct  124   EYWLRYLTITLLGYGKKSILEILSKCLGSEHWDLVRMCLITAEWLSRALSSLSGSEFQLS  183

Query  1984  lsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAE  2163
                FS+LI  LK  L++ + +EHK+LAS+ LLNF+KI ECRVLLM   E I   L+ LAE
Sbjct  184   A--FSSLIPPLKETLKNSEHVEHKILASMSLLNFTKISECRVLLMESTEDISIPLQNLAE  241

Query  2164  VTWVARELQTVIS  2202
             VTW A+ L  +IS
Sbjct  242   VTWSAKVLYAIIS  254



>ref|XP_009353928.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Pyrus x 
bretschneideri]
Length=991

 Score =   171 bits (434),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 210/385 (55%), Gaps = 12/385 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L +LL     D   +N ++++ LGGL  L+ +   G  +E+  ++++++ C+ AD 
Sbjct  614   ALYLLNQLLTGFDEDRNLENAREVVSLGGLSLLVTKIERGETHERNNIASVIAHCVRADG  673

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQ--SDD  1419
             +CRN +A  ++K  LLE ++      S  +AI+L+ E++CL+RR   T  L+GL+  S  
Sbjct  674   SCRNYLADFLNKASLLELIVLGNGKNSTGSAIALLIEMLCLSRRTKITEILNGLKEGSRG  733

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLD  1599
             I  + ILL  YLQ +  +++ L+AV++L   L+ D   S+V  + AI+AI  AL S    
Sbjct  734   INTMQILL-VYLQRAPLEERLLIAVVLLQLDLMGDPFRSSVYREEAIEAIVEALSSRTCS  792

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             +++ +   + LL+LG  FS  G+  TE  +L+QAG+   +  +    ++N  D       
Sbjct  793   KKVQQRSSRALLMLGGRFSYTGEASTEQGLLQQAGY-SHWPRNSFHFKENVVDG---FAH  848

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
              + +E   E WQ + + +L  +G +  L ALS  +A+G   L R  L TV+W+S  + + 
Sbjct  849   SNEDEAATENWQRKTATVLFKNGNRKLLVALSDSMANGIPSLARSSLVTVSWMSRFVDAV  908

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK--IPECRVLLMMIGEV  2133
                         S L+ QL   L + + +E +VLAS  LLN +K  + E   +L  +G+ 
Sbjct  909   GDEDLGSMAC--SVLVPQLLESLNYDRDMEERVLASYTLLNLAKSSVHENVPMLSSVGKE  966

Query  2134  IEDTLECLAEVTWVARELQTVISSS  2208
             +   L+ L+ VTW A EL ++I+S+
Sbjct  967   LLRKLQNLSLVTWTANELISIITSN  991


 Score =   123 bits (309),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            +++ DR++A+H+LQVFCDS   ART  LPDLW++ FLPHL H+KIWY +E+ +L S D  
Sbjct  205  IEKNDRLSARHLLQVFCDSASSARTHFLPDLWEHFFLPHLLHVKIWYAREMDVLSSSDDG  264

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
             K +K+K + + Y+E MD GT KFA+YY +WL  G E
Sbjct  265  EKEKKMKAVARAYDEQMDMGTTKFALYYNEWLQVGAE  301



>ref|XP_003547313.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2-like isoform 
X1 [Glycine max]
 gb|KHN14364.1| Putative E3 ubiquitin-protein ligase LIN-1 [Glycine soja]
Length=983

 Score =   168 bits (426),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 148/467 (32%), Positives = 236/467 (51%), Gaps = 38/467 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L++   F +AA+L + SK     P   + L  + VPL    + RV++    +  Q L  F
Sbjct  546   LKSTSLFLKAAVLLYLSK-----PKAKQMLSSEWVPL----ILRVLE--FGDKLQTL--F  592

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             + Q    S    A  +L++LL     D+  +N +Q++ LGGL  L+ R   G  +E+   
Sbjct  593   TVQC---SPQVTAFYVLDQLLTGFDEDKNLENARQVLSLGGLTLLMRRIE-GEAHERNNA  648

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN----AISLMTELICLNRRK  1380
             + ++S CI A+  CR+ +A NI+K  LLE++    +ES QN    A+S++ EL+ L+RR 
Sbjct  649   AMIISCCIRAEGTCRSFLADNINKTSLLELIV---IESKQNSSGYALSVLAELLYLDRRT  705

Query  1381  DATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGA  1557
                 FL GL+      N+  +   YLQ S  +++ +VAV+IL   L+ D    ++    A
Sbjct  706   KTLNFLRGLKDGWGGFNVMHIFFIYLQKSPPEERPIVAVIILLLDLMDDPFKGSLYRSEA  765

Query  1558  IDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLES  1737
             I+A+  AL     ++R+ +   + L++LG HFS  G  + E  +L++AGF +        
Sbjct  766   IEALVEALNCQTCNDRVQQQSARALVLLGGHFSDSGDSLMEKSLLQKAGFREI------C  819

Query  1738  TEDNEPDNGRITMMD----DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              ED+ P    I + D    + EEE  E WQ R + +L  SGKK+ L AL+  +A+G   L
Sbjct  820   LEDSYPGK-EIVVYDPIHKNVEEEEAEIWQKRAACVLFKSGKKNLLSALADSIANGIPCL  878

Query  1906  VRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              R  L T++W+      +     +     FS L  QL   L + K +E +VLAS  LL  
Sbjct  879   ARASLITISWM--SSYLNIVEDRKLPPMVFSILRPQLLRSLNYDKDVEERVLASYSLLYL  936

Query  2086  SKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS*GRAKQ  2226
              K  EC   L  + +     L+ L+ VTW A EL ++ S S  + +Q
Sbjct  937   VKYSECVSNLPSLDKDSLTHLQNLSLVTWTANELISIFSKSSFKLRQ  983


 Score =   143 bits (361),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            LQ+ DR+++KH+LQVFCDSP  ART LLPDLW+++FLPHL H+KIWY  EL  L  E+  
Sbjct  212  LQKNDRVSSKHLLQVFCDSPSLARTYLLPDLWEHLFLPHLLHVKIWYNTELEFLSNEAHG  271

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MDTGTN FA YYK WL  G   P +P+V +P
Sbjct  272  EKEKKMKVLSKVYNEKMDTGTNLFAQYYKQWLKVGASEPPLPNVSLP  318



>ref|XP_004486432.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Cicer arietinum]
Length=946

 Score =   168 bits (426),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 226/799 (28%), Positives = 365/799 (46%), Gaps = 96/799 (12%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+ +++ +KH+LQVFC SP  ART LL DLW+++FLPHL HLKIWY  EL  L +   K
Sbjct  171   LQKNEKLCSKHLLQVFCCSPNLARTYLLNDLWNHLFLPHLLHLKIWYTSELEYLSNDGEK  230

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              +K+    KV N+  +   +     +  +  + ++      + +P +S     +   +S 
Sbjct  231   DKKM----KVLNKVYNEKMDSGTYLFGMYYKQWLKVSGASELPLPIVSLPSRPSYCRSSR  286

Query  361   SCIVGSFSPQPVVSKKLYDEVF-----RHK-------NGV-------ELD--YYKEESYG  477
                  S      ++  LY  VF     +HK       NGV       E+D   Y ++ Y 
Sbjct  287   RMSSDSTISNSSINPNLYKAVFGLKQEQHKSTSLGNQNGVLTLRKSLEIDKKLYGDDYYK  346

Query  478   GSASMSNGSVTEETHCSQIVKIEP-----YATCQSYSMPITEEAEIQEENKLVEHFSDVH  642
              S      S++ E   ++I K +P     Y  C S     TE +   + N +    +   
Sbjct  347   CSLIQKEDSISFERSSNRIDKNQPQQRLDYFKCLSCRFTPTETS--TKINYIKSKNASSI  404

Query  643   PKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQN--------TEESV----------  768
                 + E   TI ++      +  I  I KA+             T+ SV          
Sbjct  405   LSTDLVEAITTICSSDILTECEFAIRVITKAWLNSPGDPLIEEALTQHSVVEGILEVLLV  464

Query  769   ---DSERPLGLSIPTEFICPLTGL----VFEDPVT------LETGQSFERAAILNWFSKG  909
                D    L +SI  E I     +    +  DP        L +   F +AAIL + SK 
Sbjct  465   STEDEILELIISILAELITRNDAIRQIILNSDPQLEIFVRLLRSTSLFLKAAILLYLSK-  523

Query  910   NRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF--SSQFASDSKAEIAVSIL  1083
                 P+  + +  + V L    + RV++    + +Q L     S Q A       A  IL
Sbjct  524   ----PMAKQMISSEWVAL----ILRVLE--FGDKFQTLFTVQCSPQVA-------AFYIL  566

Query  1084  EKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNL  1263
             ++LL     D+  +N +QL+ LGGL  L+ R   G ++E+   +++LS C+ A+ +CR+ 
Sbjct  567   DQLLNGFDEDKNLENARQLLSLGGLTLLVKRIEGGEIHERNESASMLSCCVRAEGSCRSY  626

Query  1264  IARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DIANITI  1437
             +A N++K  LLE ++      S   A+S++ EL+ L+RR     FL GL+      N   
Sbjct  627   LADNVNKSSLLELIVLGWKQNSSGFALSVIFELLFLDRRSKILKFLRGLKEGWSGLNTMH  686

Query  1438  LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEM  1617
             +  TYLQ +  +++ LVAV++L   L+ D    ++  + AIDAI  AL     ++R+ + 
Sbjct  687   IFFTYLQKAPQEERPLVAVILLLLDLMEDNFKGSIYREEAIDAIVAALNCEMCNDRVQQQ  746

Query  1618  CCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD----D  1785
               K LL+LG  FS  G+ + E  +L++AGF +         +D+      I + D    +
Sbjct  747   SAKALLLLGGQFSYAGESLMEKLLLQKAGFQEI------CLDDSFLPCKEIVVFDSIHKN  800

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EEE  E WQ R++ +L  SG +  L AL+  +A+G   L R  LTT++W+ +      +
Sbjct  801   KEEEESESWQKRVACVLFKSGNRKLLSALANSVANGIPCLARASLTTISWI-TSYLHLIQ  859

Query  1966  sgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDT  2145
               +     AFS L   L   L +   +E +VLAS  LL+ +K   C  +L  + +     
Sbjct  860   DTTNLPPIAFSILTPILLQSLNYDYDVEERVLASYSLLHLTKNSGCVSMLPSLNKESLTH  919

Query  2146  LECLAEVTWVARELQTVIS  2202
             L  L+ VTW A EL ++ S
Sbjct  920   LRNLSLVTWTANELISIFS  938



>ref|XP_010052588.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Eucalyptus grandis]
Length=995

 Score =   167 bits (423),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 187/342 (55%), Gaps = 9/342 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +L +L+     D+  +N + ++ LGGL  LI R ++G   E+   + L S CI+AD 
Sbjct  631   AFYMLNQLVFGFDEDKNLENARYMVSLGGLNLLIKRIDVGEFQERTNAAVLTSCCIQADG  690

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DIA  1425
              CRN +A NI+K  LLE++  E  +   +A++L+ E +CL+RR +   FL G++S     
Sbjct  691   TCRNYVAENINKASLLELIVLEYQKKSTHALNLLIEFLCLSRRSEINKFLCGVKSRWGGL  750

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             N   +L  YLQ +  +++ L A+++L   LL D    ++  + A++AI  AL+   + E 
Sbjct  751   NAMQVLLIYLQRASLEKRPLFAIILLQLDLLGDCGMCSLYREEALEAIIAALDCQLVSEN  810

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
             + E   + LL+LG HF + G+ +TE W+L++ GF +  + D+    +N    G  T  DD
Sbjct  811   IQEQVARSLLMLGGHFLSTGEPVTEQWLLQKLGFPE--DPDMALHSENTV-LGTTTPRDD  867

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EEE  E W  + + +LL +G+  FL ALS+ + +G   LVR  + TV+WLS  L     
Sbjct  868   EEEET-ENWLRKTALVLLRNGR--FLTALSVAIENGIPVLVRAGIVTVSWLSRFLHLVED  924

Query  1966  sgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
                + E    S L+ Q+   L   + LE +VLAS  LLN  K
Sbjct  925   GDLQLEAC--SILMPQMLKSLNFDRALEERVLASSSLLNLIK  964


 Score =   136 bits (342),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 120/226 (53%), Gaps = 22/226 (10%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            L++ DRI+A+H+LQVFCDSP  ART LLPDLW+++FLPHL HL++WY +E+  L S D  
Sbjct  220  LEKNDRISARHLLQVFCDSPFLARTHLLPDLWEHLFLPHLLHLRVWYTREVEFLSSSDDV  279

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF-LSPQLARNEDP  351
               RKLK L K+YN+ +D GT +FA+YYK WL  GVE PS+P V +P   S + +RN  P
Sbjct  280  EDERKLKCLSKLYNDQLDMGTARFALYYKQWLKVGVEAPSVPDVPLPLKQSHEFSRNVKP  339

Query  352  NSVSC-------IVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVT  510
                         + S++    +S  LY  VF    G +LD    +   GS     GSV 
Sbjct  340  QRTHSHRLTRRQSLDSYTTHSSISGNLYQAVF----GCQLDRRSMDLECGSRKF--GSVD  393

Query  511  EETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPK  648
            E   CS          C S  +   E   I   N       D+ PK
Sbjct  394  EGNLCSS------EENCSSTRIIHDETLRISSRNYCENQKVDLWPK  433



>ref|XP_003594462.1| hypothetical protein MTR_2g028940 [Medicago truncatula]
 gb|AES64713.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=949

 Score =   165 bits (418),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 144/463 (31%), Positives = 231/463 (50%), Gaps = 29/463 (6%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L +   F +A++L + SK     P+  + +  + VPL    + RV++          +  
Sbjct  511   LRSTSLFLKASVLLYLSK-----PMAKQMISSEWVPL----ILRVLEFGDKLQTLFTVQC  561

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             S Q A       A  IL++LL     D+  +N +Q++ LGGL  LI R + G ++EK+  
Sbjct  562   SPQVA-------AFYILDQLLNGFDEDKNLENARQVLSLGGLTLLIKRIDDGEIHEKENS  614

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDAT  1389
             + ++S C+ A+ +CR+ +A NI+K  LLE ++      S   A+SL+ EL+ L+RR    
Sbjct  615   ALIISCCLRAEGSCRSYLAENINKSSLLELIVLGRKQNSSGYALSLLFELLHLDRRTKIL  674

Query  1390  YFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQC-SNVCIDGAID  1563
              FL GL+      N   +   YLQ +  +++ LVAV++L   L+ D     ++  + AI+
Sbjct  675   KFLRGLKDGWSGLNTMHIFFIYLQKAPLEERPLVAVILLMLDLMEDKHLKGSIYREEAIE  734

Query  1564  AITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE  1743
             AI  AL     D+R+ +   K LL+LG HFS  G+ + E+ +L++AGF +         E
Sbjct  735   AIVAALNCKMCDDRVQQQSAKALLLLGGHFSYAGESLMENLLLQKAGFQEF------CLE  788

Query  1744  DNEPDNGRITMMDD--GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVC  1917
             D+ P    I + D    EEE  E WQ R + +L  SG K  L AL+  +A+G   L R  
Sbjct  789   DSFPPCKEIVLYDSIHKEEEEGESWQKRAACVLFKSGNKRLLSALANSIANGIPSLARAS  848

Query  1918  LTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIP  2097
             LTT++W+           ++    AFS L  QL   L +   +E +VL+S  LL  +K  
Sbjct  849   LTTISWM--CSYLHLVEDTKLPQMAFSILTPQLLQSLNYDNDVEERVLSSYSLLYLTKYS  906

Query  2098  ECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS*GRAKQ  2226
              C  +   + +     L  L+ VTW A EL ++ S    + KQ
Sbjct  907   GCDSIFPSLNKDSLTHLRNLSLVTWTANELISIFSKRSIQLKQ  949


 Score =   105 bits (262),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 3/108 (3%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            L + DR+++KH+LQVFC SP  ART LLPDLWD++FLPHL HLKIWY  E   L  E   
Sbjct  175  LHKNDRVSSKHLLQVFCYSPNLARTYLLPDLWDHLFLPHLLHLKIWYTSEFEFLSNEFHG  234

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-TEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MD+GT  FA+YYK WL   G     +P V +P
Sbjct  235  EKEKKVKVLNKVYNEKMDSGTYLFAMYYKQWLKVSGASELPLPIVPLP  282



>ref|XP_010092647.1| hypothetical protein L484_006243 [Morus notabilis]
 gb|EXB51898.1| hypothetical protein L484_006243 [Morus notabilis]
Length=1008

 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 196/388 (51%), Gaps = 13/388 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +L+++L     D    N +Q++ LGGL  L  +  +G+  E+   +  +S CI AD 
Sbjct  615   AFYLLDQILTGFDEDRNLDNARQVVSLGGLSMLTDKIKIGDTTERINAAMFISCCIRADG  674

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DI  1422
             +CRN +A N+    L+E VL         +A  L+ ELICL+RR      L  L+     
Sbjct  675   SCRNYLAENLSIDSLIELVLLEYHRNPCGSAFDLLIELICLSRRTQINKILYILKEGWGS  734

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              NI  +L  YL+ +  +++ LVA ++L   LL D    ++  + A++AI  AL+    +E
Sbjct  735   LNIMHILLAYLRKAPSEKRPLVAAILLQLDLLEDPSKCSIYREDAVEAIIEALDCQIYNE  794

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE------DNEPDNG  1764
              + E   + LL+LG  FS  G    E+W+L+QAGF +   +    TE       N+    
Sbjct  795   NVQEQSARALLMLGGRFSYTGDATIENWLLEQAGFNEFGINSYNRTEFLKFQFSNDELVA  854

Query  1765  RITMMDD-GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLs  1941
              + + D   +EE  E WQ + +A+L  SG K  L ALS+ +++G   L R  L TV+W+ 
Sbjct  855   AVFVHDQRADEEAAENWQKKAAAVLFKSGNKRLLDALSVSISNGISSLSRASLITVSWMC  914

Query  1942  svlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK-IPEC-RVLL  2115
             + L        +      S L+ Q  A L + K +E KVLAS  LLN +K   EC  +LL
Sbjct  915   TFLHLVGDENLQLMAC--SILVPQFVASLSYDKDVEGKVLASYSLLNLTKHSAECVSMLL  972

Query  2116  MMIGEVIEDTLECLAEVTWVARELQTVI  2199
              +  + +   L+ L  VTW A EL ++I
Sbjct  973   SLDKDHLLSHLKQLRLVTWTADELLSII  1000


 Score =   128 bits (322),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 93/160 (58%), Gaps = 11/160 (7%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            ++R D     H+LQVFCDSP  ART L+PDLW++ FLPHL HLK+WY  EL  L   +  
Sbjct  214  IERNDGKCTTHLLQVFCDSPFLARTHLVPDLWEHFFLPHLLHLKVWYTNELEFLTDLECR  273

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE-PPSIPSVKIPFLSPQLARNEDP  351
             K +K+K L KVYN+ MD GT +FA+YYK WL  GVE  P +P + +P    + +R    
Sbjct  274  EKEKKMKTLSKVYNKQMDKGTVEFALYYKKWLKVGVENAPVVPLIPLPVRPYRASRRS--  331

Query  352  NSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEES  471
                  + + S    V+  LY  VF  K G + + + ++S
Sbjct  332  ------MDTCSTHSSVNNNLYRVVFGSKLGRKSENFADQS  365



>ref|XP_004486431.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Cicer arietinum]
Length=947

 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 226/800 (28%), Positives = 365/800 (46%), Gaps = 97/800 (12%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
             LQ+ +++ +KH+LQVFC SP  ART LL DLW+++FLPHL HLKIWY  EL  L +   K
Sbjct  171   LQKNEKLCSKHLLQVFCCSPNLARTYLLNDLWNHLFLPHLLHLKIWYTSELEYLSNDGEK  230

Query  181   SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSV  360
              +K+    KV N+  +   +     +  +  + ++      + +P +S     +   +S 
Sbjct  231   DKKM----KVLNKVYNEKMDSGTYLFGMYYKQWLKVSGASELPLPIVSLPSRPSYCRSSR  286

Query  361   SCIVGSFSPQPVVSKKLYDEVF-----RHK-------NGV-------ELD--YYKEESYG  477
                  S      ++  LY  VF     +HK       NGV       E+D   Y ++ Y 
Sbjct  287   RMSSDSTISNSSINPNLYKAVFGLKQEQHKSTSLGNQNGVLTLRKSLEIDKKLYGDDYYK  346

Query  478   GSASMSNGSVTEETHCSQIVKIEP-----YATCQSYSMPITEEAEIQEENKLVEHFSDVH  642
              S      S++ E   ++I K +P     Y  C S     TE +   + N +    +   
Sbjct  347   CSLIQKEDSISFERSSNRIDKNQPQQRLDYFKCLSCRFTPTETS--TKINYIKSKNASSI  404

Query  643   PKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQN--------TEESV----------  768
                 + E   TI ++      +  I  I KA+             T+ SV          
Sbjct  405   LSTDLVEAITTICSSDILTECEFAIRVITKAWLNSPGDPLIEEALTQHSVVEGILEVLLV  464

Query  769   ---DSERPLGLSIPTEFICPLTGL----VFEDPVT------LETGQSFERAAILNWFSKG  909
                D    L +SI  E I     +    +  DP        L +   F +AAIL + SK 
Sbjct  465   STEDEILELIISILAELITRNDAIRQIILNSDPQLEIFVRLLRSTSLFLKAAILLYLSK-  523

Query  910   NRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF--SSQFASDSKAEIAVSIL  1083
                 P+  + +  + V L    + RV++    + +Q L     S Q A       A  IL
Sbjct  524   ----PMAKQMISSEWVAL----ILRVLE--FGDKFQTLFTVQCSPQVA-------AFYIL  566

Query  1084  EKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNL  1263
             ++LL     D+  +N +QL+ LGGL  L+ R   G ++E+   +++LS C+ A+ +CR+ 
Sbjct  567   DQLLNGFDEDKNLENARQLLSLGGLTLLVKRIEGGEIHERNESASMLSCCVRAEGSCRSY  626

Query  1264  IARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DIANITI  1437
             +A N++K  LLE ++      S   A+S++ EL+ L+RR     FL GL+      N   
Sbjct  627   LADNVNKSSLLELIVLGWKQNSSGFALSVIFELLFLDRRSKILKFLRGLKEGWSGLNTMH  686

Query  1438  LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEM  1617
             +  TYLQ +  +++ LVAV++L   L+ D    ++  + AIDAI  AL     ++R+ + 
Sbjct  687   IFFTYLQKAPQEERPLVAVILLLLDLMEDNFKGSIYREEAIDAIVAALNCEMCNDRVQQQ  746

Query  1618  CCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD----D  1785
               K LL+LG  FS  G+ + E  +L++AGF +         +D+      I + D    +
Sbjct  747   SAKALLLLGGQFSYAGESLMEKLLLQKAGFQEI------CLDDSFLPCKEIVVFDSIHKN  800

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
              EEE  E WQ R++ +L  SG +  L AL+  +A+G   L R  LTT++W+ +      +
Sbjct  801   KEEEESESWQKRVACVLFKSGNRKLLSALANSVANGIPCLARASLTTISWI-TSYLHLIQ  859

Query  1966  sgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPE-CRVLLMMIGEVIED  2142
               +     AFS L   L   L +   +E +VLAS  LL+ +K    C  +L  + +    
Sbjct  860   DTTNLPPIAFSILTPILLQSLNYDYDVEERVLASYSLLHLTKNSAGCVSMLPSLNKESLT  919

Query  2143  TLECLAEVTWVARELQTVIS  2202
              L  L+ VTW A EL ++ S
Sbjct  920   HLRNLSLVTWTANELISIFS  939



>ref|XP_006597651.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2-like isoform 
X2 [Glycine max]
Length=982

 Score =   164 bits (414),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 148/467 (32%), Positives = 236/467 (51%), Gaps = 39/467 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L++   F +AA+L + SK     P   + L  + VPL    + RV++    +  Q L  F
Sbjct  546   LKSTSLFLKAAVLLYLSK-----PKAKQMLSSEWVPL----ILRVLE--FGDKLQTL--F  592

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             + Q    S    A  +L++LL     D+  +N +Q++ LGGL  L+ R   G  +E+   
Sbjct  593   TVQC---SPQVTAFYVLDQLLTGFDEDKNLENARQVLSLGGLTLLMRRIE-GEAHERNNA  648

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN----AISLMTELICLNRRK  1380
             + ++S CI A+  CR+ +A NI+K  LLE++    +ES QN    A+S++ EL+ L+R K
Sbjct  649   AMIISCCIRAEGTCRSFLADNINKTSLLELIV---IESKQNSSGYALSVLAELLYLDRTK  705

Query  1381  DATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGA  1557
                 FL GL+      N+  +   YLQ S  +++ +VAV+IL   L+ D    ++    A
Sbjct  706   TLN-FLRGLKDGWGGFNVMHIFFIYLQKSPPEERPIVAVIILLLDLMDDPFKGSLYRSEA  764

Query  1558  IDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLES  1737
             I+A+  AL     ++R+ +   + L++LG HFS  G  + E  +L++AGF +        
Sbjct  765   IEALVEALNCQTCNDRVQQQSARALVLLGGHFSDSGDSLMEKSLLQKAGFREI------C  818

Query  1738  TEDNEPDNGRITMMD----DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              ED+ P    I + D    + EEE  E WQ R + +L  SGKK+ L AL+  +A+G   L
Sbjct  819   LEDSYPGK-EIVVYDPIHKNVEEEEAEIWQKRAACVLFKSGKKNLLSALADSIANGIPCL  877

Query  1906  VRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              R  L T++W+      +     +     FS L  QL   L + K +E +VLAS  LL  
Sbjct  878   ARASLITISWM--SSYLNIVEDRKLPPMVFSILRPQLLRSLNYDKDVEERVLASYSLLYL  935

Query  2086  SKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS*GRAKQ  2226
              K  EC   L  + +     L+ L+ VTW A EL ++ S S  + +Q
Sbjct  936   VKYSECVSNLPSLDKDSLTHLQNLSLVTWTANELISIFSKSSFKLRQ  982


 Score =   143 bits (361),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            LQ+ DR+++KH+LQVFCDSP  ART LLPDLW+++FLPHL H+KIWY  EL  L  E+  
Sbjct  212  LQKNDRVSSKHLLQVFCDSPSLARTYLLPDLWEHLFLPHLLHVKIWYNTELEFLSNEAHG  271

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MDTGTN FA YYK WL  G   P +P+V +P
Sbjct  272  EKEKKMKVLSKVYNEKMDTGTNLFAQYYKQWLKVGASEPPLPNVSLP  318



>ref|XP_007147520.1| hypothetical protein PHAVU_006G131500g [Phaseolus vulgaris]
 gb|ESW19514.1| hypothetical protein PHAVU_006G131500g [Phaseolus vulgaris]
Length=973

 Score =   161 bits (407),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 136/451 (30%), Positives = 227/451 (50%), Gaps = 32/451 (7%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L +   F +AAIL + S+     P   + L  + VPL    + RV++    + +Q L   
Sbjct  545   LRSASLFLKAAILLYLSQ-----PKAKQMLSSEWVPL----ILRVLE--FGDKFQTLFTV  593

Query  1033  --SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKK  1206
               S Q A       A  +L++LL     D+  +N +Q++ LGGL  L+ R   G ++E+ 
Sbjct  594   QCSPQVA-------AFYVLDQLLTGFDEDKNLENARQVLSLGGLTLLMTRIE-GEVHERN  645

Query  1207  CVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKD  1383
               + ++S CI A+ +CRN +A NI+K  LLE ++      S   A+S++ EL+ L+R   
Sbjct  646   NAAMIISCCIRAEGSCRNFLADNINKTSLLELIVVGSKQNSSGYALSVLAELLYLDRGTK  705

Query  1384  ATYFLSGLQSDDIANITIL--LSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGA  1557
                FL GL+ D    I ++     YL+ +  +++ +VAV++L   L+ D    ++    A
Sbjct  706   TLNFLKGLK-DGWGGINVMHVFFIYLEKAPPEERPIVAVILLLLDLMEDPFQGSLYRSEA  764

Query  1558  IDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDR-FESDLE  1734
             I A+  AL     ++R+ +   + L +LG HFS  G+ + E  +L++AGF +  FE+   
Sbjct  765   IQALVAALNCQTCNDRVQQQSARALYLLGGHFSHSGESLMEKSLLQKAGFREICFEASYP  824

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
             +T++   D    ++  + EEE  E WQ R +++L  +G K+ L AL+  +A+G   L R 
Sbjct  825   ATDNVVYD----SIHQNVEEEEAESWQKRKASVLFKNGNKNLLSALADTIANGIPCLARA  880

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKI  2094
              L T++W+      +    +     AFS L  QL   L + K +E +VLAS  LL   K 
Sbjct  881   SLITISWM--SSYLNLIEDTMLPPMAFSILRQQLLQSLNYDKDVEERVLASYSLLYLVKY  938

Query  2095  PECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
               C   +  + +     L  L+ VTW A EL
Sbjct  939   SGCVSAVPSLDKDSLTHLRNLSLVTWTANEL  969


 Score =   127 bits (319),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            LQ+ DR+++KH+LQVFCDSP  ART LLPDLW+++FLPHL H+KIWY   L +   E+  
Sbjct  211  LQKNDRVSSKHLLQVFCDSPSFARTYLLPDLWEHLFLPHLLHVKIWYNTGLELFSNEAHG  270

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +K+KV  KVY E +D+GT  FA YYK WL  G   P +P+V +P
Sbjct  271  EKEQKMKVHNKVYKEKIDSGTILFAEYYKQWLKVGASEPPLPNVSLP  317



>gb|KDP20357.1| hypothetical protein JCGZ_06466 [Jatropha curcas]
Length=922

 Score =   159 bits (402),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 105/292 (36%), Positives = 165/292 (57%), Gaps = 9/292 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL   S D   +N  Q++ LGGL  L+  F  G+++E+  V+ L+S CI A+S
Sbjct  582   AMYFLDQLLTGFSEDRNLENASQVVSLGGLSLLVRIFEKGDIDERNNVAMLMSCCIRANS  641

Query  1249  NCRNLIARNIDKMCLLEVLC-SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DI  1422
             + RN +A N++K  LLE++      +S  +A +L+TEL+CL+RR      L+ L S    
Sbjct  642   SSRNYLADNLNKTALLELIAFGIQNKSTGSAFALLTELLCLSRRTKMIKILTELNSGWGG  701

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +   YLQ S  + + LVA ++L   +L D   S++  + A++AI  AL     + 
Sbjct  702   LNTKHIFLVYLQRSLPEDRPLVAAILLQLDVLGDPLKSSLYREDAVEAIIDALNCQNCNS  761

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ E   + LL+LG HF   GK   EDW+L +AG  +R   DL  +  NE  +G +    
Sbjct  762   KVQEQTGRALLMLGGHFLYPGKAKAEDWLLYEAGCHER-SMDLYCS--NETMHGSL----  814

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
             + EE+  E+WQ R++ +LL +G K FL ALS  +A+G   L +  L TV+WL
Sbjct  815   NEEEKALEDWQKRLAIVLLNTGNKRFLSALSNSIANGTQNLAQSSLFTVSWL  866


 Score =   140 bits (353),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 94/150 (63%), Gaps = 14/150 (9%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            L++ DRI+A+H+LQVF DSP  ART LLPDLW++ FLPHL HLKIWY KEL +L   DS 
Sbjct  196  LEKNDRISARHLLQVFSDSPFLARTHLLPDLWEHFFLPHLLHLKIWYNKELEILS--DSL  253

Query  178  -----KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARN  342
                 K +++K L   YN  MD GT +FA+YYK+WL  G + PS+P+V +P      + +
Sbjct  254  CQVVDKEKRMKALRNAYNSHMDMGTIQFALYYKEWLKVGGKAPSVPAVSLP------SGH  307

Query  343  EDPNSVSCIVGSFSPQPVVSKKLYDEVFRH  432
                S      SF+    ++KKLY  VF H
Sbjct  308  SYATSRRTSADSFTSYSSINKKLYRAVFGH  337



>ref|XP_003534762.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Glycine max]
Length=990

 Score =   158 bits (400),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 138/461 (30%), Positives = 229/461 (50%), Gaps = 38/461 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L++   F +AA+L + SK     P   + L  + VPL    + RV++          +  
Sbjct  553   LKSTSLFLKAAVLLYLSK-----PKAKQMLSSEWVPL----ILRVLEFGDKLQTLFTVQC  603

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             S Q A       A  +L+++L     D+  +N +Q++ LGGL  L+ R + G ++E+   
Sbjct  604   SPQVA-------AFYVLDQILTGFDEDKNLENARQVLSLGGLTLLMRRID-GEVHERNNA  655

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN----AISLMTELICLNRRK  1380
             + ++S CI A+ +CR+ +A NI+K  LLE++    + S QN    A+S++ EL+ L+RR 
Sbjct  656   AMIISCCIRAEGSCRSFLADNINKTSLLELIV---IGSKQNSSGYALSVLAELLYLDRRT  712

Query  1381  DATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGA  1557
                 FL GL+      N+  +   YLQ S  +++ +VAV++L   L+ D    ++    A
Sbjct  713   KTLNFLRGLKDGWGGFNVMHIFFIYLQKSPPEERPIVAVILLLLDLMEDPFKGSLHRSEA  772

Query  1558  IDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLES  1737
             I+ +  AL     ++R+ +   + L++L  HFS  G+ + E  +L++AGF +        
Sbjct  773   IETLIEALNCQTCNDRVQQQSARALVLLVGHFSDSGESLMEKLLLQKAGFREI------C  826

Query  1738  TEDNEPDNGRITMMD----DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              ED+ P    I + D    + EEE  E WQ R + +L  SG K+ L AL+  +A+G   L
Sbjct  827   LEDSYPGK-EIVVYDPIHKNVEEEEAESWQKRAACVLFKSGNKNLLSALADSIANGIPCL  885

Query  1906  VRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              R  L T++W+      +     +     FS L  QL   L + K +E +VLAS  LL  
Sbjct  886   ARASLITISWM--SSYLNMVEDRKLPPMVFSILRPQLLQSLNYDKDVEERVLASYSLLYL  943

Query  2086  SKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS  2208
              K   C   L ++ +     L  L+ VTW A EL ++ S S
Sbjct  944   VKYSGCVSNLPLLDKDSLTHLRNLSLVTWTANELISIFSKS  984


 Score =   140 bits (353),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            LQ+ DR+++KH+LQVFCDSP  ART LLPDLW+++FLPHL H KIWY  EL  L  E+  
Sbjct  219  LQKNDRVSSKHLLQVFCDSPNLARTYLLPDLWEHLFLPHLLHAKIWYNTELEFLSNEAHG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MD GTN FA YYK WL  G   P +P+V +P
Sbjct  279  QKEKKMKVLSKVYNEKMDMGTNLFAQYYKQWLKVGASEPPLPNVSLP  325



>gb|KHN22969.1| Putative E3 ubiquitin-protein ligase LIN [Glycine soja]
Length=933

 Score =   157 bits (397),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 139/467 (30%), Positives = 232/467 (50%), Gaps = 38/467 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L++   F +AA+L + SK     P   + L  + VPL    + RV++          +  
Sbjct  496   LKSTSLFLKAAVLLYLSK-----PKAKQMLSSEWVPL----ILRVLEFGDKLQTLFTVQC  546

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             S Q A       A  +L+++L     D+  +N +Q++ LGGL  L+ R + G ++E+   
Sbjct  547   SPQVA-------AFYVLDQILTGFDEDKNLENARQVLSLGGLTLLMRRID-GEVHERNNA  598

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN----AISLMTELICLNRRK  1380
             + ++S CI A+ +CR+ +A NI+K  LLE++    + S QN    A+S++ EL+ L+RR 
Sbjct  599   AMIISCCIRAEGSCRSFLADNINKTSLLELIV---IGSKQNSSGYALSVLAELLYLDRRT  655

Query  1381  DATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGA  1557
                 FL GL+      N+  +   YLQ S  +++ +VAV++L   L+ D    ++    A
Sbjct  656   KTLNFLRGLKDGWGGFNVMHIFFIYLQKSPPEERPIVAVILLLLDLMEDPFKGSLHRSEA  715

Query  1558  IDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLES  1737
             I+ +  AL     ++R+ +   + L++L  HFS  G+ + E  +L++AGF +        
Sbjct  716   IETLIEALNCQTCNDRVQQQSARALVLLVGHFSDSGESLMEKLLLQKAGFREI------C  769

Query  1738  TEDNEPDNGRITMMD----DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              ED+ P    I + D    + EEE  E WQ R + +L  SG K+ L AL+  +A+G   L
Sbjct  770   LEDSYPGK-EIVVYDPIHKNVEEEEAESWQKRAACVLFKSGNKNLLSALADSIANGIPCL  828

Query  1906  VRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              R  L T++W+      +     +     FS L  QL   L + K +E +VLAS  LL  
Sbjct  829   ARASLITISWM--SSYLNMVEDRKLPPMVFSILRPQLLQSLNYDKDVEERVLASYSLLYL  886

Query  2086  SKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS*GRAKQ  2226
              K   C   L ++ +     L  L+ VTW A EL ++ S S  + +Q
Sbjct  887   VKYSGCVSNLPLLDKDSLTHLRNLSLVTWTANELISIFSKSSFQLRQ  933


 Score =   140 bits (353),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            LQ+ DR+++KH+LQVFCDSP  ART LLPDLW+++FLPHL H KIWY  EL  L  E+  
Sbjct  162  LQKNDRVSSKHLLQVFCDSPNLARTYLLPDLWEHLFLPHLLHAKIWYNTELEFLSNEAHG  221

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MD GTN FA YYK WL  G   P +P+V +P
Sbjct  222  QKEKKMKVLSKVYNEKMDMGTNLFAQYYKQWLKVGASEPPLPNVSLP  268



>ref|XP_008383331.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Malus domestica]
Length=988

 Score =   156 bits (395),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 118/384 (31%), Positives = 209/384 (54%), Gaps = 13/384 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L++LL     D   +N ++++ LGGL  L+ +   G   E+  V+++++ C+ AD 
Sbjct  614   ALYLLDQLLTGFDEDRNLENAREVVSLGGLSLLVTKIERGETRERNNVASVIARCVRADG  673

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQ--SDDI  1422
             +CRN +A  ++K  LLE++   +     +A +L+ E++CL+RR   T  L+GL+  S  +
Sbjct  674   SCRNYLADFLNKASLLELIVLGN--GTGSAFALLIEILCLSRRTKITEILNGLKEGSGGV  731

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
               + ILL  YLQ +  +++ L+AV++L   L+ D   S+V  + AI+AI  AL S    +
Sbjct  732   NTMQILL-VYLQRAPLEERPLIAVVLLQLDLMGDPFRSSVYREEAIEAIIEALSSRTCSK  790

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ +   + LL+LG  FS  G+  TE  +L+QAG+   +  +    ++N  D        
Sbjct  791   KVQQRSSRALLMLGGRFSNTGEASTEQGLLQQAGY-SHWPRNSFHFKENVVDG---FAHS  846

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + +E   E WQ + + +L  +G +  L ALS  +A+G   L R  L TV+W+S  + +  
Sbjct  847   NEDEAATENWQRKTATVLXKNGNRKLLVALSDSMANGIPSLARSSLVTVSWMSRFVDAVG  906

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK--IPECRVLLMMIGEVI  2136
                        S L+ QL   L + + +E +VLAS  LLN +K  + +   +L  +G+ +
Sbjct  907   DEDLGSMAC--SVLVPQLLESLNYDRDVEERVLASYTLLNLAKSSVHQNVPMLSSVGKEL  964

Query  2137  EDTLECLAEVTWVARELQTVISSS  2208
                L+ L+ VTW A EL ++I+S+
Sbjct  965   LRKLQNLSLVTWTANELISIITSN  988


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 76/106 (72%), Gaps = 6/106 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            +++ DR++A+ +LQVFCDS   ART  LPDLW++ FLPHL H+KIWY +E+ +L S +  
Sbjct  205  IEKNDRLSARQLLQVFCDSASLARTHFLPDLWEHFFLPHLLHVKIWYAREMDVLSSSEDG  264

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE----PPSIP  300
             K +K+K + + Y+E MD GT +FA+YYK+WL  G E    PP+IP
Sbjct  265  EKEKKMKAVARAYDEQMDMGTTRFALYYKEWLQVGAEARPVPPTIP  310



>ref|XP_006468435.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Citrus sinensis]
 ref|XP_006468436.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Citrus sinensis]
Length=940

 Score =   154 bits (390),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 181/344 (53%), Gaps = 16/344 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  609   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  668

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS--DDI  1422
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL RR     FL  L +    +
Sbjct  669   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLARRTQMMKFLDRLNNGWGGL  728

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
             + + I L+ YLQ +  +++ LVA ++L   LL D    ++  + A+DA+T A+      E
Sbjct  729   STMHIFLA-YLQRASSEERPLVAAILLQLDLLGDPSNCSMYREEAVDALTSAMNCQTCSE  787

Query  1603  RLIEMCCKGLLILGRHFSAF-GKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             ++ E   + LL+LG  F ++  +  +E W+LK AGF +  +      ++N  +       
Sbjct  788   KIQEKSARALLMLGGLFPSYIEEATSEKWLLKLAGFNEHSDDSFYGKDENLNE-------  840

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
                EE+  E WQ + +  LL SG K FL AL+ C+ +G   L R  L TVAW+S  L S+
Sbjct  841   ---EEKATEIWQQKAAMALLKSGSKGFLAALANCMVNGTPSLARASLFTVAWMSRFLHSA  897

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
                      S  S L+  L     + + LE + LAS+ L   +K
Sbjct  898   VDENFLTTAS--SILVPPLLESSSYDRSLEERTLASLSLERLTK  939


 Score =   139 bits (350),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325



>ref|XP_006448744.1| hypothetical protein CICLE_v10014170mg [Citrus clementina]
 gb|ESR61984.1| hypothetical protein CICLE_v10014170mg [Citrus clementina]
Length=932

 Score =   154 bits (390),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 181/344 (53%), Gaps = 16/344 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  594   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  653

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS--DDI  1422
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL RR     FL  L +    +
Sbjct  654   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLARRTQMMKFLDRLNNGWGGL  713

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
             + + I L+ YLQ +  +++ LVA ++L   LL D    ++  + A+DA+T A+      E
Sbjct  714   STMHIFLA-YLQRASSEERPLVAAILLQLDLLGDPSHCSMYREEAVDALTSAMNCQTCSE  772

Query  1603  RLIEMCCKGLLILGRHFSAF-GKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             ++ E   + LL+LG  F ++  +  +E W+LK AGF +  +      ++N  +       
Sbjct  773   KIQEKSARALLMLGGLFPSYIEEATSEKWLLKLAGFNEHSDDSFYGKDENLNE-------  825

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
                EE+  E WQ + +  LL SG K FL AL+ C+ +G   L R  L TVAW+S  L S+
Sbjct  826   ---EEKATEIWQQKAAMALLKSGSKGFLAALANCMVNGTPSLARASLFTVAWMSRFLHSA  882

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
                      S  S L+  L     + + LE + LAS+ L   +K
Sbjct  883   VDENFLTTAS--SILVPPLLESSSYDRSLEERTLASLSLERLTK  924


 Score =   139 bits (350),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325



>ref|XP_006468438.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X4 [Citrus sinensis]
Length=925

 Score =   154 bits (390),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 181/344 (53%), Gaps = 16/344 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  594   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  653

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS--DDI  1422
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL RR     FL  L +    +
Sbjct  654   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLARRTQMMKFLDRLNNGWGGL  713

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
             + + I L+ YLQ +  +++ LVA ++L   LL D    ++  + A+DA+T A+      E
Sbjct  714   STMHIFLA-YLQRASSEERPLVAAILLQLDLLGDPSNCSMYREEAVDALTSAMNCQTCSE  772

Query  1603  RLIEMCCKGLLILGRHFSAF-GKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             ++ E   + LL+LG  F ++  +  +E W+LK AGF +  +      ++N  +       
Sbjct  773   KIQEKSARALLMLGGLFPSYIEEATSEKWLLKLAGFNEHSDDSFYGKDENLNE-------  825

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
                EE+  E WQ + +  LL SG K FL AL+ C+ +G   L R  L TVAW+S  L S+
Sbjct  826   ---EEKATEIWQQKAAMALLKSGSKGFLAALANCMVNGTPSLARASLFTVAWMSRFLHSA  882

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
                      S  S L+  L     + + LE + LAS+ L   +K
Sbjct  883   VDENFLTTAS--SILVPPLLESSSYDRSLEERTLASLSLERLTK  924


 Score =   139 bits (350),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325



>ref|XP_006448745.1| hypothetical protein CICLE_v10014170mg [Citrus clementina]
 gb|ESR61985.1| hypothetical protein CICLE_v10014170mg [Citrus clementina]
Length=954

 Score =   154 bits (389),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 181/344 (53%), Gaps = 16/344 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  594   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  653

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS--DDI  1422
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL RR     FL  L +    +
Sbjct  654   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLARRTQMMKFLDRLNNGWGGL  713

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
             + + I L+ YLQ +  +++ LVA ++L   LL D    ++  + A+DA+T A+      E
Sbjct  714   STMHIFLA-YLQRASSEERPLVAAILLQLDLLGDPSHCSMYREEAVDALTSAMNCQTCSE  772

Query  1603  RLIEMCCKGLLILGRHFSAF-GKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             ++ E   + LL+LG  F ++  +  +E W+LK AGF +  +      ++N  +       
Sbjct  773   KIQEKSARALLMLGGLFPSYIEEATSEKWLLKLAGFNEHSDDSFYGKDENLNE-------  825

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
                EE+  E WQ + +  LL SG K FL AL+ C+ +G   L R  L TVAW+S  L S+
Sbjct  826   ---EEKATEIWQQKAAMALLKSGSKGFLAALANCMVNGTPSLARASLFTVAWMSRFLHSA  882

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
                      S  S L+  L     + + LE + LAS+ L   +K
Sbjct  883   VDENFLTTAS--SILVPPLLESSSYDRSLEERTLASLSLERLTK  924


 Score =   139 bits (349),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325



>ref|XP_002321798.1| hypothetical protein POPTR_0015s15790g [Populus trichocarpa]
 gb|EEF05925.1| hypothetical protein POPTR_0015s15790g [Populus trichocarpa]
Length=961

 Score =   154 bits (389),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 162/296 (55%), Gaps = 19/296 (6%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL     D   +N  Q++ LGGL  L   F +G++ E+   + L+  CI A+ 
Sbjct  618   AMYFLDQLLTGFDEDRNLENASQVVSLGGLSLLARTFEVGDVIERNHAATLMLCCIRANG  677

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSD-DI  1422
             +CRN +A N++K  LLE++     ++    A +L+ EL+CL+RR     FL+GL +    
Sbjct  678   SCRNYLADNLNKTSLLELIVLGIQKNYNGCAFNLLAELLCLSRRTRIVKFLTGLNNGWGG  737

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +   YLQ S  +++ LVA ++L   LL D   S++  + A++AIT +L+      
Sbjct  738   LNTMHIFLVYLQRSSPEERPLVAAVLLQLELLGDLSKSSLYREEAVEAITESLDCP--ST  795

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ E   K LL+LG  FS  G+   EDW+L+QAGF +R        E           M 
Sbjct  796   KVQEQSSKALLMLGGCFSYNGEATAEDWLLQQAGFHERLRGSFRQKE-----------MF  844

Query  1783  DG----EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
             DG    EE+  E+WQ +++ +LL SG KSFL ALS  +A+G   LV+  L TVAW+
Sbjct  845   DGNLNEEEDAMEDWQRKVAVVLLNSGSKSFLAALSNSIANGIPNLVQSSLFTVAWM  900


 Score =   118 bits (296),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 109/198 (55%), Gaps = 17/198 (9%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DR +A+H+L VFCD+P  ART LLPDLW++  LPHL HLK+WY +EL  L      
Sbjct  217  LEKNDRTSARHLLHVFCDAPFLARTHLLPDLWEHFLLPHLLHLKVWYHEELEFLSGSQHV  276

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
               RK+K L KVYN+ MD GT +FA+YYK+WL  G + PS+P++ +P      +R+    
Sbjct  277  EMERKVKTLSKVYNDQMDMGTIQFALYYKEWLKVGAKAPSVPAIPLP------SRSSYAP  330

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFR---HKNGVELDYYKEESYGGSASMSNGSVTEETHC  525
            S+     S++ +  ++  LY  VF     +  ++ D          ASM   S+ EE  C
Sbjct  331  SMRRSSDSYNSRSSINTNLYRAVFGPTLERRSMDFDSRNR------ASMDTWSIEEEKVC  384

Query  526  SQIVKIEPYATCQSYSMP  579
                K   YAT +    P
Sbjct  385  IDEYKDSNYATYKKTRNP  402



>ref|XP_006586819.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Glycine max]
Length=989

 Score =   154 bits (388),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 138/461 (30%), Positives = 229/461 (50%), Gaps = 39/461 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L++   F +AA+L + SK     P   + L  + VPL    + RV++          +  
Sbjct  553   LKSTSLFLKAAVLLYLSK-----PKAKQMLSSEWVPL----ILRVLEFGDKLQTLFTVQC  603

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             S Q A       A  +L+++L     D+  +N +Q++ LGGL  L+ R + G ++E+   
Sbjct  604   SPQVA-------AFYVLDQILTGFDEDKNLENARQVLSLGGLTLLMRRID-GEVHERNNA  655

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN----AISLMTELICLNRRK  1380
             + ++S CI A+ +CR+ +A NI+K  LLE++    + S QN    A+S++ EL+ L+R K
Sbjct  656   AMIISCCIRAEGSCRSFLADNINKTSLLELIV---IGSKQNSSGYALSVLAELLYLDRTK  712

Query  1381  DATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGA  1557
                 FL GL+      N+  +   YLQ S  +++ +VAV++L   L+ D    ++    A
Sbjct  713   TLN-FLRGLKDGWGGFNVMHIFFIYLQKSPPEERPIVAVILLLLDLMEDPFKGSLHRSEA  771

Query  1558  IDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLES  1737
             I+ +  AL     ++R+ +   + L++L  HFS  G+ + E  +L++AGF +        
Sbjct  772   IETLIEALNCQTCNDRVQQQSARALVLLVGHFSDSGESLMEKLLLQKAGFREI------C  825

Query  1738  TEDNEPDNGRITMMD----DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              ED+ P    I + D    + EEE  E WQ R + +L  SG K+ L AL+  +A+G   L
Sbjct  826   LEDSYPGK-EIVVYDPIHKNVEEEEAESWQKRAACVLFKSGNKNLLSALADSIANGIPCL  884

Query  1906  VRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              R  L T++W+      +     +     FS L  QL   L + K +E +VLAS  LL  
Sbjct  885   ARASLITISWM--SSYLNMVEDRKLPPMVFSILRPQLLQSLNYDKDVEERVLASYSLLYL  942

Query  2086  SKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS  2208
              K   C   L ++ +     L  L+ VTW A EL ++ S S
Sbjct  943   VKYSGCVSNLPLLDKDSLTHLRNLSLVTWTANELISIFSKS  983


 Score =   140 bits (352),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            LQ+ DR+++KH+LQVFCDSP  ART LLPDLW+++FLPHL H KIWY  EL  L  E+  
Sbjct  219  LQKNDRVSSKHLLQVFCDSPNLARTYLLPDLWEHLFLPHLLHAKIWYNTELEFLSNEAHG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MD GTN FA YYK WL  G   P +P+V +P
Sbjct  279  QKEKKMKVLSKVYNEKMDMGTNLFAQYYKQWLKVGASEPPLPNVSLP  325



>gb|KEH37012.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=914

 Score =   153 bits (387),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 132/418 (32%), Positives = 212/418 (51%), Gaps = 29/418 (7%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L +   F +A++L + SK     P+  + +  + VPL    + RV++          +  
Sbjct  511   LRSTSLFLKASVLLYLSK-----PMAKQMISSEWVPL----ILRVLEFGDKLQTLFTVQC  561

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             S Q A       A  IL++LL     D+  +N +Q++ LGGL  LI R + G ++EK+  
Sbjct  562   SPQVA-------AFYILDQLLNGFDEDKNLENARQVLSLGGLTLLIKRIDDGEIHEKENS  614

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDAT  1389
             + ++S C+ A+ +CR+ +A NI+K  LLE ++      S   A+SL+ EL+ L+RR    
Sbjct  615   ALIISCCLRAEGSCRSYLAENINKSSLLELIVLGRKQNSSGYALSLLFELLHLDRRTKIL  674

Query  1390  YFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQC-SNVCIDGAID  1563
              FL GL+      N   +   YLQ +  +++ LVAV++L   L+ D     ++  + AI+
Sbjct  675   KFLRGLKDGWSGLNTMHIFFIYLQKAPLEERPLVAVILLMLDLMEDKHLKGSIYREEAIE  734

Query  1564  AITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE  1743
             AI  AL     D+R+ +   K LL+LG HFS  G+ + E+ +L++AGF +         E
Sbjct  735   AIVAALNCKMCDDRVQQQSAKALLLLGGHFSYAGESLMENLLLQKAGFQEF------CLE  788

Query  1744  DNEPDNGRITMMDD--GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVC  1917
             D+ P    I + D    EEE  E WQ R + +L  SG K  L AL+  +A+G   L R  
Sbjct  789   DSFPPCKEIVLYDSIHKEEEEGESWQKRAACVLFKSGNKRLLSALANSIANGIPSLARAS  848

Query  1918  LTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
             LTT++W+           ++    AFS L  QL   L +   +E +VL+S  LL  +K
Sbjct  849   LTTISWM--CSYLHLVEDTKLPQMAFSILTPQLLQSLNYDNDVEERVLSSYSLLYLTK  904


 Score =   105 bits (261),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 3/108 (3%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            L + DR+++KH+LQVFC SP  ART LLPDLWD++FLPHL HLKIWY  E   L  E   
Sbjct  175  LHKNDRVSSKHLLQVFCYSPNLARTYLLPDLWDHLFLPHLLHLKIWYTSEFEFLSNEFHG  234

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-TEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MD+GT  FA+YYK WL   G     +P V +P
Sbjct  235  EKEKKVKVLNKVYNEKMDSGTYLFAMYYKQWLKVSGASELPLPIVPLP  282



>ref|XP_006376995.1| hypothetical protein POPTR_0012s11910g [Populus trichocarpa]
 gb|ERP54792.1| hypothetical protein POPTR_0012s11910g [Populus trichocarpa]
Length=980

 Score =   152 bits (384),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 165/292 (57%), Gaps = 9/292 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L +LL     D   +N  Q++ LGGL FL+  F +G++ E+   + L+S CI A+ 
Sbjct  611   AMYFLGQLLTGFDEDRNLENASQVVALGGLSFLVRTFEVGDIIERNHAATLMSCCIRANG  670

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAI-SLMTELICLNRRKDATYFLSGLQSDDIA  1425
             + RN +A N++K  LL+++     +  +  + +L+ +L+CL+RR     FL+GL +    
Sbjct  671   SSRNYLAENLNKDSLLQLIVLGIQKKFKGCVFTLLADLLCLSRRTWIIKFLTGLGNGWGG  730

Query  1426  NITI-LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
               T+ +   YLQ +  ++  LVA ++L   L+ D   SN+  + A++AIT +LE      
Sbjct  731   LNTMHIFLVYLQRASPEECPLVAAVLLQLDLMGDLSQSNLYREEAVEAITESLECHNCST  790

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ E   K LL+LG  FS  G+   E+W+L+QAGF +R      S +  E  +G +    
Sbjct  791   KVQEQSAKALLMLGGCFSYSGEASAEEWLLRQAGFHERLRG---SFQRKEIVDGNL----  843

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
             + EE+  E+WQ +++ +LL SG K FL ALS  +A+G   LV+  L TVAW+
Sbjct  844   NEEEDPMEDWQRKVAVVLLNSGGKRFLSALSNSIANGIPILVQSSLFTVAWM  895


 Score =   118 bits (295),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 107/189 (57%), Gaps = 13/189 (7%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DRI+A+H+L VFCDSP  ART LLPDLW++  LPHL HLK+WY +EL  L      
Sbjct  210  LEKNDRISARHLLYVFCDSPFLARTHLLPDLWEHFLLPHLLHLKVWYHEELEALSDSQHV  269

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K R++K L KVYN+ MD GT +FA+YY +WL  G + PS+P+V +P      +R     
Sbjct  270  EKERRMKALSKVYNDHMDMGTIQFALYYNEWLKVGAKAPSVPAVPLP------SRPSYAT  323

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYY-KEESYGGSASMSNGSVTEETHCSQ  531
            S+     S+  +  ++  LY  VF    G  L+   K+      ASM   S+ E+  C  
Sbjct  324  SMRKSSDSYKSRSSINTNLYRAVF----GPTLERQSKDFDSRNRASMDTWSIEEDKVCID  379

Query  532  IVKIEPYAT  558
              K   YAT
Sbjct  380  EYKDCSYAT  388



>ref|XP_008225743.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Prunus mume]
Length=1005

 Score =   151 bits (381),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 123/384 (32%), Positives = 204/384 (53%), Gaps = 10/384 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L++LL     D   +N +Q++ LGGL  L+ +   G+ +E+   ++++S C+ AD 
Sbjct  628   ALYLLDQLLTGFDKDRNLENARQVVSLGGLSLLVTQIERGDTHERNNTASIISRCVRADG  687

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             +CRN +A  ++K  LLE ++      S  +A++L+ E++CL+RRK     L GL+     
Sbjct  688   SCRNYLADFLNKASLLELIILGNGSNSAGSAVALLIEILCLSRRKKINEILDGLKEGYGG  747

Query  1426  -NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +L  +LQ +  +++ L+A ++L   L+ D   S+V  + AI+AI  AL      E
Sbjct  748   FNTMQILLVHLQRAAPEERPLIAAILLQLDLMGDPFRSSVYREEAIEAIIAALNCQTCHE  807

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ E     LL+LG  FS  G+  TE  +L+QAGF     +     E+    +G +   +
Sbjct  808   KVQERSASALLMLGGWFSYTGEASTEHRLLQQAGFSYWPRASYHFKEN--VIDGFVHSNE  865

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             DG  E  E WQ + + +L  SG K  L ALS  +A+G   L R  L TV+W+SS L +  
Sbjct  866   DG--EATENWQRKAAIVLFKSGNKKLLVALSDSIANGVPSLARASLVTVSWMSSFLNTVG  923

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK--IPECRVLLMMIGEVI  2136
                        S L+ QL   L + + +E +VLAS  LL+ +K    E   +L  + + +
Sbjct  924   DDNLRTMAC--SILVPQLLESLNYDRDVEERVLASYSLLSLAKSSAHEYVPMLSSVDKEL  981

Query  2137  EDTLECLAEVTWVARELQTVISSS  2208
                L+ L+ VTW A EL ++I+S+
Sbjct  982   LSKLKNLSLVTWTANELISIITSN  1005


 Score =   125 bits (314),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKEL-GMLESPD-  174
            +++ D ++A+H+LQVFCDSP+ ART LLPDLW++ FLPHL H+KIWY KE  G+  S D 
Sbjct  219  IEKNDPVSARHLLQVFCDSPVLARTHLLPDLWEHFFLPHLLHVKIWYAKEADGLSNSEDP  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
             + +K+K + KVYN+ MD GT +FA+YYK+WL  GVE
Sbjct  279  EREKKMKAITKVYNDQMDMGTTQFALYYKEWLKVGVE  315



>ref|XP_011096774.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Sesamum 
indicum]
Length=992

 Score =   150 bits (378),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 126/386 (33%), Positives = 197/386 (51%), Gaps = 22/386 (6%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A   L++LL     D+  +N +Q++ +GGL  L+ R   GN  EK   ++LL  CI+A
Sbjct  618   EAAYYFLDQLLTGFDEDKNLENARQIVSVGGLSLLVRRMGEGNSGEKSRAASLLHYCIQA  677

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGL-QSDD  1419
             D +CR+ +A+N+ K  ++ +L  E  +S  +A++L+TEL+ L+ R      L+GL +  D
Sbjct  678   DGSCRHYLAKNLKKEAVVSLLVLER-QSNSHALALLTELLRLSWRNGRIESLTGLIKGWD  736

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLD  1599
               N   +L   LQ +  KQ+ ++AVL+L   L+ D    +V  + A+DAI  AL+    D
Sbjct  737   CLNTMHILLFNLQRARPKQRPIIAVLLLQLDLMGDPLEHSVYREEAVDAIVKALDCWVFD  796

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             E++ E   + L ILG HFS  G+   E W+L++A              +    N   T M
Sbjct  797   EKVQEQSARALSILGGHFSYSGEAEVETWLLRKAAV------------NENTGNTLYTHM  844

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             ++ E++  E WQ + +  LL SG +  + ALS  +A     L R  L T+ W+SS L S 
Sbjct  845   NE-EDKTMEIWQRKTAIALLTSGNRRLISALSNAMAHSIPCLARSSLVTICWISSALDSL  903

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
                         S L  QL  CL+     E K+LAS  L N  K  +    L  + +  E
Sbjct  904   GDKELYSAAC--SILAPQLIECLKDKTTAEEKILASFSLHNLGKGTDYFSWLSRLEK--E  959

Query  2140  DTLEC---LAEVTWVARELQTVISSS  2208
             + L C   L+ VTW A+EL  V++++
Sbjct  960   EVLGCLHKLSRVTWTAKELIPVVTTT  985


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLES--PD  174
            + + D+IAA+H+LQVF  SP  ART LLP+LW++ FLPHL HLKIW  KEL +L +    
Sbjct  215  IAKNDKIAARHLLQVFSVSPFLARTHLLPELWEHFFLPHLLHLKIWANKELDVLATWGYA  274

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF  318
             K +++  L + YN  MDTGT+KFA+YYKDWL  G + P  PSV +P+
Sbjct  275  DKDKRIIALNEQYNSQMDTGTSKFALYYKDWLKFGGQAPPTPSVPLPW  322



>ref|XP_003594463.1| hypothetical protein MTR_2g028940 [Medicago truncatula]
Length=939

 Score =   148 bits (374),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 141/462 (31%), Positives = 225/462 (49%), Gaps = 37/462 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L +   F +A++L + SK     P+  + +  + VPL    + RV++          +  
Sbjct  511   LRSTSLFLKASVLLYLSK-----PMAKQMISSEWVPL----ILRVLEFGDKLQTLFTVQC  561

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             S Q A       A  IL++LL     D+  +N +Q++ LGGL  LI R + G ++EK+  
Sbjct  562   SPQVA-------AFYILDQLLNGFDEDKNLENARQVLSLGGLTLLIKRIDDGEIHEKENS  614

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDAT  1389
             + ++S C+ A+ +CR+ +A NI+K  LLE ++      S   A+SL+ EL+ L+RR    
Sbjct  615   ALIISCCLRAEGSCRSYLAENINKSSLLELIVLGRKQNSSGYALSLLFELLHLDRRTKIL  674

Query  1390  YFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDA  1566
              FL GL+      N   +   YLQ +  +++ LVAV++L   L+    C  + I  A   
Sbjct  675   KFLRGLKDGWSGLNTMHIFFIYLQKAPLEERPLVAVILLMLDLM--MCCRKINISRA---  729

Query  1567  ITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTED  1746
                 +E   L  R+ +   K LL+LG HFS  G+ + E+ +L++AGF +         ED
Sbjct  730   --AYIEKKLL--RVQQQSAKALLLLGGHFSYAGESLMENLLLQKAGFQEF------CLED  779

Query  1747  NEPDNGRITMMDD--GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCL  1920
             + P    I + D    EEE  E WQ R + +L  SG K  L AL+  +A+G   L R  L
Sbjct  780   SFPPCKEIVLYDSIHKEEEEGESWQKRAACVLFKSGNKRLLSALANSIANGIPSLARASL  839

Query  1921  TTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPE  2100
             TT++W+           ++    AFS L  QL   L +   +E +VL+S  LL  +K   
Sbjct  840   TTISWM--CSYLHLVEDTKLPQMAFSILTPQLLQSLNYDNDVEERVLSSYSLLYLTKYSG  897

Query  2101  CRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS*GRAKQ  2226
             C  +   + +     L  L+ VTW A EL ++ S    + KQ
Sbjct  898   CDSIFPSLNKDSLTHLRNLSLVTWTANELISIFSKRSIQLKQ  939


 Score =   105 bits (262),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 3/108 (3%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            L + DR+++KH+LQVFC SP  ART LLPDLWD++FLPHL HLKIWY  E   L  E   
Sbjct  175  LHKNDRVSSKHLLQVFCYSPNLARTYLLPDLWDHLFLPHLLHLKIWYTSEFEFLSNEFHG  234

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-TEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MD+GT  FA+YYK WL   G     +P V +P
Sbjct  235  EKEKKVKVLNKVYNEKMDSGTYLFAMYYKQWLKVSGASELPLPIVPLP  282



>ref|XP_006468437.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X3 [Citrus sinensis]
Length=939

 Score =   148 bits (373),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 181/344 (53%), Gaps = 17/344 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  609   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  668

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS--DDI  1422
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL R +    FL  L +    +
Sbjct  669   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLARTQ-MMKFLDRLNNGWGGL  727

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
             + + I L+ YLQ +  +++ LVA ++L   LL D    ++  + A+DA+T A+      E
Sbjct  728   STMHIFLA-YLQRASSEERPLVAAILLQLDLLGDPSNCSMYREEAVDALTSAMNCQTCSE  786

Query  1603  RLIEMCCKGLLILGRHFSAF-GKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
             ++ E   + LL+LG  F ++  +  +E W+LK AGF +  +      ++N  +       
Sbjct  787   KIQEKSARALLMLGGLFPSYIEEATSEKWLLKLAGFNEHSDDSFYGKDENLNE-------  839

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
                EE+  E WQ + +  LL SG K FL AL+ C+ +G   L R  L TVAW+S  L S+
Sbjct  840   ---EEKATEIWQQKAAMALLKSGSKGFLAALANCMVNGTPSLARASLFTVAWMSRFLHSA  896

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK  2091
                      S  S L+  L     + + LE + LAS+ L   +K
Sbjct  897   VDENFLTTAS--SILVPPLLESSSYDRSLEERTLASLSLERLTK  938


 Score =   139 bits (350),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325



>ref|XP_011040367.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Populus euphratica]
Length=968

 Score =   147 bits (372),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 105/294 (36%), Positives = 167/294 (57%), Gaps = 15/294 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL     D   +N  Q++ LGGL FL   F +G++ E+   + L+  CI A+ 
Sbjct  618   AMYFLDQLLTGFDEDRNLENASQVVSLGGLSFLARAFEVGDVIERNHAATLMLCCIRANG  677

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQN--AISLMTELICLNRRKDATYFLSGLQS--D  1416
             +CRN +A N++K  LLE++    ++   N  A +L+ EL+CL+RR     FL+ L +   
Sbjct  678   SCRNYLADNLNKTSLLELIVL-GIQKKYNGCAFNLLAELLCLSRRTRIVKFLTELNNGWG  736

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
              +  + I L  YLQ S  +++ LVA ++L   LL D   S++  + A++AIT +L+    
Sbjct  737   GLNTMHIFL-VYLQRSSPEERPLVAAVLLQLELLGDLSKSSLYREEAVEAITESLDCP--  793

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
               ++ E   K LL+LG  FS  G+   E+W+L+QAGF +R      S    E  +G +  
Sbjct  794   STKVQEQSSKALLMLGGCFSFNGEATAEEWLLQQAGFHERLRG---SFRRKEIVDGNL--  848

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
               + EE+  E+WQ +++ +LL SG KSFL ALS  +A+G   LV+  L TVAW+
Sbjct  849   --NEEEDAMEDWQRKVAVVLLNSGSKSFLAALSNSIANGIPSLVQSSLFTVAWM  900


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 106/198 (54%), Gaps = 17/198 (9%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DR +A+H+L VFCD+P  ART LLPDLW++  LPHL HLK+WY +EL  L      
Sbjct  217  LEKNDRTSARHLLHVFCDAPFLARTHLLPDLWEHFLLPHLLHLKVWYHEELEFLSGTQHV  276

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
               R+ K L KVYN+ MD GT +FA+YYK+WL  G + PS+P++ +P      +R+    
Sbjct  277  EMERRAKTLSKVYNDQMDMGTIQFALYYKEWLKVGAKAPSVPAIPLP------SRSSYAP  330

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFR---HKNGVELDYYKEESYGGSASMSNGSVTEETHC  525
            S+     S+  +  ++  LY  VF     +  ++ D          ASM   S+ E   C
Sbjct  331  SMRRSSDSYYSRSSINTNLYRAVFGPTLERQSMDFDSRNR------ASMDTWSIEEGKVC  384

Query  526  SQIVKIEPYATCQSYSMP  579
                K   YAT +    P
Sbjct  385  IDEYKDCNYATNKKTRTP  402



>ref|XP_011040368.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X2 
[Populus euphratica]
Length=941

 Score =   147 bits (372),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 165/293 (56%), Gaps = 13/293 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL     D   +N  Q++ LGGL FL   F +G++ E+   + L+  CI A+ 
Sbjct  618   AMYFLDQLLTGFDEDRNLENASQVVSLGGLSFLARAFEVGDVIERNHAATLMLCCIRANG  677

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQS--DD  1419
             +CRN +A N++K  LLE++     +     A +L+ EL+CL+RR     FL+ L +    
Sbjct  678   SCRNYLADNLNKTSLLELIVLGIQKKYNGCAFNLLAELLCLSRRTRIVKFLTELNNGWGG  737

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLD  1599
             +  + I L  YLQ S  +++ LVA ++L   LL D   S++  + A++AIT +L+     
Sbjct  738   LNTMHIFL-VYLQRSSPEERPLVAAVLLQLELLGDLSKSSLYREEAVEAITESLDCP--S  794

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              ++ E   K LL+LG  FS  G+   E+W+L+QAGF +R      S    E  +G +   
Sbjct  795   TKVQEQSSKALLMLGGCFSFNGEATAEEWLLQQAGFHERLRG---SFRRKEIVDGNL---  848

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
              + EE+  E+WQ +++ +LL SG KSFL ALS  +A+G   LV+  L TVAW+
Sbjct  849   -NEEEDAMEDWQRKVAVVLLNSGSKSFLAALSNSIANGIPSLVQSSLFTVAWM  900


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 106/198 (54%), Gaps = 17/198 (9%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DR +A+H+L VFCD+P  ART LLPDLW++  LPHL HLK+WY +EL  L      
Sbjct  217  LEKNDRTSARHLLHVFCDAPFLARTHLLPDLWEHFLLPHLLHLKVWYHEELEFLSGTQHV  276

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
               R+ K L KVYN+ MD GT +FA+YYK+WL  G + PS+P++ +P      +R+    
Sbjct  277  EMERRAKTLSKVYNDQMDMGTIQFALYYKEWLKVGAKAPSVPAIPLP------SRSSYAP  330

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFR---HKNGVELDYYKEESYGGSASMSNGSVTEETHC  525
            S+     S+  +  ++  LY  VF     +  ++ D          ASM   S+ E   C
Sbjct  331  SMRRSSDSYYSRSSINTNLYRAVFGPTLERQSMDFDSRNR------ASMDTWSIEEGKVC  384

Query  526  SQIVKIEPYATCQSYSMP  579
                K   YAT +    P
Sbjct  385  IDEYKDCNYATNKKTRTP  402



>gb|EYU43698.1| hypothetical protein MIMGU_mgv1a000899mg [Erythranthe guttata]
Length=947

 Score =   147 bits (372),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 127/392 (32%), Positives = 196/392 (50%), Gaps = 47/392 (12%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A   L++LL     D+  +N KQ+I LGGL  L+ R + G+  EK   +++L  CI A
Sbjct  590   EAAYYFLDQLLTGFDEDKNLENTKQVISLGGLSLLVRRMDSGDGFEKSKAASVLYYCIRA  649

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS--D  1416
             + +CR+ +A+N+ K  +L +L    ++   +  +L+TEL+ LNRR     F+ GL    +
Sbjct  650   EGSCRHYVAKNLKKSTILSLL----VKQTNSDFALLTELLLLNRRSKREEFMRGLMKGWE  705

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
              +  + ILL   LQ +  +++ ++AV++L   L+ D+   +V  + AIDAI  AL+    
Sbjct  706   SLNTLHILLCR-LQKARPEERPVIAVILLQLDLMGDSLEYSVYREEAIDAIVEALDCQVF  764

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
             DE   ++  + L ILG HFS  G+   E W+L++AG     E  L+  E N         
Sbjct  765   DEMTQKVLARSLFILGGHFSYTGEPEIERWLLRKAG----LEQILKEEEKNT--------  812

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlas  1956
                      E W+ + + +LL SG +  L ALS  +A+G   L R  L TV W+S    S
Sbjct  813   ---------ENWERKAAVILLRSGNRRLLSALSDAIANGIPCLARASLVTVCWISDGFDS  863

Query  1957  ssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIP---------ECRV  2109
                   +F     S L+ QL   L+    +E K+LAS  L N +K           E  V
Sbjct  864   VGDKELQFAAC--SILVPQLIEYLKDNNDVEEKILASFSLHNLTKGTDYIIRQSELEKEV  921

Query  2110  LLMMIGEVIEDTLECLAEVTWVARELQTVISS  2205
             LL  IG+        L  VTW A+EL +VI++
Sbjct  922   LLSCIGK--------LVRVTWTAKELISVITT  945


 Score =   137 bits (345),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 90/145 (62%), Gaps = 9/145 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            + + D+I+A+H+LQVF DSP  ART LLP+LW++ FLPHL HLKIW+ KEL  L S    
Sbjct  208  IAKNDKISARHLLQVFVDSPFLARTHLLPELWEHFFLPHLLHLKIWFHKELDFLASSGYY  267

Query  175  -SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP  351
              K +  K L K YNE MD GT +FA YYKDWL  G + PSIPSV +P   P+  R    
Sbjct  268  TDKEKHCKALNKQYNEQMDNGTIQFAQYYKDWLKVGAQAPSIPSVPLPS-KPRSRRKSAD  326

Query  352  NSVSCIVGSFSPQPVVSKKLYDEVF  426
            +S S +  S     V +K LY  VF
Sbjct  327  SSSSTLYHS-----VTNKSLYHAVF  346



>gb|KGN66433.1| hypothetical protein Csa_1G605620 [Cucumis sativus]
Length=627

 Score =   145 bits (366),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            +Q K   +AKHILQVFC+ P QAR  L P+LWD++FLPHL H+K WY  E   L +   +
Sbjct  396  IQNKKNSSAKHILQVFCNLPFQARNGLFPELWDDLFLPHLLHIKSWYDYEADSLVNAPKQ  455

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDP---  351
            SRK K+L+KVYNET+D+ T K+AVYYKDWLT G+E P  PS+ +P +S +    E P   
Sbjct  456  SRKQKLLDKVYNETLDSSTCKYAVYYKDWLT-GIEAPE-PSIVVPAVSFEGVDQESPVNN  513

Query  352  NSVSCIVGSF-SPQPVVSKKLYDEVF  426
            +S + +   F SP  +VSKKLYD +F
Sbjct  514  SSATTLCNDFVSPNLMVSKKLYDAMF  539



>ref|XP_007213690.1| hypothetical protein PRUPE_ppa000859mg [Prunus persica]
 gb|EMJ14889.1| hypothetical protein PRUPE_ppa000859mg [Prunus persica]
Length=980

 Score =   144 bits (363),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 119/384 (31%), Positives = 197/384 (51%), Gaps = 35/384 (9%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L++LL     D   +N +Q++ LGGL  L+ +   G+ +E+  +++++S C+ AD 
Sbjct  628   ALYLLDQLLTGFDEDRNLENARQVVSLGGLSLLVTQIERGDTHERNNIASIISCCVRADG  687

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             +CRN +A  ++K  LLE ++      S  +A++L+ E++CL+RRK     L GL+     
Sbjct  688   SCRNYLADFLNKASLLELIILGNGSNSTGSAVALLIEILCLSRRKKINEILDGLKEGYGG  747

Query  1426  -NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +L  +LQ +  +++ L+A ++L   L+ D   S+V  + AI+AI  AL      E
Sbjct  748   FNTMQILLVHLQRAAPEERPLIAAILLQLDLMGDPFRSSVYREEAIEAIIAALNCQTCHE  807

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ E     LL+LG  FS  G+  TE  +L+QA                           
Sbjct  808   KVQERSASALLMLGGWFSYTGEASTEHRLLQQA---------------------------  840

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             DG  E  E WQ + + +L  SG K  L ALS  +A+G   L R  L TV+W+SS L++  
Sbjct  841   DG--EATENWQRKAAIVLFKSGNKKLLVALSDSIANGIPSLARASLVTVSWMSSFLSTVG  898

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMM--IGEVI  2136
                        S L+ QL   L + K +E +VLAS  LL+ +K      + M+  + + +
Sbjct  899   DENLRNMAC--SILVPQLLESLNYDKDVEERVLASYSLLSLAKSSAHEYVPMVSSLDKEL  956

Query  2137  EDTLECLAEVTWVARELQTVISSS  2208
                L+ L+ VTW A EL ++I+S+
Sbjct  957   VSKLKNLSLVTWTANELISIITSN  980


 Score =   125 bits (314),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML---ESP  171
            +++ D ++A+H+LQVFCDSP+ ART LLPDLW++ FLPHL H+KIWY +E  +L   E P
Sbjct  219  IEKNDPVSARHLLQVFCDSPVLARTHLLPDLWEHFFLPHLLHVKIWYAREADVLSNSEDP  278

Query  172  DSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
            + + +K+K + KVYN+ MD GT +FA+YYK+WL  GVE
Sbjct  279  E-REKKMKAITKVYNDQMDMGTTQFALYYKEWLKVGVE  315



>gb|KHG00480.1| Putative E3 ubiquitin-protein ligase LIN-1 [Gossypium arboreum]
Length=901

 Score =   144 bits (362),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 116/366 (32%), Positives = 186/366 (51%), Gaps = 30/366 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L+    F +AA+L +  +     P  ++ +  + +PLS  +L+        EH Q L   
Sbjct  507   LKNSSLFLKAAVLLYLLR-----PKANQMISTEWIPLSLRVLEF------GEHLQTLYTI  555

Query  1033  --SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKK  1206
               S Q A       A+  L++LL   + D   +N  Q++ LGGL  L+     G + E+ 
Sbjct  556   RCSPQVA-------ALYFLDQLLTGFNEDRNLENACQVVSLGGLNLLMRNVEFGGVLERN  608

Query  1207  CVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDA  1386
               + ++S CI AD +CR+ +A  ++K  L+E++     +S  + I+L+TEL+CLNRR   
Sbjct  609   KAALIISCCIRADGSCRHYVADKLNKAALIELMVGNCKDSNGSVIALLTELLCLNRRTQM  668

Query  1387  TYFLSGLQS--DDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAI  1560
               FL+ L      +  + ILL+  L  +  +++ LVA L+L   LL D    +V  + A+
Sbjct  669   MKFLNELLRGWGGLNAMHILLAC-LHKALPEERPLVAALLLQLDLLGDPFRCSVYREEAV  727

Query  1561  DAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLEST  1740
             + I   L+    +E++ +   K L +LG  FS  G+  TE W+LKQAGF +  E   +  
Sbjct  728   EVIIETLDCEKCNEKIQQQSAKALTMLGGRFSYMGEATTESWLLKQAGFHENLEDSFQKK  787

Query  1741  EDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCL  1920
             E  +        +D+GEEE+ E WQ + +  LL SG K FL ALS  +A     L R  L
Sbjct  788   EIGD------NFLDEGEEEI-ENWQKKAAIALLNSGNKRFLAALSNSMAKDIPSLARASL  840

Query  1921  TTVAWL  1938
              T+AW+
Sbjct  841   VTIAWM  846


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +1

Query  127  LKIWYIKELGMLESPDS--KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
            L++WY KEL  L +  +  K  K+K L K+YN+ MD GT  FA+YYK+WL  G +
Sbjct  207  LQVWYHKELEHLSNLGNALKETKMKALSKLYNDQMDMGTAMFAMYYKEWLKIGAK  261



>ref|XP_008225742.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X1 
[Prunus mume]
Length=1015

 Score =   143 bits (361),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 204/394 (52%), Gaps = 20/394 (5%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L++LL     D   +N +Q++ LGGL  L+ +   G+ +E+   ++++S C+ AD 
Sbjct  628   ALYLLDQLLTGFDKDRNLENARQVVSLGGLSLLVTQIERGDTHERNNTASIISRCVRADG  687

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             +CRN +A  ++K  LLE ++      S  +A++L+ E++CL+RRK     L GL+     
Sbjct  688   SCRNYLADFLNKASLLELIILGNGSNSAGSAVALLIEILCLSRRKKINEILDGLKEGYGG  747

Query  1426  -NITILLSTYLQSSHCKQKSLVAVLILHFHLL----------TDTQCSNVCIDGAIDAIT  1572
              N   +L  +LQ +  +++ L+A ++L   L+           D   S+V  + AI+AI 
Sbjct  748   FNTMQILLVHLQRAAPEERPLIAAILLQLDLMFPYGVAVLLQGDPFRSSVYREEAIEAII  807

Query  1573  VALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
              AL      E++ E     LL+LG  FS  G+  TE  +L+QAGF     +     E+  
Sbjct  808   AALNCQTCHEKVQERSASALLMLGGWFSYTGEASTEHRLLQQAGFSYWPRASYHFKEN--  865

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVA  1932
               +G +   +DG  E  E WQ + + +L  SG K  L ALS  +A+G   L R  L TV+
Sbjct  866   VIDGFVHSNEDG--EATENWQRKAAIVLFKSGNKKLLVALSDSIANGVPSLARASLVTVS  923

Query  1933  WLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSK--IPECR  2106
             W+SS L +             S L+ QL   L + + +E +VLAS  LL+ +K    E  
Sbjct  924   WMSSFLNTVGDDNLRTMAC--SILVPQLLESLNYDRDVEERVLASYSLLSLAKSSAHEYV  981

Query  2107  VLLMMIGEVIEDTLECLAEVTWVARELQTVISSS  2208
              +L  + + +   L+ L+ VTW A EL ++I+S+
Sbjct  982   PMLSSVDKELLSKLKNLSLVTWTANELISIITSN  1015


 Score =   125 bits (315),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKEL-GMLESPD-  174
            +++ D ++A+H+LQVFCDSP+ ART LLPDLW++ FLPHL H+KIWY KE  G+  S D 
Sbjct  219  IEKNDPVSARHLLQVFCDSPVLARTHLLPDLWEHFFLPHLLHVKIWYAKEADGLSNSEDP  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
             + +K+K + KVYN+ MD GT +FA+YYK+WL  GVE
Sbjct  279  EREKKMKAITKVYNDQMDMGTTQFALYYKEWLKVGVE  315



>ref|XP_007157811.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
 gb|ESW29805.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
Length=1021

 Score =   143 bits (360),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 10/149 (7%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML----ES  168
            LQ+ +RI A+H+LQVFCDSP  ART LLPDLW+++FLPHL HLKIWY +EL  L    E 
Sbjct  231  LQKNNRICARHLLQVFCDSPFLARTYLLPDLWEHVFLPHLLHLKIWYAEELDALSASTEC  290

Query  169  PDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED  348
             D+K + ++ L KVY + +DTGT  FA+YYK WL  G   PS+P V +P      +R   
Sbjct  291  QDAKEKTMRTLSKVYGKKVDTGTALFALYYKQWLKVGANEPSLPVVPLP------SRPSR  344

Query  349  PNSVSCIVGSFSPQPVVSKKLYDEVFRHK  435
             +S      SF     ++K LY EVF  K
Sbjct  345  GSSRKLSSDSFVLHSSINKNLYKEVFGPK  373


 Score =   141 bits (355),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 115/389 (30%), Positives = 186/389 (48%), Gaps = 17/389 (4%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A+  +++ L     D+  +N +Q++ LGGL FL  R   G ++ +  V+ ++ SCI A
Sbjct  630   EAAIYFIDQFLTGFDEDKNLENARQVVSLGGLTFLTKRIEEGEVHHRNNVALIIYSCIHA  689

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSD-  1416
             + +CR+ ++ NI K  LLE++   + +S    A +++ EL+ L+R      FL GL+   
Sbjct  690   EGSCRSFLSDNIKKSSLLELIVLSNSKSCSGCAFTVLAELLYLDRTTKILNFLRGLKDGW  749

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
                N   +L  YL+ +  +++ LVAV++L   ++ D    +     AI+AI VAL     
Sbjct  750   GGLNTMHILFMYLKRAPPEERPLVAVILLMLDIMEDPFKESFYRAEAIEAIVVALNCQVC  809

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE-----DNEPDN  1761
             +  + E   + LL+L  HF+  G+ + E  IL  AGF +    D    +     D+ P N
Sbjct  810   NAIIQEQSARALLLLAGHFTYTGESLMERTILHLAGFQENCIEDSSYGKEIVVYDSAPKN  869

Query  1762  GRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLs  1941
                      EE   E W+   + ++  SG  + L ALS    +G   L R  L T++W+ 
Sbjct  870   --------EEENEAETWRRTAACVMFESGNHNLLKALSDSSTNGVPSLARASLVTISWM-  920

Query  1942  svlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMM  2121
                        +F    FS L   L   L + K +E +VLAS  LL  +K   C   L  
Sbjct  921   -SSYLHLVDDRKFPPMPFSILTPLLLKSLNYDKDVEARVLASYSLLCLAKNSGCVSFLQS  979

Query  2122  IGEVIEDTLECLAEVTWVARELQTVISSS  2208
             + +     L+ L+ VTW A EL  +IS S
Sbjct  980   LDKDSIKHLQNLSLVTWTANELIEIISKS  1008



>ref|XP_007157812.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
 gb|ESW29806.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
Length=1022

 Score =   142 bits (359),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 10/149 (7%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML----ES  168
            LQ+ +RI A+H+LQVFCDSP  ART LLPDLW+++FLPHL HLKIWY +EL  L    E 
Sbjct  231  LQKNNRICARHLLQVFCDSPFLARTYLLPDLWEHVFLPHLLHLKIWYAEELDALSASTEC  290

Query  169  PDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED  348
             D+K + ++ L KVY + +DTGT  FA+YYK WL  G   PS+P V +P      +R   
Sbjct  291  QDAKEKTMRTLSKVYGKKVDTGTALFALYYKQWLKVGANEPSLPVVPLP------SRPSR  344

Query  349  PNSVSCIVGSFSPQPVVSKKLYDEVFRHK  435
             +S      SF     ++K LY EVF  K
Sbjct  345  GSSRKLSSDSFVLHSSINKNLYKEVFGPK  373


 Score =   137 bits (344),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 115/390 (29%), Positives = 186/390 (48%), Gaps = 18/390 (5%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A+  +++ L     D+  +N +Q++ LGGL FL  R   G ++ +  V+ ++ SCI A
Sbjct  630   EAAIYFIDQFLTGFDEDKNLENARQVVSLGGLTFLTKRIEEGEVHHRNNVALIIYSCIHA  689

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSD-  1416
             + +CR+ ++ NI K  LLE++   + +S    A +++ EL+ L+R      FL GL+   
Sbjct  690   EGSCRSFLSDNIKKSSLLELIVLSNSKSCSGCAFTVLAELLYLDRTTKILNFLRGLKDGW  749

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
                N   +L  YL+ +  +++ LVAV++L   ++ D    +     AI+AI VAL     
Sbjct  750   GGLNTMHILFMYLKRAPPEERPLVAVILLMLDIMEDPFKESFYRAEAIEAIVVALNCQVC  809

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTE-----DNEPDN  1761
             +  + E   + LL+L  HF+  G+ + E  IL  AGF +    D    +     D+ P N
Sbjct  810   NAIIQEQSARALLLLAGHFTYTGESLMERTILHLAGFQENCIEDSSYGKEIVVYDSAPKN  869

Query  1762  GRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLs  1941
                      EE   E W+   + ++  SG  + L ALS    +G   L R  L T++W+ 
Sbjct  870   --------EEENEAETWRRTAACVMFESGNHNLLKALSDSSTNGVPSLARASLVTISWM-  920

Query  1942  svlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPE-CRVLLM  2118
                        +F    FS L   L   L + K +E +VLAS  LL  +K    C   L 
Sbjct  921   -SSYLHLVDDRKFPPMPFSILTPLLLKSLNYDKDVEARVLASYSLLCLAKNSAGCVSFLQ  979

Query  2119  MIGEVIEDTLECLAEVTWVARELQTVISSS  2208
              + +     L+ L+ VTW A EL  +IS S
Sbjct  980   SLDKDSIKHLQNLSLVTWTANELIEIISKS  1009



>ref|XP_007157809.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
 ref|XP_007157810.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
 gb|ESW29803.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
 gb|ESW29804.1| hypothetical protein PHAVU_002G100200g [Phaseolus vulgaris]
Length=807

 Score =   142 bits (358),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 10/149 (7%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML----ES  168
            LQ+ +RI A+H+LQVFCDSP  ART LLPDLW+++FLPHL HLKIWY +EL  L    E 
Sbjct  231  LQKNNRICARHLLQVFCDSPFLARTYLLPDLWEHVFLPHLLHLKIWYAEELDALSASTEC  290

Query  169  PDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED  348
             D+K + ++ L KVY + +DTGT  FA+YYK WL  G   PS+P V +P      +R   
Sbjct  291  QDAKEKTMRTLSKVYGKKVDTGTALFALYYKQWLKVGANEPSLPVVPLP------SRPSR  344

Query  349  PNSVSCIVGSFSPQPVVSKKLYDEVFRHK  435
             +S      SF     ++K LY EVF  K
Sbjct  345  GSSRKLSSDSFVLHSSINKNLYKEVFGPK  373


 Score = 76.3 bits (186),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 86/154 (56%), Gaps = 2/154 (1%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A+  +++ L     D+  +N +Q++ LGGL FL  R   G ++ +  V+ ++ SCI A
Sbjct  630   EAAIYFIDQFLTGFDEDKNLENARQVVSLGGLTFLTKRIEEGEVHHRNNVALIIYSCIHA  689

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSD-  1416
             + +CR+ ++ NI K  LLE++   + +S    A +++ EL+ L+R      FL GL+   
Sbjct  690   EGSCRSFLSDNIKKSSLLELIVLSNSKSCSGCAFTVLAELLYLDRTTKILNFLRGLKDGW  749

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLL  1518
                N   +L  YL+ +  +++ LVAV++L   ++
Sbjct  750   GGLNTMHILFMYLKRAPPEERPLVAVILLMLDIM  783



>ref|XP_006495382.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like, partial 
[Citrus sinensis]
Length=399

 Score =   137 bits (345),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325



>ref|XP_002516406.1| hypothetical protein RCOM_1424400 [Ricinus communis]
 gb|EEF45961.1| hypothetical protein RCOM_1424400 [Ricinus communis]
Length=925

 Score =   141 bits (356),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/290 (32%), Positives = 155/290 (53%), Gaps = 50/290 (17%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL   S D+  +N  +++ LGGL FL+  F +G+++EK   + L+S CI+AD 
Sbjct  615   ALYFLDELLNGYSEDKNLENASEVVSLGGLSFLLRAFEIGDIDEKNNAAMLMSCCIQADG  674

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             +CRN +A N++K  LLE++     +S ++A +L+TEL+CLNR + A              
Sbjct  675   SCRNYLAENLNKNSLLELVALGIQKSNRSAFTLLTELLCLNRYEFA--------------  720

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                                V++ I+H          +V ++ A++AI  AL+    + ++
Sbjct  721   -------------------VSIFIIH----------SVIVEYAVEAIIEALDCHICNSKV  751

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
              E   + LL+LG HFS  G+   ++W+L+Q G  D+   DL  +  N   +G +    + 
Sbjct  752   QEKSAQALLMLGSHFSYTGEAAAKEWLLQQTGCHDK-SVDLFCS--NRIIDGNL----NE  804

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
             EE   E+WQ +++  LL +G K FL ALS  +A+G   L + CL TV+W+
Sbjct  805   EENAMEDWQRKVAIALLNTGGKRFLAALSNSIANGIQNLAQSCLYTVSWM  854


 Score =   110 bits (274),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L+R +RI+A+H+LQVF DSP  ART LLPDLW+++FLPHL HLKIWY KEL  L +    
Sbjct  212  LERNERISARHLLQVFSDSPFLARTHLLPDLWEHLFLPHLLHLKIWYNKELETLSNSQYL  271

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKI  312
             K +++K L K YNE +D GT +FA+YY++WL  G + PS P+V +
Sbjct  272  DKEKRMKALSKAYNEQIDMGTIQFALYYREWLKVGGKAPSTPAVPL  317



>ref|XP_008371843.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
 ref|XP_008371844.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
Length=984

 Score =   141 bits (355),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 115/385 (30%), Positives = 196/385 (51%), Gaps = 12/385 (3%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L++LL     D   +N  ++I LGGL  L+ +   G   E+  +++++  C+ AD 
Sbjct  607   ALYLLDQLLTGFDEDRNLENAGEVISLGGLSLLVAQIERGETYERNNIASIMVCCVRADG  666

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQ--SDD  1419
              CRN +A  ++K  LLE V+      S  +A +L  E++CL+RR   T  L GL+  S  
Sbjct  667   RCRNYLADFLNKASLLELVVLGNGKNSTGSAFTLFIEMLCLSRRTKITEILDGLKEGSGG  726

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLD  1599
                + ILL  YLQ +  +++ L+A ++L   L+ D   S+V  + AI+AI  A+      
Sbjct  727   FNTMQILL-VYLQRAPLEERPLIASVLLQLDLMGDPFRSSVYREEAIEAIIEAINCRTCH  785

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              ++ +   + L +LG  FS  G+  TE W+L+QA +   +  +    ++N  D       
Sbjct  786   GKVQQRSARALXMLGGRFSDSGEATTEHWLLQQASY-SHWPGNSFLLKENIVDG---FAH  841

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
              + +E   E WQ + + +L  SG K  L ALS  + +G   L R  L TV+W+       
Sbjct  842   SNEDEAATENWQRKTATVLFKSGNKELLMALSDSMVNGIPSLARSSLVTVSWM--SRFLD  899

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMM--IGEV  2133
             +  G +     +S L+ QL   L + + +E +VLAS  LL  +K      + M+  + + 
Sbjct  900   AVXGEDLRSMTWSLLVPQLLEYLNYDRDVEERVLASYTLLKLAKXSAHEYVPMLSSVDKD  959

Query  2134  IEDTLECLAEVTWVARELQTVISSS  2208
             +   L+ L+ VTW A EL ++I+S+
Sbjct  960   LLRKLQNLSLVTWTANELISIITSN  984


 Score =   122 bits (305),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ D+++++H+LQVFCDSP  ART L PDLW+++FLPHL H+K+WY KE   L S +  
Sbjct  205  LEKNDQLSSRHLLQVFCDSPGLARTHLJPDLWEHLFLPHLLHVKVWYAKEXDALSSXEDG  264

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
             K +K+  + +VY+E MD GT KFA+YYK+WL  G E
Sbjct  265  KKEKKMXAVTRVYDEQMDMGTTKFALYYKEWLQVGAE  301



>ref|XP_009357278.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Pyrus x 
bretschneideri]
Length=982

 Score =   140 bits (352),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 198/386 (51%), Gaps = 14/386 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L++LL     D   +N  ++I LGGL  L+ +   G  +E+  +++++  C+ AD 
Sbjct  605   ALYLLDQLLTGFDEDRNLENAGEVISLGGLSLLVAQIERGETHERNNITSIIVCCVRADG  664

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQ--SDD  1419
              CRN +A  ++K  LLE V+      +  +A +L+ E++CL+RR   T  L GL+  S  
Sbjct  665   RCRNYLADFLNKASLLELVVLGNGKNATGSAFTLLIEMLCLSRRTKITEILDGLKEGSGG  724

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLD  1599
                + ILL  YLQ +  +++ L+A ++L   L+ D   S+V  + AI+AI  A+      
Sbjct  725   FNTMQILL-VYLQRAPLEERPLIASVLLQLDLMGDPFRSSVYREEAIEAIIEAINCRTCH  783

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
               + +   + L +LG  FS  G+  TE W+L++AG+   +  +    ++N  D       
Sbjct  784   VIVQQRSARALSMLGGRFSDAGEATTEHWLLQEAGY-SHWPGNSFLFKENIVDG---FAH  839

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
              + +E   E WQ + + +L  SG K  L ALS  +A+G   L R  L TV+W+       
Sbjct  840   SNEDEAATENWQRKTATVLFKSGNKELLVALSDSMANGIPSLARSSLVTVSWM--SRFLD  897

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
             +  G +     +S L+ QL   L + + +E +VLAS  LL  +K       + M+    +
Sbjct  898   AVGGEDLRSMTWSVLVPQLLEYLNYDRDVEERVLASYTLLKLAK-SSAHEYVPMLSSADK  956

Query  2140  D---TLECLAEVTWVARELQTVISSS  2208
             D    L+ L+ VTW A EL ++I+S+
Sbjct  957   DLLRKLQNLSFVTWTANELISIITSN  982


 Score =   125 bits (313),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            L++ D+++++H+LQVFCDSP  ART LLPDLW+++FLPHL H+K+WY +E+  L S +  
Sbjct  203  LEKNDQLSSRHLLQVFCDSPGLARTHLLPDLWEHLFLPHLLHVKVWYAQEMDALSSSEDG  262

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
             K +K+K + +VY+E MD GT KFA+YYK+WL  G E
Sbjct  263  EKDKKMKAMTRVYDEQMDMGTKKFALYYKEWLQVGAE  299



>gb|KDO77448.1| hypothetical protein CISIN_1g004318mg [Citrus sinensis]
Length=695

 Score =   139 bits (349),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  594   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  653

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNR  1374
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL R
Sbjct  654   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLAR  695



>gb|KDO77449.1| hypothetical protein CISIN_1g004318mg [Citrus sinensis]
Length=704

 Score =   139 bits (349),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  594   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  653

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNR  1374
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL R
Sbjct  654   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLAR  695



>ref|XP_008459082.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-2 [Cucumis melo]
Length=1008

 Score =   139 bits (351),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 91/144 (63%), Gaps = 9/144 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESP--D  174
            +++K++I+AKH+LQVFCDSP  ART LLPDLW++ FLPHL HLK+WY +EL  + +   +
Sbjct  213  IEKKEKISAKHLLQVFCDSPFFARTHLLPDLWEHFFLPHLLHLKVWYNQELEFVSNFECE  272

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K RK K L KVYN+ MD GT +FA+YY  WL +G   P +P V+ P  S   A     +
Sbjct  273  HKDRKTKALNKVYNDHMDRGTVQFALYYIQWLKDGARAPPVPVVRSPSKSIHKASRRSSD  332

Query  355  SVSCIVGSFSPQPVVSKKLYDEVF  426
                   S+  QP  +K LY  VF
Sbjct  333  -------SYFSQPSSNKNLYHAVF  349


 Score =   128 bits (322),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 125/393 (32%), Positives = 195/393 (50%), Gaps = 28/393 (7%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A  +L++LL     D   +N + LI LGGL  L+ R   G + E+K   +++S C++A
Sbjct  612   EAAFYLLDQLLKGFDEDRNLENSRHLISLGGLSLLLRRLERGEIEERKNSVSIISCCVQA  671

Query  1243  DSNCRNLIARNIDKMCLLEVLCSE-DLESVQNAISLMTELICLNRRKDATYFLSGLQSD-  1416
             D +CRN +A N++K  LLE++  E +  S +  ++L+ +L+CL+RR   T  L GL+   
Sbjct  672   DGSCRNYLAENLNKASLLELIVHESNKNSGRGGLALLVDLLCLSRRTRITKLLDGLKEGW  731

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
                 I  +LS YLQ +  +++ LVA ++L    + D    ++  + AI  I  AL +   
Sbjct  732   SGLGIMNILSVYLQRALPEEQPLVATMLLQLDFMEDALNCSIFREEAIVTIITALNARIS  791

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
              E++ +   + LLILG  FS  G+  TE+W+LK AGF            +N  D+     
Sbjct  792   GEKVQDNLARALLILGGRFSCTGEPSTENWLLKLAGF-----------RENSGDSSHSKH  840

Query  1777  MDDG------EEEVREEWQARMSAMLLGSGKK----SFLGALSMCLASGNIELVRVCLTT  1926
             + D       EEE    WQ + + +L   G K    S   +++ C+      L + CL T
Sbjct  841   LYDDVVLLYEEEEEVVNWQLKAATVLFNHGHKSLLSSLSTSMTSCVRPS---LAKACLIT  897

Query  1927  VAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECR  2106
             ++W+S  L               S L+  L   L H K +E +VLAS  LLN  K  EC+
Sbjct  898   LSWMSRYLFVIRDEKLCLMAP--SILVPALIKYLNHDKAVEDQVLASYSLLNLGKYTECK  955

Query  2107  VLLMMIGEVIEDTLECLAEVTWVARELQTVISS  2205
              +  +  E   D L  L+ VTW A EL  +I+S
Sbjct  956   HIFRLFDEEALDHLRNLSLVTWTAEELILIITS  988



>gb|KDO77447.1| hypothetical protein CISIN_1g004318mg [Citrus sinensis]
Length=761

 Score =   139 bits (349),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L + DRI+A+H+LQVFCDSP  +RT LLPDLW++ FLPHL HLK+WY KEL +L + D  
Sbjct  219  LDKNDRISARHLLQVFCDSPYLSRTHLLPDLWEHFFLPHLLHLKVWYHKELELLSNLDYG  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +++K L K +N+ MD GT +FA+YYK+WL  G + P++PSV +P
Sbjct  279  EKDKRMKALGKAFNDRMDMGTTQFALYYKNWLKIGAQLPAVPSVPLP  325


 Score = 86.3 bits (212),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 89/153 (58%), Gaps = 3/153 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A   LE+L+     D+  +N + ++  GGL  L+ R   G ++E++  ++++  CI+AD 
Sbjct  594   AFYFLEQLVNGFDEDKNFENARAVVSHGGLALLVGRIEKGEIHERQNTASIIICCIQADE  653

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQS--DDI  1422
              CR+ +A N++K  LLE++  E+    + AI+L+TEL+CL RR     FL  L +    +
Sbjct  654   KCRSYLAENLNKASLLELIVLENHNCNRCAIALLTELLCLARRTQMMKFLDRLNNGWGGL  713

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLT  1521
             + + I L+ YLQ +  +++ LVA ++L   LL 
Sbjct  714   STMHIFLA-YLQRASSEERPLVAAILLQLDLLV  745



>ref|XP_003556483.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Glycine max]
 gb|KHN20491.1| Putative E3 ubiquitin-protein ligase LIN-like protein [Glycine 
soja]
Length=1009

 Score =   139 bits (350),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 118/382 (31%), Positives = 194/382 (51%), Gaps = 7/382 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL     D   +N +Q++ LGGL  L+ R   G ++E+   + ++ SCI A+ 
Sbjct  630   AIYFLDQLLTGFDEDRNLENARQVVSLGGLTLLMKRIEEGEIHERNNAAFIIYSCIHAEE  689

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSD-DI  1422
             +CR+ +A NI K  LLE++   + ++    A S++ EL+ L+R      FL GL+     
Sbjct  690   SCRSFLADNIKKSSLLELIVLGNSKNCSGCAFSVLAELLYLDRTTKILNFLRGLKDGWGG  749

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +L  YLQ +  ++  LVAV++L F ++ D    ++    AI+AI  AL     ++
Sbjct  750   LNTMHILFIYLQRAPPEECPLVAVVLLLFDIMEDPFKESLYRAEAIEAIVAALNCQVCND  809

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ E   + LL+L  HFS  G+ + E  +L+QAGF    E+ LE +   +      +   
Sbjct  810   KIQEQSARALLLLAGHFSYTGESLMERTLLQQAGFQ---ENCLEDSSYGKEIVVYDSAHK  866

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + E++  E W+   + +LL SG K+ L  LS   A+G   L R  L T++W+        
Sbjct  867   NEEDDEAESWRRTAANVLLKSGNKNLLSVLSDSAANGVPSLARASLVTISWM--SSYLHL  924

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
                 +    A S L+  L   L + K +E +VLAS  LL   KI  C   L  + +    
Sbjct  925   VDDRKLPPMALSILMPLLLKYLNYDKDVEARVLASYSLLCLVKISGCVSFLSSLDKDSLK  984

Query  2143  TLECLAEVTWVARELQTVISSS  2208
              L+ L+ VTW + EL ++IS S
Sbjct  985   HLQNLSLVTWTSNELISIISKS  1006


 Score =   138 bits (347),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 114/214 (53%), Gaps = 12/214 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML----ES  168
            LQ+ +RI A+H+LQVFCDSP  ART LLPDLW+++FLPHL HLKIWY +EL  +    E 
Sbjct  236  LQKNNRICARHLLQVFCDSPFLARTYLLPDLWEHVFLPHLLHLKIWYAEELDAVSASSEC  295

Query  169  PDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED  348
               K +K+K L KVY   +DTGT  FA+YYK WL  G   P +P V +P      +R   
Sbjct  296  QGEKDKKMKTLSKVYGNKVDTGTAMFALYYKQWLKVGANEPPLPIVSLP------SRPSC  349

Query  349  PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCS  528
             +S      SF     ++  LY EVF  K  +E+         G  ++   S   E  CS
Sbjct  350  RSSRKMSSDSFVLHSSINTNLYKEVFGPK--LEMKPTPLAEQNGLLTIRWSSRNHEYSCS  407

Query  529  QIVKIEPYATCQSYSMPITEEAEIQEENKLVEHF  630
             + K E     +S        AEI+  ++ +++F
Sbjct  408  SLQKEETIYLGRSSRSIDKSYAEIRLGSQRLDNF  441



>ref|XP_006605524.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Glycine max]
Length=1010

 Score =   138 bits (347),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 114/214 (53%), Gaps = 12/214 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML----ES  168
            LQ+ +RI A+H+LQVFCDSP  ART LLPDLW+++FLPHL HLKIWY +EL  +    E 
Sbjct  236  LQKNNRICARHLLQVFCDSPFLARTYLLPDLWEHVFLPHLLHLKIWYAEELDAVSASSEC  295

Query  169  PDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNED  348
               K +K+K L KVY   +DTGT  FA+YYK WL  G   P +P V +P      +R   
Sbjct  296  QGEKDKKMKTLSKVYGNKVDTGTAMFALYYKQWLKVGANEPPLPIVSLP------SRPSC  349

Query  349  PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCS  528
             +S      SF     ++  LY EVF  K  +E+         G  ++   S   E  CS
Sbjct  350  RSSRKMSSDSFVLHSSINTNLYKEVFGPK--LEMKPTPLAEQNGLLTIRWSSRNHEYSCS  407

Query  529  QIVKIEPYATCQSYSMPITEEAEIQEENKLVEHF  630
             + K E     +S        AEI+  ++ +++F
Sbjct  408  SLQKEETIYLGRSSRSIDKSYAEIRLGSQRLDNF  441


 Score =   135 bits (339),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 118/383 (31%), Positives = 194/383 (51%), Gaps = 8/383 (2%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL     D   +N +Q++ LGGL  L+ R   G ++E+   + ++ SCI A+ 
Sbjct  630   AIYFLDQLLTGFDEDRNLENARQVVSLGGLTLLMKRIEEGEIHERNNAAFIIYSCIHAEE  689

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSD-DI  1422
             +CR+ +A NI K  LLE++   + ++    A S++ EL+ L+R      FL GL+     
Sbjct  690   SCRSFLADNIKKSSLLELIVLGNSKNCSGCAFSVLAELLYLDRTTKILNFLRGLKDGWGG  749

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              N   +L  YLQ +  ++  LVAV++L F ++ D    ++    AI+AI  AL     ++
Sbjct  750   LNTMHILFIYLQRAPPEECPLVAVVLLLFDIMEDPFKESLYRAEAIEAIVAALNCQVCND  809

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
             ++ E   + LL+L  HFS  G+ + E  +L+QAGF    E+ LE +   +      +   
Sbjct  810   KIQEQSARALLLLAGHFSYTGESLMERTLLQQAGFQ---ENCLEDSSYGKEIVVYDSAHK  866

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + E++  E W+   + +LL SG K+ L  LS   A+G   L R  L T++W+        
Sbjct  867   NEEDDEAESWRRTAANVLLKSGNKNLLSVLSDSAANGVPSLARASLVTISWM--SSYLHL  924

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPE-CRVLLMMIGEVIE  2139
                 +    A S L+  L   L + K +E +VLAS  LL   KI   C   L  + +   
Sbjct  925   VDDRKLPPMALSILMPLLLKYLNYDKDVEARVLASYSLLCLVKISAGCVSFLSSLDKDSL  984

Query  2140  DTLECLAEVTWVARELQTVISSS  2208
               L+ L+ VTW + EL ++IS S
Sbjct  985   KHLQNLSLVTWTSNELISIISKS  1007



>gb|KCW76671.1| hypothetical protein EUGRSUZ_D01038 [Eucalyptus grandis]
Length=783

 Score =   136 bits (342),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 120/226 (53%), Gaps = 22/226 (10%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDS-  177
            L++ DRI+A+H+LQVFCDSP  ART LLPDLW+++FLPHL HL++WY +E+  L S D  
Sbjct  192  LEKNDRISARHLLQVFCDSPFLARTHLLPDLWEHLFLPHLLHLRVWYTREVEFLSSSDDV  251

Query  178  -KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF-LSPQLARNEDP  351
               RKLK L K+YN+ +D GT +FA+YYK WL  GVE PS+P V +P   S + +RN  P
Sbjct  252  EDERKLKCLSKLYNDQLDMGTARFALYYKQWLKVGVEAPSVPDVPLPLKQSHEFSRNVKP  311

Query  352  NSVSC-------IVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVT  510
                         + S++    +S  LY  VF    G +LD    +   GS     GSV 
Sbjct  312  QRTHSHRLTRRQSLDSYTTHSSISGNLYQAVF----GCQLDRRSMDLECGSRKF--GSVD  365

Query  511  EETHCSQIVKIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHPK  648
            E   CS          C S  +   E   I   N       D+ PK
Sbjct  366  EGNLCSS------EENCSSTRIIHDETLRISSRNYCENQKVDLWPK  405


 Score = 89.7 bits (221),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A  +L +L+     D+  +N + ++ LGGL  LI R ++G   E+   + L S CI+AD 
Sbjct  603   AFYMLNQLVFGFDEDKNLENARYMVSLGGLNLLIKRIDVGEFQERTNAAVLTSCCIQADG  662

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSD-DIA  1425
              CRN +A NI+K  LLE++  E  +   +A++L+ E +CL+RR +   FL G++S     
Sbjct  663   TCRNYVAENINKASLLELIVLEYQKKSTHALNLLIEFLCLSRRSEINKFLCGVKSRWGGL  722

Query  1426  NITILLSTYLQSSHCKQKSLVAVL  1497
             N   +L  YLQ +  +++ L A++
Sbjct  723   NAMQVLLIYLQRASLEKRPLFAII  746



>gb|AFK12759.1| Ubox-like protein, partial [Helianthus annuus]
Length=208

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+K+RI AKH+LQ+FCDSP  ART+L+P+LW+N+F PHLSHL+ WY +E+  L      
Sbjct  119  LQKKERIVAKHLLQMFCDSPFSARTTLVPELWENVFXPHLSHLESWYNQEVNSLADDPHN  178

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWL  270
            +RKLK L+KVY + +D+GT +FA+YYKDW+
Sbjct  179  TRKLKQLKKVYYDILDSGTYQFALYYKDWI  208



>gb|AFK12757.1| Ubox-like protein, partial [Helianthus petiolaris]
Length=208

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+K+RI AKH+LQ+FCDSP  ART+L+P+LW+N+F PHLSHL+ WY +E+  L      
Sbjct  119  LQKKERIVAKHLLQMFCDSPFSARTTLVPELWENVFHPHLSHLEXWYNQEVNSLADDPHN  178

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWL  270
            +RKLK L+KVY + +D+GT +FA+YYKDW+
Sbjct  179  TRKLKQLKKVYYDILDSGTYQFALYYKDWI  208



>gb|AFK12758.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12760.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12761.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12762.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12763.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12764.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12765.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12766.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12767.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12768.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12769.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12770.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12771.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12772.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12773.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12774.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12775.1| Ubox-like protein, partial [Helianthus annuus]
 gb|AFK12776.1| Ubox-like protein, partial [Helianthus annuus]
Length=208

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ+K+RI AKH+LQ+FCDSP  ART+L+P+LW+N+F PHLSHL+ WY +E+  L      
Sbjct  119  LQKKERIVAKHLLQMFCDSPFSARTTLVPELWENVFHPHLSHLESWYNQEVNSLADDPHN  178

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWL  270
            +RKLK L+KVY + +D+GT +FA+YYKDW+
Sbjct  179  TRKLKQLKKVYYDILDSGTYQFALYYKDWI  208



>ref|XP_009782517.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Nicotiana 
sylvestris]
Length=1004

 Score =   131 bits (330),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 214/407 (53%), Gaps = 19/407 (5%)
 Frame = +1

Query  1018  HLLAFSSQFAS-----DSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFN  1182
              +L F+ Q  +      S  E A  +L++LL     D+  +N +Q+I LGGL  L+ R  
Sbjct  598   RVLEFADQLQTLFTVQRSPQEAAYYLLDQLLTGFDEDKNFENCRQVISLGGLGLLLRRVE  657

Query  1183  LGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAI-SLMTEL  1359
             +G+++EK  V +++  CI++D +CR+ +A N++K  LL +L  ++ ++ +  I + +TEL
Sbjct  658   MGDVSEKSKVVSVMYYCIQSDGSCRHYLANNLNKDYLLPLLLLQNQQNARGHIFAFLTEL  717

Query  1360  ICLNRRKDATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCS  1536
             +C++++     FL GL S   + N   +   YLQ +  +++ +++V++L   LL D    
Sbjct  718   LCIDKQIQRIEFLRGLLSGWGMVNTLHIFLVYLQRAQPEERPVISVILLQLDLLGDPNEC  777

Query  1537  NVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDR  1716
             +V  +  ID I  AL+    +E++     K L ILG  FS  G  + E  +LK+AG+   
Sbjct  778   SVYREEVIDEIIKALDCQVFNEKVQVQSAKALHILGSCFSYTGVPIVEQLLLKEAGYD--  835

Query  1717  FESDLESTEDNEPDNGRI---TMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
                  E+T D+      I    M  + EEE    WQ + + +LL SG K  L +L   +A
Sbjct  836   -----ENTGDSYHGKNIILNSYMNLNEEEEATRNWQRKTARVLLNSGSKRLLASLVDTIA  890

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLAS  2067
             +G   L R  L TV+W+S+   S    G    +   S LI +L   L++   +E +VLAS
Sbjct  891   NGIPCLGRASLVTVSWMSNFFCSIEDKGVRSVVC--SELIPELIKLLKYNNAIEERVLAS  948

Query  2068  VCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVISSS  2208
             + LL  +   +    L  + + +   L  L+EVTW A+EL ++ISSS
Sbjct  949   LSLLKLANNSDYLAKLSPLDKELISDLHKLSEVTWTAKELISIISSS  995


 Score =   115 bits (288),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DRIAA+H+LQVF DSP  ART LLP+LW+++FLPHL HLKIW+ +E+ +  + D  
Sbjct  221  LEKNDRIAARHLLQVFVDSPFLARTHLLPELWEHLFLPHLLHLKIWHTQEVEVFSTLDCV  280

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFL---SPQLARNE  345
             K +++K L KVYN+ +D GT KFA+YYK WL  G + P++PSV +P+    SP   R+ 
Sbjct  281  DKEKQMKALNKVYNDHIDIGTTKFALYYKQWLKVGSQAPAVPSVPLPYKVGHSPSRRRSL  340

Query  346  D  348
            D
Sbjct  341  D  341



>gb|EEC77864.1| hypothetical protein OsI_17130 [Oryza sativa Indica Group]
Length=658

 Score =   130 bits (326),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 125/210 (60%), Gaps = 12/210 (6%)
 Frame = +1

Query  1567  ITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTED  1746
             IT +L  S  +E ++    K LL+LG HFS  G ++ ED +LKQAGF+D        ++ 
Sbjct  456   ITHSLRCSLSEENVVANIRKALLLLGGHFSFSGDLLAEDRMLKQAGFVDGSRVTRADSDA  515

Query  1747  NEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTT  1926
                D GR       E+EV   W   ++A LLGSG++ FL ALSMC++S N +L   CLTT
Sbjct  516   AVQDKGR------DEDEV---WLRDVTAALLGSGRRPFLEALSMCMSSPNHDLAAACLTT  566

Query  1927  VAWLssvlasssrsgsefelsaFSALICQLKACLEHGK-LLEHKVLASVCLLNFSKIPEC  2103
              AWLS  LAS   +  +     FSALI +LK  L   +   +H+VLASV L NFSKIP+C
Sbjct  567   AAWLSRSLASIDAADVQLAA--FSALIPRLKQRLAGDRSQAQHRVLASVTLYNFSKIPDC  624

Query  2104  RVLLMMIGEVIEDTLECLAEVTWVARELQT  2193
             R LLM++ + + D L  LAE+TW A +L T
Sbjct  625   RALLMLLADGLRDHLVELAELTWTAGQLIT  654


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (58%), Gaps = 11/137 (8%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQ KD  +A H+L+ FC +P +ARTSLLP LWD +F   LSHLK W  +E     S D+ 
Sbjct  235  LQEKDHSSAVHVLEAFCLAPHEARTSLLPALWDRLFRSGLSHLKAWRDRESATAASSDT-  293

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWL---TEGVEPPSIPSVKIPFLSPQL----AR  339
              ++K +EK++ E +D GT   A YY+DWL   ++ +  P  P+     L+  L    + 
Sbjct  294  --RVKDVEKMFVEAVDDGTRALACYYRDWLLGRSQAMSLPVFPAPPSTVLASALRFSTST  351

Query  340  NEDPNS-VSCIVGSFSP  387
            + D  S V+C  GS+SP
Sbjct  352  SYDIGSDVACSSGSYSP  368



>ref|XP_002972675.1| hypothetical protein SELMODRAFT_413195 [Selaginella moellendorffii]
 gb|EFJ25896.1| hypothetical protein SELMODRAFT_413195 [Selaginella moellendorffii]
Length=1405

 Score =   131 bits (330),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 98/402 (24%), Positives = 175/402 (44%), Gaps = 74/402 (18%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELG-MLESPDS  177
             L+  DR AA+++L++F   P Q+R    P LW+ +F  HL+ +  WY ++   +L +P S
Sbjct  133   LRSDDRRAAENLLEMFIAEPFQSRVDFAPGLWEALFQRHLTGISSWYSEQRAKLLAAPSS  192

Query  178   K--------------------------------------------SRKLKVLEKVYNETM  225
             +                                            + +L+VLE++Y  T+
Sbjct  193   QDHATLGHGGDYSVDFPSYSRDDFFAVSTDEVALNNLLSAVTPEQAAQLQVLEELYQNTL  252

Query  226   DTGTNKFAVYYKDWLT-------------EGVEPPSIPSVKIPFLSPQLA------RNED  348
             D  T ++A +Y+D L                 EPP+   V  P L  QL        +E+
Sbjct  253   DDHTRQYAKFYRDCLRLPSSQLKVVKPLLPTAEPPATDEVFQP-LKAQLEVIQEHESDEE  311

Query  349   PNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGSVTEETHCS  528
              +  + +V     Q   S+++ D    HK+  +       +    AS+S  S  ++    
Sbjct  312   RDGDNELVNDTETQLSFSRQIKD----HKSSEDKKQPASATSSNGASLSRSSSFDKMSER  367

Query  529   QIVKIEPYATCQSYSMPITEEAEIQEENKLVE-HFSDVHPKPSIQEIYGTIDAAPHSKVI  705
                   P +   S S   +     Q+ ++    + S++       E   +++   H   I
Sbjct  368   SHEHAHPMSRSSSISAEFSRPGAQQKTSRSCSFNRSELDTSERSLERRSSLNHVEHLNSI  427

Query  706   KIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAA  885
                  R    +  +++     D+     +  P +F+CP+T  +F+DPVTLETGQ++ER A
Sbjct  428   S----RDGDIYDEERSVTSETDAYERRMVRPPKDFVCPITNQLFDDPVTLETGQTYERTA  483

Query  886   ILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEH  1011
             I  W  +GN TCPIT + L+ +A+P +N++LKR+++ W+  H
Sbjct  484   IREWLERGNTTCPITRQLLKNRALPSTNYVLKRLVENWKEIH  525


 Score =   104 bits (260),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 170/374 (45%), Gaps = 14/374 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLI-CLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEAD  1245
             AV +L++L  VS+  ER  +   L+  L  +  LI      +++E+    ++L  C+EAD
Sbjct  740   AVGLLQQL--VSTSPERPHSSAHLLLALEAVPILIENLKAKDIDERLSTISVLLCCMEAD  797

Query  1246  SNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
               CRNLI+R      ++E+L      + + A     EL   NRR+     L+ ++++ I 
Sbjct  798   GRCRNLISRTAQLGPVVEILVRGSGSARELATFFFLELAHSNRRETNNKVLTTVKNEGIL  857

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             +   +L    Q +  + K  +AVL+L   +L   +  ++  + A+DAI  AL      + 
Sbjct  858   STMHVLFVACQKAPIEHKHTIAVLMLQLEILGQRRQQSIYKEEALDAIVAALSRESPFDC  917

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
              +E     + ++GR FS  G  +TE W+LK AG    +E  L + ED + +         
Sbjct  918   QVETAEALVALVGR-FSYAGTPLTEAWLLKLAGLEQPYE--LLTNEDPQQEREAAEEK--  972

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
                     W+   + + L     + L AL   L S N+EL + C+    WLS V+     
Sbjct  973   ----AANLWELNAARVFLEFEGGAILEALGAMLQSKNLELWKPCMIFAVWLSFVVKKLPS  1028

Query  1966  sgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDT  2145
             SG       +   +      LE  K ++ KVLA++ L  F   PE    L+   + +   
Sbjct  1029  SGLRPYFRRY--FLAPFVVALESAKNVQQKVLAALGLHTFLDDPESMQELIGYAKDVVKP  1086

Query  2146  LECLAEVTWVAREL  2187
             L  L +VTW+A+E 
Sbjct  1087  LRQLKKVTWIAQEF  1100



>gb|KGN66908.1| hypothetical protein Csa_1G713660 [Cucumis sativus]
Length=1008

 Score =   131 bits (329),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 199/387 (51%), Gaps = 16/387 (4%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A  +L++LL     D   +N + LI LGGL  L+ R   G + E+K   +++S CI+A
Sbjct  612   EAAFYLLDQLLKGFDEDRNLENSRHLIALGGLSLLLRRLERGEIEERKNSVSIISCCIQA  671

Query  1243  DSNCRNLIARNIDKMCLLEVLCSE-DLESVQNAISLMTELICLNRRKDATYFLSGLQSD-  1416
             D +CRN +A N++K  LLE++  E +  S +  ++L+ +L+CL+RR   T  L GL+   
Sbjct  672   DGSCRNYLAENLNKASLLELVVHESNKNSDRGGLALLVDLLCLSRRTRITKLLDGLKEGW  731

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
                 I  +LS YLQ +  +++ LVA  +L    + D    ++  + AI  I  AL +   
Sbjct  732   SGLGIMNILSVYLQRALPEEQPLVATTLLQLDFMEDALNCSIFREEAIVTIITALNARIC  791

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
              E+  +   + LLILG  FS  G+  TE+W+LK AGF    E+  +S+      +  + +
Sbjct  792   GEKAQDNLARALLILGGRFSCTGEPSTENWLLKLAGFK---ENSGDSSHSKHLYDDVVQL  848

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKK----SFLGALSMCLASGNIELVRVCLTTVAWLss  1944
              ++ EEEV   WQ + +++L   G K    S   +++ C+      L + CL T++W+S 
Sbjct  849   YEE-EEEVM-NWQLKAASVLFNHGHKSLLSSLSTSMTSCIRPS---LAKACLITLSWMSR  903

Query  1945  vlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMI  2124
              L               S L+  L   L H K +E +VLAS  LLN  K  EC+ +  + 
Sbjct  904   YLFVIREEKLCLMAP--SILVPPLIKYLNHDKAVEDQVLASYSLLNLGKYTECKHIFRLF  961

Query  2125  GEVIEDTLECLAEVTWVARELQTVISS  2205
              +   D L  L+ VTW A EL  +I+S
Sbjct  962   DDEALDHLRNLSLVTWTAEELILIITS  988


 Score =   124 bits (312),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 103/176 (59%), Gaps = 15/176 (9%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESP--D  174
            +++ +R++AKH+LQVFCDSP  ART LLPDLW++ FLPHL HLK+WY +EL  + +   +
Sbjct  213  IEKNERVSAKHLLQVFCDSPYFARTHLLPDLWEHFFLPHLLHLKVWYNQELEFVSNFECE  272

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K RK+K L KVYN+ MD GT +FA+YY  WL +G   P +P V  P  S   A     +
Sbjct  273  HKDRKIKALNKVYNDHMDRGTVQFALYYIQWLKDGARAPPVPVVPSPSKSIHKASRRSSD  332

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGS--ASMSNGSVTEE  516
                   S+  QP  +K LY  VF    G  LD    E   G+  A+M+  S  +E
Sbjct  333  -------SYFSQPSSNKNLYHAVF----GPSLDQQLAELRRGNLVAAMARSSHEKE  377



>ref|XP_009628932.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Nicotiana 
tomentosiformis]
Length=1006

 Score =   130 bits (327),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 124/400 (31%), Positives = 211/400 (53%), Gaps = 19/400 (5%)
 Frame = +1

Query  1018  HLLAFSSQFAS-----DSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFN  1182
              +L F+ Q  +      S  E A  +L++LL     D+  +N +Q+I LGGL  L+ R  
Sbjct  600   RVLEFADQLQTLFTVQRSPQEAAYFLLDQLLTGFDEDKNFENCRQVISLGGLGLLLRRVE  659

Query  1183  LGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAI-SLMTEL  1359
             +G+++EK  V +++  C+++D +CR+ +A N++K CLL +L  ++ ++ +  I + +TEL
Sbjct  660   MGDVSEKSKVVSVMYCCVQSDGSCRHYLANNLNKDCLLPLLLLQNQQNARGHIFAFLTEL  719

Query  1360  ICLNRRKDATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCS  1536
             +C++++      L GL S   + N   +L  YLQ +   ++ +++V++L   LL D    
Sbjct  720   LCIDKQIQRIELLRGLLSGWGMVNTLHILLVYLQRAQPDERPIISVILLQLDLLGDPNEC  779

Query  1537  NVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDR  1716
             +V  +  I+ I  AL+    +E++     + LLILG  FS  G+ + E  +LK+AG+   
Sbjct  780   SVYREEVIEEIIKALDCQVFNEKVQVQSARALLILGSCFSYTGEPIVEQLLLKEAGYD--  837

Query  1717  FESDLESTEDNEPDNGRI---TMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
                  E+T D+      I    M  + EEE    WQ + + +LL SG K  L AL   +A
Sbjct  838   -----ENTGDSYLGKNFILNSYMHLNEEEEATRNWQRKTARVLLNSGSKRLLAALVDTIA  892

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLAS  2067
             +G   L R  L TV+W+S+   S    G    +   S LI  L   L++  ++E +VLAS
Sbjct  893   NGIPCLGRASLVTVSWMSNFFCSIEDKGVRSVVC--SELIPDLMKLLKYNNVIEERVLAS  950

Query  2068  VCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
             + LL  +   +  V L  + + +   L  L+EVTW A+EL
Sbjct  951   LSLLKLANNSDYLVKLSPLDKELISDLHKLSEVTWTAKEL  990


 Score =   120 bits (302),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 118/205 (58%), Gaps = 21/205 (10%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DRIAA+H+LQVF DSP  ART LLP+LW+++FLPHL HLKIW+ +E+ +  + D  
Sbjct  221  LEKNDRIAARHLLQVFVDSPFLARTHLLPELWEHLFLPHLLHLKIWHTQEVEVFSTLDCV  280

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF-LSPQLARNEDP  351
             K +++K L KVYN+ +D GT KFA+YYK WL  G + P++PSV +P+ L   L+R    
Sbjct  281  DKEKQMKALNKVYNDHIDIGTTKFALYYKQWLKVGAQAPAVPSVPLPYKLGHSLSRRRSL  340

Query  352  NSV---------SCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGSASMSNGS  504
            +S          S     F   P++ +K  D V   +NG+  DY +EE    +    N  
Sbjct  341  DSFTSNSSVKNNSLYRAVFG--PIMERKSMDSV---RNGI-WDYKEEEEKISAIGDDN--  392

Query  505  VTEETHCSQIVKIEPYATCQSYSMP  579
              +  +  +   +   ++ QSY  P
Sbjct  393  -KQGNYVPKKAVVHRRSSTQSYRTP  416



>ref|XP_006353070.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Solanum 
tuberosum]
Length=1008

 Score =   128 bits (321),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 116/403 (29%), Positives = 209/403 (52%), Gaps = 27/403 (7%)
 Frame = +1

Query  1021  LLAFSSQFAS-----DSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNL  1185
             +L F+ Q  +      S  E A  +L++LL     D+  +N +Q+I LGGL  L+ R   
Sbjct  602   VLEFADQLQTLFTVQRSPQEAAYYLLDQLLTGFDEDKNFENCRQVISLGGLSLLLRRVET  661

Query  1186  GNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAI-SLMTELI  1362
             GN++EK  V++++  C+++D +CR+ +A+N++K CLL +L  ++  + +  + + +TEL+
Sbjct  662   GNVSEKSKVASVMYYCVQSDGSCRHYLAKNLNKDCLLPLLLLQNQHNTRGHVFAFLTELL  721

Query  1363  CLNRRKDATYFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSN  1539
             C++++     FL GL S   + N   +L  YLQ +  +++ +++ ++L   LL D    +
Sbjct  722   CIDKQIQRIEFLRGLLSGWGMVNTLHILLLYLQRAQQEERPIISAILLQLDLLGDPNECS  781

Query  1540  VCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRF  1719
             V  +  I+ I   L+    +E++     + LLILG  FS  G+ + E  +LK+AG+    
Sbjct  782   VYREEVIEEIIKVLDCQVFNEKVQVQSARALLILGSCFSYAGEPVVEQCLLKEAGY----  837

Query  1720  ESDLESTEDNEPDN--GRITMMD-----DGEEEVREEWQARMSAMLLGSGKKSFLGALSM  1878
                    ++N  D+  G+  +++     + EEE    WQ + + +LL SG K  L  L  
Sbjct  838   -------DENAGDSYLGKNFILNSSTNLNEEEEATRNWQRKTAIVLLNSGNKRLLSGLVD  890

Query  1879  CLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKV  2058
              +A+G   L R  L TV W+              +   +S LI +L   L++   +E +V
Sbjct  891   SIANGIPCLGRASLVTVTWM--SNFFCFIEDKGVQSLVYSELIPELIKLLKYNNAIEERV  948

Query  2059  LASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
             LAS+ LL  +   +    L  + + + + L  L+EVTW A+EL
Sbjct  949   LASLSLLKLANNSDYLAKLSPLDKELINDLHKLSEVTWTAKEL  991


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 95/145 (66%), Gaps = 9/145 (6%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DRIAA+H+LQVF DSP  ART LLP+LW+++FLPHL HLKIW+ +EL +L S +  
Sbjct  220  LEKNDRIAARHLLQVFVDSPYLARTHLLPELWEHLFLPHLLHLKIWHTQELEVLSSLEYA  279

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPF-LSPQLARNEDP  351
             K + +K L K+YN+ +D GT KFA+YYK WL  G + P++PSV +P  +    +R    
Sbjct  280  EKEKHMKALNKLYNDHVDIGTTKFALYYKQWLKVGAQAPAVPSVPLPSKVGYSTSRRRSM  339

Query  352  NSVSCIVGSFSPQPVVSKKLYDEVF  426
            +SV+      S   V +  LY  VF
Sbjct  340  DSVT------SNSSVKNNSLYHAVF  358



>ref|XP_007147519.1| hypothetical protein PHAVU_006G131500g [Phaseolus vulgaris]
 gb|ESW19513.1| hypothetical protein PHAVU_006G131500g [Phaseolus vulgaris]
Length=772

 Score =   126 bits (317),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            LQ+ DR+++KH+LQVFCDSP  ART LLPDLW+++FLPHL H+KIWY   L +   E+  
Sbjct  211  LQKNDRVSSKHLLQVFCDSPSFARTYLLPDLWEHLFLPHLLHVKIWYNTGLELFSNEAHG  270

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIP  315
             K +K+KV  KVY E +D+GT  FA YYK WL  G   P +P+V +P
Sbjct  271  EKEQKMKVHNKVYKEKIDSGTILFAEYYKQWLKVGASEPPLPNVSLP  317


 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 113/220 (51%), Gaps = 25/220 (11%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L +   F +AAIL + S+     P   + L  + VPL    + RV++    + +Q L   
Sbjct  545   LRSASLFLKAAILLYLSQ-----PKAKQMLSSEWVPL----ILRVLE--FGDKFQTLFTV  593

Query  1033  --SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKK  1206
               S Q A       A  +L++LL     D+  +N +Q++ LGGL  L+ R   G ++E+ 
Sbjct  594   QCSPQVA-------AFYVLDQLLTGFDEDKNLENARQVLSLGGLTLLMTRIE-GEVHERN  645

Query  1207  CVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKD  1383
               + ++S CI A+ +CRN +A NI+K  LLE ++      S   A+S++ EL+ L+R   
Sbjct  646   NAAMIISCCIRAEGSCRNFLADNINKTSLLELIVVGSKQNSSGYALSVLAELLYLDRGTK  705

Query  1384  ATYFLSGLQSDDIANITIL--LSTYLQSSHCKQKSLVAVL  1497
                FL GL+ D    I ++     YL+ +  +++ +VAV+
Sbjct  706   TLNFLKGLK-DGWGGINVMHVFFIYLEKAPPEERPIVAVI  744



>ref|XP_008225744.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN isoform X3 
[Prunus mume]
Length=808

 Score =   125 bits (314),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 2/97 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKEL-GMLESPD-  174
            +++ D ++A+H+LQVFCDSP+ ART LLPDLW++ FLPHL H+KIWY KE  G+  S D 
Sbjct  219  IEKNDPVSARHLLQVFCDSPVLARTHLLPDLWEHFFLPHLLHVKIWYAKEADGLSNSEDP  278

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVE  285
             + +K+K + KVYN+ MD GT +FA+YYK+WL  GVE
Sbjct  279  EREKKMKAITKVYNDQMDMGTTQFALYYKEWLKVGVE  315


 Score = 86.7 bits (213),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 89/156 (57%), Gaps = 2/156 (1%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+ +L++LL     D   +N +Q++ LGGL  L+ +   G+ +E+   ++++S C+ AD 
Sbjct  628   ALYLLDQLLTGFDKDRNLENARQVVSLGGLSLLVTQIERGDTHERNNTASIISRCVRADG  687

Query  1249  NCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
             +CRN +A  ++K  LLE ++      S  +A++L+ E++CL+RRK     L GL+     
Sbjct  688   SCRNYLADFLNKASLLELIILGNGSNSAGSAVALLIEILCLSRRKKINEILDGLKEGYGG  747

Query  1426  -NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQ  1530
              N   +L  +LQ +  +++ L+A ++L   L+   Q
Sbjct  748   FNTMQILLVHLQRAAPEERPLIAAILLQLDLMERHQ  783



>ref|XP_004145484.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cucumis 
sativus]
 ref|XP_004170877.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Cucumis 
sativus]
Length=863

 Score =   125 bits (313),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 103/176 (59%), Gaps = 15/176 (9%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESP--D  174
            +++ +R++AKH+LQVFCDSP  ART LLPDLW++ FLPHL HLK+WY +EL  + +   +
Sbjct  213  IEKNERVSAKHLLQVFCDSPYFARTHLLPDLWEHFFLPHLLHLKVWYNQELEFVSNFECE  272

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
             K RK+K L KVYN+ MD GT +FA+YY  WL +G   P +P V  P  S   A     +
Sbjct  273  HKDRKIKALNKVYNDHMDRGTVQFALYYIQWLKDGARAPPVPVVPSPSKSIHKASRRSSD  332

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEESYGGS--ASMSNGSVTEE  516
                   S+  QP  +K LY  VF    G  LD    E   G+  A+M+  S  +E
Sbjct  333  -------SYFSQPSSNKNLYHAVF----GPSLDQQLAELRRGNLVAAMARSSHEKE  377


 Score = 91.3 bits (225),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 121/217 (56%), Gaps = 2/217 (1%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E A  +L++LL     D   +N + LI LGGL  L+ R   G + E+K   +++S CI+A
Sbjct  612   EAAFYLLDQLLKGFDEDRNLENSRHLIALGGLSLLLRRLERGEIEERKNSVSIISCCIQA  671

Query  1243  DSNCRNLIARNIDKMCLLEVLCSE-DLESVQNAISLMTELICLNRRKDATYFLSGLQSD-  1416
             D +CRN +A N++K  LLE++  E +  S +  ++L+ +L+CL+RR   T  L GL+   
Sbjct  672   DGSCRNYLAENLNKASLLELVVHESNKNSDRGGLALLVDLLCLSRRTRITKLLDGLKEGW  731

Query  1417  DIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFL  1596
                 I  +LS YLQ +  +++ LVA  +L    + D    ++  + AI  I  AL +   
Sbjct  732   SGLGIMNILSVYLQRALPEEQPLVATTLLQLDFMEDALNCSIFREEAIVTIITALNARIC  791

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF  1707
              E+  +   + LLILG  FS  G+  TE+W+LK AGF
Sbjct  792   GEKAQDNLARALLILGGRFSCTGEPSTENWLLKLAGF  828



>ref|XP_006374716.1| hypothetical protein POPTR_0015s15790g [Populus trichocarpa]
 ref|XP_006374717.1| hypothetical protein POPTR_0015s15790g [Populus trichocarpa]
 gb|ERP52513.1| hypothetical protein POPTR_0015s15790g [Populus trichocarpa]
 gb|ERP52514.1| hypothetical protein POPTR_0015s15790g [Populus trichocarpa]
Length=732

 Score =   118 bits (295),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 109/198 (55%), Gaps = 17/198 (9%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPD--  174
            L++ DR +A+H+L VFCD+P  ART LLPDLW++  LPHL HLK+WY +EL  L      
Sbjct  217  LEKNDRTSARHLLHVFCDAPFLARTHLLPDLWEHFLLPHLLHLKVWYHEELEFLSGSQHV  276

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPN  354
               RK+K L KVYN+ MD GT +FA+YYK+WL  G + PS+P++ +P      +R+    
Sbjct  277  EMERKVKTLSKVYNDQMDMGTIQFALYYKEWLKVGAKAPSVPAIPLP------SRSSYAP  330

Query  355  SVSCIVGSFSPQPVVSKKLYDEVFR---HKNGVELDYYKEESYGGSASMSNGSVTEETHC  525
            S+     S++ +  ++  LY  VF     +  ++ D          ASM   S+ EE  C
Sbjct  331  SMRRSSDSYNSRSSINTNLYRAVFGPTLERRSMDFDSRNR------ASMDTWSIEEEKVC  384

Query  526  SQIVKIEPYATCQSYSMP  579
                K   YAT +    P
Sbjct  385  IDEYKDSNYATYKKTRNP  402


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 64/109 (59%), Gaps = 1/109 (1%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             A+  L++LL     D   +N  Q++ LGGL  L   F +G++ E+   + L+  CI A+ 
Sbjct  618   AMYFLDQLLTGFDEDRNLENASQVVSLGGLSLLARTFEVGDVIERNHAATLMLCCIRANG  677

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATY  1392
             +CRN +A N++K  LLE++     ++    A +L+ EL+CL+R + +++
Sbjct  678   SCRNYLADNLNKTSLLELIVLGIQKNYNGCAFNLLAELLCLSRYEFSSF  726



>sp|C6L7U1.2|LIN1_LOTJA RecName: Full=Putative E3 ubiquitin-protein ligase LIN-1; AltName: 
Full=Protein cerberus [Lotus japonicus]
Length=1485

 Score =   117 bits (294),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 152/644 (24%), Positives = 294/644 (46%), Gaps = 60/644 (9%)
 Frame = +1

Query  313   PFLSPQLARNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEES---YGGS  483
             P L+ + +    P   SC   +     + +++   +   HKN    DY ++ S      +
Sbjct  583   PELAQEFSNVNTPRGSSCSPSAKDIPMLSTRQRTTDSPNHKNK---DYARQRSNRFMPAA  639

Query  484   ASMSNGSVTEETHCSQIVK-IEPYAT--CQSYSMPITEEAEIQ-----EENKLVEHFSDV  639
              + S  SV  +     IV  ++PY +  C S ++P  EEA ++     +++K        
Sbjct  640   ITTSPTSVLSQAAVETIVNSLKPYISSLCTSENLPECEEAVLKIARLLKDSKTNPQIHSY  699

Query  640   HPKPSIQEIYGTID---AAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEF  810
               KP+I  I G ++   A+ + +V++  I  +++  F   +  E+++S       + ++F
Sbjct  700   LSKPTI--INGLVEILSASRNREVLRTSIYILSELIFTDDSVAETLNS-------VDSDF  750

Query  811   ICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVI  990
              C  T L                AA+L +     +  P+ ++    + +P        ++
Sbjct  751   DCLATLL----------KNGLAEAALLIY-----QLRPVFAQLSAHELIP-------SLV  788

Query  991   DKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLI  1170
             D  ++++ + L  F  Q   D K + A++ILE+ L+      R+ N   +I   G+  L+
Sbjct  789   DVIQNKN-EELDDF--QLVIDPK-DAAIAILEQTLMGGDEYSRSLNASSVISANGIPTLV  844

Query  1171  HRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLM  1350
                 L  +  ++ V ++L  C++A+ +C+NLIA  I+   +LE+  S +       +  +
Sbjct  845   KY--LERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCVEFL  902

Query  1351  TELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQ  1530
             +EL+ LNRR      L  ++ +   +       YLQ +  + +  VA L+L   LL + +
Sbjct  903   SELVQLNRRTSCNQILHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLAEPR  962

Query  1531  CSNVCIDGAIDAITVAL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF  1707
               ++  + A++ +  AL +  F + ++  +    LL L  H S+ GK  TE W+LK AGF
Sbjct  963   KMSIYREEAVETLIEALWQKDFSNTQMKAL--DALLFLIGHISSSGKSYTEAWLLKIAGF  1020

Query  1708  IDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
                + + ++  +  + DN  I  M+D E+     WQ R++++L      S   AL  CL 
Sbjct  1021  DQPYNALMKVEQLGQHDNDLIETMED-EKNALNSWQKRIASVLCNHENGSIFKALEECLK  1079

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLAS  2067
             S ++++ + CL    WL+ +L +   +G         +L+ ++   L+  K LE K+LA+
Sbjct  1080  SNSLKMAKSCLVLATWLTHMLYTLPDTGVRDVAR--KSLLEEVINVLQSSKNLEEKILAT  1137

Query  2068  VCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             + L  F   P     L +  + I  TL  L + + VA ++  VI
Sbjct  1138  LALKTFISDPSTHEALRVYAKSIYRTLRRLKKYSVVAVDIMKVI  1181


 Score = 95.1 bits (235),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  507   MGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSASILPK  566

Query  964   SNFILKRVIDKWRSEHWQHLLAFSS  1038
             +N++LKR+I  W+ ++ +    FS+
Sbjct  567   TNYVLKRLITSWKEQNPELAQEFSN  591


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 52/130 (40%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H L++F   P   R    P+LW ++FLPH+S +  WY +E   L M   PDS        
Sbjct  145  HALEMFIVDPFFTRIDFAPELWKSLFLPHMSSIVGWYSEERHRLMMEVIPDSADLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y E++D  T  +A YY D +             
Sbjct  205  FEQFFNESLVLTMRPHQLEKLQKLEQLYGESLDENTKLYAKYYNDCMNSDSSSSKKAVPM  264

Query  280  ---VEPPSIP  300
                EPP  P
Sbjct  265  LPIAEPPMTP  274



>dbj|BAH86605.1| U-box protein with unknown function [Lotus japonicus]
 dbj|BAH86606.1| U-box protein with unknown function [Lotus japonicus]
Length=1477

 Score =   117 bits (294),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 152/644 (24%), Positives = 294/644 (46%), Gaps = 60/644 (9%)
 Frame = +1

Query  313   PFLSPQLARNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEES---YGGS  483
             P L+ + +    P   SC   +     + +++   +   HKN    DY ++ S      +
Sbjct  575   PELAQEFSNVNTPRGSSCSPSAKDIPMLSTRQRTTDSPNHKNK---DYARQRSNRFMPAA  631

Query  484   ASMSNGSVTEETHCSQIVK-IEPYAT--CQSYSMPITEEAEIQ-----EENKLVEHFSDV  639
              + S  SV  +     IV  ++PY +  C S ++P  EEA ++     +++K        
Sbjct  632   ITTSPTSVLSQAAVETIVNSLKPYISSLCTSENLPECEEAVLKIARLLKDSKTNPQIHSY  691

Query  640   HPKPSIQEIYGTID---AAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEF  810
               KP+I  I G ++   A+ + +V++  I  +++  F   +  E+++S       + ++F
Sbjct  692   LSKPTI--INGLVEILSASRNREVLRTSIYILSELIFTDDSVAETLNS-------VDSDF  742

Query  811   ICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVI  990
              C  T L                AA+L +     +  P+ ++    + +P        ++
Sbjct  743   DCLATLL----------KNGLAEAALLIY-----QLRPVFAQLSAHELIP-------SLV  780

Query  991   DKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLI  1170
             D  ++++ + L  F  Q   D K + A++ILE+ L+      R+ N   +I   G+  L+
Sbjct  781   DVIQNKN-EELDDF--QLVIDPK-DAAIAILEQTLMGGDEYSRSLNASSVISANGIPTLV  836

Query  1171  HRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLM  1350
                 L  +  ++ V ++L  C++A+ +C+NLIA  I+   +LE+  S +       +  +
Sbjct  837   KY--LERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCVEFL  894

Query  1351  TELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQ  1530
             +EL+ LNRR      L  ++ +   +       YLQ +  + +  VA L+L   LL + +
Sbjct  895   SELVQLNRRTSCNQILHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLAEPR  954

Query  1531  CSNVCIDGAIDAITVAL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF  1707
               ++  + A++ +  AL +  F + ++  +    LL L  H S+ GK  TE W+LK AGF
Sbjct  955   KMSIYREEAVETLIEALWQKDFSNTQMKAL--DALLFLIGHISSSGKSYTEAWLLKIAGF  1012

Query  1708  IDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
                + + ++  +  + DN  I  M+D E+     WQ R++++L      S   AL  CL 
Sbjct  1013  DQPYNALMKVEQLGQHDNDLIETMED-EKNALNSWQKRIASVLCNHENGSIFKALEECLK  1071

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLAS  2067
             S ++++ + CL    WL+ +L +   +G         +L+ ++   L+  K LE K+LA+
Sbjct  1072  SNSLKMAKSCLVLATWLTHMLYTLPDTGVRDVAR--KSLLEEVINVLQSSKNLEEKILAT  1129

Query  2068  VCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             + L  F   P     L +  + I  TL  L + + VA ++  VI
Sbjct  1130  LALKTFISDPSTHEALRVYAKSIYRTLRRLKKYSVVAVDIMKVI  1173


 Score = 95.1 bits (235),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  499   MGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSASILPK  558

Query  964   SNFILKRVIDKWRSEHWQHLLAFSS  1038
             +N++LKR+I  W+ ++ +    FS+
Sbjct  559   TNYVLKRLITSWKEQNPELAQEFSN  583


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 52/130 (40%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H L++F   P   R    P+LW ++FLPH+S +  WY +E   L M   PDS        
Sbjct  137  HALEMFIVDPFFTRIDFAPELWKSLFLPHMSSIVGWYSEERHRLMMEVIPDSADLSFTAD  196

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y E++D  T  +A YY D +             
Sbjct  197  FEQFFNESLVLTMRPHQLEKLQKLEQLYGESLDENTKLYAKYYNDCMNSDSSSSKKAVPM  256

Query  280  ---VEPPSIP  300
                EPP  P
Sbjct  257  LPIAEPPMTP  266



>ref|XP_010104461.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
 gb|EXC00994.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
Length=1555

 Score =   117 bits (293),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 112/445 (25%), Positives = 181/445 (41%), Gaps = 119/445 (27%)
 Frame = +1

Query  31    HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
             H+L++F   P  +R    P+LW ++FL H+  +  WY +E   L M   PDS        
Sbjct  213   HVLEMFIVDPFFSRIDFAPELWKDLFLQHMGSIAGWYSEERHRLVMEVIPDSSDLSFTID  272

Query  184   ----------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG------------  279
                              KL+ LE+++ E++D  T  +A Y+KD L               
Sbjct  273   LDQFFNESLIFRPDQVEKLQKLEQLFGESLDESTRLYAKYFKDCLNSDSTNTGRKVIPML  332

Query  280   --VEPP---------SIPS-VKI-----------PFLSPQLARNEDPNSVSCIVG-SFSP  387
                EPP         SIP  VK            PFL  + +  E     S + G S +P
Sbjct  333   PIAEPPMTPLHEVSRSIPDFVKFGPVLPKSAGFAPFLKAKDSIRETSRGPSIMSGTSITP  392

Query  388   QPVVSKKLYDEVFRHKNGVELDYYKEE-------------SYGGSASMSNGSVTEETHCS  528
             Q   S+    E    +N  E DY +++             S G S ++++    E    S
Sbjct  393   QNRESRWDPQEGLLEENEDESDYDQDDASMDSNDKAQRLHSPGSSKTINDKETEENVQTS  452

Query  529   QIVKI-------EPYATCQSYSMPITE-EAEIQEEN------------KLVEHFS--DVH  642
             ++  +        P+ + + +   ++  + E+Q  N            +L +  S   + 
Sbjct  453   KMKALIHSPTVFSPFCSPKPFPPNMSSPKPEVQCRNNEPVTLLRLKSVRLTDSASATSLP  512

Query  643   PKPSIQEIYGTIDAAPHSKVIKIIIE----------------------RIAKAFFGQQNT  756
               P +   Y T       + I+++                         I + + G Q+ 
Sbjct  513   VSPPMSNDYSTSSVDSDGEAIEVLQSCSRNSSQKHSFESVNNRTCKNSSINEDYEGSQSC  572

Query  757   EESVDSERPLGLSIP-TEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
                  SE+P   S P  +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  573   ISFPLSEKPTSKSRPLKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLKRGNITCPITR  632

Query  934   KKLECQAVPLSNFILKRVIDKWRSE  1008
             + L    +P +N++LKR+I  W+ +
Sbjct  633   QPLSSNKLPKTNYVLKRLIISWKEQ  657


 Score = 99.0 bits (245),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 175/350 (50%), Gaps = 9/350 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QF  + K + A+++LE++L+    + R  N   +I   G+  L    N   +  +  V +
Sbjct  880   QFVMEPK-DAAIAMLEQILVGGDENSRCINALSVISANGIPALAKVLN--RVEGRTSVVS  936

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C++A+  CRNLIA  I+   +LE+    + +SV+   I  ++EL+ L+RR  +   
Sbjct  937   ILLCCMQAEKGCRNLIANRIELSPVLELFHGGN-DSVRGICIGFLSELVRLSRRTFSNQI  995

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +   +L  YLQ +  +Q+  +A L+L   LL + +  ++  + AI+A+T 
Sbjct  996   LQTIKDEGAFSSMHMLLVYLQMAPMEQQPAIASLLLQLDLLVEPRKMSLYREEAIEALTE  1055

Query  1576  ALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEP  1755
             AL         I +    L  L    ++ G   TE W+LK AGF   + + +++ +  + 
Sbjct  1056  ALRRKHFSNSQI-LAIDALSSLIGRITSSGDSYTEAWLLKTAGFDQPYNALMKAEQLKKH  1114

Query  1756  DNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAW  1935
             D+  +  +++ EE+    W+ R++ +L    + S   AL  CL S ++E+ + CL    W
Sbjct  1115  DSDLMETIEE-EEKAISTWEKRVALVLCNHERGSIFKALEECLRSSSLEMAKACLVVATW  1173

Query  1936  LssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
             L+ +L+    +G +       +L+ +    L+  K  E K+LA++ L  F
Sbjct  1174  LTYMLSIIPDTGVKSAAR--KSLLDEFINVLQSSKNQEEKILATLALKTF  1221



>ref|XP_006853357.1| hypothetical protein AMTR_s00032p00110960 [Amborella trichopoda]
 gb|ERN14824.1| hypothetical protein AMTR_s00032p00110960 [Amborella trichopoda]
Length=333

 Score =   111 bits (278),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGMLESPDSK  180
            LQR  RI+AKH+LQVFCDSPLQAR  LLPDLW+ +FL HL  L+ WY +E   L     +
Sbjct  217  LQRNHRISAKHLLQVFCDSPLQARAYLLPDLWERLFLSHLRPLEAWYSEEAESLRHFLER  276

Query  181  SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKI  312
              K++V+ +V+NE MD GT + A+YYK WL   ++P +  S+++
Sbjct  277  EGKMRVVNRVFNEEMDLGTCEIALYYKQWLQ--IDPRTPKSLQL  318



>gb|KHN37909.1| Putative E3 ubiquitin-protein ligase LIN-1 [Glycine soja]
Length=1479

 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/381 (25%), Positives = 190/381 (50%), Gaps = 10/381 (3%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A++ILE++LI      R+ N   ++   G+  L+    L  +  ++ V ++L  C++A
Sbjct  805   DAAIAILEQILIGGDEYSRSLNALSVVSENGIPALVKY--LERMEGRRSVVSILLCCMQA  862

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSDD  1419
             +  C++LIA  I+   +LE+  + + +SV+   +  ++EL+ LNRR      L  ++ + 
Sbjct  863   EKGCKSLIANKIELSPVLELFHAGN-DSVRGICVEFLSELVQLNRRTVCNQILQTIKDEG  921

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFL  1596
               +       YLQ +  + +  VA L+L   LL + +  ++  + A++ +  AL +  F 
Sbjct  922   AFSTMHTFLVYLQMAPMEHQLAVASLLLQIDLLVEPRKMSIYREEAVETLIEALWQKDFS  981

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
             + ++       L+ L  H +  GK  TE W+LK AGF   + + +++ +  + DN  +  
Sbjct  982   NTQM--KAFDALIFLIGHVTLSGKSYTEAWLLKIAGFEQPYNALIKAEQLGQYDNDSMET  1039

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlas  1956
             M+D E+     WQ R++ +L      S   AL  CL S ++++ + CL  V WL+ +L++
Sbjct  1040  MED-EKNAMNSWQRRVAFVLCNHENGSIFQALEECLRSNSLKMAKSCLVLVTWLTHMLST  1098

Query  1957  ssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVI  2136
                +G +       +L+ +L   L+  K LE K+LA++ L NF   P  +  L    + I
Sbjct  1099  FPDTGIKDVAR--KSLLDELINVLQSSKNLEEKILATLALKNFINDPIAQEALRAYAKSI  1156

Query  2137  EDTLECLAEVTWVARELQTVI  2199
                +  L + + VA ++   +
Sbjct  1157  YRIMRKLKKYSTVAADIMKTL  1177


 Score = 95.1 bits (235),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  504   IGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSANTLPK  563

Query  964   SNFILKRVIDKWRSEHWQHLLAFSS  1038
             +N++LKR+I  W+ ++ +    FS+
Sbjct  564   TNYVLKRLITSWKEQNPELAQEFSN  588


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 56/130 (43%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H L++F   P  +R    P+LW N+FLPH+S +  WY +E   L M   PDS        
Sbjct  145  HALEMFIVDPFFSRIDFAPELWKNLFLPHMSSIVGWYSEERHRLMMEVIPDSSDLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWL----TEG------  279
                               KL+ +E++Y E++D  T  +A YYKD +    T G      
Sbjct  205  FDQFFNESLVFSMRPHQLDKLQKMEQLYGESLDENTRLYAKYYKDCMNSDSTSGKKVAPM  264

Query  280  ---VEPPSIP  300
                EPP  P
Sbjct  265  LPIAEPPMTP  274



>ref|XP_003536276.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Glycine 
max]
Length=1481

 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/381 (25%), Positives = 190/381 (50%), Gaps = 10/381 (3%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A++ILE++LI      R+ N   ++   G+  L+    L  +  ++ V ++L  C++A
Sbjct  805   DAAIAILEQILIGGDEYSRSLNALSVVSENGIPALVKY--LERMEGRRSVVSILLCCMQA  862

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYFLSGLQSDD  1419
             +  C++LIA  I+   +LE+  + + +SV+   +  ++EL+ LNRR      L  ++ + 
Sbjct  863   EKGCKSLIANKIELSPVLELFHAGN-DSVRGICVEFLSELVQLNRRTVCNQILQTIKDEG  921

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFL  1596
               +       YLQ +  + +  VA L+L   LL + +  ++  + A++ +  AL +  F 
Sbjct  922   AFSTMHTFLVYLQMAPMEHQLAVASLLLQIDLLVEPRKMSIYREEAVETLIEALWQKDFS  981

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITM  1776
             + ++       L+ L  H +  GK  TE W+LK AGF   + + +++ +  + DN  +  
Sbjct  982   NTQM--KAFDALIFLIGHVTLSGKSYTEAWLLKIAGFEQPYNALIKAEQLGQYDNDSMET  1039

Query  1777  MDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlas  1956
             M+D E+     WQ R++ +L      S   AL  CL S ++++ + CL  V WL+ +L++
Sbjct  1040  MED-EKNAMNSWQRRVAFVLCNHENGSIFQALEECLRSNSLKMAKSCLVLVTWLTHMLST  1098

Query  1957  ssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVI  2136
                +G +       +L+ +L   L+  K LE K+LA++ L NF   P  +  L    + I
Sbjct  1099  FPDTGIKDVAR--KSLLDELINVLQSSKNLEEKILATLALKNFINDPIAQEALRAYAKSI  1156

Query  2137  EDTLECLAEVTWVARELQTVI  2199
                +  L + + VA ++   +
Sbjct  1157  YRIMRKLKKYSTVAADIMKTL  1177


 Score = 95.1 bits (235),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  504   IGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSANTLPK  563

Query  964   SNFILKRVIDKWRSEHWQHLLAFSS  1038
             +N++LKR+I  W+ ++ +    FS+
Sbjct  564   TNYVLKRLITSWKEQNPELAQEFSN  588


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 56/130 (43%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H L++F   P  +R    P+LW N+FLPH+S +  WY +E   L M   PDS        
Sbjct  145  HALEMFIVDPFFSRIDFAPELWKNLFLPHMSSIVGWYSEERHRLMMEVIPDSSDLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWL----TEG------  279
                               KL+ +E++Y E++D  T  +A YYKD +    T G      
Sbjct  205  FDQFFNESLVFSMRPHQLDKLQKMEQLYGESLDENTRLYAKYYKDCMNSDSTSGKKVAPM  264

Query  280  ---VEPPSIP  300
                EPP  P
Sbjct  265  LPIAEPPMTP  274



>ref|XP_007144197.1| hypothetical protein PHAVU_007G136300g [Phaseolus vulgaris]
 gb|ESW16191.1| hypothetical protein PHAVU_007G136300g [Phaseolus vulgaris]
Length=1491

 Score =   112 bits (280),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 105/385 (27%), Positives = 189/385 (49%), Gaps = 11/385 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             Q   D K + A++ILE++LI      R+ N   +I   G+  L     L  +  ++CV +
Sbjct  808   QLVIDPK-DAAIAILEQILIGGDEYGRSLNALSVISENGIPCLAKY--LERMEGRRCVVS  864

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C++A+  C++LIA  I+   +LE+  + + +SV+   +  ++EL+ LNRR      
Sbjct  865   ILLCCMQAEKGCKSLIANTIELSPVLELFHAGN-DSVRGICVEFLSELVQLNRRTVCNQI  923

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  + +  VA L+L   LL + +  ++  + AI+ +  
Sbjct  924   LQTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQIDLLVEPRKMSIYREEAIEILIE  983

Query  1576  AL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
             AL +  F + ++  +    LL L    +  GK  TE W+LK AGF   + + L+  +  +
Sbjct  984   ALWQKDFSNTQMKAL--DALLFLIGQVTTSGKSYTEAWLLKIAGFDQPYNALLKPGQLGQ  1041

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVA  1932
              DN  +  M+D E++    WQ R++ +L      S   AL  CL S ++++ + CL  VA
Sbjct  1042  YDNESMETMED-EKDAMNSWQKRVAFVLCNHENGSIFQALEECLRSNSLKMAKSCLVLVA  1100

Query  1933  WLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVL  2112
             WL+ +L +   +G +       +L+ +L   L   K LE  +LAS+ L  F   P  +  
Sbjct  1101  WLTHMLNTLPDTGIKNVAR--KSLLEELMNVLLSSKNLEEMILASLALKTFIGDPITQEA  1158

Query  2113  LMMIGEVIEDTLECLAEVTWVAREL  2187
             L    + I  T+  L   + VA ++
Sbjct  1159  LRAYAKRIYRTMRKLKRYSTVAVDI  1183


 Score = 94.0 bits (232),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  512   IGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSANILPK  571

Query  964   SNFILKRVIDKWRSEH  1011
             +N++LKR+I  W+ ++
Sbjct  572   TNYVLKRLITSWKEQN  587


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 54/131 (41%), Gaps = 41/131 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H L++F   P  +R    P+LW N+FLPH+S +  WY +E   L M   PDS        
Sbjct  145  HALEMFTVDPFFSRIDFAPELWKNLFLPHMSSIVGWYSEERHRLMMEVMPDSSDLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y E++D  T  +A YYKD +             
Sbjct  205  FDRFFNESLIFSMRPHELDKLQKLEQLYAESLDENTRLYAKYYKDCMNSDSTSSGKKAAH  264

Query  280  ----VEPPSIP  300
                 EPP  P
Sbjct  265  MLPIAEPPRTP  275



>ref|XP_008366744.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
 ref|XP_008366745.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
 ref|XP_008366746.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Malus 
domestica]
Length=1484

 Score =   112 bits (279),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 100/380 (26%), Positives = 187/380 (49%), Gaps = 8/380 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A++I+E++L+    + R+ N   +I   G+  L+ RF L      + + ++L  C++A
Sbjct  805   DAALAIIEQILMGGDENSRSINALSVISANGIPGLV-RF-LDKAEGTRSIVSILLCCMQA  862

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             + +CRNLIA  ID   +LE+  + +       +  ++EL+ LNRR  +   L  ++ +  
Sbjct  863   EKSCRNLIANRIDLSPVLELFHAGNDCVRGICVEFLSELVQLNRRTLSNQILHMIKDEGA  922

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALE-SSFLD  1599
              +       YLQ +  +Q+  +A L+L   LL +    ++  + AI+A+  A+    F +
Sbjct  923   FSTMHTFLVYLQMAPMEQQPTIASLLLQLDLLVEPWKMSIYREDAIEALIEAMRRKDFPN  982

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              ++  M    LL L    ++ G   TE W+LK AGF   + + +++    + DN  +  M
Sbjct  983   SQM--MALDTLLSLTGRVTSSGDSNTEAWLLKTAGFDQPYNALMKAERLRKHDNDFMETM  1040

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             D+ EE+    WQ R++ +L    K S   AL  CL S ++E+ + CL    WL+ +L+  
Sbjct  1041  DE-EEKAVTSWQKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIATWLTHMLSVL  1099

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
               +G +       AL+ +    L+    +E K+LA++ L +F   P     L +  + I 
Sbjct  1100  PDTGVKSGAC--KALLDEFMNVLQSSNNMEEKILATLALKSFVNDPAALEALRVYAKPIY  1157

Query  2140  DTLECLAEVTWVARELQTVI  2199
              TL  L +  +VA ++   +
Sbjct  1158  KTLRKLKKYAFVANDIMKAL  1177


 Score = 99.0 bits (245),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + +    +P +N++L
Sbjct  504   PKDFVCPITGQIFGDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPIATSTLPKTNYVL  563

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ EH
Sbjct  564   KRLITSWKEEH  574


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 59/125 (47%), Gaps = 27/125 (22%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESP  171
            L+   ++A  H++++F   P  +R    P+LW N+FLPH+S +  WY ++   L M   P
Sbjct  135  LRNNIQLAVLHVIEMFIVDPFFSRIDFAPELWKNLFLPHMSSIIGWYSEQRHRLVMEVIP  194

Query  172  DS------------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG  279
            DS                        +  KL+ LE++Y E++D  T  +A Y+KD +   
Sbjct  195  DSADLSFTADLDHLFNESVVCSMRPDQGEKLQKLEQLYGESLDENTRLYAKYFKDCMNXD  254

Query  280  VEPPS  294
               PS
Sbjct  255  STTPS  259



>sp|D1FP57.1|LIN2_LOTJA RecName: Full=Putative E3 ubiquitin-protein ligase LIN-2; Short=LjLIN 
[Lotus japonicus]
 gb|ACL14423.1| putative E3 ubiquitin ligase [Lotus japonicus]
Length=1485

 Score =   109 bits (273),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 147/640 (23%), Positives = 289/640 (45%), Gaps = 60/640 (9%)
 Frame = +1

Query  313   PFLSPQLARNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEES---YGGS  483
             P L+ + +    P   SC   +     + +++   +   HKN    DY ++ S      +
Sbjct  583   PELAQEFSNVNTPRGSSCSPSAKDIPMLSTRQRTTDSPNHKNK---DYARQRSNRFMPAA  639

Query  484   ASMSNGSVTEETHCSQIVK-IEPYAT--CQSYSMPITEEAEIQ-----EENKLVEHFSDV  639
              + S  SV  +     IV  ++PY +  C S ++P  EEA ++     +++K        
Sbjct  640   ITTSPTSVLSQAAVETIVNSLKPYISSLCTSENLPECEEAVLKIARLLKDSKTNPQIHSY  699

Query  640   HPKPSIQEIYGTID---AAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEF  810
               KP+I  I G ++   A+ + +V++  I  +++  F   +  E+++S       + ++F
Sbjct  700   LSKPTI--INGLVEILSASRNREVLRTSIYILSELIFTDDSVAETLNS-------VDSDF  750

Query  811   ICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVI  990
              C  T L                AA+L +     +  P+ ++    + +P        ++
Sbjct  751   DCLATLL----------KNGLAEAALLIY-----QLRPVFAQLSAHELIP-------SLV  788

Query  991   DKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLI  1170
             D  ++++ + L  F  Q   D K + A++ILE+ L+      R+ N   +I   G+  L+
Sbjct  789   DVIQNKN-EELDDF--QLVIDPK-DAAIAILEQTLMGGDEYSRSLNASSVISANGIPTLV  844

Query  1171  HRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLM  1350
                 L  +  ++ V ++L  C++A+ +C+NLIA  I+   +LE+  S +       +  +
Sbjct  845   KY--LERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCVEFL  902

Query  1351  TELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQ  1530
             +EL+ LNRR      L  ++ +   +       YLQ +  + +  VA L+L   LL + +
Sbjct  903   SELVQLNRRTSCNQLLHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLAEPR  962

Query  1531  CSNVCIDGAIDAITVAL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF  1707
               ++  + A++ +  AL +  F + ++  +    LL L  H S+ GK  TE W+LK AGF
Sbjct  963   KMSIYREEAVETLIEALWQKDFSNTQMKAL--DALLFLIGHISSSGKSYTEAWLLKIAGF  1020

Query  1708  IDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
                + + ++  +  + DN  I  M+D E+     WQ R++++L      S   AL  CL 
Sbjct  1021  DQPYNALMKVEQLGQHDNDLIETMED-EKNALNSWQKRIASVLCNHENGSIFKALEECLK  1079

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLAS  2067
             S ++++ + CL    WL+ +L +   +G         +L+ ++   L   K LE  +L +
Sbjct  1080  SNSLKMAKSCLVLATWLTRMLYTLPDTGVRDVAR--KSLLEEVIKVLHSSKSLEDMILVT  1137

Query  2068  VCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
             + L  F   P    +L +  + I   L  L + + VA ++
Sbjct  1138  LSLYPFISDPTVHEVLRVYAKSIYRILRKLKKYSTVAADI  1177


 Score = 95.1 bits (235),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  507   MGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSASILPK  566

Query  964   SNFILKRVIDKWRSEHWQHLLAFSS  1038
             +N++LKR+I  W+ ++ +    FS+
Sbjct  567   TNYVLKRLITSWKEQNPELAQEFSN  591


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 52/130 (40%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H L++F   P   R    P+LW ++FLPH+S +  WY +E   L M   PDS        
Sbjct  145  HALEMFIVDPFFTRIDFAPELWKSLFLPHMSSIVGWYSEERHRLMMEVIPDSADLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y E++D  T  +A YY D +             
Sbjct  205  FEQFFNESLVLTMRPHQLEKLQKLEQLYGESLDENTKLYAKYYNDCMNSDSSSSKKAVPM  264

Query  280  ---VEPPSIP  300
                EPP  P
Sbjct  265  LPIAEPPMTP  274



>gb|ACL14424.1| putative E3 ubiquitin ligase [Lotus japonicus]
Length=1485

 Score =   109 bits (273),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 147/640 (23%), Positives = 289/640 (45%), Gaps = 60/640 (9%)
 Frame = +1

Query  313   PFLSPQLARNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRHKNGVELDYYKEES---YGGS  483
             P L+ + +    P   SC   +     + +++   +   HKN    DY ++ S      +
Sbjct  583   PELAQEFSNVNTPRGSSCSPSAKDIPMLSTRQRTTDSPNHKNK---DYARQRSNRFMPAA  639

Query  484   ASMSNGSVTEETHCSQIVK-IEPYAT--CQSYSMPITEEAEIQ-----EENKLVEHFSDV  639
              + S  SV  +     IV  ++PY +  C S ++P  EEA ++     +++K        
Sbjct  640   ITTSPTSVLSQAAVETIVNSLKPYISSLCTSENLPECEEAVLKIARLLKDSKTNPQIHSY  699

Query  640   HPKPSIQEIYGTID---AAPHSKVIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEF  810
               KP+I  I G ++   A+ + +V++  I  +++  F   +  E+++S       + ++F
Sbjct  700   LSKPTI--INGLVEILSASRNREVLRTSIYILSELIFTDDSVAETLNS-------VDSDF  750

Query  811   ICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVI  990
              C  T L                AA+L +     +  P+ ++    + +P        ++
Sbjct  751   DCLATLL----------KNGLAEAALLIY-----QLRPVFAQLSAHELIP-------SLV  788

Query  991   DKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLI  1170
             D  ++++ + L  F  Q   D K + A++ILE+ L+      R+ N   +I   G+  L+
Sbjct  789   DVIQNKN-EELDDF--QLVIDPK-DAAIAILEQTLMGGDEYSRSLNASSVISANGIPTLV  844

Query  1171  HRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLM  1350
                 L  +  ++ V ++L  C++A+ +C+NLIA  I+   +LE+  S +       +  +
Sbjct  845   KY--LERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCVEFL  902

Query  1351  TELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQ  1530
             +EL+ LNRR      L  ++ +   +       YLQ +  + +  VA L+L   LL + +
Sbjct  903   SELVQLNRRTSCNQLLHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLAEPR  962

Query  1531  CSNVCIDGAIDAITVAL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF  1707
               ++  + A++ +  AL +  F + ++  +    LL L  H S+ GK  TE W+LK AGF
Sbjct  963   KMSIYREEAVETLIEALWQKDFSNTQMKAL--DALLFLIGHISSSGKSYTEAWLLKIAGF  1020

Query  1708  IDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLA  1887
                + + ++  +  + DN  I  M+D E+     WQ R++++L      S   AL  CL 
Sbjct  1021  DQPYNALMKVEQLGQHDNDLIETMED-EKNALNSWQKRIASVLCNHENGSIFKALEECLK  1079

Query  1888  SGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLAS  2067
             S ++++ + CL    WL+ +L +   +G         +L+ ++   L   K LE  +L +
Sbjct  1080  SNSLKMAKSCLVLATWLTRMLYTLPDTGVRDVAR--KSLLEEVIKVLHSSKSLEDMILVT  1137

Query  2068  VCLLNFSKIPECRVLLMMIGEVIEDTLECLAEVTWVAREL  2187
             + L  F   P    +L +  + I   L  L + + VA ++
Sbjct  1138  LSLYPFISDPTVHEVLRVYAKSIYRILRKLKKYSTVAADI  1177


 Score = 95.1 bits (235),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  507   MGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLRTGNTTCPITRQPLSASILPK  566

Query  964   SNFILKRVIDKWRSEHWQHLLAFSS  1038
             +N++LKR+I  W+ ++ +    FS+
Sbjct  567   TNYVLKRLITSWKEQNPELAQEFSN  591


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 52/130 (40%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H L++F   P   R    P+LW ++FLPH+S +  WY +E   L M   PDS        
Sbjct  145  HALEMFIVDPFFTRIDFAPELWKSLFLPHMSSIVGWYSEERHRLMMEVIPDSADLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y E++D  T  +A YY D +             
Sbjct  205  FEQFFNESLVLTMRPHQLEKLQKLEQLYGESLDENTKLYAKYYNDCMNSDSSSSKKAVPM  264

Query  280  ---VEPPSIP  300
                EPP  P
Sbjct  265  LPIAEPPMTP  274



>ref|XP_002510542.1| hypothetical protein RCOM_1598060 [Ricinus communis]
 gb|EEF52729.1| hypothetical protein RCOM_1598060 [Ricinus communis]
Length=1427

 Score =   109 bits (272),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 101/384 (26%), Positives = 159/384 (41%), Gaps = 62/384 (16%)
 Frame = +1

Query  22    AAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWY--IKELGMLES-PDS-----  177
             +  H+L++F   P  +R    P+LW ++FLPH+S +  WY   +   M+E  PDS     
Sbjct  142   SVSHVLEMFVIDPFFSRIDFAPELWKDLFLPHMSSIVGWYSEARHRLMVEVIPDSYDFSF  201

Query  178   -------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-----TEGVE  285
                                +  KL+ LE++Y E++   T  FA YY+D +     T    
Sbjct  202   TADMDQFFNESLVFSMKPEQVEKLQKLEQLYGESLGENTRLFAKYYEDCMNSDSITSKKI  261

Query  286   PPSIPSVKIPFLSPQLARNEDPNSVSCIVGSFSPQ-----PVV-SKKLYDEVFRHKNGVE  447
              P +P  + P           P+ V    G   P+     PVV SK    E  R      
Sbjct  262   APMLPIAEPPMTPLHEVSRSIPDYVK--FGPILPKSAGFSPVVRSKYGAREAGRLSASPS  319

Query  448   LDYYKEESYGGSASMS------------NGSVTEETHCSQIVKIEPYATCQSYSMPITEE  591
             L +  EES       S            NG++  E    ++V +      +   M   + 
Sbjct  320   LSHNLEESTVWDTQESILNENEDHSDPDNGNLDSEDKSHKLVTLRSTKMIEIKEMGTIKP  379

Query  592   AEIQEENKLVEHFSDV-HPKPSIQEIYGTIDAAPHSKVIKIIIERIAKAFFGQQNTEESV  768
             ++    +     FS +  P     ++    DA  HSK     + R        Q  + + 
Sbjct  380   SKSSSRSHSPTIFSSMDSPSTFWPKVSANSDA--HSKTESTSLSR----HLSSQVMDSTN  433

Query  769   DSERPLGLSIPTEFICPLT---GLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKK  939
                 P+  SI  ++        G +F DPVTLETGQ++ER AI  W  +GN TCPIT + 
Sbjct  434   APSLPVSPSIINDYSISSRDSDGQLFIDPVTLETGQTYERKAIQEWLKRGNTTCPITRQP  493

Query  940   LECQAVPLSNFILKRVIDKWRSEH  1011
             L   ++P +N++LKR+I  W+ ++
Sbjct  494   LSANSLPKTNYVLKRLITSWKEQY  517


 Score = 91.3 bits (225),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 82/342 (24%), Positives = 166/342 (49%), Gaps = 8/342 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L   + + ++ N   +I   G+  L+    L  ++ +K + ++L  C+ A
Sbjct  744   DAAIALLEQILTGGNENSQSINAFSVISANGIPALLK--CLDRMDGRKSIISILLCCVLA  801

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CR+ IA  I+   +LE+  S +       I L++EL+ LNRR      L  ++ +  
Sbjct  802   DKSCRDFIASRIELCPVLEIFHSGNDCVRGVCIDLLSELVQLNRRTFCNQILKIIKEEGS  861

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLD  1599
              +       YLQ +  +Q+  +A L+L   LL + +  ++  + A++ +  AL +  F +
Sbjct  862   FSTMHTFLVYLQMAPMEQQPTIATLLLQLDLLVEPRKMSIYREEAVETLIEALHKKEFSN  921

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              ++  M    L+ L    ++ G+   E W+LK AG+   + + +++    + +N     M
Sbjct  922   SQM--MALDALVSLSGRLTSSGRYYLEAWLLKIAGYDQPYNALMKAEGLKKGENDLAETM  979

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             +D EE+    W+ +++ +L    K S    L  C  S +IE+ + CL    WL  +L+  
Sbjct  980   ED-EEKAASSWETKVAFVLCNHEKGSIFKGLEECFKSNSIEMAKSCLVISTWLVYMLSVL  1038

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
                G       +  L+ +    L+  + +E K+LA++ L  F
Sbjct  1039  PDIGVREVARKY--LLDEFINVLQSSRNIEEKILAALALKTF  1078



>ref|XP_008242573.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Prunus mume]
Length=1340

 Score =   109 bits (272),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 101/397 (25%), Positives = 171/397 (43%), Gaps = 85/397 (21%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE----LGMLES  168
             L R+   AA  +L +F   P  ART L P L++ +FL HL  +  WY ++    L  L +
Sbjct  100   LYRRPIEAALSLLDIFHTDPSFARTELAPVLFEELFLVHLLPVLHWYNEQRTQILPTLST  159

Query  169   ------------------PDSKS---------RKLKVLEKVYNETMDTGTNKFAVYYKDW  267
                               P SKS          +LK LE  Y + +D     F+ Y+K  
Sbjct  160   NVSYENDDCSISDMSVVFPCSKSLSKMSGGQTSELKELESNYEKVLDENCRVFSNYFKQV  219

Query  268   L-----TEGVEPPSIPSVKIPFLSPQLARNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRH  432
             L     +  ++PP++   +I  +  Q+   +D   +       + +P      Y+ ++  
Sbjct  220   LENKDASRLIDPPTVMMKRIERVV-QVKYGDDEQGIK------TEEPGFENGRYNPIWAE  272

Query  433   KNG-VELDYYKEESYGGSASMSNGSVTEETHCSQIVKIEPYATCQ---------------  564
                 VEL      S G        +  +  + + I+ ++  ++ +               
Sbjct  273   AEASVEL---FSSSRGRKPESPPPAYPQRVYLNNILTVQEESSWRLEASANVNSDSESES  329

Query  565   --------SYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPHSKVIKIIIE  720
                     S S  +  EAEI+E N+ +E F     K  IQ++   I A       + + +
Sbjct  330   SLEDNSVGSSSSSLDSEAEIEENNREMELFEAT--KSQIQKLKQPISAESSCSPDRFMAD  387

Query  721   RIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWF  900
               + +  G +NT              P +F+CP+T  +F+DPVTLETGQ++ER AI  W 
Sbjct  388   SDSTSAGGGKNTP-------------PKDFVCPITSTLFDDPVTLETGQTYERKAIQEWI  434

Query  901   SKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEH  1011
              +GN TCPIT + L+   +P +N++LKR+I  W+ ++
Sbjct  435   ERGNSTCPITRQNLQSTQLPKTNYVLKRLIASWQEQN  471


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 144/339 (42%), Gaps = 36/339 (11%)
 Frame = +1

Query  1129  VKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLC  1308
             V  ++    L+ +I       + E+     +L  C++ D  CRN IA   DK  L  VL 
Sbjct  685   VNTVVSEKALERIISSLESEYVEERIAAVGILLRCMQQDGKCRNTIA---DKAELAPVLD  741

Query  1309  S----EDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQ  1476
             S     D E  +  +   +EL+ LNRR      L  ++ +   +    L  YLQ++   Q
Sbjct  742   SFMGANDTERFE-IVHFFSELVKLNRRTFNEQILHIIKDEGPLSTMHTLLIYLQTALQDQ  800

Query  1477  KSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFS  1656
               +VA L+L   LL + +  ++  + AID +   L +       I      + + GR F+
Sbjct  801   CPIVAGLLLQLDLLAEPRKMSIYREEAIDVLISCLRNVEFPTAQIAAAETIMSLQGR-FT  859

Query  1657  AFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD--GEEEVREE------W  1812
               GK +T  ++LK+AG    ++S +           R+  + +  GE+E  EE      W
Sbjct  860   TSGKPLTRAFLLKRAGLDKSYKSSV-----------RMDQLSNFSGEDETLEEEKAANNW  908

Query  1813  QARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsa  1992
             + +M+ +L          AL+  L S   EL   C  +  WL+ +L     +G       
Sbjct  909   ERKMALVLASHEFGLLFEALAEGLKSRYAELCSACFVSATWLAHMLDVLPDTGIRG----  964

Query  1993  FSALICQLK---ACLEHGKLLEHKVLASVCLLNFSKIPE  2100
              +A +C LK   +  +  K  E K L+ + L +F   PE
Sbjct  965   -AARVCLLKRFISIFKSAKDTEDKALSMLALNSFINDPE  1002



>ref|XP_007204677.1| hypothetical protein PRUPE_ppa000309mg [Prunus persica]
 gb|EMJ05876.1| hypothetical protein PRUPE_ppa000309mg [Prunus persica]
Length=1300

 Score =   108 bits (271),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 101/397 (25%), Positives = 171/397 (43%), Gaps = 85/397 (21%)
 Frame = +1

Query  1     LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE----LGMLES  168
             L R+   AA  +L +F   P  ART L P L++ +FL HL  +  WY ++    L  L +
Sbjct  100   LYRRPIEAALSLLDIFHTDPSFARTELAPVLFEELFLVHLLPVLHWYNEQRTQILPTLST  159

Query  169   ------------------PDSKS---------RKLKVLEKVYNETMDTGTNKFAVYYKDW  267
                               P SKS          +LK LE  Y + +D     F+ Y+K  
Sbjct  160   NVSYENDDCSISDMSIVFPCSKSLSKMSGGQTSELKELESNYEKVLDENCRVFSNYFKQV  219

Query  268   L-----TEGVEPPSIPSVKIPFLSPQLARNEDPNSVSCIVGSFSPQPVVSKKLYDEVFRH  432
             L     +  ++PP++   +I  +  Q+   +D   +       + +P      Y+ ++  
Sbjct  220   LENKDASRLIDPPTVMLKRIERVD-QVKYGDDEQGIK------TEEPRFENGRYNPIWAE  272

Query  433   KNG-VELDYYKEESYGGSASMSNGSVTEETHCSQIVKIEPYATCQ---------------  564
                 VEL      S G        +  +  + + I+ ++  ++ +               
Sbjct  273   AEASVEL---FSSSRGRKPKSPPPAYPQRVYLNNILTVQEESSWRLEASANVNSDSESES  329

Query  565   --------SYSMPITEEAEIQEENKLVEHFSDVHPKPSIQEIYGTIDAAPHSKVIKIIIE  720
                     S S  +  EAEI+E N+ +E F     K  IQ++   I A       + + +
Sbjct  330   SLEDNSVGSSSSSLDSEAEIEENNREMELFEAT--KSQIQKLKQPISAESSCSPDRFMAD  387

Query  721   RIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWF  900
               + +  G +NT              P +F+CP+T  +F+DPVTLETGQ++ER AI  W 
Sbjct  388   SDSTSAGGGKNTP-------------PKDFVCPITSTLFDDPVTLETGQTYERKAIQEWI  434

Query  901   SKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEH  1011
              +GN TCPIT + L+   +P +N++LKR+I  W+ ++
Sbjct  435   ERGNSTCPITRQNLQSTQLPKTNYVLKRLIASWQEQN  471


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 75/306 (25%), Positives = 130/306 (42%), Gaps = 28/306 (9%)
 Frame = +1

Query  1216  ALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYF  1395
              +L  C++ D  CRN IA   +   +L+     +       +   +EL+ LNRR      
Sbjct  714   GILLRCMQQDGKCRNTIADKAELAPVLDSFMGANDRERFEIVHFFSELVKLNRRTFNEQI  773

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +    L  YLQ++   Q  +VA L+L   LL + +  ++  + AID +  
Sbjct  774   LHIIKDEGPLSTMHTLLIYLQTALQDQCPIVAGLLLQLDLLAEPRKMSIYREEAIDVLIS  833

Query  1576  ALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEP  1755
              L +       I      + + GR F+  GK +T  ++LK+AG    ++S +        
Sbjct  834   CLRNVEFPAAQIAAAETIMSLQGR-FTTSGKPLTRAFLLKRAGLDKSYKSSM--------  884

Query  1756  DNGRITMMDD--GEEEVREE------WQARMSAMLLGSGKKSFLGALSMCLASGNIELVR  1911
                R+  + +  GE+E  EE      W+ +M+ +L          AL+  L S   EL  
Sbjct  885   ---RMDQLSNFSGEDETLEEEKAANNWERKMALVLASHEFGLLFEALAEGLKSRYAELCS  941

Query  1912  VCLTTVAWLssvlasssrsgsefelsaFSALICQLK---ACLEHGKLLEHKVLASVCLLN  2082
              C  +  WL+ +L     +G        +A +C LK   +  +  K  E K L+ + L +
Sbjct  942   ACFVSATWLAHMLDVLPDTGIRE-----AARVCLLKRFISIFKSAKDTEDKALSMLALNS  996

Query  2083  FSKIPE  2100
             F   PE
Sbjct  997   FIHDPE  1002



>ref|XP_009334977.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Pyrus 
x bretschneideri]
Length=1484

 Score =   108 bits (271),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 98/380 (26%), Positives = 183/380 (48%), Gaps = 8/380 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A++I+E++LI    + R+ N   +I   G+  L+    L      + + ++L  C++A
Sbjct  805   DAALAIIEQILIGGDENSRSINALSVISANGIPGLVR--CLDRAEGTRSIVSILLCCMQA  862

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             + +CRNLIA  ID   +LE+  + +       +  ++EL+ LNRR  +   L  ++ +  
Sbjct  863   EKSCRNLIANRIDLSPVLELFHAGNDCVRGICVEFLSELVQLNRRTLSGQILHMIKDEGA  922

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALE-SSFLD  1599
              +       YLQ +  +Q+  +A L+L   LL +    ++  + AI+A+  A+    F +
Sbjct  923   FSTMHTFLVYLQMAPMEQQPTIASLLLQLDLLVEPWKMSIYREDAIEALIEAMRRKDFSN  982

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              ++  M    LL L    +  G   TE W+LK AGF   + + +++    + DN  +  M
Sbjct  983   SQM--MALDALLSLTGRVTPSGDSYTEAWLLKTAGFDQPYNALMKAERLRKHDNDFMETM  1040

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             D+ EE+    WQ R++ +L    K S   AL  CL S ++E+ + CL    WL+ +L+  
Sbjct  1041  DE-EEKAVASWQKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIATWLTHMLSIL  1099

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
               +G +       AL+ +    L+    +E K+LA++ L +F   P     L +  +   
Sbjct  1100  PDTGVKSGAC--KALLDEFMNVLQSSNNMEEKILATLALKSFVNDPAALEALRVYAKPFY  1157

Query  2140  DTLECLAEVTWVARELQTVI  2199
              TL  L +  +VA ++   +
Sbjct  1158  KTLRKLKKYAFVANDIMKAL  1177


 Score = 99.8 bits (247),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + +    +P +N++L
Sbjct  504   PKDFVCPITGQIFGDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPIATSTLPKTNYVL  563

Query  979   KRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERT  1122
             KR+I  W+ EH +  LA  S ++   K     S  ++    ++  +RT
Sbjct  564   KRLITSWKEEHPE--LAQESPYSESPKMSFDPSSAKETHSATATSQRT  609


 Score = 60.5 bits (145),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 56/115 (49%), Gaps = 27/115 (23%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESP  171
            L+   ++A  H++++F   P  +R    P+LW N+FLPH+S +  WY ++   L M   P
Sbjct  135  LRNNIQLAVLHVIEMFIVDPFFSRIDFAPELWKNLFLPHMSSIIGWYSEQRHKLVMEVIP  194

Query  172  DS------------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKD  264
            DS                        +  KL+ LE++Y E++D  T  +A Y+KD
Sbjct  195  DSADLSFTADLDHLFNESVVCSMRPDQGEKLQKLEQLYGESLDENTRLYAKYFKD  249



>ref|XP_004292946.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Fragaria 
vesca subsp. vesca]
Length=1476

 Score =   108 bits (270),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 103/388 (27%), Positives = 185/388 (48%), Gaps = 9/388 (2%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             Q   D K + A+SILE+ L+    + R+ +   +I   G+  L+    L     ++ + +
Sbjct  790   QLVIDPK-DAALSILEQFLMGGDENSRSISALSVISANGIPVLVKY--LDRPEGRRSIVS  846

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFL  1398
             +L  C++A+  CRNLIA  I+   +LE+  +         +  ++EL+ LNRR      L
Sbjct  847   ILLCCMQAEKTCRNLIAHRIELSPVLELFHTGTDGVRGICVEFLSELVQLNRRTLCNQIL  906

Query  1399  SGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
               ++ +   +       YLQ +  +Q+  +A L+L   LL +    ++  + +I+ +  +
Sbjct  907   QMIKDEGSFSTMHTFLVYLQMAPMEQQPAIATLLLQLDLLVEPSKMSIYREESIEGLIES  966

Query  1579  LE-SSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEP  1755
             L    F + ++  M    LL L    ++ G+  TE W+LK AGF   + + +++    + 
Sbjct  967   LRRKEFSNSQM--MALDALLCLTGRITSSGESYTEVWLLKIAGFDQPYNALMKAERLRKN  1024

Query  1756  DNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAW  1935
             DN  I  M++ EE+    WQ R++ +L    K S   AL  CL S +IE+ + CL    W
Sbjct  1025  DNDLIETMEE-EEKALSSWQKRVAFVLCNHEKGSIFKALEECLKSNSIEMAKSCLVIATW  1083

Query  1936  LssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLL  2115
             L  +L+    +G +      +AL+ +L   L+    LE K+LA++ L +F   P     L
Sbjct  1084  LIHMLSVLPDTGVKISAR--NALLEELVNVLQSSNNLEEKILATLALKSFVSEPAALEAL  1141

Query  2116  MMIGEVIEDTLECLAEVTWVARELQTVI  2199
              +  + I  TL  L   T VA ++   +
Sbjct  1142  GVYAKCIYKTLRKLKRSTMVASDIMKAL  1169


 Score = 94.7 bits (234),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQA-VPLSNFI  975
             P +F+CP+TG +F DPVTLETGQ+FER AI  W  +GN TCP+T + +   A +P +N++
Sbjct  497   PKDFVCPITGQIFSDPVTLETGQTFERKAIQEWLKRGNTTCPMTRQPISTTAQLPNTNYV  556

Query  976   LKRVIDKWRSEH  1011
             LKR+I  W+ +H
Sbjct  557   LKRLITSWKEQH  568


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 57/130 (44%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELG--MLES-PDSKSR-----  186
            H++++F   P  +R    P+LW  +FLPH+S +  WY ++    M+E  PDS+       
Sbjct  145  HVIEMFTVDPFFSRIDFAPELWKLLFLPHMSSIIGWYSEQRQRLMIEVIPDSQDMSYTAD  204

Query  187  -------------------KLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y E++D  T  +A Y+KD +T            
Sbjct  205  LDQFFNESLIYAMRPDQIDKLQQLEQLYGESLDENTRLYAKYFKDCMTSNATSSRKVMPM  264

Query  280  ---VEPPSIP  300
                EPP  P
Sbjct  265  MPIAEPPMTP  274



>ref|XP_008221252.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Prunus mume]
Length=1482

 Score =   107 bits (266),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 97/380 (26%), Positives = 189/380 (50%), Gaps = 8/380 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A++I+E++L+    + R+ N   +I   G+  L+    L     ++ + ++L  C++A
Sbjct  803   DAALAIIEQILMGGDENSRSINALSVISANGIPSLVR--CLDRAEGRRSIVSILLCCMQA  860

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             + +CR+LIA  ++   +LE+  + +       +  ++EL+ LNRR      L  ++ +  
Sbjct  861   EKSCRSLIANRVELSPVLELFHAGNDCVRGICVEFLSELVQLNRRTLCNQILQMIKDEGA  920

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALE-SSFLD  1599
              +       YLQ +  +Q+  +A L+L   LL +    ++  + +I+A+  AL    F +
Sbjct  921   FSTMHTFLVYLQMAPMEQQPAIATLLLQLDLLVEPWKMSIYREESIEALIEALRRKEFSN  980

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              ++  M    LL L  H ++ G+  TE W+LK AGF   + + +++    + DN  +  M
Sbjct  981   SQM--MALDALLSLTGHITSSGESYTEAWLLKIAGFDHPYNALMKAERPRKHDNDLMGTM  1038

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             D+ EE+    WQ R++ +L    + S   AL  CL S ++E+ + CL    WL+++L+  
Sbjct  1039  DE-EEKAVTSWQKRVAFVLCNHERGSIFKALEECLKSNSLEMAKSCLVIATWLTNMLSIL  1097

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
               +G + E     AL+ +    L+    LE K+LA++ L +F   P     L +  + I 
Sbjct  1098  PDTGVKREAR--KALLDEFINVLQSSNNLEEKILATLALKSFVNDPAALEALGVYAKCIY  1155

Query  2140  DTLECLAEVTWVARELQTVI  2199
              TL  L + + VA ++   +
Sbjct  1156  KTLRKLKKNSVVANDIMKAL  1175


 Score = 90.9 bits (224),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLEC-QAVPLSNFI  975
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + +     +P +N++
Sbjct  504   PKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPIAATTTLPKTNYV  563

Query  976   LKRVIDKWRSEH  1011
             LKR++  W+ +H
Sbjct  564   LKRLMTSWKEQH  575


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 50/105 (48%), Gaps = 27/105 (26%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS--------  177
            H++++F   P  +R    P+LW  +FLPH+S +  WY ++   L M   PDS        
Sbjct  145  HVIEMFIVDPFFSRIDFAPELWKQLFLPHMSSIVGWYSEQRHRLVMEVIPDSTDLSFTAD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKD  264
                            +  KL+ LE++Y E++D  T  +A Y+KD
Sbjct  205  LDQFFSESLIYSMRPDQVEKLQKLEQLYGESLDENTRLYAKYFKD  249



>gb|AES64714.2| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=740

 Score =   104 bits (260),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 3/108 (3%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML--ESPD  174
            L + DR+++KH+LQVFC SP  ART LLPDLWD++FLPHL HLKIWY  E   L  E   
Sbjct  175  LHKNDRVSSKHLLQVFCYSPNLARTYLLPDLWDHLFLPHLLHLKIWYTSEFEFLSNEFHG  234

Query  175  SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-TEGVEPPSIPSVKIP  315
             K +K+KVL KVYNE MD+GT  FA+YYK WL   G     +P V +P
Sbjct  235  EKEKKVKVLNKVYNEKMDSGTYLFAMYYKQWLKVSGASELPLPIVPLP  282


 Score = 73.6 bits (179),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 116/224 (52%), Gaps = 18/224 (8%)
 Frame = +1

Query  853   LETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAF  1032
             L +   F +A++L + SK     P+  + +  + VPL    + RV++          +  
Sbjct  511   LRSTSLFLKASVLLYLSK-----PMAKQMISSEWVPL----ILRVLEFGDKLQTLFTVQC  561

Query  1033  SSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCV  1212
             S Q A       A  IL++LL     D+  +N +Q++ LGGL  LI R + G ++EK+  
Sbjct  562   SPQVA-------AFYILDQLLNGFDEDKNLENARQVLSLGGLTLLIKRIDDGEIHEKENS  614

Query  1213  SALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNRRKDAT  1389
             + ++S C+ A+ +CR+ +A NI+K  LLE ++      S   A+SL+ EL+ L+RR    
Sbjct  615   ALIISCCLRAEGSCRSYLAENINKSSLLELIVLGRKQNSSGYALSLLFELLHLDRRTKIL  674

Query  1390  YFLSGLQSD-DIANITILLSTYLQSSHCKQKSLVAVLILHFHLL  1518
              FL GL+      N   +   YLQ +  +++ LVAV++L   L+
Sbjct  675   KFLRGLKDGWSGLNTMHIFFIYLQKAPLEERPLVAVILLMLDLM  718



>ref|XP_007225466.1| hypothetical protein PRUPE_ppa000216mg [Prunus persica]
 gb|EMJ26665.1| hypothetical protein PRUPE_ppa000216mg [Prunus persica]
Length=1450

 Score =   104 bits (260),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 95/380 (25%), Positives = 189/380 (50%), Gaps = 8/380 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A++I+E++L+    + R+ N   +I   G+  L+    L     ++ + ++L  C++A
Sbjct  771   DAALAIIEQILMGGDENSRSINALSVISANGIPALVR--CLDRAEGRRSIVSILLCCMQA  828

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             + +CR+LIA  ++   +LE+  + +       +  ++EL+ LNRR      L  ++ +  
Sbjct  829   EKSCRSLIANRVELSPVLELFHAGNDCVRGICVEFLSELVQLNRRTLCNQILQMIKDEGP  888

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALE-SSFLD  1599
              +       YLQ +  +Q+  +A L+L   LL +    ++  + +I+A+  AL    F +
Sbjct  889   FSTMHTFLVYLQMAPMEQQPAIATLLLQLDLLVEPWKMSIYREESIEALIEALRRKEFSN  948

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              ++  M    LL L  H ++ G+  T  W+LK AGF   + + +++ +  + DN  +  M
Sbjct  949   SQM--MALDALLSLTGHITSSGESYTGAWLLKIAGFDQPYNALMKAEQPRKHDNDLMGTM  1006

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             D+ EE+    WQ R++ +L    + S   AL  C+ S ++E+ + CL    WL+++L+  
Sbjct  1007  DE-EEKAVTSWQKRVAFVLCNHERGSIFKALEECIKSNSLEMAKSCLVIATWLTNMLSIL  1065

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
               +G + E     AL+ +    L+    LE K+LA++ L +F   P     L +  + I 
Sbjct  1066  PDTGVKREAR--KALLDEFINVLQSSNNLEEKILATLALKSFVSDPAALEALGVYAKCIY  1123

Query  2140  DTLECLAEVTWVARELQTVI  2199
              TL  L + + VA ++   +
Sbjct  1124  KTLRKLKKNSVVANDIMKAL  1143


 Score = 90.9 bits (224),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLEC-QAVPLSNFI  975
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + +     +P +N++
Sbjct  472   PKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPIAATTTLPKTNYV  531

Query  976   LKRVIDKWRSEH  1011
             LKR++  W+ +H
Sbjct  532   LKRLMTSWKEQH  543



>ref|XP_002988129.1| hypothetical protein SELMODRAFT_426843 [Selaginella moellendorffii]
 gb|EFJ10921.1| hypothetical protein SELMODRAFT_426843 [Selaginella moellendorffii]
Length=1405

 Score =   102 bits (255),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 136/309 (44%), Gaps = 66/309 (21%)
 Frame = +1

Query  199   LEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVKIPFLSPQLARNEDPNSVSCIVGS  378
             LE++Y  T+D  T ++A +Y+D L        +PS ++  + P L   E P         
Sbjct  244   LEELYQNTLDDHTRQYAKFYRDCL-------RLPSSQLKVVKPLLPTAEPP---------  287

Query  379   FSPQPVVSKKLYDEVFRH-KNGVEL--DYYKEESYGGSASMSNGSVTEETHCSQIV----  537
                       + DEVF+  K  +E+  ++  +E   G   + N + T+ +   QI     
Sbjct  288   ----------VTDEVFQPLKAQLEVIQEHESDEERDGDNELVNDTETQLSFSRQIKDHES  337

Query  538   ---KIEPYATCQSYSMPITEEAEIQEENKLVEHFSDVHP-----------KPSIQEIYGT  675
                K +P +   S    ++  +   + ++    +   HP           +P  Q+    
Sbjct  338   SEEKKQPASATSSKGASLSRSSSFDKTSE--RSYEHAHPMSRSSISAEFSRPGAQQKTSR  395

Query  676   IDAAPHSKVIKI-----------------IIERIAKAFFGQQNTEESVDSERPLGLSIPT  804
               +   S++                     I R    +  +++     D+     +  P 
Sbjct  396   SSSFNRSELDTSERSLERRCSLNHVEHLNSISRDGDIYDEERSVTSETDAYERRMVRPPK  455

Query  805   EFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFILKR  984
             +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT + L+ +A+P +N++LKR
Sbjct  456   DFVCPITNQLFDDPVTLETGQTYERTAIREWLERGNTTCPITRQLLKNRALPSTNYVLKR  515

Query  985   VIDKWRSEH  1011
             +++ W+  H
Sbjct  516   LVENWKEIH  524


 Score = 99.4 bits (246),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 168/374 (45%), Gaps = 14/374 (4%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLI-CLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEAD  1245
             AV +L++L  VS+  ER  +   L+  L  +  +I      +++E+    ++L  C+EAD
Sbjct  740   AVGLLQQL--VSTSPERPHSSAHLLLALEAVPIVIENLKAKDIDERLSTISVLLCCMEAD  797

Query  1246  SNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIA  1425
               CRNLI+R      ++E+L      + + A     EL   NRR+     L+ ++++ I 
Sbjct  798   GRCRNLISRTAQLGPVVEILVRGSGSARELATFFFLELAHSNRRETNNKVLTTVKNEGIL  857

Query  1426  NITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDER  1605
             +   +L    Q +  + K  +AVL+L   +L   +  ++  + A+DAI  AL      + 
Sbjct  858   STMHVLFVACQKAPTEHKHTIAVLMLQLEILGQRRQQSIYKEEALDAIVAALSRESPFDC  917

Query  1606  LIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDD  1785
              +E     + ++GR FS  G  +TE W+LK AG    +E  L + ED + +         
Sbjct  918   QVETAEALVALVGR-FSYAGTPLTEAWLLKLAGLEQPYE--LLTNEDPQQEREAAEEK--  972

Query  1786  GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssr  1965
                     W+   + + L     + L AL   L S N+EL + C+    WLS V+     
Sbjct  973   ----AANLWELNAARVFLEYEGGAILEALGAMLQSKNLELWKPCMIFAVWLSFVVKKLPI  1028

Query  1966  sgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIEDT  2145
             SG       +   +      LE  K ++ KVLA++ L  F    E    L+   + +   
Sbjct  1029  SGLRPYFRRY--FLAPFVVALESTKNVQQKVLAALGLHTFLDDAESMQELIGYAKDVVKP  1086

Query  2146  LECLAEVTWVAREL  2187
                L +VTW+A+E 
Sbjct  1087  FRQLKKVTWIAQEF  1100



>ref|XP_009588634.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X3 [Nicotiana tomentosiformis]
Length=1375

 Score =   102 bits (255),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  387   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  441

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  442   QSLSASTLPKANYVLKRLITSWREQH  467


 Score = 87.4 bits (215),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 88/342 (26%), Positives = 163/342 (48%), Gaps = 8/342 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + +V +LE+++      +++ N  Q+I   G+  L+    L + N ++ +  +L  CI A
Sbjct  696   DASVVLLEQIITGGGESDQSFNAMQIISGNGILALLK--CLEHENGRESIVCILLCCIRA  753

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D++CRN +A  I+   +LE++ +         I L+ EL+ L+RR      L  ++ +  
Sbjct  754   DTSCRNTVASRIELSPVLELIHTGSDSVKATCIELLYELVLLSRRTLCNQILQIIKDEGA  813

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLD  1599
              +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  AL +  F  
Sbjct  814   FSTMHTLLVSLQMASVEQKSTIAPLLLQLDLLVEPRKMSIYREESIEALIEALHKKDFPA  873

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              +L  +    LL L  H +  GK   E  +LK AGF  R+ + ++       +N    +M
Sbjct  874   SQLRAL--DALLSLSGHLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAGENDTTNIM  931

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             ++ EE+    W+ R + +L    K     AL  CL S ++E+ +       WL  +L + 
Sbjct  932   EE-EEKALSSWENRTAFVLCNHEKGLVFRALEECLKSTSMEIAKSSFIVATWLIHMLYNF  990

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
               +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  991   PDTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  1030



>ref|XP_003591660.1| U-box domain-containing protein [Medicago truncatula]
 ref|XP_003637097.1| U-box domain-containing protein [Medicago truncatula]
 gb|AES61911.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=1490

 Score =   102 bits (254),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 101/385 (26%), Positives = 190/385 (49%), Gaps = 11/385 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             Q A D KA  A++ILE++LI      R+ N   +I   G+  ++    L     ++ V +
Sbjct  807   QLAIDPKA-AAIAILEQILIGGDEYNRSVNASSVISANGIPAIVKY--LDKTEGRRPVIS  863

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C++A+ +C++ IA  I+   +LE+  + + +SV+   +  ++EL+ LNRR  +   
Sbjct  864   ILLCCMQAEKSCKSSIANRIELSPVLELFHAGN-DSVRGICVEFLSELVRLNRRTSSNQT  922

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  + +  VA L+L   LL + +  ++  + A++ +  
Sbjct  923   LQIIKDEGAFSTMHTFLVYLQMAPMEHQIAVASLLLQLDLLAEPRKMSIYREEAVETLIE  982

Query  1576  AL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
             AL +  F + ++       LL L  H ++ GK  TE  +LK AGF   +   +++ +   
Sbjct  983   ALWQKDFSNNQM--KALDALLFLIGHVTSSGKSYTEAGLLKIAGFDQPYNVLMKAEQLGH  1040

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVA  1932
              DN  +  M+D E+   + WQ R++++L      S   AL  CL S ++++ + CL    
Sbjct  1041  SDNDFMETMED-EKNAMKSWQKRVASVLCNHENGSIFQALEECLKSNSLKMAKSCLVLAT  1099

Query  1933  WLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVL  2112
             WL+ +L +   +G         +L+  L   L+  K LE K+LAS+ L +F   P    +
Sbjct  1100  WLTHMLFTLPDTGVRDVAR--KSLLEALMNVLQSSKNLEEKILASLALKSFISDPTVHEV  1157

Query  2113  LMMIGEVIEDTLECLAEVTWVAREL  2187
             L +  + I   L  L + + VA ++
Sbjct  1158  LRVYAKSIYRILRKLKKYSTVAADI  1182


 Score = 96.3 bits (238),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  511   IGSKPPKDFVCPITGQIFSDPVTLETGQTYERKAIQEWLGTGNTTCPITRQALSANILPK  570

Query  964   SNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQ  1137
             +N++LKR+I  W+ ++ +    FS+  ++  +        + + +VSSI   T +  Q
Sbjct  571   TNYVLKRLIVSWKEQNPELAQEFSN--SNTPRGSSCSPSAKDITMVSSIQRTTDSPSQ  626


 Score = 57.4 bits (137),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 31/126 (25%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML------ESPD------  174
            H L++F   P  +R    P+LW N+FLPH+S +  WY +E   L      ES D      
Sbjct  147  HSLEMFIVDPFFSRIDFAPELWKNLFLPHMSSIVGWYSEERHKLMMEVLPESTDFSYTAD  206

Query  175  ---------------SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVK  309
                           ++  KL+ LE++Y E++D  T  +A YY D +     P S  S K
Sbjct  207  FDKVFNESLVFSMRPNQLEKLQKLEQLYGESLDENTRLYAKYYNDCMN----PDSTSSKK  262

Query  310  IPFLSP  327
            +  + P
Sbjct  263  VVPMLP  268



>sp|D1FP53.1|LIN_MEDTR RecName: Full=Putative E3 ubiquitin-protein ligase LIN; Short=MtLIN 
[Medicago truncatula]
 gb|ACL14419.1| putative E3 ubiquitin ligase [Medicago truncatula]
 gb|ACL14420.1| putative E3 ubiquitin ligase [Medicago truncatula]
 gb|KEH43296.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=1488

 Score =   102 bits (254),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 101/385 (26%), Positives = 190/385 (49%), Gaps = 11/385 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             Q A D KA  A++ILE++LI      R+ N   +I   G+  ++    L     ++ V +
Sbjct  805   QLAIDPKA-AAIAILEQILIGGDEYNRSVNASSVISANGIPAIVKY--LDKTEGRRPVIS  861

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C++A+ +C++ IA  I+   +LE+  + + +SV+   +  ++EL+ LNRR  +   
Sbjct  862   ILLCCMQAEKSCKSSIANRIELSPVLELFHAGN-DSVRGICVEFLSELVRLNRRTSSNQT  920

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  + +  VA L+L   LL + +  ++  + A++ +  
Sbjct  921   LQIIKDEGAFSTMHTFLVYLQMAPMEHQIAVASLLLQLDLLAEPRKMSIYREEAVETLIE  980

Query  1576  AL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
             AL +  F + ++       LL L  H ++ GK  TE  +LK AGF   +   +++ +   
Sbjct  981   ALWQKDFSNNQM--KALDALLFLIGHVTSSGKSYTEAGLLKIAGFDQPYNVLMKAEQLGH  1038

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVA  1932
              DN  +  M+D E+   + WQ R++++L      S   AL  CL S ++++ + CL    
Sbjct  1039  SDNDFMETMED-EKNAMKSWQKRVASVLCNHENGSIFQALEECLKSNSLKMAKSCLVLAT  1097

Query  1933  WLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVL  2112
             WL+ +L +   +G         +L+  L   L+  K LE K+LAS+ L +F   P    +
Sbjct  1098  WLTHMLFTLPDTGVRDVAR--KSLLEALMNVLQSSKNLEEKILASLALKSFISDPTVHEV  1155

Query  2113  LMMIGEVIEDTLECLAEVTWVAREL  2187
             L +  + I   L  L + + VA ++
Sbjct  1156  LRVYAKSIYRILRKLKKYSTVAADI  1180


 Score = 96.3 bits (238),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  509   IGSKPPKDFVCPITGQIFSDPVTLETGQTYERKAIQEWLGTGNTTCPITRQALSANILPK  568

Query  964   SNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQ  1137
             +N++LKR+I  W+ ++ +    FS+  ++  +        + + +VSSI   T +  Q
Sbjct  569   TNYVLKRLIVSWKEQNPELAQEFSN--SNTPRGSSCSPSAKDITMVSSIQRTTDSPSQ  624


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 31/126 (25%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML------ESPD------  174
            H L++F   P  +R    P+LW N+FLPH+S +  WY +E   L      ES D      
Sbjct  145  HSLEMFIVDPFFSRIDFAPELWKNLFLPHMSSIVGWYSEERHKLMMEVLPESTDFSYTAD  204

Query  175  ---------------SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVK  309
                           ++  KL+ LE++Y E++D  T  +A YY D +     P S  S K
Sbjct  205  FDKVFNESLVFSMRPNQLEKLQKLEQLYGESLDENTRLYAKYYNDCMN----PDSTSSKK  260

Query  310  IPFLSP  327
            +  + P
Sbjct  261  VVPMLP  266



>ref|XP_009588635.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X4 [Nicotiana tomentosiformis]
Length=1266

 Score =   102 bits (254),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  278   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  332

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  333   QSLSASTLPKANYVLKRLITSWREQH  358


 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 166/350 (47%), Gaps = 9/350 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QF    K + +V +LE+++      +++ N  Q+I   G+  L+    L + N ++ +  
Sbjct  580   QFTIGPK-DASVVLLEQIITGGGESDQSFNAMQIISGNGILALLK--CLEHENGRESIVC  636

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFL  1398
             +L  CI AD++CRN +A  I+   +LE++ +         I L+ EL+ L+RR      L
Sbjct  637   ILLCCIRADTSCRNTVASRIELSPVLELIHTGSDSVKATCIELLYELVLLSRRTLCNQIL  696

Query  1399  SGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
               ++ +   +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  A
Sbjct  697   QIIKDEGAFSTMHTLLVSLQMASVEQKSTIAPLLLQLDLLVEPRKMSIYREESIEALIEA  756

Query  1579  L-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEP  1755
             L +  F   +L  +    LL L  H +  GK   E  +LK AGF  R+ + ++       
Sbjct  757   LHKKDFPASQLRAL--DALLSLSGHLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAG  814

Query  1756  DNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAW  1935
             +N    +M++ EE+    W+ R + +L    K     AL  CL S ++E+ +       W
Sbjct  815   ENDTTNIMEE-EEKALSSWENRTAFVLCNHEKGLVFRALEECLKSTSMEIAKSSFIVATW  873

Query  1936  LssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
             L  +L +   +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  874   LIHMLYNFPDTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  921



>ref|XP_006851973.1| hypothetical protein AMTR_s00041p00198410 [Amborella trichopoda]
 gb|ERN13440.1| hypothetical protein AMTR_s00041p00198410 [Amborella trichopoda]
Length=647

 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = +1

Query  718   ERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNW  897
             E I+++      +E+    +RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W
Sbjct  211   EDISQSTTSIPTSEKLTPRKRP-----PKDFVCPITGQLFNDPVTLETGQTYERRAIQEW  265

Query  898   FSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFAS  1050
               +GN TCPIT + L    +P +N++LKR+I  W+ +H      FS+  AS
Sbjct  266   LERGNTTCPITRQNLSATTLPKTNYVLKRLITSWKEQHPDLAHEFSNSEAS  316



>ref|XP_009773043.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Nicotiana sylvestris]
Length=1375

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  387   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  441

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  442   QSLSASTLPKTNYVLKRLITSWREQH  467


 Score = 84.3 bits (207),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 88/341 (26%), Positives = 157/341 (46%), Gaps = 6/341 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + AV +LE+++      +R+ N  Q+I   G+  L+    L + N ++ +  +L  CI A
Sbjct  696   DAAVVLLEQIITGGGESDRSFNAMQIISGNGILALLK--CLDHENGRESIICILLCCIRA  753

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRN IA  I+   +LE++ +         I L+ EL+ L+RR      L  ++ +  
Sbjct  754   DKSCRNTIASRIEFSPVLELIHTGSDSVKGTCIELLYELVLLSRRTLCNQILQIIKDEGA  813

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  AL       
Sbjct  814   FSTMHTLLVCLQMASMEQKSTIAPLLLQLDLLVEPRQMSIYREESIEALIEALHKKDFPA  873

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               +      L + G H +  GK   E  +LK AGF  R+ + ++       +N    +M+
Sbjct  874   SQLSALDALLSLSG-HLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAGENDTTNIME  932

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + EE+    W+ R + +L    K     AL  CL S ++E+ +       WL  +L    
Sbjct  933   E-EEKALSSWENRTAFVLCNHEKGLIFRALEECLKSTSMEIAKSSFIVATWLIHMLYKFP  991

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  992   DTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  1030



>ref|XP_009588632.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X1 [Nicotiana tomentosiformis]
Length=1486

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  498   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  552

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  553   QSLSASTLPKANYVLKRLITSWREQH  578


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 88/342 (26%), Positives = 163/342 (48%), Gaps = 8/342 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + +V +LE+++      +++ N  Q+I   G+  L+    L + N ++ +  +L  CI A
Sbjct  807   DASVVLLEQIITGGGESDQSFNAMQIISGNGILALLK--CLEHENGRESIVCILLCCIRA  864

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D++CRN +A  I+   +LE++ +         I L+ EL+ L+RR      L  ++ +  
Sbjct  865   DTSCRNTVASRIELSPVLELIHTGSDSVKATCIELLYELVLLSRRTLCNQILQIIKDEGA  924

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLD  1599
              +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  AL +  F  
Sbjct  925   FSTMHTLLVSLQMASVEQKSTIAPLLLQLDLLVEPRKMSIYREESIEALIEALHKKDFPA  984

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              +L  +    LL L  H +  GK   E  +LK AGF  R+ + ++       +N    +M
Sbjct  985   SQLRAL--DALLSLSGHLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAGENDTTNIM  1042

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             ++ EE+    W+ R + +L    K     AL  CL S ++E+ +       WL  +L + 
Sbjct  1043  EE-EEKALSSWENRTAFVLCNHEKGLVFRALEECLKSTSMEIAKSSFIVATWLIHMLYNF  1101

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
               +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  1102  PDTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  1141


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 31/133 (23%)
 Frame = +1

Query  22   AAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS-----  177
            A  HIL++F   P  +R    P+LW ++F+PH+S +  WY +E   + M   PDS     
Sbjct  142  AVLHILEMFTVDPFFSRIDFAPELWKSLFVPHMSSIVGWYSEERHRIVMDVIPDSSDLSF  201

Query  178  -------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLT--EGVEPPS  294
                               ++ K++ +E++Y +++D  T  +A YYKD +         +
Sbjct  202  TMDFDHDFNESLIFSVRPDQAEKMQKVEQLYGQSLDENTRLYAKYYKDCMNYDSATSKKA  261

Query  295  IPSVKI--PFLSP  327
            IP + I  P ++P
Sbjct  262  IPLLPIAEPPMTP  274



>ref|XP_009588633.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 {ECO:0000250|UniProtKB:D1FP53} 
isoform X2 [Nicotiana tomentosiformis]
Length=1481

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  493   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  547

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  548   QSLSASTLPKANYVLKRLITSWREQH  573


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 88/342 (26%), Positives = 163/342 (48%), Gaps = 8/342 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + +V +LE+++      +++ N  Q+I   G+  L+    L + N ++ +  +L  CI A
Sbjct  802   DASVVLLEQIITGGGESDQSFNAMQIISGNGILALLK--CLEHENGRESIVCILLCCIRA  859

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D++CRN +A  I+   +LE++ +         I L+ EL+ L+RR      L  ++ +  
Sbjct  860   DTSCRNTVASRIELSPVLELIHTGSDSVKATCIELLYELVLLSRRTLCNQILQIIKDEGA  919

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLD  1599
              +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  AL +  F  
Sbjct  920   FSTMHTLLVSLQMASVEQKSTIAPLLLQLDLLVEPRKMSIYREESIEALIEALHKKDFPA  979

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              +L  +    LL L  H +  GK   E  +LK AGF  R+ + ++       +N    +M
Sbjct  980   SQLRAL--DALLSLSGHLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAGENDTTNIM  1037

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             ++ EE+    W+ R + +L    K     AL  CL S ++E+ +       WL  +L + 
Sbjct  1038  EE-EEKALSSWENRTAFVLCNHEKGLVFRALEECLKSTSMEIAKSSFIVATWLIHMLYNF  1096

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
               +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  1097  PDTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  1136


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 31/133 (23%)
 Frame = +1

Query  22   AAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS-----  177
            A  HIL++F   P  +R    P+LW ++F+PH+S +  WY +E   + M   PDS     
Sbjct  142  AVLHILEMFTVDPFFSRIDFAPELWKSLFVPHMSSIVGWYSEERHRIVMDVIPDSSDLSF  201

Query  178  -------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLT--EGVEPPS  294
                               ++ K++ +E++Y +++D  T  +A YYKD +         +
Sbjct  202  TMDFDHDFNESLIFSVRPDQAEKMQKVEQLYGQSLDENTRLYAKYYKDCMNYDSATSKKA  261

Query  295  IPSVKI--PFLSP  327
            IP + I  P ++P
Sbjct  262  IPLLPIAEPPMTP  274



>ref|XP_009773059.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X5 [Nicotiana sylvestris]
Length=1266

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  278   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  332

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  333   QSLSASTLPKTNYVLKRLITSWREQH  358


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 98/375 (26%), Positives = 171/375 (46%), Gaps = 15/375 (4%)
 Frame = +1

Query  967   NFI--LKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQL  1140
             NF+  L ++I   RSE +        QF    K + AV +LE+++      +R+ N  Q+
Sbjct  560   NFVPSLTQIISN-RSEDFSDF-----QFTIGPK-DAAVVLLEQIITGGGESDRSFNAMQI  612

Query  1141  ICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDL  1320
             I   G+  L+    L + N ++ +  +L  CI AD +CRN IA  I+   +LE++ +   
Sbjct  613   ISGNGILALLK--CLDHENGRESIICILLCCIRADKSCRNTIASRIEFSPVLELIHTGSD  670

Query  1321  ESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLI  1500
                   I L+ EL+ L+RR      L  ++ +   +    L   LQ +  +QKS +A L+
Sbjct  671   SVKGTCIELLYELVLLSRRTLCNQILQIIKDEGAFSTMHTLLVCLQMASMEQKSTIAPLL  730

Query  1501  LHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTE  1680
             L   LL + +  ++  + +I+A+  AL         +      L + G H +  GK   E
Sbjct  731   LQLDLLVEPRQMSIYREESIEALIEALHKKDFPASQLSALDALLSLSG-HLTNSGKSFLE  789

Query  1681  DWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSF  1860
               +LK AGF  R+ + ++       +N    +M++ EE+    W+ R + +L    K   
Sbjct  790   ARLLKIAGFNQRYNATMKEERQKAGENDTTNIMEE-EEKALSSWENRTAFVLCNHEKGLI  848

Query  1861  LGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGK  2040
               AL  CL S ++E+ +       WL  +L     +G         +L+ Q    L+  K
Sbjct  849   FRALEECLKSTSMEIAKSSFIVATWLIHMLYKFPDTGIRDVAR--KSLLEQFIQMLQSTK  906

Query  2041  LLEHKVLASVCLLNF  2085
              +E K+LA++ L  F
Sbjct  907   NIEEKILAALALRGF  921



>ref|XP_004496090.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496091.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like isoform 
X2 [Cicer arietinum]
Length=1486

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 95/384 (25%), Positives = 185/384 (48%), Gaps = 9/384 (2%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             Q A D +A  ++++LE++L+      R+ N   +I   G+  ++    L     ++ V +
Sbjct  803   QLAIDPRAA-SIAVLEQILMGGDEYNRSVNASSVISANGIPAIVKY--LDRTEGRRSVVS  859

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFL  1398
             +L  C++A+ +C++ IA  I+   +LE+    +       +  ++EL+ LNRR  +   L
Sbjct  860   ILLCCMQAEKSCKSSIANRIELSPVLELFHGGNDSVRGTCVEFLSELVRLNRRTFSNQIL  919

Query  1399  SGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
               ++ +   +       YLQ +  + +  VA L+L   LL   +  ++  + A++ +  A
Sbjct  920   QIIKDEGAFSTMHTFLVYLQMAPMEHQIAVASLLLQLDLLVVPRKMSIYREEAVETLIEA  979

Query  1579  L-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEP  1755
             L +  F + ++  +    LL L  H ++ GK  TE W+LK AGF+  + + +++ +    
Sbjct  980   LWQKDFSNTQMKAL--DALLFLIGHVTSSGKSYTEAWLLKIAGFVQPYNALMKAEQLGHY  1037

Query  1756  DNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAW  1935
             +N  +  M+D EE     WQ R++ +L      S   AL  CL S ++++ + CL    W
Sbjct  1038  ENDVMETMED-EENAMNSWQKRVAFVLCNHENGSIFQALEECLKSNSLKMAKSCLVLATW  1096

Query  1936  LssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLL  2115
             L+ +L++   +G         +L  +    L+  K LE K+LA++ L +F   P     L
Sbjct  1097  LTHMLSTLPDTGLRDAAR--KSLFEEFINVLQSSKNLEEKILAALALKSFISDPTAHEAL  1154

Query  2116  MMIGEVIEDTLECLAEVTWVAREL  2187
              +  + I   L  L + + VA E+
Sbjct  1155  RVYAKSIYRILRKLKKYSTVAVEI  1178


 Score = 94.7 bits (234),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  784   LGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPL  963
             +G   P +F+CP+TG +F DPVTLETGQ++ER AI  W   GN TCPIT + L    +P 
Sbjct  507   IGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQEWLGTGNTTCPITRQPLSANILPK  566

Query  964   SNFILKRVIDKWRSEHWQHLLAFSS  1038
             +N++LKR+I  W+ ++ +    FS+
Sbjct  567   TNYVLKRLITSWKEQNPKLAQEFSN  591


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 56/126 (44%), Gaps = 31/126 (25%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDSKS------  183
            H +++F   P  +R    P+LW N+FLPH+S +  WY +E   L M   PDS        
Sbjct  145  HAIEMFIVDPFFSRIDFAPELWKNLFLPHMSSIVGWYSEERHRLMMEVIPDSSDLSYTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVK  309
                               KL+ LE++Y E++D  T  +A YY D +     P S  S +
Sbjct  205  FEQFFNESLVFSMRPHQLDKLQKLEQLYGESLDENTRLYAKYYNDCMN----PDSTSSKR  260

Query  310  IPFLSP  327
            +  + P
Sbjct  261  VVPMLP  266



>ref|XP_011045078.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Populus euphratica]
Length=1258

 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = +1

Query  727   AKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSK  906
             ++++     +E      RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W  +
Sbjct  250   SQSYISLPTSEMPTPRSRP-----PKDFVCPITGQLFNDPVTLETGQTYERKAIQEWVKR  304

Query  907   GNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILE  1086
             GN TCPIT + L   ++P +N++LKR+I  W+ +H +    FS  ++   +   + S L 
Sbjct  305   GNTTCPITRQPLSANSLPKTNYVLKRLITSWKEQHPELAQEFS--YSETPRNSFSPSSLR  362

Query  1087  KLLIVSS  1107
             + L+VS+
Sbjct  363   ENLLVST  369


 Score = 87.0 bits (214),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 99/381 (26%), Positives = 180/381 (47%), Gaps = 18/381 (5%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QFA + K + A+++LE LL     + ++ N   +IC  G+  L+    L  +  +K + +
Sbjct  564   QFAIEPK-DAAIAVLEHLLTGGDENSQSVNAFDVICANGIPALVK--CLDRVEGRKSIIS  620

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C+ AD   RN IA  I+   +LE+  S D +SV+   I  ++EL+ LNRR      
Sbjct  621   ILLCCMRADKTSRNSIASTIELSPVLELFHSGD-DSVRGLCIDFLSELVQLNRRTFCNQI  679

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  +Q+  +A L+L   LL + +  ++  + A++A+  
Sbjct  680   LQIIKDEGAFSTMHTFLVYLQMAPMRQQPSLATLLLQLDLLAEPRKMSIYREEAVEALIE  739

Query  1576  AL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF------IDRFESDLE  1734
             +L    F + ++  M    L+ +    ++ G    E W+LK AG+      + + E  L+
Sbjct  740   SLHRKDFSNSQM--MALDALISISARRTSSGGTYMEAWLLKIAGYDLPCNALMKAEK-LK  796

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
               E++  +N     M+D EE+    W+ R++ +L    K S   AL  C  S ++E  + 
Sbjct  797   KNENDLAENFLAETMED-EEKAVSSWEKRVAFVLCNHEKGSIFKALEECFKSNSLETEKS  855

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKI  2094
             CL    WL  +L+    +G +       +L+ +    L+  + +E K+LA++ L  F   
Sbjct  856   CLVISTWLIYMLSVLPDTGVKSAAR--KSLLDEFINVLQSTRNMEEKILATLALRTFVSD  913

Query  2095  PECRVLLMMIGEVIEDTLECL  2157
             P     L    + I  TL  L
Sbjct  914   PAALEELGKYAKCIYSTLRKL  934



>ref|XP_009773037.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Nicotiana sylvestris]
Length=1478

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  490   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  544

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  545   QSLSASTLPKTNYVLKRLITSWREQH  570


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 88/341 (26%), Positives = 157/341 (46%), Gaps = 6/341 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + AV +LE+++      +R+ N  Q+I   G+  L+    L + N ++ +  +L  CI A
Sbjct  799   DAAVVLLEQIITGGGESDRSFNAMQIISGNGILALLK--CLDHENGRESIICILLCCIRA  856

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRN IA  I+   +LE++ +         I L+ EL+ L+RR      L  ++ +  
Sbjct  857   DKSCRNTIASRIEFSPVLELIHTGSDSVKGTCIELLYELVLLSRRTLCNQILQIIKDEGA  916

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  AL       
Sbjct  917   FSTMHTLLVCLQMASMEQKSTIAPLLLQLDLLVEPRQMSIYREESIEALIEALHKKDFPA  976

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               +      L + G H +  GK   E  +LK AGF  R+ + ++       +N    +M+
Sbjct  977   SQLSALDALLSLSG-HLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAGENDTTNIME  1035

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + EE+    W+ R + +L    K     AL  CL S ++E+ +       WL  +L    
Sbjct  1036  E-EEKALSSWENRTAFVLCNHEKGLIFRALEECLKSTSMEIAKSSFIVATWLIHMLYKFP  1094

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  1095  DTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  1133


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 53/108 (49%), Gaps = 27/108 (25%)
 Frame = +1

Query  22   AAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS-----  177
            A  HIL++F   P  +R    P+LW ++F+PH+S +  WY +E   + M   PDS     
Sbjct  134  AVLHILEMFTVDPFFSRIDFAPELWKSLFIPHMSSIVGWYSEERHRIVMDVIPDSSDLSF  193

Query  178  -------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKD  264
                               ++ K++ LE++Y +++D  T  +A YYKD
Sbjct  194  TMDFDHDFNESLIFSVRPDQAEKMQKLEQLYGQSLDENTRLYAKYYKD  241



>ref|XP_009773032.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Nicotiana sylvestris]
Length=1486

 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  498   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  552

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  553   QSLSASTLPKTNYVLKRLITSWREQH  578


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 88/341 (26%), Positives = 157/341 (46%), Gaps = 6/341 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + AV +LE+++      +R+ N  Q+I   G+  L+    L + N ++ +  +L  CI A
Sbjct  807   DAAVVLLEQIITGGGESDRSFNAMQIISGNGILALLK--CLDHENGRESIICILLCCIRA  864

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRN IA  I+   +LE++ +         I L+ EL+ L+RR      L  ++ +  
Sbjct  865   DKSCRNTIASRIEFSPVLELIHTGSDSVKGTCIELLYELVLLSRRTLCNQILQIIKDEGA  924

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  AL       
Sbjct  925   FSTMHTLLVCLQMASMEQKSTIAPLLLQLDLLVEPRQMSIYREESIEALIEALHKKDFPA  984

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               +      L + G H +  GK   E  +LK AGF  R+ + ++       +N    +M+
Sbjct  985   SQLSALDALLSLSG-HLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAGENDTTNIME  1043

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + EE+    W+ R + +L    K     AL  CL S ++E+ +       WL  +L    
Sbjct  1044  E-EEKALSSWENRTAFVLCNHEKGLIFRALEECLKSTSMEIAKSSFIVATWLIHMLYKFP  1102

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
              +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  1103  DTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  1141


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 53/108 (49%), Gaps = 27/108 (25%)
 Frame = +1

Query  22   AAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS-----  177
            A  HIL++F   P  +R    P+LW ++F+PH+S +  WY +E   + M   PDS     
Sbjct  142  AVLHILEMFTVDPFFSRIDFAPELWKSLFIPHMSSIVGWYSEERHRIVMDVIPDSSDLSF  201

Query  178  -------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKD  264
                               ++ K++ LE++Y +++D  T  +A YYKD
Sbjct  202  TMDFDHDFNESLIFSVRPDQAEKMQKLEQLYGQSLDENTRLYAKYYKD  249



>ref|XP_009773051.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X4 [Nicotiana sylvestris]
Length=1338

 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +++S    RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT 
Sbjct  350   SDKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITR  404

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  405   QSLSASTLPKTNYVLKRLITSWREQH  430


 Score = 85.9 bits (211),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 160/349 (46%), Gaps = 7/349 (2%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QF    K + AV +LE+++      +R+ N  Q+I   G+  L+    L + N ++ +  
Sbjct  652   QFTIGPK-DAAVVLLEQIITGGGESDRSFNAMQIISGNGILALLK--CLDHENGRESIIC  708

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFL  1398
             +L  CI AD +CRN IA  I+   +LE++ +         I L+ EL+ L+RR      L
Sbjct  709   ILLCCIRADKSCRNTIASRIEFSPVLELIHTGSDSVKGTCIELLYELVLLSRRTLCNQIL  768

Query  1399  SGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVA  1578
               ++ +   +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  A
Sbjct  769   QIIKDEGAFSTMHTLLVCLQMASMEQKSTIAPLLLQLDLLVEPRQMSIYREESIEALIEA  828

Query  1579  LESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPD  1758
             L         +      L + G H +  GK   E  +LK AGF  R+ + ++       +
Sbjct  829   LHKKDFPASQLSALDALLSLSG-HLTNSGKSFLEARLLKIAGFNQRYNATMKEERQKAGE  887

Query  1759  NGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWL  1938
             N    +M++ EE+    W+ R + +L    K     AL  CL S ++E+ +       WL
Sbjct  888   NDTTNIMEE-EEKALSSWENRTAFVLCNHEKGLIFRALEECLKSTSMEIAKSSFIVATWL  946

Query  1939  ssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
               +L     +G         +L+ Q    L+  K +E K+LA++ L  F
Sbjct  947   IHMLYKFPDTGIRDVAR--KSLLEQFIQMLQSTKNIEEKILAALALRGF  993



>ref|XP_011045075.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Populus euphratica]
 ref|XP_011045076.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Populus euphratica]
Length=1508

 Score =   101 bits (252),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = +1

Query  727   AKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSK  906
             ++++     +E      RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W  +
Sbjct  500   SQSYISLPTSEMPTPRSRP-----PKDFVCPITGQLFNDPVTLETGQTYERKAIQEWVKR  554

Query  907   GNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILE  1086
             GN TCPIT + L   ++P +N++LKR+I  W+ +H +    FS  ++   +   + S L 
Sbjct  555   GNTTCPITRQPLSANSLPKTNYVLKRLITSWKEQHPELAQEFS--YSETPRNSFSPSSLR  612

Query  1087  KLLIVSS  1107
             + L+VS+
Sbjct  613   ENLLVST  619


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 99/381 (26%), Positives = 180/381 (47%), Gaps = 18/381 (5%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QFA + K + A+++LE LL     + ++ N   +IC  G+  L+    L  +  +K + +
Sbjct  814   QFAIEPK-DAAIAVLEHLLTGGDENSQSVNAFDVICANGIPALVK--CLDRVEGRKSIIS  870

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C+ AD   RN IA  I+   +LE+  S D +SV+   I  ++EL+ LNRR      
Sbjct  871   ILLCCMRADKTSRNSIASTIELSPVLELFHSGD-DSVRGLCIDFLSELVQLNRRTFCNQI  929

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  +Q+  +A L+L   LL + +  ++  + A++A+  
Sbjct  930   LQIIKDEGAFSTMHTFLVYLQMAPMRQQPSLATLLLQLDLLAEPRKMSIYREEAVEALIE  989

Query  1576  AL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF------IDRFESDLE  1734
             +L    F + ++  M    L+ +    ++ G    E W+LK AG+      + + E  L+
Sbjct  990   SLHRKDFSNSQM--MALDALISISARRTSSGGTYMEAWLLKIAGYDLPCNALMKAEK-LK  1046

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
               E++  +N     M+D EE+    W+ R++ +L    K S   AL  C  S ++E  + 
Sbjct  1047  KNENDLAENFLAETMED-EEKAVSSWEKRVAFVLCNHEKGSIFKALEECFKSNSLETEKS  1105

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKI  2094
             CL    WL  +L+    +G +       +L+ +    L+  + +E K+LA++ L  F   
Sbjct  1106  CLVISTWLIYMLSVLPDTGVKSAAR--KSLLDEFINVLQSTRNMEEKILATLALRTFVSD  1163

Query  2095  PECRVLLMMIGEVIEDTLECL  2157
             P     L    + I  TL  L
Sbjct  1164  PAALEELGKYAKCIYSTLRKL  1184



>ref|XP_011045077.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Populus euphratica]
Length=1505

 Score =   101 bits (252),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = +1

Query  727   AKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSK  906
             ++++     +E      RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W  +
Sbjct  500   SQSYISLPTSEMPTPRSRP-----PKDFVCPITGQLFNDPVTLETGQTYERKAIQEWVKR  554

Query  907   GNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILE  1086
             GN TCPIT + L   ++P +N++LKR+I  W+ +H +    FS  ++   +   + S L 
Sbjct  555   GNTTCPITRQPLSANSLPKTNYVLKRLITSWKEQHPELAQEFS--YSETPRNSFSPSSLR  612

Query  1087  KLLIVSS  1107
             + L+VS+
Sbjct  613   ENLLVST  619


 Score = 87.8 bits (216),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 99/381 (26%), Positives = 180/381 (47%), Gaps = 18/381 (5%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QFA + K + A+++LE LL     + ++ N   +IC  G+  L+    L  +  +K + +
Sbjct  814   QFAIEPK-DAAIAVLEHLLTGGDENSQSVNAFDVICANGIPALVK--CLDRVEGRKSIIS  870

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C+ AD   RN IA  I+   +LE+  S D +SV+   I  ++EL+ LNRR      
Sbjct  871   ILLCCMRADKTSRNSIASTIELSPVLELFHSGD-DSVRGLCIDFLSELVQLNRRTFCNQI  929

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  +Q+  +A L+L   LL + +  ++  + A++A+  
Sbjct  930   LQIIKDEGAFSTMHTFLVYLQMAPMRQQPSLATLLLQLDLLAEPRKMSIYREEAVEALIE  989

Query  1576  AL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGF------IDRFESDLE  1734
             +L    F + ++  M    L+ +    ++ G    E W+LK AG+      + + E  L+
Sbjct  990   SLHRKDFSNSQM--MALDALISISARRTSSGGTYMEAWLLKIAGYDLPCNALMKAEK-LK  1046

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
               E++  +N     M+D EE+    W+ R++ +L    K S   AL  C  S ++E  + 
Sbjct  1047  KNENDLAENFLAETMED-EEKAVSSWEKRVAFVLCNHEKGSIFKALEECFKSNSLETEKS  1105

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKI  2094
             CL    WL  +L+    +G +       +L+ +    L+  + +E K+LA++ L  F   
Sbjct  1106  CLVISTWLIYMLSVLPDTGVKSAAR--KSLLDEFINVLQSTRNMEEKILATLALRTFVSD  1163

Query  2095  PECRVLLMMIGEVIEDTLECL  2157
             P     L    + I  TL  L
Sbjct  1164  PAALEELGKYAKCIYSTLRKL  1184



>ref|XP_007027082.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY07584.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=1500

 Score =   100 bits (250),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT + L   A+P +N++L
Sbjct  523   PKDFVCPITGQIFNDPVTLETGQTYERKAIEEWLNRGNTTCPITRQPLSSSALPKTNYVL  582

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ +H
Sbjct  583   KRLITSWKEQH  593


 Score = 93.2 bits (230),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 93/379 (25%), Positives = 184/379 (49%), Gaps = 12/379 (3%)
 Frame = +1

Query  1060  AEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIE  1239
             ++ A+++LE++L+      R+ N   +I   G+  L+    L  +  ++ + ++L  C+ 
Sbjct  820   SDAAIAMLEQILMGGDEKSRSFNALSVISANGIPRLVK--CLDRMEIRRSIISILLCCMR  877

Query  1240  ADSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDD  1419
              D +CRNLIA  I+   +LE+  + +       I  + +L+ LNRR  +   L  ++++ 
Sbjct  878   VDKSCRNLIATGIELSYVLELFHAGNDSIRGICIDFLFKLVQLNRRTLSNQMLEIIRTEG  937

Query  1420  IANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFL  1596
               +       YLQ +  + +  +A L+L   LL + +  ++  + AI+A+  AL    F 
Sbjct  938   AFSTMHTFLVYLQMAPMEHQPAIATLLLQLDLLVEPRKMSIYREEAIEALIEALHRKDFP  997

Query  1597  DERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLEST--EDNEPDNGRI  1770
             ++++I +    LL L   F++ G+   E W+LK AGF   + + +++   + +E D   +
Sbjct  998   NQQMIVL--DALLSLSGRFTSAGESYIEVWLLKMAGFDQPYNALIKTNLLQKHEKD---L  1052

Query  1771  TMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvl  1950
                 +GEE+    W+ R++ +L    K S   AL  C  S ++++ +  L   +WL+ +L
Sbjct  1053  NETMEGEEKAAYLWERRVAFVLCNHEKGSIFKALEECFKSNSLKMAKSSLVIASWLTYML  1112

Query  1951  asssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGE  2130
             ++   +G         +L+ +    L+  K LE K+LA++ L  F   P     L    +
Sbjct  1113  STLPDTGVSQAAR--ESLLDEFINVLQSSKNLEEKILAALALKTFINDPAALEELGKYAK  1170

Query  2131  VIEDTLECLAEVTWVAREL  2187
              I  TL  L   + VA ++
Sbjct  1171  GIYKTLRKLKRNSVVATDI  1189


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 59/129 (46%), Gaps = 33/129 (26%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWY--IKELGMLES-PDSKS------  183
            HILQ+F   P  AR    P+LW  +FLPH+S +  WY   +   M+E+ PDS        
Sbjct  145  HILQMFIIDPFFARIDFAPELWKELFLPHMSSIVGWYSEARHRLMMEAIPDSSDLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWL------TEGVEPP  291
                               KLK LE++Y E++D  T  FA YYKD +      ++ V  P
Sbjct  205  FDQFFNESLIFSMRPDQVEKLKKLEQLYGESLDENTRLFAKYYKDCMNSDSTASKKVMAP  264

Query  292  SIPSVKIPF  318
             +P  + P 
Sbjct  265  MLPIAEPPM  273



>ref|XP_002307730.2| hypothetical protein POPTR_0005s26160g [Populus trichocarpa]
 gb|EEE94726.2| hypothetical protein POPTR_0005s26160g [Populus trichocarpa]
Length=1368

 Score =   100 bits (250),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + L   ++P +N++L
Sbjct  382   PKDFVCPITGQLFNDPVTLETGQTYERKAIQEWVKRGNTTCPITRQPLSANSLPKTNYVL  441

Query  979   KRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSS  1107
             KR+I  W+ +H +    FS  ++   +   + S L + L+VS+
Sbjct  442   KRLITSWKEQHPELAQEFS--YSETPRNSFSPSSLRENLLVST  482


 Score = 92.0 bits (227),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 99/380 (26%), Positives = 180/380 (47%), Gaps = 16/380 (4%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QFA + K + A+++LE LL     + R+ N   +IC  G+  L+    L  +  +K + +
Sbjct  677   QFAIEPK-DAAIAVLEHLLTGGDENSRSVNAFDVICANGIPALVK--CLDRVEGRKSIIS  733

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C+ AD + RN IA  I+   +LE+  S D +SV+   I  ++EL+ LNRR      
Sbjct  734   ILLCCMRADKSSRNSIASTIELSPVLELFHSGD-DSVRGLCIDFLSELVQLNRRTFCNQI  792

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  +Q+  +A L+L   LL + +  ++  + A++A+  
Sbjct  793   LQIIKDEGAFSTMHTFLVYLQMAPMRQQPSLATLLLQLDLLAEPRKMSIYREEAVEALIE  852

Query  1576  AL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFES-----DLES  1737
             AL    F + ++  M    L+ +    ++ G    E W+LK AG+   + +      L+ 
Sbjct  853   ALHRKDFSNSQM--MALDALVSISARRTSSGGTYMEAWLLKIAGYDLPYNALMKAEKLKK  910

Query  1738  TEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVC  1917
              E++  +N     ++D EE+    W+ R++ +L    K S   AL  C  S ++E  + C
Sbjct  911   NENDLAENFLAETVED-EEKAVSSWEKRVAFVLCNHEKGSIFKALEECFKSNSLETAKSC  969

Query  1918  LTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIP  2097
             L    WL  +L+    +G +       +L+ +    L+  + +E K+LA++ L  F   P
Sbjct  970   LVISTWLIYMLSVLPDTGVKSAAR--KSLLDEFINVLQSTRNMEEKILATLALRTFVSDP  1027

Query  2098  ECRVLLMMIGEVIEDTLECL  2157
                  L    + I  TL  L
Sbjct  1028  AALEELGKYAKCIYSTLRKL  1047


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 54/115 (47%), Gaps = 27/115 (23%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWY--IKELGMLES-P  171
            ++  D  +  H+L++F   P  +R    P+LW ++FLP +S +  WY   +   M+E  P
Sbjct  135  MRNNDENSVLHVLEMFIVDPFFSRIDFAPELWKDLFLPQMSSIVGWYSEARHRLMVEVIP  194

Query  172  DS------------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKD  264
            DS                        +  KL+ LE++Y E++D  T  FA YYKD
Sbjct  195  DSSDLSFTADLDQFFNESLIYSMRPDQVEKLQNLEELYRESLDENTRLFAKYYKD  249



>ref|XP_010319718.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Solanum lycopersicum]
Length=1482

 Score =   100 bits (248),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 109/376 (29%), Positives = 178/376 (47%), Gaps = 17/376 (5%)
 Frame = +1

Query  967   NFI--LKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQL  1140
             NF+  L ++I   R+E   H      QF   +K E AV++LE+++      +R+ N  Q+
Sbjct  776   NFVPSLTQIISN-RNEDSSHF-----QFTIGTK-EAAVALLEQIITGGGESDRSFNAIQV  828

Query  1141  ICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDL  1320
             I   G+  L+    L + N ++ +  +L  CI AD +CRN IA  I+   +LE++ +   
Sbjct  829   ISGNGIPALLK--CLEHENGRESIVCILLFCIRADKSCRNTIASRIELSPVLELIHTGSD  886

Query  1321  ESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLI  1500
                   I L+ EL+ LNRR      L  ++ +   +    L   LQ +  +QKS +A L+
Sbjct  887   SVKATCIELLYELVLLNRRTLCNQILQIIKDEGAFSTMHTLLVCLQMASMEQKSTIAPLL  946

Query  1501  LHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMT  1677
             L   LL + +  ++  + +IDA+  AL E  F   +L  +    LL L  H S   K   
Sbjct  947   LQLDLLVEPRKMSIYREESIDALIEALHEKDFPASQLRAL--DALLSLSGHLSNSAKSFL  1004

Query  1678  EDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKS  1857
             E  +LK AGF  R+ + ++  +    +N  IT   + EE+    W+ RM+ +L    K  
Sbjct  1005  EARLLKTAGFNQRYNATIKEEKQRAGEND-ITNTTEEEEKALSSWENRMAFVLCNHEKGL  1063

Query  1858  FLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHG  2037
                AL  CL S ++E+ +       WL  +L S   +G         +L+ Q    L+  
Sbjct  1064  IFKALEECLTSTSMEIAKSSFILATWLIHMLYSFPDTGIRDIAR--KSLLEQFIQMLQST  1121

Query  2038  KLLEHKVLASVCLLNF  2085
             K LE K+LA++ L  F
Sbjct  1122  KNLEEKILAALALRGF  1137


 Score = 99.8 bits (247),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +E+S    RP     P +F+CP+TG +F DPVTLETGQ++E  AI  W  +GN TCPIT 
Sbjct  494   SEKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYEGKAIQEWIKRGNTTCPITR  548

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  549   QSLSAATLPKTNYVLKRLITSWREQH  574


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 61/142 (43%), Gaps = 32/142 (23%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E   + M   PDS        
Sbjct  145  HILEMFIIDPFFSRIDFAPELWKCLFLPHMSSIVGWYSEERHRIVMDVIPDSSDLSFTMD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-----TEGVEPPS  294
                            ++ K++ LE +Y +++D  T  +A +YKD +     T     P 
Sbjct  205  FDHDFNESLIFSVRPDQAEKMQKLELLYGQSLDDNTRLYAKFYKDCINYDSATSKKAIPL  264

Query  295  IPSVKIPFLSPQLARNEDPNSV  360
            +P  + P       R   P+ V
Sbjct  265  LPIAEPPMTPLHEVRRSIPDYV  286



>ref|XP_011083563.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Sesamum 
indicum]
Length=1499

 Score =   100 bits (248),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W ++GN TCPIT + L   ++P +N++L
Sbjct  516   PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWMNRGNTTCPITRQPLSAASLPKTNYVL  575

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ +H
Sbjct  576   KRLITSWKEQH  586


 Score = 93.6 bits (231),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 93/366 (25%), Positives = 173/366 (47%), Gaps = 14/366 (4%)
 Frame = +1

Query  1018  HLLAFSSQFASD-----SKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFN  1182
             H+++  S+ ++D     +  + A+++LE+++      +R+ N + +I   G+  L++  N
Sbjct  787   HIISNKSEDSADFQYVIAPKDAAIALLEEIVAGGDKTDRSYNARTIITENGIPALLNCLN  846

Query  1183  LGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNA-ISLMTEL  1359
                ++ ++ + ++L  CI  D  C+++IA  I+   +LE+    + +SV+   +  + EL
Sbjct  847   --RVDGRQSIMSILLCCIRIDIACKDIIANRIELSPVLELFHGGN-DSVRGVCVEFLCEL  903

Query  1360  ICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSN  1539
             + L+RR  +   L  ++ +   +    L  YLQ S  +QK  VA L+L   LLT  +  +
Sbjct  904   VQLSRRTLSNQILQIIKEEGTFSTMHTLLVYLQMSPMEQKPAVAFLLLQLDLLTAPRKMS  963

Query  1540  VCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRF  1719
             +  + A++A+  AL+        I M  + L  L  H  A  K   E W+LK AGF   +
Sbjct  964   IYREEAMEALLEALQRKDFPSSQI-MALRMLSSLSGHQGASRKPYMESWLLKIAGFDQPY  1022

Query  1720  ESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNI  1899
              + +   E    D     M +  EE+    W+ RM+ +L    +     AL  C  S +I
Sbjct  1023  NAMMRGEETKTSDTKFAAMKE--EEKATRTWEKRMAFVLTNYERGMVFRALEECFKSNSI  1080

Query  1900  ELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLL  2079
             ++ + C+    WL  +L S    G         +L+ +    L+  K LE K+LA++ L 
Sbjct  1081  DIAKSCIVVATWLVYMLYSFPDCGIRDVAC--KSLLDKFINVLQSSKNLEEKILAALALR  1138

Query  2080  NFSKIP  2097
              F   P
Sbjct  1139  GFISEP  1144



>ref|XP_010319719.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X3 [Solanum lycopersicum]
Length=1481

 Score =   100 bits (248),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 109/376 (29%), Positives = 178/376 (47%), Gaps = 17/376 (5%)
 Frame = +1

Query  967   NFI--LKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQL  1140
             NF+  L ++I   R+E   H      QF   +K E AV++LE+++      +R+ N  Q+
Sbjct  775   NFVPSLTQIISN-RNEDSSHF-----QFTIGTK-EAAVALLEQIITGGGESDRSFNAIQV  827

Query  1141  ICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDL  1320
             I   G+  L+    L + N ++ +  +L  CI AD +CRN IA  I+   +LE++ +   
Sbjct  828   ISGNGIPALLK--CLEHENGRESIVCILLFCIRADKSCRNTIASRIELSPVLELIHTGSD  885

Query  1321  ESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLI  1500
                   I L+ EL+ LNRR      L  ++ +   +    L   LQ +  +QKS +A L+
Sbjct  886   SVKATCIELLYELVLLNRRTLCNQILQIIKDEGAFSTMHTLLVCLQMASMEQKSTIAPLL  945

Query  1501  LHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMT  1677
             L   LL + +  ++  + +IDA+  AL E  F   +L  +    LL L  H S   K   
Sbjct  946   LQLDLLVEPRKMSIYREESIDALIEALHEKDFPASQLRAL--DALLSLSGHLSNSAKSFL  1003

Query  1678  EDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKS  1857
             E  +LK AGF  R+ + ++  +    +N  IT   + EE+    W+ RM+ +L    K  
Sbjct  1004  EARLLKTAGFNQRYNATIKEEKQRAGEND-ITNTTEEEEKALSSWENRMAFVLCNHEKGL  1062

Query  1858  FLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHG  2037
                AL  CL S ++E+ +       WL  +L S   +G         +L+ Q    L+  
Sbjct  1063  IFKALEECLTSTSMEIAKSSFILATWLIHMLYSFPDTGIRDIAR--KSLLEQFIQMLQST  1120

Query  2038  KLLEHKVLASVCLLNF  2085
             K LE K+LA++ L  F
Sbjct  1121  KNLEEKILAALALRGF  1136


 Score = 99.4 bits (246),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +E+S    RP     P +F+CP+TG +F DPVTLETGQ++E  AI  W  +GN TCPIT 
Sbjct  493   SEKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYEGKAIQEWIKRGNTTCPITR  547

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  548   QSLSAATLPKTNYVLKRLITSWREQH  573


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 61/142 (43%), Gaps = 32/142 (23%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E   + M   PDS        
Sbjct  145  HILEMFIIDPFFSRIDFAPELWKCLFLPHMSSIVGWYSEERHRIVMDVIPDSSDLSFTMD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-----TEGVEPPS  294
                            ++ K++ LE +Y +++D  T  +A +YKD +     T     P 
Sbjct  205  FDHDFNESLIFSVRPDQAEKMQKLELLYGQSLDDNTRLYAKFYKDCINYDSATSKKAIPL  264

Query  295  IPSVKIPFLSPQLARNEDPNSV  360
            +P  + P       R   P+ V
Sbjct  265  LPIAEPPMTPLHEVRRSIPDYV  286



>ref|XP_010319715.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319716.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319717.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Solanum lycopersicum]
Length=1483

 Score =   100 bits (248),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 109/376 (29%), Positives = 178/376 (47%), Gaps = 17/376 (5%)
 Frame = +1

Query  967   NFI--LKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQL  1140
             NF+  L ++I   R+E   H      QF   +K E AV++LE+++      +R+ N  Q+
Sbjct  777   NFVPSLTQIISN-RNEDSSHF-----QFTIGTK-EAAVALLEQIITGGGESDRSFNAIQV  829

Query  1141  ICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDL  1320
             I   G+  L+    L + N ++ +  +L  CI AD +CRN IA  I+   +LE++ +   
Sbjct  830   ISGNGIPALLK--CLEHENGRESIVCILLFCIRADKSCRNTIASRIELSPVLELIHTGSD  887

Query  1321  ESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLI  1500
                   I L+ EL+ LNRR      L  ++ +   +    L   LQ +  +QKS +A L+
Sbjct  888   SVKATCIELLYELVLLNRRTLCNQILQIIKDEGAFSTMHTLLVCLQMASMEQKSTIAPLL  947

Query  1501  LHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLDERLIEMCCKGLLILGRHFSAFGKIMT  1677
             L   LL + +  ++  + +IDA+  AL E  F   +L  +    LL L  H S   K   
Sbjct  948   LQLDLLVEPRKMSIYREESIDALIEALHEKDFPASQLRAL--DALLSLSGHLSNSAKSFL  1005

Query  1678  EDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKS  1857
             E  +LK AGF  R+ + ++  +    +N  IT   + EE+    W+ RM+ +L    K  
Sbjct  1006  EARLLKTAGFNQRYNATIKEEKQRAGEND-ITNTTEEEEKALSSWENRMAFVLCNHEKGL  1064

Query  1858  FLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHG  2037
                AL  CL S ++E+ +       WL  +L S   +G         +L+ Q    L+  
Sbjct  1065  IFKALEECLTSTSMEIAKSSFILATWLIHMLYSFPDTGIRDIAR--KSLLEQFIQMLQST  1122

Query  2038  KLLEHKVLASVCLLNF  2085
             K LE K+LA++ L  F
Sbjct  1123  KNLEEKILAALALRGF  1138


 Score = 99.4 bits (246),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +E+S    RP     P +F+CP+TG +F DPVTLETGQ++E  AI  W  +GN TCPIT 
Sbjct  495   SEKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYEGKAIQEWIKRGNTTCPITR  549

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  550   QSLSAATLPKTNYVLKRLITSWREQH  575


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 61/142 (43%), Gaps = 32/142 (23%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E   + M   PDS        
Sbjct  145  HILEMFIIDPFFSRIDFAPELWKCLFLPHMSSIVGWYSEERHRIVMDVIPDSSDLSFTMD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-----TEGVEPPS  294
                            ++ K++ LE +Y +++D  T  +A +YKD +     T     P 
Sbjct  205  FDHDFNESLIFSVRPDQAEKMQKLELLYGQSLDDNTRLYAKFYKDCINYDSATSKKAIPL  264

Query  295  IPSVKIPFLSPQLARNEDPNSV  360
            +P  + P       R   P+ V
Sbjct  265  LPIAEPPMTPLHEVRRSIPDYV  286



>ref|XP_006442167.1| hypothetical protein CICLE_v10024300mg [Citrus clementina]
 gb|ESR55407.1| hypothetical protein CICLE_v10024300mg [Citrus clementina]
Length=1441

 Score = 99.8 bits (247),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 82/151 (54%), Gaps = 19/151 (13%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +E+     RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  494   SEKMTSRSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITR  548

Query  934   KKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSID  1113
             + L   ++P +N++LKR+I  W+ ++      FS  ++   K     S L+ + + SS  
Sbjct  549   QPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFS--YSETPKHSFGSSPLKDMTLASS-P  605

Query  1114  ERTKNVKQLICLGGLQFLIHRFNLGNLNEKK  1206
              RT N           F IH     ++NE++
Sbjct  606   SRTFN-----------FHIHNNTDDHINERR  625


 Score = 86.7 bits (213),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 99/389 (25%), Positives = 189/389 (49%), Gaps = 11/389 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QF  + K + A+ +L+++L+      R+     LI   G+  LI    L  + E++ + +
Sbjct  795   QFVMEPK-DAAIEMLDQILMGGDKKSRSITALSLISANGIPALIK--CLDRVEERRSIVS  851

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C+ AD +C+ LIA+ I+   +L+ L  +  +SV+   I+ ++EL+ LNRR  +   
Sbjct  852   ILLCCMHADKSCKTLIAKRIELSHVLD-LFHDGNDSVRGICINFLSELVLLNRRTFSNQI  910

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  +Q+   A L+L   LL + +  ++  + A++A+  
Sbjct  911   LQVIRDEGAFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIE  970

Query  1576  ALE-SSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
             AL    F + ++  M    LL L   F+  GK  TE  +LK AGF   + + ++    ++
Sbjct  971   ALRRKDFPNSQM--MALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSK  1028

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVA  1932
             P++  +  M++ E+     W+ R++ +L    K S   AL  CL S ++E+ + CL    
Sbjct  1029  PESEMVESMEEEEQAACS-WEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAT  1087

Query  1933  WLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVL  2112
             WL+ +L++   +G         +L+ +    L+  K LE K+L ++ L  F         
Sbjct  1088  WLTHMLSTLPDTGVRGTARR--SLLDEFINVLQSSKNLEEKILTTLALKTFISDSVALEE  1145

Query  2113  LMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             L    + I  TL  L + + V  ++Q  +
Sbjct  1146  LGKYAKCIYGTLRKLKKYSAVVTDIQKAL  1174


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 53/130 (41%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESPDSKS------  183
            H+L++F   P  +R    P+LW  +FLP +S +  WY +    L M   PDS        
Sbjct  145  HVLEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y +++D  T  FA YYKD +             
Sbjct  205  LDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDKNTRMFAKYYKDCMNSDSSTRTKVIPM  264

Query  280  ---VEPPSIP  300
                EPP+ P
Sbjct  265  LPIAEPPATP  274



>ref|XP_006492801.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Citrus 
sinensis]
Length=1496

 Score = 99.8 bits (247),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 82/151 (54%), Gaps = 19/151 (13%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +E+     RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  507   SEKMTSRSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITR  561

Query  934   KKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSID  1113
             + L   ++P +N++LKR+I  W+ ++      FS  ++   K     S L+ + + SS  
Sbjct  562   QPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFS--YSETPKHSFGSSPLKDMTLASS-P  618

Query  1114  ERTKNVKQLICLGGLQFLIHRFNLGNLNEKK  1206
              RT N           F IH     ++NE++
Sbjct  619   SRTFN-----------FHIHNNTDDHINERR  638


 Score = 86.3 bits (212),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 99/389 (25%), Positives = 189/389 (49%), Gaps = 11/389 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QF  + K + A+ +LE++L       R+     LI   G+  LI    L  +  ++ + +
Sbjct  808   QFVMEPK-DAAIEMLEQILKGGDKKSRSITALSLISANGIPALIK--CLDRVEVRRSIVS  864

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C+ AD +C+ LIA+ I+   +L+ L  +  +SV+   I+ ++EL+ LNRR  +   
Sbjct  865   ILLCCMHADKSCKTLIAKRIELSHVLD-LFHDGNDSVRGICINFLSELVLLNRRTFSNQI  923

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  +Q+   A L+L   LL + +  ++  + A++A+  
Sbjct  924   LQVIRDEGAFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIE  983

Query  1576  ALE-SSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
             AL    F + ++  M    LL L   F+  GK  TE  +LK +GF   + + ++    ++
Sbjct  984   ALRRKDFPNSQM--MALDALLSLTGRFTFSGKSYTEALLLKISGFDQPYNALMKPERLSK  1041

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVA  1932
             P++  +  M++ E+     W+ R++ +L    K S   AL  CL S ++E+ + CL   A
Sbjct  1042  PESEMVESMEEEEQAACS-WEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAA  1100

Query  1933  WLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVL  2112
             WL+ +L++   +G         +L+ +    L+  + LE K+L ++ L  F   P     
Sbjct  1101  WLTHMLSTLPDTGVRGTARR--SLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEE  1158

Query  2113  LMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             L    + I  TL  L + + V  ++Q  +
Sbjct  1159  LGKYAKCIYGTLRKLKKYSAVVTDIQKAL  1187


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 52/130 (40%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESPDSKS------  183
            H L++F   P  +R    P+LW  +FLP +S +  WY +    L M   PDS        
Sbjct  145  HALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTAD  204

Query  184  ------------------RKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                               KL+ LE++Y +++D  T  FA YYKD +             
Sbjct  205  LDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPM  264

Query  280  ---VEPPSIP  300
                EPP+ P
Sbjct  265  LPIAEPPATP  274



>ref|XP_002325006.2| hypothetical protein POPTR_0018s09040g [Populus trichocarpa]
 gb|EEF03571.2| hypothetical protein POPTR_0018s09040g [Populus trichocarpa]
Length=991

 Score = 99.4 bits (246),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT +KL C  +P +N++L
Sbjct  134   PKDFVCPITSHIFDDPVTLETGQTYERRAIQEWLERGNSTCPITRQKLNCTQLPKTNYVL  193

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ ++
Sbjct  194   KRLIASWKEQN  204



>ref|XP_006357361.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Solanum 
tuberosum]
Length=1490

 Score = 99.8 bits (247),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +E+S    RP     P +F+CP+TG +F DPVTLETGQ++E  AI  W  +GN TCPIT 
Sbjct  502   SEKSTAPSRP-----PKDFVCPITGQIFNDPVTLETGQTYEGKAIQEWIKRGNTTCPITR  556

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             + L    +P +N++LKR+I  WR +H
Sbjct  557   QSLSAATLPKTNYVLKRLITSWREQH  582


 Score = 92.4 bits (228),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 93/342 (27%), Positives = 161/342 (47%), Gaps = 8/342 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             E AV +LE+++      +R+ N  Q+I   G+  L+    L + N ++ +  +L  CI  
Sbjct  811   EAAVVLLEQIITGGGESDRSFNAMQIISGNGIPALLK--CLEHENGRESIVCILLFCIRV  868

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRN +A  I+   +LE++ +         I L+ EL+ L+RR      L  ++ +  
Sbjct  869   DKSCRNTVASRIELSPVLELIHTGSDSVKATCIELLYELVLLSRRTLCNQILQIIKDEGA  928

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVAL-ESSFLD  1599
              +    L   LQ +  +QKS +A L+L   LL + +  ++  + +I+A+  AL E  F  
Sbjct  929   FSTMHTLLVCLQMASMEQKSTIAPLLLQLDLLVEPRKMSIYREESIEALIEALHEKDFPA  988

Query  1600  ERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
              +L  +    LL L  H +  GK   E  +LK AGF  R+ + ++  +    +N     M
Sbjct  989   SQLRAL--DALLSLSGHLTNSGKSFLEARLLKTAGFNQRYNATIKEEKQRAGENDITNTM  1046

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             ++ EE+    W+ R + +L    K     AL  CL S ++E+ +       WL  +L S 
Sbjct  1047  EE-EEKALSSWEKRTAFVLCNHEKGLIFKALEECLTSTSMEIAKSSFIVATWLIHMLYSF  1105

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNF  2085
               +G         +L+ Q    L+  K LE K+LA++ L  F
Sbjct  1106  PDTGIRDIAR--KSLLEQFIQMLQSTKNLEEKILAALALRGF  1145


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 62/142 (44%), Gaps = 32/142 (23%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E   + M   PDS        
Sbjct  145  HILEMFIIDPFFSRIDFAPELWKCLFLPHMSSIVGWYSEERHRIVMDVIPDSSDLSFTMD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWL-----TEGVEPPS  294
                            ++ K++ LE++Y +++D  T  +A YYKD +     T     P 
Sbjct  205  FDHDFNESLMFSVRPDQAEKMQKLEQLYGQSLDDNTRLYAKYYKDCINYDSATSKKTIPL  264

Query  295  IPSVKIPFLSPQLARNEDPNSV  360
            +P  + P       R   P+ V
Sbjct  265  LPIAEPPMTPLHEVRRSIPDYV  286



>gb|KDO41596.1| hypothetical protein CISIN_1g0007442mg, partial [Citrus sinensis]
Length=1294

 Score = 99.4 bits (246),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 82/151 (54%), Gaps = 19/151 (13%)
 Frame = +1

Query  754   TEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             +E+     RP     P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  331   SEKMTSRSRP-----PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITR  385

Query  934   KKLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFASDSKAEIAVSILEKLLIVSSID  1113
             + L   ++P +N++LKR+I  W+ ++      FS  ++   K     S L+ + + SS  
Sbjct  386   QPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFS--YSETPKHSFGSSPLKDMTLASS-P  442

Query  1114  ERTKNVKQLICLGGLQFLIHRFNLGNLNEKK  1206
              RT N           F IH     ++NE++
Sbjct  443   SRTFN-----------FHIHNNTDDHINERR  462


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 100/389 (26%), Positives = 190/389 (49%), Gaps = 11/389 (3%)
 Frame = +1

Query  1039  QFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSA  1218
             QF  + K + A+ +LE++L+      R+     LI   G+  LI    L  +  ++ + +
Sbjct  632   QFVMEPK-DAAIEMLEQILMGGDKKSRSITALSLISANGIPALIK--CLDRVEVRRSIVS  688

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQN-AISLMTELICLNRRKDATYF  1395
             +L  C+ AD +C+ LIA+ I+   +L+ L  +  +SV+   I+ ++EL+ LNRR  +   
Sbjct  689   ILLCCMHADKSCKTLIAKRIELSHVLD-LFHDGNDSVRGICINFLSELVLLNRRTFSNQI  747

Query  1396  LSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITV  1575
             L  ++ +   +       YLQ +  +Q+   A L+L   LL + +  ++  + A++A+  
Sbjct  748   LQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIE  807

Query  1576  ALE-SSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNE  1752
             AL    F + ++  M    LL L   F+  GK  TE  +LK AGF   + + ++    ++
Sbjct  808   ALRRKDFPNSQM--MALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSK  865

Query  1753  PDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVA  1932
             P++  +  M++ E+     W+ R++ +L    K S   AL  CL S ++E+ + CL   A
Sbjct  866   PESEMVESMEEEEQAACS-WEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAA  924

Query  1933  WLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVL  2112
             WL+ +L++   +G         +L+ +    L+  + LE K+L ++ L  F   P     
Sbjct  925   WLTHMLSTLPDTGVRGTARR--SLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEE  982

Query  2113  LMMIGEVIEDTLECLAEVTWVARELQTVI  2199
             L    + I  TL  L + + V  ++Q  +
Sbjct  983   LGKYAKCIYGTLRKLKKYSAVVTDIQKAL  1011


 Score = 55.5 bits (132),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 53/130 (41%), Gaps = 40/130 (31%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESPDS--------  177
            H L++F   P  +R    P+LW  +FLP +S +  WY +    L M   PDS        
Sbjct  145  HALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTAD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG----------  279
                            +  KL+ LE++Y +++D  T  FA YYKD +             
Sbjct  205  LDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPM  264

Query  280  ---VEPPSIP  300
                EPP+ P
Sbjct  265  LPIAEPPATP  274



>ref|XP_008675635.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Zea mays]
Length=1403

 Score = 99.4 bits (246),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = +1

Query  763   SVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKL  942
             +VD  +PL    P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT ++L
Sbjct  399   AVDPLQPL--PTPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRQRL  456

Query  943   ECQAVPLSNFILKRVIDKWRSEH  1011
                 +P +N++LKR+I  WR + 
Sbjct  457   HGAQLPKTNYVLKRLIGAWRDQR  479



>tpg|DAA52769.1| TPA: hypothetical protein ZEAMMB73_576745 [Zea mays]
Length=1398

 Score = 99.4 bits (246),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = +1

Query  763   SVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKL  942
             +VD  +PL    P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT ++L
Sbjct  394   AVDPLQPL--PTPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRQRL  451

Query  943   ECQAVPLSNFILKRVIDKWRSEH  1011
                 +P +N++LKR+I  WR + 
Sbjct  452   HGAQLPKTNYVLKRLIGAWRDQR  474



>gb|EEE54168.1| hypothetical protein OsJ_00982 [Oryza sativa Japonica Group]
Length=1152

 Score = 99.0 bits (245),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  772   SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQ  951
             + RP+ ++ P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT  +L   
Sbjct  232   ARRPV-VATPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRHRLHGA  290

Query  952   AVPLSNFILKRVIDKWRSEH  1011
              +P +N++LKR+I  WR ++
Sbjct  291   HLPSTNYVLKRLIAAWRDQN  310



>ref|XP_010230655.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Brachypodium 
distachyon]
Length=1419

 Score = 99.0 bits (245),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  793   SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNF  972
             S P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT ++L   A+P +N+
Sbjct  425   STPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRQRLLGGALPKTNY  484

Query  973   ILKRVIDKWRSE  1008
             +LKR+I  WR +
Sbjct  485   VLKRLIAGWRDQ  496


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 85/332 (26%), Positives = 146/332 (44%), Gaps = 28/332 (8%)
 Frame = +1

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNA-----ISLMTELICLNRRKD  1383
             +L  C+  D +CR  I   ++K+ L  VL  +    V +A     +  ++EL+ L RR  
Sbjct  781   ILLRCVAEDGHCRGSI---VEKLSLGAVL--DAFHVVGDADKFDIVRFLSELVKLKRRSA  835

Query  1384  ATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAID  1563
             A   L  ++     ++   L  YLQS+  +Q  +VA L+L   LL + +  ++  + A+D
Sbjct  836   AERVLRAIKEGGSFSMMHTLLVYLQSTTPEQSPVVAGLLLQLDLLVEPRKISMYREEAVD  895

Query  1564  AITVALESS-FLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRF-------  1719
             ++   L +S F   +L  +  + ++ L   FS+ G+ +    +LK A   +R+       
Sbjct  896   SLVQCLRNSDFPRSQL--LAAETIMNLPGKFSSSGRPLARSSLLKLARVKERYRQPQSQS  953

Query  1720  ---ESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLAS  1890
                E  +    D     G   ++  GE++   EW+ + +  L+G        ALS CL S
Sbjct  954   QSQELSVVRGTDGVGVGGEDEVVVAGEDKGASEWERKTAYALVGHEFGLVFEALSECLES  1013

Query  1891  GNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASV  2070
              + EL    L   AWL+ +L     +G        + L+ QL   L   K    + LA V
Sbjct  1014  KSAELFGASLVCAAWLAHMLPVLPDTGVVGAAR--ACLLRQLVIVLRSAKHGSDRALAMV  1071

Query  2071  CLLNFSKIPECRVLLMMIGEVIEDTLECLAEV  2166
              L +F      R  +  I   I+D L+ L E+
Sbjct  1072  ALRSFMN---DRDGMQDIATYIKDVLKTLREL  1100



>ref|NP_001042489.1| Os01g0229700 [Oryza sativa Japonica Group]
 dbj|BAD81324.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF04403.1| Os01g0229700 [Oryza sativa Japonica Group]
Length=1392

 Score = 99.0 bits (245),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  772   SERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQ  951
             + RP+ ++ P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT  +L   
Sbjct  417   ARRPV-VATPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRHRLHGA  475

Query  952   AVPLSNFILKRVIDKWRSEH  1011
              +P +N++LKR+I  WR ++
Sbjct  476   HLPSTNYVLKRLIAAWRDQN  495



>ref|XP_004971473.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Setaria 
italica]
Length=1374

 Score = 99.0 bits (245),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  775   ERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQA  954
             E P   + P +F+CP+T  +FEDPVTLETGQ++ER AI  W  +GN TCPIT  +L    
Sbjct  410   ETPQPAATPKDFVCPITSQLFEDPVTLETGQTYERRAIQEWLDRGNATCPITRHRLHGAQ  469

Query  955   VPLSNFILKRVIDKWRSEHWQHLL  1026
             +P +N++LKR+I  WR +  Q  L
Sbjct  470   LPSTNYVLKRLIAAWRDDQNQPQL  493



>gb|KCW79939.1| hypothetical protein EUGRSUZ_C01271 [Eucalyptus grandis]
Length=1043

 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  766   VDSERPLG---LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSK  936
              +SE P G    + P +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT +
Sbjct  214   AESENPPGGGKHTPPKDFVCPITSNLFDDPVTLETGQTYERRAIQEWLERGNSTCPITRQ  273

Query  937   KLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFA  1047
             KL+   +P +N++LKR+I  WR ++   +L  S  ++
Sbjct  274   KLQSTQLPKTNYVLKRLIASWREQNPGAVLDKSESYS  310


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 86/331 (26%), Positives = 153/331 (46%), Gaps = 19/331 (6%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +LS C++ D  CRN IA   +   +LE  + + D E  +  I  ++EL+ LNR
Sbjct  534   ERLAAVVILSKCMQEDGKCRNPIADKAELGPVLESFIGAADAERFE-IIRFLSELVKLNR  592

Query  1375  R---KDATYFLSGLQSDDIANITI-LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNV  1542
             R   +   + +  +  D+ A  T+     YLQ++   Q  +VA L+L   LL + +  ++
Sbjct  593   RTFNEQVLHIILHIIKDEGAFSTMHTFLNYLQTALQDQCPVVAGLLLQLDLLAEPRKMSI  652

Query  1543  CIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFE  1722
               + AIDA+   L+++      I      + + GR FS  GK +T  ++LK+AG   R+ 
Sbjct  653   YREEAIDALISCLKNTDFPAAQIAAAETIVSLQGR-FSGSGKPLTRAFLLKRAGLEKRYR  711

Query  1723  SDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIE  1902
             + +   E     N         EE+  ++W+ +++  L+         AL+  L S N +
Sbjct  712   TVMR-MEHLGNSNVEFEGSLQEEEKAADDWERKVAYALVSHEFGLLFEALAEGLKSRNAD  770

Query  1903  LVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLE---HGKLLEHKVLASVC  2073
             L   C  +  WL+ +L     +G        +A +C LK  L+     K +E K L+ + 
Sbjct  771   LCSACFVSATWLAYMLGILPDTGIRG-----AARVCLLKRFLQIFKSAKDVEDKALSMLA  825

Query  2074  LLNFSKIPECRVLLMMIGEVIEDTLECLAEV  2166
             L +F +  E    L  +   ++D L+ L E+
Sbjct  826   LNSFIQDAES---LRDLAPSMKDVLKGLREL  853



>gb|KCW79938.1| hypothetical protein EUGRSUZ_C01271 [Eucalyptus grandis]
Length=1172

 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  766   VDSERPLG---LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSK  936
              +SE P G    + P +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT +
Sbjct  214   AESENPPGGGKHTPPKDFVCPITSNLFDDPVTLETGQTYERRAIQEWLERGNSTCPITRQ  273

Query  937   KLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFA  1047
             KL+   +P +N++LKR+I  WR ++   +L  S  ++
Sbjct  274   KLQSTQLPKTNYVLKRLIASWREQNPGAVLDKSESYS  310


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 86/331 (26%), Positives = 153/331 (46%), Gaps = 19/331 (6%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +LS C++ D  CRN IA   +   +LE  + + D E  +  I  ++EL+ LNR
Sbjct  534   ERLAAVVILSKCMQEDGKCRNPIADKAELGPVLESFIGAADAERFE-IIRFLSELVKLNR  592

Query  1375  R---KDATYFLSGLQSDDIANITI-LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNV  1542
             R   +   + +  +  D+ A  T+     YLQ++   Q  +VA L+L   LL + +  ++
Sbjct  593   RTFNEQVLHIILHIIKDEGAFSTMHTFLNYLQTALQDQCPVVAGLLLQLDLLAEPRKMSI  652

Query  1543  CIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFE  1722
               + AIDA+   L+++      I      + + GR FS  GK +T  ++LK+AG   R+ 
Sbjct  653   YREEAIDALISCLKNTDFPAAQIAAAETIVSLQGR-FSGSGKPLTRAFLLKRAGLEKRYR  711

Query  1723  SDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIE  1902
             + +   E     N         EE+  ++W+ +++  L+         AL+  L S N +
Sbjct  712   TVMR-MEHLGNSNVEFEGSLQEEEKAADDWERKVAYALVSHEFGLLFEALAEGLKSRNAD  770

Query  1903  LVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLE---HGKLLEHKVLASVC  2073
             L   C  +  WL+ +L     +G        +A +C LK  L+     K +E K L+ + 
Sbjct  771   LCSACFVSATWLAYMLGILPDTGIRG-----AARVCLLKRFLQIFKSAKDVEDKALSMLA  825

Query  2074  LLNFSKIPECRVLLMMIGEVIEDTLECLAEV  2166
             L +F +  E    L  +   ++D L+ L E+
Sbjct  826   LNSFIQDAES---LRDLAPSMKDVLKGLREL  853



>ref|XP_006580471.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Glycine 
max]
Length=1384

 Score = 98.2 bits (243),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+T  +F+DPVTLETGQ++ER AI  WF++GN TCPIT +KL+   +P +N++L
Sbjct  445   PKDFVCPITSYIFDDPVTLETGQTYERKAIEEWFNRGNLTCPITRQKLQNTQLPKTNYVL  504

Query  979   KRVIDKWRSEH  1011
             KR+I  W+  +
Sbjct  505   KRLIASWKDRN  515



>ref|XP_010050571.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 [Eucalyptus 
grandis]
Length=1321

 Score = 97.8 bits (242),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  766   VDSERPLG---LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSK  936
              +SE P G    + P +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT +
Sbjct  363   AESENPPGGGKHTPPKDFVCPITSNLFDDPVTLETGQTYERRAIQEWLERGNSTCPITRQ  422

Query  937   KLECQAVPLSNFILKRVIDKWRSEHWQHLLAFSSQFA  1047
             KL+   +P +N++LKR+I  WR ++   +L  S  ++
Sbjct  423   KLQSTQLPKTNYVLKRLIASWREQNPGAVLDKSESYS  459


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 86/331 (26%), Positives = 153/331 (46%), Gaps = 19/331 (6%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +LS C++ D  CRN IA   +   +LE  + + D E  +  I  ++EL+ LNR
Sbjct  683   ERLAAVVILSKCMQEDGKCRNPIADKAELGPVLESFIGAADAERFE-IIRFLSELVKLNR  741

Query  1375  R---KDATYFLSGLQSDDIANITI-LLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNV  1542
             R   +   + +  +  D+ A  T+     YLQ++   Q  +VA L+L   LL + +  ++
Sbjct  742   RTFNEQVLHIILHIIKDEGAFSTMHTFLNYLQTALQDQCPVVAGLLLQLDLLAEPRKMSI  801

Query  1543  CIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFE  1722
               + AIDA+   L+++      I      + + GR FS  GK +T  ++LK+AG   R+ 
Sbjct  802   YREEAIDALISCLKNTDFPAAQIAAAETIVSLQGR-FSGSGKPLTRAFLLKRAGLEKRYR  860

Query  1723  SDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIE  1902
             + +   E     N         EE+  ++W+ +++  L+         AL+  L S N +
Sbjct  861   TVMR-MEHLGNSNVEFEGSLQEEEKAADDWERKVAYALVSHEFGLLFEALAEGLKSRNAD  919

Query  1903  LVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLE---HGKLLEHKVLASVC  2073
             L   C  +  WL+ +L     +G        +A +C LK  L+     K +E K L+ + 
Sbjct  920   LCSACFVSATWLAYMLGILPDTGIRG-----AARVCLLKRFLQIFKSAKDVEDKALSMLA  974

Query  2074  LLNFSKIPECRVLLMMIGEVIEDTLECLAEV  2166
             L +F +  E    L  +   ++D L+ L E+
Sbjct  975   LNSFIQDAES---LRDLAPSMKDVLKGLREL  1002



>ref|XP_010656297.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Vitis vinifera]
Length=1339

 Score = 97.8 bits (242),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  763   SVDSERPLG---LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             + DS+ P G    + P +FICP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  381   AADSDDPPGGGKCTPPKDFICPITSHIFDDPVTLETGQTYERKAIQEWIDRGNSTCPITR  440

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             +KL    +P +N++LKR+I  W+ ++
Sbjct  441   QKLHSTQLPKTNYVLKRLIASWQEQN  466


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 78/305 (26%), Positives = 139/305 (46%), Gaps = 13/305 (4%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +L  C++ D  CR+ IA   +   +LE  + + D E  +  I+  +EL+ LNR
Sbjct  706   ERIAAVGILLRCMQEDGKCRHTIADKAELAPVLESFMGASDGERFE-IINFFSELVKLNR  764

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDG  1554
             R      L  ++ +   +    L  YLQ++   Q  +VA L+L   LL + +  ++  + 
Sbjct  765   RTFNEQVLHIIKDEGAFSTMHTLLIYLQTALQDQCPVVAGLLLQLDLLVEPRKMSIYREE  824

Query  1555  AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLE  1734
             A+D +   L +S      I      + + GR FS+ GK +T   +LK+AG    + + ++
Sbjct  825   AMDTLISCLRNSDFPAAQIAAAETIVSLQGR-FSSSGKSLTRASLLKRAGLDKSYRTLMQ  883

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
                D   ++   +  +  EE+  +EW+ +M+ +L+         AL+  L S N EL   
Sbjct  884   V--DQLSNSSGESEENLEEEQAADEWERKMAFVLVSHEFGLLFEALAEGLRSRNQELFSS  941

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLK---ACLEHGKLLEHKVLASVCLLNF  2085
             C  +  WL  +L     +G        +A +C LK   +  +  K  E K L+ + L +F
Sbjct  942   CFLSATWLIHMLTVLPDTGIRG-----AARVCLLKHFISMFKSAKGTEEKALSMLALSSF  996

Query  2086  SKIPE  2100
                PE
Sbjct  997   IHDPE  1001



>ref|XP_010656298.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Vitis vinifera]
Length=1074

 Score = 97.4 bits (241),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  763   SVDSERPLG---LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             + DS+ P G    + P +FICP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  116   AADSDDPPGGGKCTPPKDFICPITSHIFDDPVTLETGQTYERKAIQEWIDRGNSTCPITR  175

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             +KL    +P +N++LKR+I  W+ ++
Sbjct  176   QKLHSTQLPKTNYVLKRLIASWQEQN  201


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 78/305 (26%), Positives = 139/305 (46%), Gaps = 13/305 (4%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +L  C++ D  CR+ IA   +   +LE  + + D E  +  I+  +EL+ LNR
Sbjct  441   ERIAAVGILLRCMQEDGKCRHTIADKAELAPVLESFMGASDGERFE-IINFFSELVKLNR  499

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDG  1554
             R      L  ++ +   +    L  YLQ++   Q  +VA L+L   LL + +  ++  + 
Sbjct  500   RTFNEQVLHIIKDEGAFSTMHTLLIYLQTALQDQCPVVAGLLLQLDLLVEPRKMSIYREE  559

Query  1555  AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLE  1734
             A+D +   L +S      I      + + GR FS+ GK +T   +LK+AG    + + ++
Sbjct  560   AMDTLISCLRNSDFPAAQIAAAETIVSLQGR-FSSSGKSLTRASLLKRAGLDKSYRTLMQ  618

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
                D   ++   +  +  EE+  +EW+ +M+ +L+         AL+  L S N EL   
Sbjct  619   V--DQLSNSSGESEENLEEEQAADEWERKMAFVLVSHEFGLLFEALAEGLRSRNQELFSS  676

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLK---ACLEHGKLLEHKVLASVCLLNF  2085
             C  +  WL  +L     +G        +A +C LK   +  +  K  E K L+ + L +F
Sbjct  677   CFLSATWLIHMLTVLPDTGIRG-----AARVCLLKHFISMFKSAKGTEEKALSMLALSSF  731

Query  2086  SKIPE  2100
                PE
Sbjct  732   IHDPE  736



>emb|CBI28040.3| unnamed protein product [Vitis vinifera]
Length=1154

 Score = 97.4 bits (241),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  763   SVDSERPLG---LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             + DS+ P G    + P +FICP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  196   AADSDDPPGGGKCTPPKDFICPITSHIFDDPVTLETGQTYERKAIQEWIDRGNSTCPITR  255

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             +KL    +P +N++LKR+I  W+ ++
Sbjct  256   QKLHSTQLPKTNYVLKRLIASWQEQN  281


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 78/305 (26%), Positives = 139/305 (46%), Gaps = 13/305 (4%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +L  C++ D  CR+ IA   +   +LE  + + D E  +  I+  +EL+ LNR
Sbjct  521   ERIAAVGILLRCMQEDGKCRHTIADKAELAPVLESFMGASDGERFE-IINFFSELVKLNR  579

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDG  1554
             R      L  ++ +   +    L  YLQ++   Q  +VA L+L   LL + +  ++  + 
Sbjct  580   RTFNEQVLHIIKDEGAFSTMHTLLIYLQTALQDQCPVVAGLLLQLDLLVEPRKMSIYREE  639

Query  1555  AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLE  1734
             A+D +   L +S      I      + + GR FS+ GK +T   +LK+AG    + + ++
Sbjct  640   AMDTLISCLRNSDFPAAQIAAAETIVSLQGR-FSSSGKSLTRASLLKRAGLDKSYRTLMQ  698

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
                D   ++   +  +  EE+  +EW+ +M+ +L+         AL+  L S N EL   
Sbjct  699   V--DQLSNSSGESEENLEEEQAADEWERKMAFVLVSHEFGLLFEALAEGLRSRNQELFSS  756

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLK---ACLEHGKLLEHKVLASVCLLNF  2085
             C  +  WL  +L     +G        +A +C LK   +  +  K  E K L+ + L +F
Sbjct  757   CFLSATWLIHMLTVLPDTGIRG-----AARVCLLKHFISMFKSAKGTEEKALSMLALSSF  811

Query  2086  SKIPE  2100
                PE
Sbjct  812   IHDPE  816



>ref|XP_009380565.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN [Musa acuminata 
subsp. malaccensis]
Length=1335

 Score = 97.4 bits (241),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 87/282 (31%), Positives = 141/282 (50%), Gaps = 31/282 (11%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P EF+CP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT +KL+   +P +N++L
Sbjct  396   PKEFVCPITSNLFDDPVTLETGQTYERRAIKEWLDRGNSTCPITRQKLQSSQLPKTNYVL  455

Query  979   KRVIDKWRSEH----WQHLLAFSSQFASDSKAEIAVSILEKLLIVSSIDERTKNVKQLI-  1143
             KR+I  W  E+       L     + A D     +   L  ++  +S+     +++  I 
Sbjct  456   KRLIGSWVEENPYSTPNRLENSPPKIARDLNMSQSSPSLTSIIYQASVGGSASDLRLAIS  515

Query  1144  CLGGLQFLIHRFNLGNLNEKKCVS-ALLSSCIEADSNCRNLIARNIDKMCLLEVLC-SED  1317
             CL   +FL       + +EK  +    L      +S    ++A+       +E+L  S D
Sbjct  516   CLCTSEFL-------DESEKAVLQIEKLWRDTSPESEIIAMLAKPATVNGFIEILFKSVD  568

Query  1318  LESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVL  1497
             L+ ++ AI L+ EL    + K     L+ + SD    +  + + +       +K LV   
Sbjct  569   LQVLRAAIFLLAELA--TKDKFVVQTLTRVDSD----VKCMAALF-------KKGLVEAA  615

Query  1498  ILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCC  1623
             +L F LL+    S V +D A DA+  A+E +  D+ L+EMC 
Sbjct  616   VLIF-LLSPRWESLVEMDMA-DALLRAIEKN--DDELLEMCV  653



>emb|CBI19874.3| unnamed protein product [Vitis vinifera]
Length=1510

 Score = 97.4 bits (241),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 100/375 (27%), Positives = 170/375 (45%), Gaps = 6/375 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+    + R+ N   +I   G+  LI    L  +  ++ + ++L  CI A
Sbjct  831   DAAIALLEQILMGGDENSRSLNAMSVISANGIPALIK--CLDKVEGRQAIVSILLCCIHA  888

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRNLIA  ID   +LE+  + D          ++EL+ LNRR      L  ++ +  
Sbjct  889   DRSCRNLIANRIDLSSVLELFHTGDDYVRGICTKFLSELVQLNRRIFCNQILKIIKDEGA  948

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +       YLQ +  +Q+  +A L+L   LL + +  ++  + AI+A+  AL       
Sbjct  949   FSTMHTFLVYLQMAPMEQQPAIASLLLQLDLLVEPRKMSIYREEAIEALVEALHKKDFPH  1008

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               I M    LL L  H +  GK  TE W+LK AG+   + + ++S E  +     +T   
Sbjct  1009  SQI-MALDALLSLSGHLTTSGKSYTEAWLLKIAGYDQPYHALMKS-ERLKIYENELTETT  1066

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + EE+    WQ R+  +L    K S   AL  CL S ++E+ + CL    WL        
Sbjct  1067  EEEEKAVTSWQKRVVFVLCNHEKGSIFKALEECLKSNSLEIAKSCLVVATWL--TYMLYH  1124

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
                +     A  + +      L+  K LE K+LA++ L  F   P     L    + +  
Sbjct  1125  LPDTGVRNVAHKSFLEPFINVLQSSKNLEEKILATLALNCFLNDPGALEELGAYAKCMYK  1184

Query  2143  TLECLAEVTWVAREL  2187
             TL  L + + V  ++
Sbjct  1185  TLRKLKKNSVVVSDM  1199


 Score = 94.0 bits (232),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F D VTLETGQ++ER AI  W  +GN TCPIT + L   ++P +N++L
Sbjct  535   PKDFVCPITGQIFSDAVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSASSLPKTNYVL  594

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ ++
Sbjct  595   KRLITTWKEQY  605


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 59/130 (45%), Gaps = 31/130 (24%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +    + M   PDS        
Sbjct  161  HILEMFIVDPFFSRIDFAPELWKALFLPHMSSIVGWYSEARHRIVMEVIPDSTDLSFTAD  220

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLT--EGVEPPSIPS  303
                            ++ K++ LE++Y E++D  T  ++ YY D L         +IP 
Sbjct  221  FDQFFNESLIFSMRPDQAEKMQKLEQLYGESLDENTRLYSKYYMDCLNFDSNTSKRAIPM  280

Query  304  VKI--PFLSP  327
            + I  P ++P
Sbjct  281  LPIAEPPMTP  290



>emb|CAN74785.1| hypothetical protein VITISV_011516 [Vitis vinifera]
Length=1494

 Score = 97.4 bits (241),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 95/343 (28%), Positives = 158/343 (46%), Gaps = 9/343 (3%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+    + R+ N   +I   G+  LI    L  +  ++ + ++L  CI A
Sbjct  815   DAAIALLEQILMGGDENSRSLNAMSVISANGIPALIK--CLDKVEGRQAIVSILLCCIHA  872

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRNLIA  ID   +LE+  + D          ++EL+ LNRR      L  ++ +  
Sbjct  873   DRSCRNLIANRIDLSSVLELFHTGDDYVRGICTKFLSELVQLNRRIFCNQILKIIKDEGA  932

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +       YLQ +  +Q+  +A L+L   LL + +  ++  + AI+A+  AL       
Sbjct  933   FSTMHTFLVYLQMAPMEQQPAIASLLLQLDLLVEPRKMSIYREEAIEALVEALHKKDFPH  992

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               I M    LL L  H +  GK  TE W+LK AG+   + + L  +E  +     +T   
Sbjct  993   SQI-MALDALLSLSGHLTTSGKSYTEAWLLKIAGYDQPYHA-LMKSERLKIYENELTETT  1050

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
               EE+    WQ R+  +L    K S   AL  CL S ++E+ + CL    WL       +
Sbjct  1051  XEEEKAVTSWQKRVVFVLCNHEKGSIFKALEECLKSNSLEIAKSCLVVATWL--TYMLYN  1108

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASV---CLLN  2082
                +     A  + +      L+  K LE K+LA++   C LN
Sbjct  1109  LPDTGVRNVAHKSFLEPFINVLQSSKNLEEKILATLALNCFLN  1151


 Score = 94.0 bits (232),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F D VTLETGQ++ER AI  W  +GN TCPIT + L   ++P +N++L
Sbjct  519   PKDFVCPITGQIFSDAVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSASSLPKTNYVL  578

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ ++
Sbjct  579   KRLITTWKEQY  589


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 59/130 (45%), Gaps = 31/130 (24%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +    + M   PDS        
Sbjct  145  HILEMFIVDPFFSRIDFAPELWKALFLPHMSSIVGWYSEARHRIVMEVIPDSTDLSFTAD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLT--EGVEPPSIPS  303
                            ++ K++ LE++Y E++D  T  ++ YY D L         +IP 
Sbjct  205  FDQFFNESLIFSMRPDQAEKMQKLEQLYGESLDENTRLYSKYYMDCLNFDSNTSKRAIPM  264

Query  304  VKI--PFLSP  327
            + I  P ++P
Sbjct  265  LPIAEPPMTP  274



>ref|XP_002279863.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X2 [Vitis vinifera]
Length=1494

 Score = 97.1 bits (240),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 95/343 (28%), Positives = 158/343 (46%), Gaps = 9/343 (3%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+    + R+ N   +I   G+  LI    L  +  ++ + ++L  CI A
Sbjct  815   DAAIALLEQILMGGDENSRSLNAMSVISANGIPALIK--CLDKVEGRQAIVSILLCCIHA  872

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRNLIA  ID   +LE+  + D          ++EL+ LNRR      L  ++ +  
Sbjct  873   DRSCRNLIANRIDLSSVLELFHTGDDYVRGICTKFLSELVQLNRRIFCNQILKIIKDEGA  932

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +       YLQ +  +Q+  +A L+L   LL + +  ++  + AI+A+  AL       
Sbjct  933   FSTMHTFLVYLQMAPMEQQPAIASLLLQLDLLVEPRKMSIYREEAIEALVEALHKKDFPH  992

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               I M    LL L  H +  GK  TE W+LK AG+   + + L  +E  +     +T   
Sbjct  993   SQI-MALDALLSLSGHLTTSGKSYTEAWLLKIAGYDQPYHA-LMKSERLKIYENELTETT  1050

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + EE+    WQ R+  +L    K S   AL  CL S ++E+ + CL    WL        
Sbjct  1051  EEEEKAVTSWQKRVVFVLCNHEKGSIFKALEECLKSNSLEIAKSCLVVATWL--TYMLYH  1108

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASV---CLLN  2082
                +     A  + +      L+  K LE K+LA++   C LN
Sbjct  1109  LPDTGVRNVAHKSFLEPFINVLQSSKNLEEKILATLALNCFLN  1151


 Score = 94.0 bits (232),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F D VTLETGQ++ER AI  W  +GN TCPIT + L   ++P +N++L
Sbjct  519   PKDFVCPITGQIFSDAVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSASSLPKTNYVL  578

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ ++
Sbjct  579   KRLITTWKEQY  589


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 59/130 (45%), Gaps = 31/130 (24%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +    + M   PDS        
Sbjct  145  HILEMFIVDPFFSRIDFAPELWKALFLPHMSSIVGWYSEARHRIVMEVIPDSTDLSFTAD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLT--EGVEPPSIPS  303
                            ++ K++ LE++Y E++D  T  ++ YY D L         +IP 
Sbjct  205  FDQFFNESLIFSMRPDQAEKMQKLEQLYGESLDENTRLYSKYYMDCLNFDSNTSKRAIPM  264

Query  304  VKI--PFLSP  327
            + I  P ++P
Sbjct  265  LPIAEPPMTP  274



>ref|XP_010664820.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1 isoform 
X1 [Vitis vinifera]
Length=1496

 Score = 97.1 bits (240),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 100/375 (27%), Positives = 170/375 (45%), Gaps = 6/375 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+    + R+ N   +I   G+  LI    L  +  ++ + ++L  CI A
Sbjct  815   DAAIALLEQILMGGDENSRSLNAMSVISANGIPALIK--CLDKVEGRQAIVSILLCCIHA  872

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRNLIA  ID   +LE+  + D          ++EL+ LNRR      L  ++ +  
Sbjct  873   DRSCRNLIANRIDLSSVLELFHTGDDYVRGICTKFLSELVQLNRRIFCNQILKIIKDEGA  932

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +       YLQ +  +Q+  +A L+L   LL + +  ++  + AI+A+  AL       
Sbjct  933   FSTMHTFLVYLQMAPMEQQPAIASLLLQLDLLVEPRKMSIYREEAIEALVEALHKKDFPH  992

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               I M    LL L  H +  GK  TE W+LK AG+   + + ++S E  +     +T   
Sbjct  993   SQI-MALDALLSLSGHLTTSGKSYTEAWLLKIAGYDQPYHALMKS-ERLKIYENELTETT  1050

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + EE+    WQ R+  +L    K S   AL  CL S ++E+ + CL    WL        
Sbjct  1051  EEEEKAVTSWQKRVVFVLCNHEKGSIFKALEECLKSNSLEIAKSCLVVATWL--TYMLYH  1108

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
                +     A  + +      L+  K LE K+LA++ L  F   P     L    + +  
Sbjct  1109  LPDTGVRNVAHKSFLEPFINVLQSSKNLEEKILATLALNCFLNDPGALEELGAYAKCMYK  1168

Query  2143  TLECLAEVTWVAREL  2187
             TL  L + + V  ++
Sbjct  1169  TLRKLKKNSVVVSDM  1183


 Score = 93.6 bits (231),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F D VTLETGQ++ER AI  W  +GN TCPIT + L   ++P +N++L
Sbjct  519   PKDFVCPITGQIFSDAVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSASSLPKTNYVL  578

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ ++
Sbjct  579   KRLITTWKEQY  589


 Score = 53.5 bits (127),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 59/130 (45%), Gaps = 31/130 (24%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESPDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +    + M   PDS        
Sbjct  145  HILEMFIVDPFFSRIDFAPELWKALFLPHMSSIVGWYSEARHRIVMEVIPDSTDLSFTAD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLT--EGVEPPSIPS  303
                            ++ K++ LE++Y E++D  T  ++ YY D L         +IP 
Sbjct  205  FDQFFNESLIFSMRPDQAEKMQKLEQLYGESLDENTRLYSKYYMDCLNFDSNTSKRAIPM  264

Query  304  VKI--PFLSP  327
            + I  P ++P
Sbjct  265  LPIAEPPMTP  274



>emb|CAN83797.1| hypothetical protein VITISV_002973 [Vitis vinifera]
Length=1618

 Score = 97.1 bits (240),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  763   SVDSERPLG---LSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITS  933
             + DS+ P G    + P +FICP+T  +F+DPVTLETGQ++ER AI  W  +GN TCPIT 
Sbjct  660   AADSDDPPGGGKCTPPKDFICPITSHIFDDPVTLETGQTYERKAIQEWIDRGNSTCPITR  719

Query  934   KKLECQAVPLSNFILKRVIDKWRSEH  1011
             +KL    +P +N++LKR+I  W+ ++
Sbjct  720   QKLHSTQLPKTNYVLKRLIASWQEQN  745


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 78/305 (26%), Positives = 139/305 (46%), Gaps = 13/305 (4%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +L  C++ D  CR+ IA   +   +LE  + + D E  +  I+  +EL+ LNR
Sbjct  985   ERIAAVGILLRCMQEDGKCRHTIADKAELAPVLESFMGASDGERFE-IINFFSELVKLNR  1043

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDG  1554
             R      L  ++ +   +    L  YLQ++   Q  +VA L+L   LL + +  ++  + 
Sbjct  1044  RTFNEQVLHIIKDEGAFSTMHTLLIYLQTALQDQCPVVAGLLLQLDLLVEPRKMSIYREE  1103

Query  1555  AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLE  1734
             A+D +   L +S      I      + + GR FS+ GK +T   +LK+AG    + + ++
Sbjct  1104  AMDTLISCLRNSDFPAAQIAAAETIVSLQGR-FSSSGKSLTRASLLKRAGLDKSYRTLMQ  1162

Query  1735  STEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
                D   ++   +  +  EE+  +EW+ +M+ +L+         AL+  L S N EL   
Sbjct  1163  V--DQLSNSSGESEENLEEEQAADEWERKMAFVLVSHEFGLLFEALAEGLRSRNQELFSS  1220

Query  1915  CLTTVAWLssvlasssrsgsefelsaFSALICQLK---ACLEHGKLLEHKVLASVCLLNF  2085
             C  +  WL  +L     +G        +A +C LK   +  +  K  E K L+ + L +F
Sbjct  1221  CFMSATWLIHMLTVLPDTGIRG-----AARVCLLKHFISMFKSAKGTEEKALSMLALSSF  1275

Query  2086  SKIPE  2100
                PE
Sbjct  1276  IHDPE  1280



>ref|XP_002984593.1| hypothetical protein SELMODRAFT_423775 [Selaginella moellendorffii]
 gb|EFJ14238.1| hypothetical protein SELMODRAFT_423775 [Selaginella moellendorffii]
Length=1211

 Score = 97.1 bits (240),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 104/197 (53%), Gaps = 27/197 (14%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+T  +F+DPVTLETGQ++ER AI  W S+GN TCP++ + L   A+P +N+IL
Sbjct  343   PKDFVCPITNQIFDDPVTLETGQTYERKAIKEWLSRGNVTCPMSRQPLIKVALPRTNYIL  402

Query  979   KRVIDKWRSEHWQHLLAFSSQ--------FASDSKAEIAVSILEKLLIVSSIDERTKNVK  1134
             KR+I  W++E  Q  +  S Q         +S S  +  ++ LEKL +      R  N+ 
Sbjct  403   KRLISDWKAESTQFSIKDSPQTTNNDYFPTSSGSLTDAGLTGLEKLKMSLETLSRLDNLT  462

Query  1135  QLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLC-S  1311
                C   ++ +   +   + NE   V+ LL+              R ID   L+E +C S
Sbjct  463   D--CEAAVRTICQFWEEVHGNED--VTVLLTE------------PRVID--ALMETICKS  504

Query  1312  EDLESVQNAISLMTELI  1362
               +E  + A+ ++ EL+
Sbjct  505   SSVEVQKEAVDILIELV  521


 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 85/385 (22%), Positives = 169/385 (44%), Gaps = 41/385 (11%)
 Frame = +1

Query  1069  AVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADS  1248
             AV++LE +L    ++  + N+K L+ L  +  LI   N  +  E+    ++L  C+ AD 
Sbjct  602   AVTMLEHVLSSIELERNSVNIKTLVSLTAVPALIESLNTKDKKERVAAVSILLRCVRADE  661

Query  1249  NCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIAN  1428
             + R  +++      +L+VL S D  +    I+L+ EL+  +++      L  ++++   +
Sbjct  662   DARTFVSQADHLTLVLKVLHSADKVARARTIALLMELVRSHKKTSRLQILGLIKTEGCVS  721

Query  1429  ITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERL  1608
                 L  +LQ +  +Q+ L A L++   LL + +  +V  + A+D +  A+++       
Sbjct  722   SMHALLMHLQVAPLEQQILTAGLLMQLDLLGEPRKDSVYTEEAMDTLLKAIKNKDRLSLQ  781

Query  1609  IEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDG  1788
             +E     + I+GR FS+ GK +   W++K         S  + T++ + D+         
Sbjct  782   VEAARTIICIVGR-FSSSGKPVLRSWLIKA--------SKTKPTKNYQQDD---------  823

Query  1789  EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrs  1968
                    W  +++  LL     + L  L+  +    +EL   C+T   WL  +       
Sbjct  824   -------WDKKVARALLDYENGTLLEVLAENVLDEALELATPCITIATWLLYMAGELPE-  875

Query  1969  gsefelsaFSALICQLKACL--EHGKLLE---HKVLASVCLLNFSKIPECRVLLMMIGEV  2133
                      + L  Q +  L   +  LL+   H+VLA++ L +F K       L+     
Sbjct  876   ---------TGLWIQARKLLLPRYITLLQSDAHRVLAALALYSFLKDKGSAQELVKSAAA  926

Query  2134  IEDTLECLAEVTWVAREL-QTVISS  2205
             +   L+ +   +W + +L QT I+S
Sbjct  927   VCKPLKSMRNESWTSSKLYQTFITS  951


 Score = 73.9 bits (180),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 80/187 (43%), Gaps = 43/187 (23%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYI---KELGMLESP  171
            L+  DR AA  +L +F   P  AR    P LWD +F PHL+ +K WY      + M ES 
Sbjct  138  LRNDDRKAAVCVLDMFLVDPRSARVKFAPQLWDQLFQPHLTSIKGWYSLQRHRIKMAESD  197

Query  172  D-------------------SKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG-----  279
            D                    +  +L+ +E +Y  ++D  T +FA +YKDWLT       
Sbjct  198  DVSYSFQSREEDGEEDLLTLEQKEQLEGVEGLYQASLDDHTREFAQHYKDWLTLTADSLK  257

Query  280  ---------VEPPSIPSVKIPFLSPQLARNEDPNSV-SCIVGSFSPQP----VVSKKL--  411
                      EPP  P  ++   + +   N+   +  SC + S + QP    V S K   
Sbjct  258  KRVPPLMPIAEPPMTPVHELAIFNRKNVENQSLKTYESCTLSSDNTQPEVENVKSNKADG  317

Query  412  YDEVFRH  432
             DEVF H
Sbjct  318  SDEVFNH  324



>ref|XP_010064564.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-1 [Eucalyptus grandis]
Length=1429

 Score = 97.1 bits (240),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 95/367 (26%), Positives = 172/367 (47%), Gaps = 15/367 (4%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+    + ++ N + +I   G+  LI   +   +  ++ + ++L  CI A
Sbjct  817   DAAIAMLEQILMGGDENSQSVNAQSVISANGVPGLIKYMD--KVEGRQSIISILLCCIHA  874

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D  CRNLIA  I+   +L++  + +       I  + EL+  +RR  +   L  ++ +  
Sbjct  875   DRTCRNLIANRIELSSVLDLFHAGNDTVRGICIEFLLELVQTDRRTISNQILQLIKDEGA  934

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L  +LQ +  +Q+  +A L+L   LL + +  ++  + AI+A+  AL+      
Sbjct  935   FSTMHTLLVHLQMAPMEQQPAIATLLLMLDLLVEPRNMSIYREEAIEALIEALQKKDFPS  994

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               I      LL L    +A GK  TE W+LK AGF   F + ++          R TM +
Sbjct  995   SQI-TALNALLCLSGRMTASGKSCTEAWLLKVAGFDQPFNALMKGE--------RPTMHE  1045

Query  1783  D--GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlas  1956
             +   E  V   W+ R++ +L    +     AL  CL S +IE+ + CL    WL+ +L+ 
Sbjct  1046  NELAETMVEYVWERRVAFVLCNHERGVIFKALEECLKSNSIEMAKSCLVIATWLTYMLSV  1105

Query  1957  ssrsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVI  2136
                +G +       + + +L   L+  K LE K+LA++ +  F   P     L M  + I
Sbjct  1106  LPDTGMKNAAR--KSFLEELINVLQSSKNLEEKILATLAIKTFISDPAALEELGMYAKCI  1163

Query  2137  EDTLECL  2157
               TL  L
Sbjct  1164  YKTLRKL  1170


 Score = 94.7 bits (234),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN  CPIT + L    +P +N++L
Sbjct  519   PKDFVCPITGQLFSDPVTLETGQTYERRAIQEWIERGNTXCPITRQALSANTLPKTNYVL  578

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ ++
Sbjct  579   KRLITSWKEQY  589


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (48%), Gaps = 27/117 (23%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIK---ELGMLESP  171
            L+ +DR +  H++++F   P  +R    PD+W ++FLPH++ +  WY +    L M   P
Sbjct  135  LRNEDRESVLHVIEMFIVDPFFSRIDFAPDVWRDLFLPHMNSIAGWYTEARHRLVMEAIP  194

Query  172  DS------------------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWL  270
            D+                        +  K + LE++Y E++D  T  +A YY+D L
Sbjct  195  DASDLSFTADMDQFLNESVIFSMRPDQMEKTQKLEQLYRESLDENTRLYAKYYRDCL  251



>ref|XP_008661121.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-2 [Zea mays]
Length=187

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 100/193 (52%), Gaps = 12/193 (6%)
 Frame = +1

Query  1354  ELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQC  1533
             EL+CL RR+     L G +++ I     +L  YL+S   ++++ +AVL++    L +   
Sbjct  2     ELVCLRRREMVELLLHGSRAELIVEAMDVLLKYLRSLPAEEQAPIAVLLMCLDALVEPNR  61

Query  1534  SNVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFID  1713
             +N   + AI  IT +L     ++  +    + LL+LG  F+  G +  EDW+L+ AGF+D
Sbjct  62    NNTYREEAIKTITHSLRCCLSEDTAVPSTRRALLLLGGQFNFSGDLHAEDWMLEHAGFVD  121

Query  1714  RFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSG---KKSFLGALSMCL  1884
               ++   +++          ++ D E    + W   ++A LLGS    K+ FL ALS CL
Sbjct  122   HSQATTATSD---------AVVHDKEAAENDAWLRHVAATLLGSRSRIKRPFLEALSRCL  172

Query  1885  ASGNIELVRVCLT  1923
              S ++ LV  CLT
Sbjct  173   GSPDVGLVGACLT  185



>ref|XP_010100641.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
 gb|EXB83506.1| Putative E3 ubiquitin-protein ligase LIN-1 [Morus notabilis]
Length=1365

 Score = 97.1 bits (240),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  775   ERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQA  954
             +RP+    P +F+CP+T  +F DPVTLETGQ++ER AI  W  +GN TCPIT +KLE   
Sbjct  420   DRPMR---PQDFVCPITSNLFNDPVTLETGQTYERQAIQEWLDRGNSTCPITRQKLESTQ  476

Query  955   VPLSNFILKRVIDKWRSEH  1011
             +P +N++LKR+I  W+ ++
Sbjct  477   LPKTNYVLKRLIGSWQEQN  495


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 152/335 (45%), Gaps = 28/335 (8%)
 Frame = +1

Query  1192  LNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICL  1368
             + E+     +L  C++ D  CRN+IA   +   +LE  + + D E  + A   + EL+ L
Sbjct  730   VEERIAALEILVKCMQEDGMCRNIIADTAELAPVLECFMGASDGEKFEIA-RFLFELVKL  788

Query  1369  NRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCI  1548
             NRR      L  ++++   +    L  YLQ++   Q  +VA L+L   LLT+ +  ++  
Sbjct  789   NRRTFNEQILHIIKNEGPLSTMHALLVYLQTALHDQCPVVAGLLLQLDLLTEPRKMSIYR  848

Query  1549  DGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESD  1728
             + AID +   L  +      I      +L+ GR F+  GK +T  ++LK AG        
Sbjct  849   EEAIDTLIECLRDTDFPGAQIAAAETIMLLPGR-FTISGKSLTRAFLLKHAG--------  899

Query  1729  LESTEDNEPDNGRITMMDDGEEEVREE------WQARMSAMLLGSGKKSFLGALSMCLAS  1890
             +E + +N     ++++     E++ EE      W+ +M+++L+         A S  L S
Sbjct  900   IEKSYNNLVRMDQLSISGREAEDILEEKKAADNWERKMASVLVSHEFGLLFEAFSEGLKS  959

Query  1891  GNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLK---ACLEHGKLLEHKVL  2061
              N EL   C  +  WL  +L     +G        +A +C LK   +  +  +  E + L
Sbjct  960   TNAELCSKCFISATWLVDMLKVLPDTGVRG-----AARVCLLKHFISIFKSSRYTEDRAL  1014

Query  2062  ASVCLLNFSKIPECRVLLMMIGEVIEDTLECLAEV  2166
             + + L +F + PE    L  I   ++D ++ L E+
Sbjct  1015  SLLALSSFIQDPEG---LRDITSSVKDVIKGLREL  1046



>ref|XP_006584821.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-like [Glycine 
max]
Length=1333

 Score = 96.7 bits (239),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+T  +F+DPVTLETGQ++ER AI  WF++GN TCPIT +KL+   +P +N++L
Sbjct  392   PKDFVCPITSHIFDDPVTLETGQTYERKAIEEWFNRGNITCPITRQKLQNTQLPKTNYVL  451

Query  979   KRVIDKWRSEH  1011
             KR+I  W+  +
Sbjct  452   KRLIASWKDRN  462



>ref|XP_002454892.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor]
 gb|EES00012.1| hypothetical protein SORBIDRAFT_03g000870 [Sorghum bicolor]
Length=1404

 Score = 96.7 bits (239),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  769  DSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLEC  948
            + + P  L  P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT ++L  
Sbjct  406  NDDTPGPLPTPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNSTCPITRQRLHG  465

Query  949  QAVPLSNFILKRVIDKW  999
              +P +N++LKR+I  W
Sbjct  466  AQLPKTNYVLKRLIGAW  482



>ref|XP_007160321.1| hypothetical protein PHAVU_002G311800g [Phaseolus vulgaris]
 gb|ESW32315.1| hypothetical protein PHAVU_002G311800g [Phaseolus vulgaris]
Length=1334

 Score = 96.7 bits (239),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+T  +F+DPVTLETGQ++ER AI  WF++GN TCPIT +KL+   +P +N++L
Sbjct  394   PKDFVCPITSHIFDDPVTLETGQTYERKAIEEWFNRGNSTCPITRQKLQNIQLPKTNYVL  453

Query  979   KRVIDKWRSEHWQHLL  1026
             KR+I  W+  +  HL+
Sbjct  454   KRLIASWKDRN-PHLV  468


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 75/328 (23%), Positives = 136/328 (41%), Gaps = 12/328 (4%)
 Frame = +1

Query  1129  VKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEADSNCRNLIARNIDKMCLLEVLC  1308
             V  L     +  ++  F      E+     +L  C+E D  CR+ IA   +   L+E L 
Sbjct  677   VNTLFSGNAIGTIVSSFGADLAKERIAAVEILLRCMEEDGTCRSNIADKAELSPLMETLI  736

Query  1309  SEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLV  1488
               D       I    EL+ LNRR      L  ++     +    L  YLQ++      ++
Sbjct  737   GADDGERFKIIQFFAELVKLNRRTSTEQILHIIKEQGPFSTMHTLLIYLQAALHDHCPVM  796

Query  1489  AVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDERLIEMCCKGLLI-LGRHFSAFG  1665
             A L+L   LL + +  ++  + A+D +   L ++  D  +I++     ++ L   F   G
Sbjct  797   AGLLLQLDLLVEPRKMSIYREEAMDTLISCLRNT--DFPVIQLAAADTIMSLQGSFDFSG  854

Query  1666  KIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGS  1845
               +  + +LK+AG ID+    L   +    ++     +   EE+  ++W+ R++ +L+  
Sbjct  855   NPLIREVLLKRAG-IDKSSRSLVLVDHQISNSSPEIDITPEEEKAADDWERRIAYILVSH  913

Query  1846  GKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLK--  2019
                +   AL+  + S N EL   C  +  WL     +   +          A  C LK  
Sbjct  914   EFGTIFEALADGMKSRNPELRSACFLSATWL-----TYMLTILPDTGIQVPARACLLKPF  968

Query  2020  -ACLEHGKLLEHKVLASVCLLNFSKIPE  2100
              A L   + +E ++L+ V L +F   PE
Sbjct  969   IAKLNSARDVEDRILSMVALNSFLHFPE  996



>dbj|BAJ95654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1375

 Score = 96.7 bits (239),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  793   SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNF  972
             + P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT + L   ++P +N+
Sbjct  405   TTPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRQHLHGGSLPKTNY  464

Query  973   ILKRVIDKWRSE  1008
             +LKR+I  WR +
Sbjct  465   VLKRLIAGWREQ  476


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 117/248 (47%), Gaps = 19/248 (8%)
 Frame = +1

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNA-----ISLMTELICLNRRKD  1383
             +L  C+  D +CR+ I   ++K+ +  VL  +    V +A     +  ++EL+ L +R  
Sbjct  748   ILMRCVGEDGHCRSSI---VEKLAVGAVL--DAFHVVGDADKFEIVRFLSELLKLRKRSA  802

Query  1384  ATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAID  1563
             A   L  ++     ++   L  YLQS+  +Q  +VA L+L   LL + +  ++  + A+D
Sbjct  803   AERVLRAIKEGSSFSMMHTLLVYLQSTTPEQTPVVAGLLLQLDLLVEPRKISMYREEAMD  862

Query  1564  AITVALESS-FLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLEST  1740
             ++   L++S F   +L  +  + ++ L   FS+ G+ +    +LK A   +R+    E +
Sbjct  863   SLVQCLKNSDFPRSQL--LAAETIMNLPGKFSSSGRPLARSTLLKLARVKERYRHSQELS  920

Query  1741  EDNEPDNGRITMMDD--GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRV  1914
                  D       DD  GEE+   EW+ + +  L+       L ALS CL S N EL   
Sbjct  921   VVRGTDGAE----DDAAGEEKAASEWERKTAYALVSHEFGLVLEALSECLESKNAELFAA  976

Query  1915  CLTTVAWL  1938
              L   AWL
Sbjct  977   SLVCAAWL  984



>gb|KDO66446.1| hypothetical protein CISIN_1g001349mg [Citrus sinensis]
Length=897

 Score = 95.9 bits (237),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +1

Query  769   DSERPLGL---SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKK  939
             D++ P G+   + P +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN +CPIT +K
Sbjct  148   DADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQK  207

Query  940   LECQAVPLSNFILKRVIDKWRSEH  1011
             L    +P +N++LKR+I  W+ ++
Sbjct  208   LSSTKLPKTNYVLKRLIASWQEQN  231


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 115/251 (46%), Gaps = 11/251 (4%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +L  C++ D  CRN IA   +   ++E  + + D E  +  +  ++EL+ LNR
Sbjct  461   ERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFE-IVCFLSELVKLNR  519

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDG  1554
             R      L  ++ +   +    L  YLQ+++  Q  +VA L+L   LL + +  ++  + 
Sbjct  520   RTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREE  579

Query  1555  AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLE  1734
             AID +   L +S      +    K ++ L   F+  GK +T   +LK+AG + +   +L 
Sbjct  580   AIDTLISCLRNSDYPAAQL-AAAKTIVSLQGRFTTSGKSLTRAMLLKRAG-VGKSYKNLT  637

Query  1735  STEDNEPDNGRITMMDDG---EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              TE      G I   DD    EE+  ++W+ +M+ +L+         AL   L S   EL
Sbjct  638   RTE----QIGNICGEDDDTSEEEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAEL  693

Query  1906  VRVCLTTVAWL  1938
                C  +  WL
Sbjct  694   YSACFESATWL  704



>gb|EMT16354.1| U-box domain-containing protein 13 [Aegilops tauschii]
Length=1035

 Score = 96.3 bits (238),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  793   SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNF  972
             + P +F+CP+T  VF+DPVTLETGQ++ER AI  W  +GN TCPIT + L   ++P +N+
Sbjct  17    TTPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRQHLHGGSLPKTNY  76

Query  973   ILKRVIDKWRSE  1008
             +LKR+I  WR +
Sbjct  77    VLKRLIAGWREQ  88


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 69/256 (27%), Positives = 117/256 (46%), Gaps = 27/256 (11%)
 Frame = +1

Query  1219  LLSSCIEADSNCRNLIARNIDKMCLLEVLCSEDLESVQNA-----ISLMTELICLN----  1371
             +L  CI  D +CR+ I   ++K+ +  VL  +    V +A     +  ++EL+ L     
Sbjct  360   ILMRCIAEDGHCRSSI---VEKLAVGAVL--DAFHVVGDADKFEIVRFLSELLKLKKHNR  414

Query  1372  ----RRKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSN  1539
                 RR  A   L  ++     ++   L  YLQS+  +Q  +VA L+L   LL + +  +
Sbjct  415   YSDCRRSTAERVLRAIKEGSSFSMMHTLLVYLQSTTPEQSPVVAGLLLQLDLLVEPRKIS  474

Query  1540  VCIDGAIDAITVALESS-FLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDR  1716
             +  + A+D++   L++S F   +L  +  + ++ L   FS+ G+ +    +LK A   +R
Sbjct  475   MYREEAMDSLVQCLKNSDFPRSQL--LAAETIMNLPGKFSSSGRPLARSALLKLARVKER  532

Query  1717  FESDLESTEDNEPDNGRITMMDD--GEEEVREEWQARMSAMLLGSGKKSFLGALSMCLAS  1890
             +    E +     D       DD  GEE+   EW+ + +  L+       L ALS CL S
Sbjct  533   YRQSQELSVVRGTDGAE----DDAAGEEKAASEWERKTAYALVSHEFGLVLEALSECLES  588

Query  1891  GNIELVRVCLTTVAWL  1938
              N EL    L   AWL
Sbjct  589   KNAELFAASLVCAAWL  604



>gb|KGN60041.1| hypothetical protein Csa_3G872720 [Cucumis sativus]
Length=1516

 Score = 96.3 bits (238),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + L    +P +N++L
Sbjct  511   PKDFVCPITGQIFSDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSSTVMPKTNYVL  570

Query  979   KRVIDKWRSEH  1011
             KR+   W+ +H
Sbjct  571   KRLTTSWQEQH  581


 Score = 70.5 bits (171),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 87/392 (22%), Positives = 169/392 (43%), Gaps = 34/392 (9%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+      +++NV  LI   G   L+ +F  G    +  +S LL  C+  
Sbjct  808   DAAIAMLEQILMGGDEYSQSRNVASLISAEGCPALV-KFLDGEEVRRPILSMLLC-CMRV  865

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D  C++ I   I+   +LE+L + + +     ++ ++EL+ +NRR      L  ++++  
Sbjct  866   DKGCKDSIVEKIELAPVLELLYTGNEDDRGLCVAFLSELVQMNRRTQCNQILQQIKNEGA  925

Query  1423  ANITILLSTYLQSSHCKQKS-----------------LVAVLILHFH--LLTDTQCS---  1536
              +    L T+L  +  +Q+                  ++A +   F    LTD   S   
Sbjct  926   FSTMHTLLTHLPKATIEQQPSIASLLLQLDLLVSLDPIIASMRKSFSSWKLTDNSASCQV  985

Query  1537  -----NVCIDGAIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQA  1701
                  ++  + +IDA+  A      +  +       LL L    ++ GK   + W+LK A
Sbjct  986   EPRKMSIYREESIDALFEAFRRKD-NYNVQTAAADALLYLSGRLTSSGKCYAKSWLLKLA  1044

Query  1702  GFIDRFESDLESTEDNEPDNGRITMMDDGEEEVREEWQARMSAMLLGSGKKSFLGALSMC  1881
             GF   + + ++     +PD+      +  EE+    W+ R++ ++    K      +  C
Sbjct  1045  GFDQPYNALMKDEGLRKPDSELSEREE--EEKAISVWEKRVALVICNHEKGYIFKVMKEC  1102

Query  1882  LASGNIELVRVCLTTVAWLssvlasssrsgsefelsaFSALICQLKACLEHGKLLEHKVL  2061
             L S ++E+ + CL  V+WL  ++++   +G       F  L+ +L   L+     E K+L
Sbjct  1103  LKSKSLEMEKSCLVIVSWLCHMVSTLPDTGVRETARRF--LLDELVNVLQSSNSQEDKIL  1160

Query  2062  ASVCLLNFSKIPECRVLLMMIGEVIEDTLECL  2157
             A + L  F   P     L +    I  TL  L
Sbjct  1161  ACLALKTFISDPAALEELGLHARSINKTLRKL  1192


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 27/105 (26%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELG--MLES-PDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E    M+E  PDS        
Sbjct  145  HILEMFIVDPFFSRNDFAPELWKELFLPHMSSIVGWYSEERHRLMIEVIPDSSDLSFTAD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKD  264
                            ++ KL+ LE++Y  ++D  T  FA Y+KD
Sbjct  205  LDQFFNESLIFSLRPDQAEKLQKLEQLYGASLDENTRLFAKYFKD  249



>ref|XP_004136490.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Cucumis 
sativus]
Length=1489

 Score = 96.3 bits (238),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + L    +P +N++L
Sbjct  511   PKDFVCPITGQIFSDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSSTVMPKTNYVL  570

Query  979   KRVIDKWRSEH  1011
             KR+   W+ +H
Sbjct  571   KRLTTSWQEQH  581


 Score = 79.7 bits (195),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 86/365 (24%), Positives = 169/365 (46%), Gaps = 7/365 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+      +++NV  LI   G   L+ +F  G    +  +S LL  C+  
Sbjct  808   DAAIAMLEQILMGGDEYSQSRNVASLISAEGCPALV-KFLDGEEVRRPILSMLLC-CMRV  865

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D  C++ I   I+   +LE+L + + +     ++ ++EL+ +NRR      L  ++++  
Sbjct  866   DKGCKDSIVEKIELAPVLELLYTGNEDDRGLCVAFLSELVQMNRRTQCNQILQQIKNEGA  925

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L T+L  +  +Q+  +A L+L   LL + +  ++  + +IDA+  A      + 
Sbjct  926   FSTMHTLLTHLPKATIEQQPSIASLLLQLDLLVEPRKMSIYREESIDALFEAFRRKD-NY  984

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
              +       LL L    ++ GK   + W+LK AGF   + + ++     +PD+      +
Sbjct  985   NVQTAAADALLYLSGRLTSSGKCYAKSWLLKLAGFDQPYNALMKDEGLRKPDSELSEREE  1044

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
               EE+    W+ R++ ++    K      +  CL S ++E+ + CL  V+WL  ++++  
Sbjct  1045  --EEKAISVWEKRVALVICNHEKGYIFKVMKECLKSKSLEMEKSCLVIVSWLCHMVSTLP  1102

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
              +G       F  L+ +L   L+     E K+LA + L  F   P     L +    I  
Sbjct  1103  DTGVRETARRF--LLDELVNVLQSSNSQEDKILACLALKTFISDPAALEELGLHARSINK  1160

Query  2143  TLECL  2157
             TL  L
Sbjct  1161  TLRKL  1165


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (45%), Gaps = 27/128 (21%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELG--MLES-PDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E    M+E  PDS        
Sbjct  145  HILEMFIVDPFFSRNDFAPELWKELFLPHMSSIVGWYSEERHRLMIEVIPDSSDLSFTAD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVK  309
                            ++ KL+ LE++Y  ++D  T  FA Y+KD +          +  
Sbjct  205  LDQFFNESLIFSLRPDQAEKLQKLEQLYGASLDENTRLFAKYFKDCMNSDSSSTKKVAPM  264

Query  310  IPFLSPQL  333
            +P   P +
Sbjct  265  LPIAEPPM  272



>ref|XP_003607857.1| hypothetical protein MTR_4g083620 [Medicago truncatula]
 gb|AES90054.1| E3 ubiquitin-protein ligase LIN-like protein, putative [Medicago 
truncatula]
Length=336

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +1

Query  1    LQRKDRIAAKHILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML----ES  168
            LQ+ +R+ A+H++QVFCD+P  ART L+P+ W+ +FLPHL HLKIWY +E+  +    ES
Sbjct  225  LQKNNRVCARHLMQVFCDAPFFARTYLVPEFWELLFLPHLLHLKIWYAEEIETISDSNES  284

Query  169  PDSKSRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEG  279
               K +K+K L +VYN  +D GT  FA+YYK WL  G
Sbjct  285  DGVKEKKMKYLTRVYNNKVDIGTIMFALYYKQWLKVG  321



>ref|XP_004162568.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like, partial 
[Cucumis sativus]
Length=1407

 Score = 96.3 bits (238),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + L    +P +N++L
Sbjct  429   PKDFVCPITGQIFSDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSSTVMPKTNYVL  488

Query  979   KRVIDKWRSEH  1011
             KR+   W+ +H
Sbjct  489   KRLTTSWQEQH  499


 Score = 80.5 bits (197),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 87/366 (24%), Positives = 170/366 (46%), Gaps = 9/366 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+      +++NV  LI   G   L+ +F  G    +  +S LL  C+  
Sbjct  726   DAAIAMLEQILMGGDEYSQSRNVASLISAEGCPALV-KFLDGEEVRRPILSMLLC-CMRV  783

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D  C++ I   I+   +LE+L + + +     ++ ++EL+ +NRR      L  ++++  
Sbjct  784   DKGCKDSIVEKIELAPVLELLYTGNEDDRGLCVAFLSELVQMNRRTQCNQILQQIKNEGA  843

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L T+L  +  +Q+  +A L+L   LL + +  ++  + +IDA+  A      D 
Sbjct  844   FSTMHTLLTHLPKATIEQQPSIASLLLQLDLLVEPRKMSIYREESIDALFEAFRRK--DN  901

Query  1603  RLIEM-CCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
               ++      LL L    ++ GK   + W+LK AGF   + + ++     +PD+      
Sbjct  902   YNVQTAAADALLYLSGRLTSSGKCYAKSWLLKLAGFDQPYNALMKDEGLRKPDSELSERE  961

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             +  EE+    W+ R++ ++    K      +  CL S ++E+ + CL  V+WL  ++++ 
Sbjct  962   E--EEKAISVWEKRVALVICNHEKGYIFKVMKECLKSKSLEMEKSCLVIVSWLCHMVSTL  1019

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
               +G       F  L+ +L   L+     E K+LA + L  F   P     L +    I 
Sbjct  1020  PDTGVRETARRF--LLDELVNVLQSSNSQEDKILACLALKTFISDPAALEELGLHARSIN  1077

Query  2140  DTLECL  2157
              TL  L
Sbjct  1078  KTLRKL  1083


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 27/105 (26%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELG--MLES-PDS--------  177
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E    M+E  PDS        
Sbjct  63   HILEMFIVDPFFSRNDFAPELWKELFLPHMSSIVGWYSEERHRLMIEVIPDSSDLSFTAD  122

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKD  264
                            ++ KL+ LE++Y  ++D  T  FA Y+KD
Sbjct  123  LDQFFNESLIFSLRPDQAEKLQKLEQLYGASLDENTRLFAKYFKD  167



>ref|XP_008466477.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-1 [Cucumis melo]
Length=1488

 Score = 96.3 bits (238),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT + L    +P +N++L
Sbjct  510   PKDFVCPITGQIFSDPVTLETGQTYERRAIQEWLKRGNTTCPITRQPLSSTVMPKTNYVL  569

Query  979   KRVIDKWRSEH  1011
             KR+   W+ +H
Sbjct  570   KRLTTSWQEQH  580


 Score = 86.7 bits (213),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 87/366 (24%), Positives = 174/366 (48%), Gaps = 9/366 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+++LE++L+ +  D +++NV+ LI   G   L+ +F L     ++ + ++L  C+  
Sbjct  807   DAAIAMLEQILMGADEDSQSRNVESLISAEGCPALV-KF-LDGAEVRRPILSMLLCCMRV  864

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             +  C++ I   I+   +LE+L + + +     ++ ++EL+ +NRR      L  ++++  
Sbjct  865   NKGCKDSIVEKIELAPVLELLYTGNEDDRGLCVAFLSELVQMNRRTQCNQILQKIKNEGA  924

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L T+LQ +  +Q+  +A L+L   LL + +  ++  + +IDA+  A      D 
Sbjct  925   FSTMHTLLTHLQKATIEQQPSIASLLLQLDLLVEPRKMSIYREESIDALFEAFCRK--DN  982

Query  1603  RLIEM-CCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMM  1779
               ++      LL L    ++ GK   + W+LK AGF   + + ++     +PD+      
Sbjct  983   YHVQTAAADALLHLSGRLTSSGKCYAKSWLLKLAGFDQPYNALMKDEGLRKPDSELSERE  1042

Query  1780  DDGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlass  1959
             +  EE+    W+ R++ ++    K      +  CL S ++E+ R CL  V+WL  + +  
Sbjct  1043  E--EEKAISVWEKRVALVICNHEKGYIFKVMKECLKSKSLEMARFCLVIVSWLCHMASML  1100

Query  1960  srsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIE  2139
               +G +     F  L+ +L   L+     E K+LA + L  F   P     L +    I 
Sbjct  1101  PDTGVQETARRF--LLDELVNVLQSSNSQEDKILACLALKTFISDPAALEELGLYARSIN  1158

Query  2140  DTLECL  2157
              TL  L
Sbjct  1159  KTLRKL  1164


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 27/128 (21%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKELGML---ESPDSK-------  180
            HIL++F   P  +R    P+LW  +FLPH+S +  WY +E   L     PDS        
Sbjct  145  HILEMFIVDPFFSRNDFAPELWKELFLPHMSSIVGWYSEERHRLVIEVIPDSSDLSFTAD  204

Query  181  -----------------SRKLKVLEKVYNETMDTGTNKFAVYYKDWLTEGVEPPSIPSVK  309
                             + KL+ LE++Y  ++D  T  FA Y+KD +          +  
Sbjct  205  LDQFFNESLIFSLRPDHAEKLQKLEQLYGASLDENTRLFAKYFKDCMNSDSSSTKKVAPM  264

Query  310  IPFLSPQL  333
            +P   P +
Sbjct  265  LPIAEPPM  272



>ref|XP_006645675.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein 
ligase LIN-like [Oryza brachyantha]
Length=1245

 Score = 96.3 bits (238),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = +1

Query  700   VIKIIIERIAKAFFGQQNTEESVDSERPLGLSIPTEFICPLTGLVFEDPVTLETGQSFER  879
             V+ I+    A +  G    E      +   ++ P +F+CP+T  VF+DPVTLETGQ++ER
Sbjct  261   VVAILSPEPASSAVGSDGDEARRRRRQQHTVATPKDFVCPITSQVFDDPVTLETGQTYER  320

Query  880   AAILNWFSKGNRTCPITSKKLECQAVPLSNFILKRVIDKWRSEH  1011
              AI  W  +GN  CPIT  +L    +P +N++LKR+I  WR ++
Sbjct  321   RAIQEWLDRGNVPCPITRHRLRGAHLPNTNYVLKRLIAAWRDQN  364



>gb|KDO66444.1| hypothetical protein CISIN_1g001349mg [Citrus sinensis]
Length=1094

 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +1

Query  769   DSERPLGL---SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKK  939
             D++ P G+   + P +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN +CPIT +K
Sbjct  148   DADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQK  207

Query  940   LECQAVPLSNFILKRVIDKWRSEH  1011
             L    +P +N++LKR+I  W+ ++
Sbjct  208   LSSTKLPKTNYVLKRLIASWQEQN  231


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 115/251 (46%), Gaps = 11/251 (4%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +L  C++ D  CRN IA   +   ++E  + + D E  +  +  ++EL+ LNR
Sbjct  461   ERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFE-IVCFLSELVKLNR  519

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDG  1554
             R      L  ++ +   +    L  YLQ+++  Q  +VA L+L   LL + +  ++  + 
Sbjct  520   RTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREE  579

Query  1555  AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLE  1734
             AID +   L +S      +    K ++ L   F+  GK +T   +LK+AG + +   +L 
Sbjct  580   AIDTLISCLRNSDYPAAQL-AAAKTIVSLQGRFTTSGKSLTRAMLLKRAG-VGKSYKNLT  637

Query  1735  STEDNEPDNGRITMMDDG---EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              TE      G I   DD    EE+  ++W+ +M+ +L+         AL   L S   EL
Sbjct  638   RTE----QIGNICGEDDDTSEEEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAEL  693

Query  1906  VRVCLTTVAWL  1938
                C  +  WL
Sbjct  694   YSACFESATWL  704



>gb|KDO66445.1| hypothetical protein CISIN_1g001349mg [Citrus sinensis]
Length=949

 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +1

Query  769   DSERPLGL---SIPTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKK  939
             D++ P G+   + P +F+CP+T  +F+DPVTLETGQ++ER AI  W  +GN +CPIT +K
Sbjct  3     DADNPPGIGKHTPPKDFVCPITTHIFDDPVTLETGQTYERRAIQEWIERGNSSCPITRQK  62

Query  940   LECQAVPLSNFILKRVIDKWRSEH  1011
             L    +P +N++LKR+I  W+ ++
Sbjct  63    LSSTKLPKTNYVLKRLIASWQEQN  86


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 115/251 (46%), Gaps = 11/251 (4%)
 Frame = +1

Query  1198  EKKCVSALLSSCIEADSNCRNLIARNIDKMCLLE-VLCSEDLESVQNAISLMTELICLNR  1374
             E+     +L  C++ D  CRN IA   +   ++E  + + D E  +  +  ++EL+ LNR
Sbjct  316   ERIAAVGILLRCMQEDGKCRNSIADKAELAPVMESFMAASDGERFE-IVCFLSELVKLNR  374

Query  1375  RKDATYFLSGLQSDDIANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDG  1554
             R      L  ++ +   +    L  YLQ+++  Q  +VA L+L   LL + +  ++  + 
Sbjct  375   RTFNEQILHIIKDEGTYSSMHTLLVYLQTANHDQCPVVAGLLLQLDLLAEPRKMSIYREE  434

Query  1555  AIDAITVALESSFLDERLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLE  1734
             AID +   L +S      +    K ++ L   F+  GK +T   +LK+AG + +   +L 
Sbjct  435   AIDTLISCLRNSDYPAAQL-AAAKTIVSLQGRFTTSGKSLTRAMLLKRAG-VGKSYKNLT  492

Query  1735  STEDNEPDNGRITMMDDG---EEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIEL  1905
              TE      G I   DD    EE+  ++W+ +M+ +L+         AL   L S   EL
Sbjct  493   RTE----QIGNICGEDDDTSEEEKAADDWERKMALVLVSHDFGLLFEALEEGLNSRFAEL  548

Query  1906  VRVCLTTVAWL  1938
                C  +  WL
Sbjct  549   YSACFESATWL  559



>emb|CDP07391.1| unnamed protein product [Coffea canephora]
Length=1488

 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  799   PTEFICPLTGLVFEDPVTLETGQSFERAAILNWFSKGNRTCPITSKKLECQAVPLSNFIL  978
             P +F+CP+TG +F DPVTLETGQ++ER AI  W  +GN TCPIT +      +P +N++L
Sbjct  511   PKDFVCPITGQIFHDPVTLETGQTYERRAIQEWIDRGNTTCPITRQPFLATELPKTNYVL  570

Query  979   KRVIDKWRSEH  1011
             KR+I  W+ +H
Sbjct  571   KRLITSWKEQH  581


 Score = 84.0 bits (206),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 95/375 (25%), Positives = 166/375 (44%), Gaps = 6/375 (2%)
 Frame = +1

Query  1063  EIAVSILEKLLIVSSIDERTKNVKQLICLGGLQFLIHRFNLGNLNEKKCVSALLSSCIEA  1242
             + A+ +LE+++       R      +I  G +  L+    L  ++ +     +L  CI A
Sbjct  809   DAALVLLEQIITGGDETTRLTITMDIISTGSVPALLK--CLDRVDGRHSSVTILLCCIRA  866

Query  1243  DSNCRNLIARNIDKMCLLEVLCSEDLESVQNAISLMTELICLNRRKDATYFLSGLQSDDI  1422
             D +CRN IA  I+   +LE+  + +       I   +EL+ L+RR      L  ++ +  
Sbjct  867   DKSCRNTIASRIELSPVLELFHAGNDSVRGTCIEFFSELVHLSRRNLCNRILQIIKDEGA  926

Query  1423  ANITILLSTYLQSSHCKQKSLVAVLILHFHLLTDTQCSNVCIDGAIDAITVALESSFLDE  1602
              +    L  YLQ +  +QK  +A L+L   LL + +  ++  + AI+A+  AL       
Sbjct  927   FSTMHTLLVYLQMAPMEQKPAIASLLLQLDLLVEPRKMSIYREEAIEALIEALRKKEFPA  986

Query  1603  RLIEMCCKGLLILGRHFSAFGKIMTEDWILKQAGFIDRFESDLESTEDNEPDNGRITMMD  1782
               I      L  L  H +A GK  TE W+LK AGF   + + L+  +    ++     ++
Sbjct  987   SQI-AALDALSSLPGHMNASGKPYTEAWLLKLAGFDQPYNALLKGDKLQTYESEFSETVE  1045

Query  1783  DGEEEVREEWQARMSAMLLGSGKKSFLGALSMCLASGNIELVRVCLTTVAWLssvlasss  1962
             + E   R  W+ R+  +L    K +   AL  C+ S ++E+ + CL    WL  +L +  
Sbjct  1046  EEERAAR-SWEKRVGFVLCNHEKGAIFRALEECIKSNSLEIAKSCLVISTWLIHMLYNFP  1104

Query  1963  rsgsefelsaFSALICQLKACLEHGKLLEHKVLASVCLLNFSKIPECRVLLMMIGEVIED  2142
              +G       +  L+ Q    L+  K LE K+LA++ L  F   P     L +  + +  
Sbjct  1105  DTGVRDAARKY--LLDQFITILQSSKNLEEKILATLALGGFITDPGALNELGVYAKNMYK  1162

Query  2143  TLECLAEVTWVAREL  2187
             TL  L   + V  +L
Sbjct  1163  TLRKLKRNSVVVNDL  1177


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 44/139 (32%)
 Frame = +1

Query  31   HILQVFCDSPLQARTSLLPDLWDNIFLPHLSHLKIWYIKE---LGMLESPDS--------  177
            HIL +F   PL +R    P+LW ++FLPH+S +  WY +E   + M   PDS        
Sbjct  145  HILDMFIIDPLFSRIDFAPELWKSLFLPHMSSIIGWYSEERHRIVMDVIPDSNDLSFTVD  204

Query  178  ----------------KSRKLKVLEKVYNETMDTGTNKFAVYYKDWL------TEGV---  282
                            ++ K++ LE +Y +++D  T  +A YYK+ +      T+ V   
Sbjct  205  FDNYFNESLITSVRPDQAEKMQKLEHLYGQSLDENTRLYARYYKECMNYDSATTKKVIPM  264

Query  283  ----EPPSIP----SVKIP  315
                EPP  P    S KIP
Sbjct  265  MPIAEPPMTPLHEVSHKIP  283



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7504903404848